5CW8A

Crystal structure of mycobacterium tuberculosis kstr in complex with 3-oxo-4-cholesten-26-oyl-coa
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
183
structure length
176
Chain Sequence
EAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor KstR
publication title The Structure of the Transcriptional Repressor KstR in Complex with CoA Thioester Cholesterol Metabolites Sheds Light on the Regulation of Cholesterol Catabolism in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator
total genus 67
structure length 176
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5cw8A00
3HIMA 4L62A 2DTZA 1JUPA 3LWJA 2TCTA 4MO7A 2W53A 3NRGA 3ON2A 2XRLA 3Q0VA 4W1UA 4D5CA 3ZQHA 5HSZA 2JK3A 4DW6A 2UXHA 2JJ7A 2OPTA 4CGRA 3O60A 3BTCA 3BJBA 5K7HA 2IAIA 2NX4A 2PZ9A 5F1JA 2NP3A 4GCKA 2XDNA 4UDSA 2UXPA 3LSPA 2FJ1A 2XPVA 3GZIA 3AQTA 5FHPA 4B3AA 5IOZA 3BRUA 3HTAA 3VPRA 4AUXA 2PBXA 2RHAA 2YVHA 3VUQA 2QTQA 2X6OA 3GEUA 5F0CA 2NS7A 3IH2A 4YZEA 1QVTA 4MK6A 3VIBA 3BCGA 2O7TA 4GCLA 2GBYA 1UI5A 3ANGA 3SDGA 3EUPA 4ABZA 2ZCXA 3FK7A 3HTHA 5J1RA 3VVXA 2REKA 4AC6A 3HTJA 3LJLA 1U9OA 3COLA 1VI0A 2FBQA 2EH3A 3V6GA 3KZ9A 3MNLA 4I6ZA 3HGGA 2HXIA 1JTYA 4M3GA 3V78A 3CCYA 3F1BA 1T56A 5EFYA 5F0HA 3AQSA 4HKUA 5AQCA 1JUSA 3ON4A 5CW8A 3QPLA 4NN1A 1RKWA 5F08A 3QPSA 2Y30A 5J1YA 4AF5A 3VVYA 2HYTA 2D6YA 3LSJA 2WGBA 4I76A 3B6CA 2HQ5A 5GPCA 2DG7A 3CWRA 3PPBA 3G1MA 5D1RA 4MXMA 4M3DA 3P9TA 5J3LA 2UXOA 2XPUA 3EGQA 2WUIA 2X9DA 5FKKA 3IUVA 3Q0WA 3G7RA 5CXIA 2Q24A 1JT6A 2G3BA 3PM1A 3BQZA 3VW2A 5FKMA 3KKCA 2HYJA 3BR6A 5FKOA 3RD3A 3BR2A 3CDLA 4M3EA 2QOPA 1QPIA 1ZKGA 5GPAA 1UI6A 5HAWA 3WHCA 5FKLA 4JKZA 2IBDA 5K7ZA 2QIBA 2UXUA 3QKXA 3JSJA 5J1UA 2YVEA 2ZB9A 2VKEA 2G7LA 2QKOA 2UXIA 3BR3A 3ZQGA 1RPWA 2V57A 4D7MA 3O8GA 2IU5A 2WV1A 3IH3A 5F04A 5FMPA 1ZK8A 4M3FA 4PXIA 4V2FA 3TP3A 2G7SA 3O8HA 4ICHA 2GFNA 2Y31A 1RKTA 3B6AA 3NNRA 2ID3A 3FRQA 2XGEA 3HTIA 4GFKA 2RAEA 2DG8A 2FX0A 4AC0A 5IOYA 3PASA 3VOXA 3QBMA 1BJZA 3KNWA 3CRJA 5FGLA 2O7OA 5D18A 4G12A 4GFLA 2G0EA 3VOKA 2ZOYA 3BR1A 4JNNA 2F07A 2RASA 5F27A 4KWAA 3G1LA 2NP5A 2XB5A 3BTJA 3BTIA 4ME9A 3DPJA 3F0CA 5F0FA 3VVZA 2GENA 2OERA 3G1OA 1JUMA 2NS8A 1Z0XA 5EZGA 4NELA 5GP9A 5IPAA 2OF7A 3VW1A 3TP0A 3ZQLA 5DAJA 3KKDA 4XK4A 2XPWA 2HXOA 4ACIA 2XGCA 1QVUA 3VW0A 3DEWA 5C4YA 3C07A 5K7FA 2I10A 3T6NA 3ANPA 4JL3A 3E7QA 5FKNA 2OI8A 2QCOA 2ZCMA 3NI7A 1Z77A 2G7GA 5CXGA 3G56A 2HKUA 3BQYA 5D19A 3LSRA 3C2BA 2ZCNA 3FK6A 3IH4A 3HE0A 3DCFA 3NPIA 3HGYA 2ID6A 3NXCA 5EYRA 3SFIA 1SGMA 3BT9A 3BR0A 3VP5A 4JYKA 3BNIA 1JTXA 4V2GA 3Q0UA 1JT0A 3ZQIA 5K58A 2FD5A 3FIWA 3QQAA 2GUHA 3WHBA 2ZOZA 2XGDA 2VPRA 2TRTA 1ORKA 3CJDA 1U9NA 2VKVA 4W97A 2Y2ZA 3S5RA 4D5FA 2QWTA 3LOCA 3MVPA 1T33A 5H9TA 3RH2A 4D7NA 5IP6A 3BR5A 4GCTA 2FQ4A 4M3BA 1A6IA 4B1RA 3ZQFA 5HBUA 5EZHA 3BTLA 3BHQA 4X1EA 2IEKA 3B81A 3LHQA 3Q3SA
chains in the Genus database with same CATH superfamily
3HIMA 4L62A 2DTZA 1JUPA 3LWJA 2TCTA 4MO7A 2W53A 3NRGA 3VTIA 3ON2A 2XRLA 3Q0VA 4W1UA 4D5CA 3ZQHA 5HSZA 2JK3A 4DW6A 2UXHA 3NS4A 2JJ7A 2OPTA 4CGRA 3O60A 3BTCA 3BJBA 5K7HA 2IAIA 2NX4A 2PZ9A 5F1JA 2NP3A 4GCKA 2XDNA 4UDSA 2UXPA 3LSPA 4OD5A 2FJ1A 2XPVA 3GZIA 3AQTA 3DU6A 5FHPA 4B3AA 5IOZA 3BRUA 3HTAA 3VPRA 4AUXA 2PBXA 2RHAA 2YVHA 3VUQA 2QTQA 2X6OA 3GEUA 5F0CA 2NS7A 3IH2A 4YZEA 1QVTA 4MK6A 3VIBA 3BCGA 3K8PC 2O7TA 4GCLA 2GBYA 2R7UA 1UI5A 3ANGA 3SDGA 3EUPA 4ABZA 2ZCXA 3FK7A 3HTHA 3SWHA 3VVXA 5J1RA 4WIBA 2REKA 4AC6A 3HTJA 3LJLA 1U9OA 3COLA 1VI0A 2FBQA 2EH3A 3V6GA 3KZ9A 3MNLA 4I6ZA 3HGGA 2HXIA 1JTYA 4M3GA 4IRVA 3V78A 3CCYA 3F1BA 1T56A 5EFYA 5F0HA 3AQSA 4HKUA 5AQCA 1JUSA 3ON4A 5CW8A 3QPLA 4NN1A 1RKWA 5F08A 3QPSA 2Y30A 5J1YA 4AF5A 3VVYA 2HYTA 2D6YA 3LSJA 2WGBA 4I76A 3B6CA 2HQ5A 5GPCA 2DG7A 3CWRA 3PPBA 3G1MA 5D1RA 4MXMA 4M3DA 3P9TA 5J3LA 2UXOA 2XPUA 3EGQA 2WUIA 2X9DA 5FKKA 3IUVA 3Q0WA 2R7XA 3G7RA 5CXIA 2Q24A 1JT6A 2G3BA 3PM1A 3BQZA 3VW2A 5FKMA 3KKCA 2HYJA 3BR6A 5FKOA 3RD3A 3BR2A 3CDLA 4M3EA 2QOPA 1QPIA 1ZKGA 5GPAA 2FJI1 2YVXA 1UI6A 5HAWA 3WHCA 5FKLA 4JKZA 2IBDA 2R7WA 5K7ZA 2QIBA 2UXUA 3QKXA 3JSJA 5J1UA 2YVEA 2ZB9A 2B1EA 2VKEA 2G7LA 2QKOA 2UXIA 3BR3A 3ZQGA 1RPWA 2V57A 4D7MA 3O8GA 2IU5A 4C2MA 2WV1A 3IH3A 5F04A 5FMPA 1ZK8A 2ZY9A 4M3FA 4PXIA 4V2FA 3TP3A 2A2FX 2G7SA 2R7TA 3O8HA 4ICHA 2GFNA 2Y31A 1RKTA 3B6AA 3NNRA 2ID3A 3FRQA 3KYLA 3DU5A 2XGEA 3HTIA 4GFKA 2RAEA 2R7QA 2DG8A 4U9LA 2FX0A 4AC0A 5IOYA 3PASA 3VOXA 3QBMA 2B3WA 1BJZA 3KNWA 3CRJA 5FGLA 2O7OA 5D18A 4G12A 4GFLA 2G0EA 3VOKA 2ZOYA 3BR1A 4JNNA 2F07A 2RASA 5F27A 4KWAA 4OD4A 4U9NA 3G1LA 2NP5A 2XB5A 3BTJA 3BTIA 4ME9A 3DPJA 3F0CA 5F0FA 3VVZA 2GENA 2OERA 3G1OA 1JUMA 2NS8A 1Z0XA 2PFVA 5EZGA 4NELA 5GP9A 5IPAA 2OF7A 3VW1A 3TP0A 3ZQLA 5CQGA 5DAJA 3KKDA 4XK4A 2XPWA 2HXOA 4ACIA 2XGCA 1QVUA 3VW0A 3DEWA 5C4YA 3C07A 5K7FA 2I10A 3T6NA 3ANPA 4JL3A 3E7QA 5FKNA 2OI8A 2QCOA 2ZCMA 3NI7A 1Z77A 2G7GA 5CXGA 3G56A 2R7SA 2HKUA 3BQYA 5D19A 3LSRA 3FHNA 3C2BA 2R7OA 2ZCNA 3FK6A 3IH4A 3HE0A 3DCFA 3NPIA 3HGYA 2ID6A 3NXCA 5EYRA 3SFIA 1SGMA 3BT9A 3BR0A 3VP5A 4JYKA 3BNIA 1JTXA 4V2GA 3Q0UA 1JT0A 3ZQIA 5K58A 2FD5A 3FIWA 3QQAA 2R7VA 2GUHA 3WHBA 2ZOZA 2XGDA 2VPRA 2TRTA 1ORKA 3CJDA 4DVYP 1U9NA 2VKVA 4W97A 2Y2ZA 3S5RA 4D5FA 2QWTA 3LOCA 3MVPA 1T33A 5H9TA 3RH2A 2R7RA 4D7NA 5IP6A 3BR5A 4GCTA 2FQ4A 4M3BA 1A6IA 4B1RA 3ZQFA 5HBUA 5EZHA 3BTLA 3BHQA 4X1EA 2IEKA 3B81A 3LHQA 3Q3SA
chains in the Genus database with same CATH topology
3HIMA 4L62A 2DTZA 1JUPA 3LWJA 2TCTA 4MO7A 2W53A 3NRGA 3ON2A 2XRLA 3Q0VA 4W1UA 4D5CA 3ZQHA 5HSZA 2JK3A 4DW6A 2UXHA 2JJ7A 2OPTA 4CGRA 3O60A 3BTCA 3BJBA 5K7HA 2IAIA 2NX4A 2PZ9A 5F1JA 2NP3A 4GCKA 2XDNA 4UDSA 2UXPA 3LSPA 2FJ1A 2XPVA 3GZIA 3AQTA 5FHPA 4B3AA 5IOZA 3BRUA 3HTAA 3VPRA 4AUXA 2PBXA 2RHAA 2YVHA 3VUQA 2QTQA 2X6OA 3GEUA 5F0CA 2NS7A 3IH2A 4YZEA 1QVTA 4MK6A 3VIBA 3BCGA 2O7TA 4GCLA 2GBYA 1UI5A 3ANGA 3SDGA 3EUPA 4ABZA 2ZCXA 3FK7A 3HTHA 5J1RA 3VVXA 2REKA 4AC6A 3HTJA 3LJLA 1U9OA 3COLA 1VI0A 2FBQA 2EH3A 3V6GA 3KZ9A 3MNLA 4I6ZA 3HGGA 2HXIA 1JTYA 4M3GA 3V78A 3CCYA 3F1BA 1T56A 5EFYA 5F0HA 3AQSA 4HKUA 5AQCA 1JUSA 3ON4A 5CW8A 3QPLA 4NN1A 1RKWA 5F08A 3QPSA 2Y30A 5J1YA 4AF5A 3VVYA 2HYTA 2D6YA 3LSJA 2WGBA 4I76A 3B6CA 2HQ5A 5GPCA 2DG7A 3CWRA 3PPBA 3G1MA 5D1RA 4MXMA 4M3DA 3P9TA 5J3LA 2UXOA 2XPUA 3EGQA 2WUIA 2X9DA 5FKKA 3IUVA 3Q0WA 3G7RA 5CXIA 2Q24A 1JT6A 2G3BA 3PM1A 3BQZA 3VW2A 5FKMA 3KKCA 2HYJA 3BR6A 5FKOA 3RD3A 3BR2A 3CDLA 4M3EA 2QOPA 1QPIA 1ZKGA 5GPAA 1UI6A 5HAWA 3WHCA 5FKLA 4JKZA 2IBDA 5K7ZA 2QIBA 2UXUA 3QKXA 3JSJA 5J1UA 2YVEA 2ZB9A 2VKEA 2G7LA 2QKOA 2UXIA 3BR3A 3ZQGA 1RPWA 2V57A 4D7MA 3O8GA 2IU5A 2WV1A 3IH3A 5F04A 5FMPA 1ZK8A 4M3FA 4PXIA 4V2FA 3TP3A 2G7SA 3O8HA 4ICHA 2GFNA 2Y31A 1RKTA 3B6AA 3NNRA 2ID3A 3FRQA 2XGEA 3HTIA 4GFKA 2RAEA 2DG8A 2FX0A 4AC0A 5IOYA 3PASA 3VOXA 3QBMA 1BJZA 3KNWA 3CRJA 5FGLA 2O7OA 5D18A 4G12A 4GFLA 2G0EA 3VOKA 2ZOYA 3BR1A 4JNNA 2F07A 2RASA 5F27A 4KWAA 3G1LA 2NP5A 2XB5A 3BTJA 3BTIA 4ME9A 3DPJA 3F0CA 5F0FA 3VVZA 2GENA 2OERA 3G1OA 1JUMA 2NS8A 1Z0XA 5EZGA 4NELA 5GP9A 5IPAA 2OF7A 3VW1A 3TP0A 3ZQLA 5DAJA 3KKDA 4XK4A 2XPWA 2HXOA 4ACIA 2XGCA 1QVUA 3VW0A 3DEWA 5C4YA 3C07A 5K7FA 2I10A 3T6NA 3ANPA 4JL3A 3E7QA 5FKNA 2OI8A 2QCOA 2ZCMA 3NI7A 1Z77A 2G7GA 5CXGA 3G56A 2HKUA 3BQYA 5D19A 3LSRA 3C2BA 2ZCNA 3FK6A 3IH4A 3HE0A 3DCFA 3NPIA 3HGYA 2ID6A 3NXCA 5EYRA 3SFIA 1SGMA 3BT9A 3BR0A 3VP5A 4JYKA 3BNIA 1JTXA 4V2GA 3Q0UA 1JT0A 3ZQIA 5K58A 2FD5A 3FIWA 3QQAA 2GUHA 3WHBA 2ZOZA 2XGDA 2VPRA 2TRTA 1ORKA 3CJDA 1U9NA 2VKVA 4W97A 2Y2ZA 3S5RA 4D5FA 2QWTA 3LOCA 3MVPA 1T33A 5H9TA 3RH2A 4D7NA 5IP6A 3BR5A 4GCTA 2FQ4A 4M3BA 1A6IA 4B1RA 3ZQFA 5HBUA 5EZHA 3BTLA 3BHQA 4X1EA 2IEKA 3B81A 3LHQA 3Q3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HIM A;  4L62 A;  2DTZ A;  1JUP A;  3LWJ A;  2TCT A;  4MO7 A;  2W53 A;  3NRG A;  3ON2 A;  2XRL A;  3Q0V A;  4W1U A;  4D5C A;  3ZQH A;  5HSZ A;  2JK3 A;  4DW6 A;  2UXH A;  2JJ7 A;  2OPT A;  4CGR A;  3O60 A;  3BTC A;  3BJB A;  5K7H A;  2IAI A;  2NX4 A;  2PZ9 A;  5F1J A;  2NP3 A;  4GCK A;  2XDN A;  4UDS A;  2UXP A;  3LSP A;  2FJ1 A;  2XPV A;  3GZI A;  3AQT A;  5FHP A;  4B3A A;  5IOZ A;  3BRU A;  3HTA A;  3VPR A;  4AUX A;  2PBX A;  2RHA A;  2YVH A;  3VUQ A;  2QTQ A;  2X6O A;  3GEU A;  5F0C A;  2NS7 A;  3IH2 A;  4YZE A;  1QVT A;  4MK6 A;  3VIB A;  3BCG A;  2O7T A;  4GCL A;  2GBY A;  1UI5 A;  3ANG A;  3SDG A;  3EUP A;  4ABZ A;  2ZCX A;  3FK7 A;  3HTH A;  5J1R A;  3VVX A;  2REK A;  4AC6 A;  3HTJ A;  3LJL A;  1U9O A;  3COL A;  1VI0 A;  2FBQ A;  2EH3 A;  3V6G A;  3KZ9 A;  3MNL A;  4I6Z A;  3HGG A;  2HXI A;  1JTY A;  4M3G A;  3V78 A;  3CCY A;  3F1B A;  1T56 A;  5EFY A;  5F0H A;  3AQS A;  4HKU A;  5AQC A;  1JUS A;  3ON4 A;  5CW8 A;  3QPL A;  4NN1 A;  1RKW A;  5F08 A;  3QPS A;  2Y30 A;  5J1Y A;  4AF5 A;  3VVY A;  2HYT A;  2D6Y A;  3LSJ A;  2WGB A;  4I76 A;  3B6C A;  2HQ5 A;  5GPC A;  2DG7 A;  3CWR A;  3PPB A;  3G1M A;  5D1R A;  4MXM A;  4M3D A;  3P9T A;  5J3L A;  2UXO A;  2XPU A;  3EGQ A;  2WUI A;  2X9D A;  5FKK A;  3IUV A;  3Q0W A;  3G7R A;  5CXI A;  2Q24 A;  1JT6 A;  2G3B A;  3PM1 A;  3BQZ A;  3VW2 A;  5FKM A;  3KKC A;  2HYJ A;  3BR6 A;  5FKO A;  3RD3 A;  3BR2 A;  3CDL A;  4M3E A;  2QOP A;  1QPI A;  1ZKG A;  5GPA A;  1UI6 A;  5HAW A;  3WHC A;  5FKL A;  4JKZ A;  2IBD A;  5K7Z A;  2QIB A;  2UXU A;  3QKX A;  3JSJ A;  5J1U A;  2YVE A;  2ZB9 A;  2VKE A;  2G7L A;  2QKO A;  2UXI A;  3BR3 A;  3ZQG A;  1RPW A;  2V57 A;  4D7M A;  3O8G A;  2IU5 A;  2WV1 A;  3IH3 A;  5F04 A;  5FMP A;  1ZK8 A;  4M3F A;  4PXI A;  4V2F A;  3TP3 A;  2G7S A;  3O8H A;  4ICH A;  2GFN A;  2Y31 A;  1RKT A;  3B6A A;  3NNR A;  2ID3 A;  3FRQ A;  2XGE A;  3HTI A;  4GFK A;  2RAE A;  2DG8 A;  2FX0 A;  4AC0 A;  5IOY A;  3PAS A;  3VOX A;  3QBM A;  1BJZ A;  3KNW A;  3CRJ A;  5FGL A;  2O7O A;  5D18 A;  4G12 A;  4GFL A;  2G0E A;  3VOK A;  2ZOY A;  3BR1 A;  4JNN A;  2F07 A;  2RAS A;  5F27 A;  4KWA A;  3G1L A;  2NP5 A;  2XB5 A;  3BTJ A;  3BTI A;  4ME9 A;  3DPJ A;  3F0C A;  5F0F A;  3VVZ A;  2GEN A;  2OER A;  3G1O A;  1JUM A;  2NS8 A;  1Z0X A;  5EZG A;  4NEL A;  5GP9 A;  5IPA A;  2OF7 A;  3VW1 A;  3TP0 A;  3ZQL A;  5DAJ A;  3KKD A;  4XK4 A;  2XPW A;  2HXO A;  4ACI A;  2XGC A;  1QVU A;  3VW0 A;  3DEW A;  5C4Y A;  3C07 A;  5K7F A;  2I10 A;  3T6N A;  3ANP A;  4JL3 A;  3E7Q A;  5FKN A;  2OI8 A;  2QCO A;  2ZCM A;  3NI7 A;  1Z77 A;  2G7G A;  5CXG A;  3G56 A;  2HKU A;  3BQY A;  5D19 A;  3LSR A;  3C2B A;  2ZCN A;  3FK6 A;  3IH4 A;  3HE0 A;  3DCF A;  3NPI A;  3HGY A;  2ID6 A;  3NXC A;  5EYR A;  3SFI A;  1SGM A;  3BT9 A;  3BR0 A;  3VP5 A;  4JYK A;  3BNI A;  1JTX A;  4V2G A;  3Q0U A;  1JT0 A;  3ZQI A;  5K58 A;  2FD5 A;  3FIW A;  3QQA A;  2GUH A;  3WHB A;  2ZOZ A;  2XGD A;  2VPR A;  2TRT A;  1ORK A;  3CJD A;  1U9N A;  2VKV A;  4W97 A;  2Y2Z A;  3S5R A;  4D5F A;  2QWT A;  3LOC A;  3MVP A;  1T33 A;  5H9T A;  3RH2 A;  4D7N A;  5IP6 A;  3BR5 A;  4GCT A;  2FQ4 A;  4M3B A;  1A6I A;  4B1R A;  3ZQF A;  5HBU A;  5EZH A;  3BTL A;  3BHQ A;  4X1E A;  2IEK A;  3B81 A;  3LHQ A;  3Q3S A; 
#chains in the Genus database with same CATH topology
 3HIM A;  4L62 A;  2DTZ A;  1JUP A;  3LWJ A;  2TCT A;  4MO7 A;  2W53 A;  3NRG A;  3VTI A;  3ON2 A;  2XRL A;  3Q0V A;  4W1U A;  4D5C A;  3ZQH A;  5HSZ A;  2JK3 A;  4DW6 A;  2UXH A;  3NS4 A;  2JJ7 A;  2OPT A;  4CGR A;  3O60 A;  3BTC A;  3BJB A;  5K7H A;  2IAI A;  2NX4 A;  2PZ9 A;  5F1J A;  2NP3 A;  4GCK A;  2XDN A;  4UDS A;  2UXP A;  3LSP A;  4OD5 A;  2FJ1 A;  2XPV A;  3GZI A;  3AQT A;  3DU6 A;  5FHP A;  4B3A A;  5IOZ A;  3BRU A;  3HTA A;  3VPR A;  4AUX A;  2PBX A;  2RHA A;  2YVH A;  3VUQ A;  2QTQ A;  2X6O A;  3GEU A;  5F0C A;  2NS7 A;  3IH2 A;  4YZE A;  1QVT A;  4MK6 A;  3VIB A;  3BCG A;  3K8P C;  2O7T A;  4GCL A;  2GBY A;  2R7U A;  1UI5 A;  3ANG A;  3SDG A;  3EUP A;  4ABZ A;  2ZCX A;  3FK7 A;  3HTH A;  3SWH A;  3VVX A;  5J1R A;  4WIB A;  2REK A;  4AC6 A;  3HTJ A;  3LJL A;  1U9O A;  3COL A;  1VI0 A;  2FBQ A;  2EH3 A;  3V6G A;  3KZ9 A;  3MNL A;  4I6Z A;  3HGG A;  2HXI A;  1JTY A;  4M3G A;  4IRV A;  3V78 A;  3CCY A;  3F1B A;  1T56 A;  5EFY A;  5F0H A;  3AQS A;  4HKU A;  5AQC A;  1JUS A;  3ON4 A;  5CW8 A;  3QPL A;  4NN1 A;  1RKW A;  5F08 A;  3QPS A;  2Y30 A;  5J1Y A;  4AF5 A;  3VVY A;  2HYT A;  2D6Y A;  3LSJ A;  2WGB A;  4I76 A;  3B6C A;  2HQ5 A;  5GPC A;  2DG7 A;  3CWR A;  3PPB A;  3G1M A;  5D1R A;  4MXM A;  4M3D A;  3P9T A;  5J3L A;  2UXO A;  2XPU A;  3EGQ A;  2WUI A;  2X9D A;  5FKK A;  3IUV A;  3Q0W A;  2R7X A;  3G7R A;  5CXI A;  2Q24 A;  1JT6 A;  2G3B A;  3PM1 A;  3BQZ A;  3VW2 A;  5FKM A;  3KKC A;  2HYJ A;  3BR6 A;  5FKO A;  3RD3 A;  3BR2 A;  3CDL A;  4M3E A;  2QOP A;  1QPI A;  1ZKG A;  5GPA A;  2FJI 1;  2YVX A;  1UI6 A;  5HAW A;  3WHC A;  5FKL A;  4JKZ A;  2IBD A;  2R7W A;  5K7Z A;  2QIB A;  2UXU A;  3QKX A;  3JSJ A;  5J1U A;  2YVE A;  2ZB9 A;  2B1E A;  2VKE A;  2G7L A;  2QKO A;  2UXI A;  3BR3 A;  3ZQG A;  1RPW A;  2V57 A;  4D7M A;  3O8G A;  2IU5 A;  4C2M A;  2WV1 A;  3IH3 A;  5F04 A;  5FMP A;  1ZK8 A;  2ZY9 A;  4M3F A;  4PXI A;  4V2F A;  3TP3 A;  2A2F X;  2G7S A;  2R7T A;  3O8H A;  4ICH A;  2GFN A;  2Y31 A;  1RKT A;  3B6A A;  3NNR A;  2ID3 A;  3FRQ A;  3KYL A;  3DU5 A;  2XGE A;  3HTI A;  4GFK A;  2RAE A;  2R7Q A;  2DG8 A;  4U9L A;  2FX0 A;  4AC0 A;  5IOY A;  3PAS A;  3VOX A;  3QBM A;  2B3W A;  1BJZ A;  3KNW A;  3CRJ A;  5FGL A;  2O7O A;  5D18 A;  4G12 A;  4GFL A;  2G0E A;  3VOK A;  2ZOY A;  3BR1 A;  4JNN A;  2F07 A;  2RAS A;  5F27 A;  4KWA A;  4OD4 A;  4U9N A;  3G1L A;  2NP5 A;  2XB5 A;  3BTJ A;  3BTI A;  4ME9 A;  3DPJ A;  3F0C A;  5F0F A;  3VVZ A;  2GEN A;  2OER A;  3G1O A;  1JUM A;  2NS8 A;  1Z0X A;  2PFV A;  5EZG A;  4NEL A;  5GP9 A;  5IPA A;  2OF7 A;  3VW1 A;  3TP0 A;  3ZQL A;  5CQG A;  5DAJ A;  3KKD A;  4XK4 A;  2XPW A;  2HXO A;  4ACI A;  2XGC A;  1QVU A;  3VW0 A;  3DEW A;  5C4Y A;  3C07 A;  5K7F A;  2I10 A;  3T6N A;  3ANP A;  4JL3 A;  3E7Q A;  5FKN A;  2OI8 A;  2QCO A;  2ZCM A;  3NI7 A;  1Z77 A;  2G7G A;  5CXG A;  3G56 A;  2R7S A;  2HKU A;  3BQY A;  5D19 A;  3LSR A;  3FHN A;  3C2B A;  2R7O A;  2ZCN A;  3FK6 A;  3IH4 A;  3HE0 A;  3DCF A;  3NPI A;  3HGY A;  2ID6 A;  3NXC A;  5EYR A;  3SFI A;  1SGM A;  3BT9 A;  3BR0 A;  3VP5 A;  4JYK A;  3BNI A;  1JTX A;  4V2G A;  3Q0U A;  1JT0 A;  3ZQI A;  5K58 A;  2FD5 A;  3FIW A;  3QQA A;  2R7V A;  2GUH A;  3WHB A;  2ZOZ A;  2XGD A;  2VPR A;  2TRT A;  1ORK A;  3CJD A;  4DVY P;  1U9N A;  2VKV A;  4W97 A;  2Y2Z A;  3S5R A;  4D5F A;  2QWT A;  3LOC A;  3MVP A;  1T33 A;  5H9T A;  3RH2 A;  2R7R A;  4D7N A;  5IP6 A;  3BR5 A;  4GCT A;  2FQ4 A;  4M3B A;  1A6I A;  4B1R A;  3ZQF A;  5HBU A;  5EZH A;  3BTL A;  3BHQ A;  4X1E A;  2IEK A;  3B81 A;  3LHQ A;  3Q3S A; 
#chains in the Genus database with same CATH homology
 3HIM A;  4L62 A;  2DTZ A;  1JUP A;  3LWJ A;  2TCT A;  4MO7 A;  2W53 A;  3NRG A;  3ON2 A;  2XRL A;  3Q0V A;  4W1U A;  4D5C A;  3ZQH A;  5HSZ A;  2JK3 A;  4DW6 A;  2UXH A;  2JJ7 A;  2OPT A;  4CGR A;  3O60 A;  3BTC A;  3BJB A;  5K7H A;  2IAI A;  2NX4 A;  2PZ9 A;  5F1J A;  2NP3 A;  4GCK A;  2XDN A;  4UDS A;  2UXP A;  3LSP A;  2FJ1 A;  2XPV A;  3GZI A;  3AQT A;  5FHP A;  4B3A A;  5IOZ A;  3BRU A;  3HTA A;  3VPR A;  4AUX A;  2PBX A;  2RHA A;  2YVH A;  3VUQ A;  2QTQ A;  2X6O A;  3GEU A;  5F0C A;  2NS7 A;  3IH2 A;  4YZE A;  1QVT A;  4MK6 A;  3VIB A;  3BCG A;  2O7T A;  4GCL A;  2GBY A;  1UI5 A;  3ANG A;  3SDG A;  3EUP A;  4ABZ A;  2ZCX A;  3FK7 A;  3HTH A;  5J1R A;  3VVX A;  2REK A;  4AC6 A;  3HTJ A;  3LJL A;  1U9O A;  3COL A;  1VI0 A;  2FBQ A;  2EH3 A;  3V6G A;  3KZ9 A;  3MNL A;  4I6Z A;  3HGG A;  2HXI A;  1JTY A;  4M3G A;  3V78 A;  3CCY A;  3F1B A;  1T56 A;  5EFY A;  5F0H A;  3AQS A;  4HKU A;  5AQC A;  1JUS A;  3ON4 A;  5CW8 A;  3QPL A;  4NN1 A;  1RKW A;  5F08 A;  3QPS A;  2Y30 A;  5J1Y A;  4AF5 A;  3VVY A;  2HYT A;  2D6Y A;  3LSJ A;  2WGB A;  4I76 A;  3B6C A;  2HQ5 A;  5GPC A;  2DG7 A;  3CWR A;  3PPB A;  3G1M A;  5D1R A;  4MXM A;  4M3D A;  3P9T A;  5J3L A;  2UXO A;  2XPU A;  3EGQ A;  2WUI A;  2X9D A;  5FKK A;  3IUV A;  3Q0W A;  3G7R A;  5CXI A;  2Q24 A;  1JT6 A;  2G3B A;  3PM1 A;  3BQZ A;  3VW2 A;  5FKM A;  3KKC A;  2HYJ A;  3BR6 A;  5FKO A;  3RD3 A;  3BR2 A;  3CDL A;  4M3E A;  2QOP A;  1QPI A;  1ZKG A;  5GPA A;  1UI6 A;  5HAW A;  3WHC A;  5FKL A;  4JKZ A;  2IBD A;  5K7Z A;  2QIB A;  2UXU A;  3QKX A;  3JSJ A;  5J1U A;  2YVE A;  2ZB9 A;  2VKE A;  2G7L A;  2QKO A;  2UXI A;  3BR3 A;  3ZQG A;  1RPW A;  2V57 A;  4D7M A;  3O8G A;  2IU5 A;  2WV1 A;  3IH3 A;  5F04 A;  5FMP A;  1ZK8 A;  4M3F A;  4PXI A;  4V2F A;  3TP3 A;  2G7S A;  3O8H A;  4ICH A;  2GFN A;  2Y31 A;  1RKT A;  3B6A A;  3NNR A;  2ID3 A;  3FRQ A;  2XGE A;  3HTI A;  4GFK A;  2RAE A;  2DG8 A;  2FX0 A;  4AC0 A;  5IOY A;  3PAS A;  3VOX A;  3QBM A;  1BJZ A;  3KNW A;  3CRJ A;  5FGL A;  2O7O A;  5D18 A;  4G12 A;  4GFL A;  2G0E A;  3VOK A;  2ZOY A;  3BR1 A;  4JNN A;  2F07 A;  2RAS A;  5F27 A;  4KWA A;  3G1L A;  2NP5 A;  2XB5 A;  3BTJ A;  3BTI A;  4ME9 A;  3DPJ A;  3F0C A;  5F0F A;  3VVZ A;  2GEN A;  2OER A;  3G1O A;  1JUM A;  2NS8 A;  1Z0X A;  5EZG A;  4NEL A;  5GP9 A;  5IPA A;  2OF7 A;  3VW1 A;  3TP0 A;  3ZQL A;  5DAJ A;  3KKD A;  4XK4 A;  2XPW A;  2HXO A;  4ACI A;  2XGC A;  1QVU A;  3VW0 A;  3DEW A;  5C4Y A;  3C07 A;  5K7F A;  2I10 A;  3T6N A;  3ANP A;  4JL3 A;  3E7Q A;  5FKN A;  2OI8 A;  2QCO A;  2ZCM A;  3NI7 A;  1Z77 A;  2G7G A;  5CXG A;  3G56 A;  2HKU A;  3BQY A;  5D19 A;  3LSR A;  3C2B A;  2ZCN A;  3FK6 A;  3IH4 A;  3HE0 A;  3DCF A;  3NPI A;  3HGY A;  2ID6 A;  3NXC A;  5EYR A;  3SFI A;  1SGM A;  3BT9 A;  3BR0 A;  3VP5 A;  4JYK A;  3BNI A;  1JTX A;  4V2G A;  3Q0U A;  1JT0 A;  3ZQI A;  5K58 A;  2FD5 A;  3FIW A;  3QQA A;  2GUH A;  3WHB A;  2ZOZ A;  2XGD A;  2VPR A;  2TRT A;  1ORK A;  3CJD A;  1U9N A;  2VKV A;  4W97 A;  2Y2Z A;  3S5R A;  4D5F A;  2QWT A;  3LOC A;  3MVP A;  1T33 A;  5H9T A;  3RH2 A;  4D7N A;  5IP6 A;  3BR5 A;  4GCT A;  2FQ4 A;  4M3B A;  1A6I A;  4B1R A;  3ZQF A;  5HBU A;  5EZH A;  3BTL A;  3BHQ A;  4X1E A;  2IEK A;  3B81 A;  3LHQ A;  3Q3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...