5CW8A

Crystal structure of mycobacterium tuberculosis kstr in complex with 3-oxo-4-cholesten-26-oyl-coa
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
183
structure length
176
Chain Sequence
b'EAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor KstR
publication title The Structure of the Transcriptional Repressor KstR in Complex with CoA Thioester Cholesterol Metabolites Sheds Light on the Regulation of Cholesterol Catabolism in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator
total genus 67
structure length 176
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5cw8A00
4V2FA 3HGGA 5D18A 4GCLA 5EYRA 1JT0A 1JUMA 4L62A 2G7LA 4ME9A 2WV1A 2REKA 3T6NA 3DEWA 2XPVA 2QOPA 5IP6A 3QBMA 5J1RA 5J3LA 2QTQA 3BQZA 1A6IA 2XPWA 2YVEA 3F1BA 3AQSA 3B81A 2NP3A 3HGYA 4M3EA 4I6ZA 3SDGA 2X6OA 5HBUA 1Z0XA 4PXIA 3VW0A 4GCKA 3VOKA 3QKXA 5FKKA 2UXPA 3TP0A 3BR0A 3BTCA 4V2GA 5F27A 2EH3A 3QPSA 3EGQA 5HAWA 1RKTA 3Q3SA 4G12A 5IOZA 3BR5A 3KKDA 3PM1A 3ZQGA 3BTLA 3VPRA 4NN1A 3ZQIA 2GFNA 3LSJA 2PZ9A 3VW2A 3G1OA 2XGCA 2HXIA 1ZKGA 2RHAA 5EZGA 2IU5A 2FX0A 3KZ9A 1JUSA 5EFYA 2WGBA 2RAEA 3S5RA 2QKOA 3G7RA 2OPTA 4M3FA 2O7TA 3NI7A 4YZEA 5F0HA 3FK6A 5K7FA 2WUIA 4AC6A 1U9OA 3BNIA 5J1UA 3B6CA 1UI5A 3HTJA 5IOYA 1JUPA 1U9NA 4JKZA 5CXGA 3C07A 3BR1A 2NS8A 2TCTA 4D5CA 5FKOA 2QCOA 2ID6A 4B3AA 2FBQA 3BR3A 3BT9A 4ABZA 5AQCA 3KNWA 1QPIA 4MO7A 3O8GA 1ZK8A 5F0CA 2VKEA 3CRJA 2XDNA 2GBYA 3FRQA 3NRGA 3COLA 1BJZA 3Q0VA 5IPAA 4GFKA 1JTYA 2HYTA 4ACIA 3C2BA 3VVZA 4AC0A 2I10A 2OERA 3GZIA 4GCTA 2UXIA 4B1RA 4AUXA 4W1UA 2G7SA 2TRTA 3IUVA 2HYJA 3O60A 5FHPA 3LOCA 3NXCA 2W53A 4D7MA 4AF5A 3DCFA 5F08A 3ZQFA 4KWAA 4ICHA 1ORKA 2NX4A 3CJDA 2FJ1A 5F0FA 2XPUA 4W97A 3VW1A 5FGLA 4JNNA 5H9TA 3AQTA 3IH3A 5F04A 3QQAA 3TP3A 5EZHA 2IAIA 3ON2A 2ZOYA 3FIWA 3ON4A 3EUPA 3LJLA 2DTZA 2UXHA 2VPRA 5FKNA 5J1YA 1JTXA 3ANGA 3MNLA 2JJ7A 4UDSA 2IEKA 3BTIA 4MK6A 5GP9A 3LWJA 5K7HA 3RH2A 5D19A 5K58A 3HTIA 2UXOA 4DW6A 3G1MA 3BRUA 3GEUA 5C4YA 4X1EA 5GPCA 3G1LA 3LSPA 3V78A 4D7NA 3Q0WA 3VIBA 1JT6A 1UI6A 2Q24A 3BJBA 2HKUA 4HKUA 2G7GA 5FKLA 2YVHA 4M3GA 3HIMA 2G3BA 1VI0A 3ZQHA 2PBXA 3PPBA 4JYKA 3BR6A 3DPJA 4XK4A 5GPAA 3B6AA 3P9TA 2O7OA 4M3DA 5D1RA 3BQYA 2G0EA 3BR2A 3VOXA 4M3BA 5FMPA 3CWRA 2F07A 5CW8A 2QWTA 3BCGA 2DG7A 3E7QA 2RASA 2NP5A 2V57A 3JSJA 3NPIA 5FKMA 2Y30A 2JK3A 2ZCNA 3WHCA 2FD5A 3KKCA 3MVPA 2HXOA 2UXUA 3Q0UA 2XGDA 3VUQA 3HTAA 3G56A 3RD3A 4D5FA 3VP5A 3LHQA 3ZQLA 2Y31A 3HTHA 3SFIA 3V6GA 2ZOZA 2VKVA 1T33A 1QVTA 4NELA 3BTJA 2OI8A 4JL3A 3IH2A 2GUHA 3FK7A 3ANPA 3IH4A 1RPWA 3F0CA 4GFLA 2NS7A 3NNRA 2ZB9A 5F1JA 2HQ5A 2GENA 2Y2ZA 2OF7A 4MXMA 3VVYA 2ID3A 2ZCXA 2FQ4A 1QVUA 5HSZA 1Z77A 2ZCMA 3O8HA 1T56A 3HE0A 5CXIA 3PASA 2XRLA 4I76A 2IBDA 4CGRA 2DG8A 3BHQA 2QIBA 2X9DA 2D6YA 3QPLA 5K7ZA 3LSRA 3VVXA 5DAJA 2XB5A 1SGMA 1RKWA 2XGEA 3WHBA 3CDLA 3CCYA
chains in the Genus database with same CATH superfamily
4V2FA 3HGGA 5D18A 4GCLA 5EYRA 1JT0A 1JUMA 4L62A 2G7LA 2B1EA 2R7WA 4ME9A 4WIBA 2WV1A 2REKA 3T6NA 3DEWA 2XPVA 2QOPA 5IP6A 3QBMA 5J1RA 5J3LA 2QTQA 3BQZA 4OD5A 1A6IA 2XPWA 2YVEA 2YVXA 3F1BA 3AQSA 3B81A 2NP3A 3HGYA 4M3EA 4I6ZA 3SDGA 2X6OA 5HBUA 1Z0XA 4PXIA 5CQGA 3VW0A 4GCKA 3VOKA 3QKXA 5FKKA 2R7UA 2R7TA 2UXPA 3TP0A 3BR0A 3BTCA 4V2GA 5F27A 2EH3A 3QPSA 3EGQA 5HAWA 1RKTA 3Q3SA 4G12A 5IOZA 3BR5A 3KKDA 2PFVA 3PM1A 3K8PC 3ZQGA 3BTLA 3VPRA 4NN1A 3ZQIA 4DVYP 2GFNA 3LSJA 2PZ9A 3VW2A 3G1OA 2XGCA 2HXIA 1ZKGA 2RHAA 5EZGA 2IU5A 2FX0A 3KZ9A 1JUSA 5EFYA 2WGBA 2RAEA 3S5RA 2QKOA 3G7RA 2OPTA 4M3FA 2O7TA 3NI7A 4YZEA 5F0HA 3FK6A 5K7FA 2WUIA 4AC6A 4OD4A 1U9OA 3BNIA 5J1UA 3B6CA 1UI5A 3HTJA 5IOYA 1JUPA 1U9NA 4JKZA 3NS4A 5CXGA 3C07A 3BR1A 2NS8A 2TCTA 4D5CA 5FKOA 4C2MA 4U9NA 2QCOA 2ID6A 4B3AA 2FBQA 3BR3A 3BT9A 4ABZA 3KYLA 5AQCA 4U9LA 3KNWA 1QPIA 4MO7A 3O8GA 1ZK8A 5F0CA 2VKEA 3CRJA 2XDNA 2GBYA 3FRQA 3NRGA 3COLA 1BJZA 3Q0VA 5IPAA 4GFKA 1JTYA 2HYTA 4ACIA 3C2BA 3VVZA 4AC0A 2I10A 2OERA 3GZIA 4GCTA 2UXIA 4B1RA 4AUXA 2A2FX 4W1UA 2G7SA 2TRTA 2ZY9A 3IUVA 2HYJA 3O60A 5FHPA 3LOCA 3NXCA 2W53A 4D7MA 2B3WA 4AF5A 3DCFA 5F08A 3ZQFA 4KWAA 4ICHA 1ORKA 2NX4A 2R7XA 3CJDA 2FJ1A 5F0FA 2XPUA 4W97A 3VW1A 2R7QA 5FGLA 4JNNA 5H9TA 3AQTA 3IH3A 5F04A 3QQAA 3TP3A 5EZHA 2IAIA 3ON2A 2ZOYA 3DU6A 3FIWA 3ON4A 3EUPA 3LJLA 2DTZA 2UXHA 2VPRA 5FKNA 5J1YA 1JTXA 3ANGA 3MNLA 2JJ7A 4UDSA 2IEKA 3BTIA 4MK6A 5GP9A 3LWJA 5K7HA 3RH2A 5D19A 5K58A 3HTIA 2UXOA 4DW6A 3G1MA 3BRUA 3GEUA 5C4YA 3SWHA 4X1EA 5GPCA 3G1LA 3LSPA 3V78A 4D7NA 3Q0WA 3VIBA 1JT6A 1UI6A 2Q24A 3BJBA 2HKUA 4HKUA 2G7GA 5FKLA 2YVHA 4M3GA 2FJI1 3HIMA 2G3BA 1VI0A 3ZQHA 2PBXA 3PPBA 3VTIA 4JYKA 3BR6A 3DPJA 4XK4A 5GPAA 3B6AA 3P9TA 2O7OA 4M3DA 5D1RA 2R7VA 3BQYA 2G0EA 3BR2A 3VOXA 4M3BA 5FMPA 3CWRA 2F07A 5CW8A 2QWTA 3BCGA 2DG7A 3E7QA 2RASA 2NP5A 2R7RA 2V57A 3JSJA 3NPIA 5FKMA 2Y30A 2JK3A 2ZCNA 3WHCA 2FD5A 3KKCA 3MVPA 2HXOA 2UXUA 3Q0UA 2XGDA 3VUQA 3HTAA 3G56A 3RD3A 4D5FA 3VP5A 3LHQA 3ZQLA 2Y31A 3FHNA 3HTHA 3SFIA 3V6GA 2ZOZA 2VKVA 1T33A 1QVTA 4NELA 3BTJA 2OI8A 4JL3A 3IH2A 2R7SA 2GUHA 3FK7A 3ANPA 3IH4A 1RPWA 3F0CA 4GFLA 2NS7A 3NNRA 2ZB9A 5F1JA 2HQ5A 2GENA 2Y2ZA 2OF7A 4MXMA 3VVYA 2ID3A 2ZCXA 2FQ4A 1QVUA 5HSZA 1Z77A 2ZCMA 3O8HA 1T56A 3HE0A 4IRVA 3PASA 5CXIA 2XRLA 4I76A 2IBDA 4CGRA 2DG8A 2R7OA 3BHQA 2QIBA 2X9DA 2D6YA 3DU5A 3QPLA 5K7ZA 3LSRA 3VVXA 5DAJA 2XB5A 1SGMA 1RKWA 2XGEA 3WHBA 3CDLA 3CCYA
chains in the Genus database with same CATH topology
4V2FA 3HGGA 5D18A 4GCLA 5EYRA 1JT0A 1JUMA 4L62A 2G7LA 4ME9A 2WV1A 2REKA 3T6NA 3DEWA 2XPVA 2QOPA 5IP6A 3QBMA 5J1RA 5J3LA 2QTQA 3BQZA 1A6IA 2XPWA 2YVEA 3F1BA 3AQSA 3B81A 2NP3A 3HGYA 4M3EA 4I6ZA 3SDGA 2X6OA 5HBUA 1Z0XA 4PXIA 3VW0A 4GCKA 3VOKA 3QKXA 5FKKA 2UXPA 3TP0A 3BR0A 3BTCA 4V2GA 5F27A 2EH3A 3QPSA 3EGQA 5HAWA 1RKTA 3Q3SA 4G12A 5IOZA 3BR5A 3KKDA 3PM1A 3ZQGA 3BTLA 3VPRA 4NN1A 3ZQIA 2GFNA 3LSJA 2PZ9A 3VW2A 3G1OA 2XGCA 2HXIA 1ZKGA 2RHAA 5EZGA 2IU5A 2FX0A 3KZ9A 1JUSA 5EFYA 2WGBA 2RAEA 3S5RA 2QKOA 3G7RA 2OPTA 4M3FA 2O7TA 3NI7A 4YZEA 5F0HA 3FK6A 5K7FA 2WUIA 4AC6A 1U9OA 3BNIA 5J1UA 3B6CA 1UI5A 3HTJA 5IOYA 1JUPA 1U9NA 4JKZA 5CXGA 3C07A 3BR1A 2NS8A 2TCTA 4D5CA 5FKOA 2QCOA 2ID6A 4B3AA 2FBQA 3BR3A 3BT9A 4ABZA 5AQCA 3KNWA 1QPIA 4MO7A 3O8GA 1ZK8A 5F0CA 2VKEA 3CRJA 2XDNA 2GBYA 3FRQA 3NRGA 3COLA 1BJZA 3Q0VA 5IPAA 4GFKA 1JTYA 2HYTA 4ACIA 3C2BA 3VVZA 4AC0A 2I10A 2OERA 3GZIA 4GCTA 2UXIA 4B1RA 4AUXA 4W1UA 2G7SA 2TRTA 3IUVA 2HYJA 3O60A 5FHPA 3LOCA 3NXCA 2W53A 4D7MA 4AF5A 3DCFA 5F08A 3ZQFA 4KWAA 4ICHA 1ORKA 2NX4A 3CJDA 2FJ1A 5F0FA 2XPUA 4W97A 3VW1A 5FGLA 4JNNA 5H9TA 3AQTA 3IH3A 5F04A 3QQAA 3TP3A 5EZHA 2IAIA 3ON2A 2ZOYA 3FIWA 3ON4A 3EUPA 3LJLA 2DTZA 2UXHA 2VPRA 5FKNA 5J1YA 1JTXA 3ANGA 3MNLA 2JJ7A 4UDSA 2IEKA 3BTIA 4MK6A 5GP9A 3LWJA 5K7HA 3RH2A 5D19A 5K58A 3HTIA 2UXOA 4DW6A 3G1MA 3BRUA 3GEUA 5C4YA 4X1EA 5GPCA 3G1LA 3LSPA 3V78A 4D7NA 3Q0WA 3VIBA 1JT6A 1UI6A 2Q24A 3BJBA 2HKUA 4HKUA 2G7GA 5FKLA 2YVHA 4M3GA 3HIMA 2G3BA 1VI0A 3ZQHA 2PBXA 3PPBA 4JYKA 3BR6A 3DPJA 4XK4A 5GPAA 3B6AA 3P9TA 2O7OA 4M3DA 5D1RA 3BQYA 2G0EA 3BR2A 3VOXA 4M3BA 5FMPA 3CWRA 2F07A 5CW8A 2QWTA 3BCGA 2DG7A 3E7QA 2RASA 2NP5A 2V57A 3JSJA 3NPIA 5FKMA 2Y30A 2JK3A 2ZCNA 3WHCA 2FD5A 3KKCA 3MVPA 2HXOA 2UXUA 3Q0UA 2XGDA 3VUQA 3HTAA 3G56A 3RD3A 4D5FA 3VP5A 3LHQA 3ZQLA 2Y31A 3HTHA 3SFIA 3V6GA 2ZOZA 2VKVA 1T33A 1QVTA 4NELA 3BTJA 2OI8A 4JL3A 3IH2A 2GUHA 3FK7A 3ANPA 3IH4A 1RPWA 3F0CA 4GFLA 2NS7A 3NNRA 2ZB9A 5F1JA 2HQ5A 2GENA 2Y2ZA 2OF7A 4MXMA 3VVYA 2ID3A 2ZCXA 2FQ4A 1QVUA 5HSZA 1Z77A 2ZCMA 3O8HA 1T56A 3HE0A 5CXIA 3PASA 2XRLA 4I76A 2IBDA 4CGRA 2DG8A 3BHQA 2QIBA 2X9DA 2D6YA 3QPLA 5K7ZA 3LSRA 3VVXA 5DAJA 2XB5A 1SGMA 1RKWA 2XGEA 3WHBA 3CDLA 3CCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V2F A;  3HGG A;  5D18 A;  4GCL A;  5EYR A;  1JT0 A;  1JUM A;  4L62 A;  2G7L A;  4ME9 A;  2WV1 A;  2REK A;  3T6N A;  3DEW A;  2XPV A;  2QOP A;  5IP6 A;  3QBM A;  5J1R A;  5J3L A;  2QTQ A;  3BQZ A;  1A6I A;  2XPW A;  2YVE A;  3F1B A;  3AQS A;  3B81 A;  2NP3 A;  3HGY A;  4M3E A;  4I6Z A;  3SDG A;  2X6O A;  5HBU A;  1Z0X A;  4PXI A;  3VW0 A;  4GCK A;  3VOK A;  3QKX A;  5FKK A;  2UXP A;  3TP0 A;  3BR0 A;  3BTC A;  4V2G A;  5F27 A;  2EH3 A;  3QPS A;  3EGQ A;  5HAW A;  1RKT A;  3Q3S A;  4G12 A;  5IOZ A;  3BR5 A;  3KKD A;  3PM1 A;  3ZQG A;  3BTL A;  3VPR A;  4NN1 A;  3ZQI A;  2GFN A;  3LSJ A;  2PZ9 A;  3VW2 A;  3G1O A;  2XGC A;  2HXI A;  1ZKG A;  2RHA A;  5EZG A;  2IU5 A;  2FX0 A;  3KZ9 A;  1JUS A;  5EFY A;  2WGB A;  2RAE A;  3S5R A;  2QKO A;  3G7R A;  2OPT A;  4M3F A;  2O7T A;  3NI7 A;  4YZE A;  5F0H A;  3FK6 A;  5K7F A;  2WUI A;  4AC6 A;  1U9O A;  3BNI A;  5J1U A;  3B6C A;  1UI5 A;  3HTJ A;  5IOY A;  1JUP A;  1U9N A;  4JKZ A;  5CXG A;  3C07 A;  3BR1 A;  2NS8 A;  2TCT A;  4D5C A;  5FKO A;  2QCO A;  2ID6 A;  4B3A A;  2FBQ A;  3BR3 A;  3BT9 A;  4ABZ A;  5AQC A;  3KNW A;  1QPI A;  4MO7 A;  3O8G A;  1ZK8 A;  5F0C A;  2VKE A;  3CRJ A;  2XDN A;  2GBY A;  3FRQ A;  3NRG A;  3COL A;  1BJZ A;  3Q0V A;  5IPA A;  4GFK A;  1JTY A;  2HYT A;  4ACI A;  3C2B A;  3VVZ A;  4AC0 A;  2I10 A;  2OER A;  3GZI A;  4GCT A;  2UXI A;  4B1R A;  4AUX A;  4W1U A;  2G7S A;  2TRT A;  3IUV A;  2HYJ A;  3O60 A;  5FHP A;  3LOC A;  3NXC A;  2W53 A;  4D7M A;  4AF5 A;  3DCF A;  5F08 A;  3ZQF A;  4KWA A;  4ICH A;  1ORK A;  2NX4 A;  3CJD A;  2FJ1 A;  5F0F A;  2XPU A;  4W97 A;  3VW1 A;  5FGL A;  4JNN A;  5H9T A;  3AQT A;  3IH3 A;  5F04 A;  3QQA A;  3TP3 A;  5EZH A;  2IAI A;  3ON2 A;  2ZOY A;  3FIW A;  3ON4 A;  3EUP A;  3LJL A;  2DTZ A;  2UXH A;  2VPR A;  5FKN A;  5J1Y A;  1JTX A;  3ANG A;  3MNL A;  2JJ7 A;  4UDS A;  2IEK A;  3BTI A;  4MK6 A;  5GP9 A;  3LWJ A;  5K7H A;  3RH2 A;  5D19 A;  5K58 A;  3HTI A;  2UXO A;  4DW6 A;  3G1M A;  3BRU A;  3GEU A;  5C4Y A;  4X1E A;  5GPC A;  3G1L A;  3LSP A;  3V78 A;  4D7N A;  3Q0W A;  3VIB A;  1JT6 A;  1UI6 A;  2Q24 A;  3BJB A;  2HKU A;  4HKU A;  2G7G A;  5FKL A;  2YVH A;  4M3G A;  3HIM A;  2G3B A;  1VI0 A;  3ZQH A;  2PBX A;  3PPB A;  4JYK A;  3BR6 A;  3DPJ A;  4XK4 A;  5GPA A;  3B6A A;  3P9T A;  2O7O A;  4M3D A;  5D1R A;  3BQY A;  2G0E A;  3BR2 A;  3VOX A;  4M3B A;  5FMP A;  3CWR A;  2F07 A;  5CW8 A;  2QWT A;  3BCG A;  2DG7 A;  3E7Q A;  2RAS A;  2NP5 A;  2V57 A;  3JSJ A;  3NPI A;  5FKM A;  2Y30 A;  2JK3 A;  2ZCN A;  3WHC A;  2FD5 A;  3KKC A;  3MVP A;  2HXO A;  2UXU A;  3Q0U A;  2XGD A;  3VUQ A;  3HTA A;  3G56 A;  3RD3 A;  4D5F A;  3VP5 A;  3LHQ A;  3ZQL A;  2Y31 A;  3HTH A;  3SFI A;  3V6G A;  2ZOZ A;  2VKV A;  1T33 A;  1QVT A;  4NEL A;  3BTJ A;  2OI8 A;  4JL3 A;  3IH2 A;  2GUH A;  3FK7 A;  3ANP A;  3IH4 A;  1RPW A;  3F0C A;  4GFL A;  2NS7 A;  3NNR A;  2ZB9 A;  5F1J A;  2HQ5 A;  2GEN A;  2Y2Z A;  2OF7 A;  4MXM A;  3VVY A;  2ID3 A;  2ZCX A;  2FQ4 A;  1QVU A;  5HSZ A;  1Z77 A;  2ZCM A;  3O8H A;  1T56 A;  3HE0 A;  5CXI A;  3PAS A;  2XRL A;  4I76 A;  2IBD A;  4CGR A;  2DG8 A;  3BHQ A;  2QIB A;  2X9D A;  2D6Y A;  3QPL A;  5K7Z A;  3LSR A;  3VVX A;  5DAJ A;  2XB5 A;  1SGM A;  1RKW A;  2XGE A;  3WHB A;  3CDL A;  3CCY A; 
#chains in the Genus database with same CATH topology
 4V2F A;  3HGG A;  5D18 A;  4GCL A;  5EYR A;  1JT0 A;  1JUM A;  4L62 A;  2G7L A;  2B1E A;  2R7W A;  4ME9 A;  4WIB A;  2WV1 A;  2REK A;  3T6N A;  3DEW A;  2XPV A;  2QOP A;  5IP6 A;  3QBM A;  5J1R A;  5J3L A;  2QTQ A;  3BQZ A;  4OD5 A;  1A6I A;  2XPW A;  2YVE A;  2YVX A;  3F1B A;  3AQS A;  3B81 A;  2NP3 A;  3HGY A;  4M3E A;  4I6Z A;  3SDG A;  2X6O A;  5HBU A;  1Z0X A;  4PXI A;  5CQG A;  3VW0 A;  4GCK A;  3VOK A;  3QKX A;  5FKK A;  2R7U A;  2R7T A;  2UXP A;  3TP0 A;  3BR0 A;  3BTC A;  4V2G A;  5F27 A;  2EH3 A;  3QPS A;  3EGQ A;  5HAW A;  1RKT A;  3Q3S A;  4G12 A;  5IOZ A;  3BR5 A;  3KKD A;  2PFV A;  3PM1 A;  3K8P C;  3ZQG A;  3BTL A;  3VPR A;  4NN1 A;  3ZQI A;  4DVY P;  2GFN A;  3LSJ A;  2PZ9 A;  3VW2 A;  3G1O A;  2XGC A;  2HXI A;  1ZKG A;  2RHA A;  5EZG A;  2IU5 A;  2FX0 A;  3KZ9 A;  1JUS A;  5EFY A;  2WGB A;  2RAE A;  3S5R A;  2QKO A;  3G7R A;  2OPT A;  4M3F A;  2O7T A;  3NI7 A;  4YZE A;  5F0H A;  3FK6 A;  5K7F A;  2WUI A;  4AC6 A;  4OD4 A;  1U9O A;  3BNI A;  5J1U A;  3B6C A;  1UI5 A;  3HTJ A;  5IOY A;  1JUP A;  1U9N A;  4JKZ A;  3NS4 A;  5CXG A;  3C07 A;  3BR1 A;  2NS8 A;  2TCT A;  4D5C A;  5FKO A;  4C2M A;  4U9N A;  2QCO A;  2ID6 A;  4B3A A;  2FBQ A;  3BR3 A;  3BT9 A;  4ABZ A;  3KYL A;  5AQC A;  4U9L A;  3KNW A;  1QPI A;  4MO7 A;  3O8G A;  1ZK8 A;  5F0C A;  2VKE A;  3CRJ A;  2XDN A;  2GBY A;  3FRQ A;  3NRG A;  3COL A;  1BJZ A;  3Q0V A;  5IPA A;  4GFK A;  1JTY A;  2HYT A;  4ACI A;  3C2B A;  3VVZ A;  4AC0 A;  2I10 A;  2OER A;  3GZI A;  4GCT A;  2UXI A;  4B1R A;  4AUX A;  2A2F X;  4W1U A;  2G7S A;  2TRT A;  2ZY9 A;  3IUV A;  2HYJ A;  3O60 A;  5FHP A;  3LOC A;  3NXC A;  2W53 A;  4D7M A;  2B3W A;  4AF5 A;  3DCF A;  5F08 A;  3ZQF A;  4KWA A;  4ICH A;  1ORK A;  2NX4 A;  2R7X A;  3CJD A;  2FJ1 A;  5F0F A;  2XPU A;  4W97 A;  3VW1 A;  2R7Q A;  5FGL A;  4JNN A;  5H9T A;  3AQT A;  3IH3 A;  5F04 A;  3QQA A;  3TP3 A;  5EZH A;  2IAI A;  3ON2 A;  2ZOY A;  3DU6 A;  3FIW A;  3ON4 A;  3EUP A;  3LJL A;  2DTZ A;  2UXH A;  2VPR A;  5FKN A;  5J1Y A;  1JTX A;  3ANG A;  3MNL A;  2JJ7 A;  4UDS A;  2IEK A;  3BTI A;  4MK6 A;  5GP9 A;  3LWJ A;  5K7H A;  3RH2 A;  5D19 A;  5K58 A;  3HTI A;  2UXO A;  4DW6 A;  3G1M A;  3BRU A;  3GEU A;  5C4Y A;  3SWH A;  4X1E A;  5GPC A;  3G1L A;  3LSP A;  3V78 A;  4D7N A;  3Q0W A;  3VIB A;  1JT6 A;  1UI6 A;  2Q24 A;  3BJB A;  2HKU A;  4HKU A;  2G7G A;  5FKL A;  2YVH A;  4M3G A;  2FJI 1;  3HIM A;  2G3B A;  1VI0 A;  3ZQH A;  2PBX A;  3PPB A;  3VTI A;  4JYK A;  3BR6 A;  3DPJ A;  4XK4 A;  5GPA A;  3B6A A;  3P9T A;  2O7O A;  4M3D A;  5D1R A;  2R7V A;  3BQY A;  2G0E A;  3BR2 A;  3VOX A;  4M3B A;  5FMP A;  3CWR A;  2F07 A;  5CW8 A;  2QWT A;  3BCG A;  2DG7 A;  3E7Q A;  2RAS A;  2NP5 A;  2R7R A;  2V57 A;  3JSJ A;  3NPI A;  5FKM A;  2Y30 A;  2JK3 A;  2ZCN A;  3WHC A;  2FD5 A;  3KKC A;  3MVP A;  2HXO A;  2UXU A;  3Q0U A;  2XGD A;  3VUQ A;  3HTA A;  3G56 A;  3RD3 A;  4D5F A;  3VP5 A;  3LHQ A;  3ZQL A;  2Y31 A;  3FHN A;  3HTH A;  3SFI A;  3V6G A;  2ZOZ A;  2VKV A;  1T33 A;  1QVT A;  4NEL A;  3BTJ A;  2OI8 A;  4JL3 A;  3IH2 A;  2R7S A;  2GUH A;  3FK7 A;  3ANP A;  3IH4 A;  1RPW A;  3F0C A;  4GFL A;  2NS7 A;  3NNR A;  2ZB9 A;  5F1J A;  2HQ5 A;  2GEN A;  2Y2Z A;  2OF7 A;  4MXM A;  3VVY A;  2ID3 A;  2ZCX A;  2FQ4 A;  1QVU A;  5HSZ A;  1Z77 A;  2ZCM A;  3O8H A;  1T56 A;  3HE0 A;  4IRV A;  3PAS A;  5CXI A;  2XRL A;  4I76 A;  2IBD A;  4CGR A;  2DG8 A;  2R7O A;  3BHQ A;  2QIB A;  2X9D A;  2D6Y A;  3DU5 A;  3QPL A;  5K7Z A;  3LSR A;  3VVX A;  5DAJ A;  2XB5 A;  1SGM A;  1RKW A;  2XGE A;  3WHB A;  3CDL A;  3CCY A; 
#chains in the Genus database with same CATH homology
 4V2F A;  3HGG A;  5D18 A;  4GCL A;  5EYR A;  1JT0 A;  1JUM A;  4L62 A;  2G7L A;  4ME9 A;  2WV1 A;  2REK A;  3T6N A;  3DEW A;  2XPV A;  2QOP A;  5IP6 A;  3QBM A;  5J1R A;  5J3L A;  2QTQ A;  3BQZ A;  1A6I A;  2XPW A;  2YVE A;  3F1B A;  3AQS A;  3B81 A;  2NP3 A;  3HGY A;  4M3E A;  4I6Z A;  3SDG A;  2X6O A;  5HBU A;  1Z0X A;  4PXI A;  3VW0 A;  4GCK A;  3VOK A;  3QKX A;  5FKK A;  2UXP A;  3TP0 A;  3BR0 A;  3BTC A;  4V2G A;  5F27 A;  2EH3 A;  3QPS A;  3EGQ A;  5HAW A;  1RKT A;  3Q3S A;  4G12 A;  5IOZ A;  3BR5 A;  3KKD A;  3PM1 A;  3ZQG A;  3BTL A;  3VPR A;  4NN1 A;  3ZQI A;  2GFN A;  3LSJ A;  2PZ9 A;  3VW2 A;  3G1O A;  2XGC A;  2HXI A;  1ZKG A;  2RHA A;  5EZG A;  2IU5 A;  2FX0 A;  3KZ9 A;  1JUS A;  5EFY A;  2WGB A;  2RAE A;  3S5R A;  2QKO A;  3G7R A;  2OPT A;  4M3F A;  2O7T A;  3NI7 A;  4YZE A;  5F0H A;  3FK6 A;  5K7F A;  2WUI A;  4AC6 A;  1U9O A;  3BNI A;  5J1U A;  3B6C A;  1UI5 A;  3HTJ A;  5IOY A;  1JUP A;  1U9N A;  4JKZ A;  5CXG A;  3C07 A;  3BR1 A;  2NS8 A;  2TCT A;  4D5C A;  5FKO A;  2QCO A;  2ID6 A;  4B3A A;  2FBQ A;  3BR3 A;  3BT9 A;  4ABZ A;  5AQC A;  3KNW A;  1QPI A;  4MO7 A;  3O8G A;  1ZK8 A;  5F0C A;  2VKE A;  3CRJ A;  2XDN A;  2GBY A;  3FRQ A;  3NRG A;  3COL A;  1BJZ A;  3Q0V A;  5IPA A;  4GFK A;  1JTY A;  2HYT A;  4ACI A;  3C2B A;  3VVZ A;  4AC0 A;  2I10 A;  2OER A;  3GZI A;  4GCT A;  2UXI A;  4B1R A;  4AUX A;  4W1U A;  2G7S A;  2TRT A;  3IUV A;  2HYJ A;  3O60 A;  5FHP A;  3LOC A;  3NXC A;  2W53 A;  4D7M A;  4AF5 A;  3DCF A;  5F08 A;  3ZQF A;  4KWA A;  4ICH A;  1ORK A;  2NX4 A;  3CJD A;  2FJ1 A;  5F0F A;  2XPU A;  4W97 A;  3VW1 A;  5FGL A;  4JNN A;  5H9T A;  3AQT A;  3IH3 A;  5F04 A;  3QQA A;  3TP3 A;  5EZH A;  2IAI A;  3ON2 A;  2ZOY A;  3FIW A;  3ON4 A;  3EUP A;  3LJL A;  2DTZ A;  2UXH A;  2VPR A;  5FKN A;  5J1Y A;  1JTX A;  3ANG A;  3MNL A;  2JJ7 A;  4UDS A;  2IEK A;  3BTI A;  4MK6 A;  5GP9 A;  3LWJ A;  5K7H A;  3RH2 A;  5D19 A;  5K58 A;  3HTI A;  2UXO A;  4DW6 A;  3G1M A;  3BRU A;  3GEU A;  5C4Y A;  4X1E A;  5GPC A;  3G1L A;  3LSP A;  3V78 A;  4D7N A;  3Q0W A;  3VIB A;  1JT6 A;  1UI6 A;  2Q24 A;  3BJB A;  2HKU A;  4HKU A;  2G7G A;  5FKL A;  2YVH A;  4M3G A;  3HIM A;  2G3B A;  1VI0 A;  3ZQH A;  2PBX A;  3PPB A;  4JYK A;  3BR6 A;  3DPJ A;  4XK4 A;  5GPA A;  3B6A A;  3P9T A;  2O7O A;  4M3D A;  5D1R A;  3BQY A;  2G0E A;  3BR2 A;  3VOX A;  4M3B A;  5FMP A;  3CWR A;  2F07 A;  5CW8 A;  2QWT A;  3BCG A;  2DG7 A;  3E7Q A;  2RAS A;  2NP5 A;  2V57 A;  3JSJ A;  3NPI A;  5FKM A;  2Y30 A;  2JK3 A;  2ZCN A;  3WHC A;  2FD5 A;  3KKC A;  3MVP A;  2HXO A;  2UXU A;  3Q0U A;  2XGD A;  3VUQ A;  3HTA A;  3G56 A;  3RD3 A;  4D5F A;  3VP5 A;  3LHQ A;  3ZQL A;  2Y31 A;  3HTH A;  3SFI A;  3V6G A;  2ZOZ A;  2VKV A;  1T33 A;  1QVT A;  4NEL A;  3BTJ A;  2OI8 A;  4JL3 A;  3IH2 A;  2GUH A;  3FK7 A;  3ANP A;  3IH4 A;  1RPW A;  3F0C A;  4GFL A;  2NS7 A;  3NNR A;  2ZB9 A;  5F1J A;  2HQ5 A;  2GEN A;  2Y2Z A;  2OF7 A;  4MXM A;  3VVY A;  2ID3 A;  2ZCX A;  2FQ4 A;  1QVU A;  5HSZ A;  1Z77 A;  2ZCM A;  3O8H A;  1T56 A;  3HE0 A;  5CXI A;  3PAS A;  2XRL A;  4I76 A;  2IBD A;  4CGR A;  2DG8 A;  3BHQ A;  2QIB A;  2X9D A;  2D6Y A;  3QPL A;  5K7Z A;  3LSR A;  3VVX A;  5DAJ A;  2XB5 A;  1SGM A;  1RKW A;  2XGE A;  3WHB A;  3CDL A;  3CCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...