5CX3A

Crystal structure of fyco1 lir in complex with lc3a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
119
structure length
119
Chain Sequence
SDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3A
publication title Structural basis of FYCO1 and MAP1LC3A interaction reveals a novel binding mode for Atg8-family proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5cx3A00
2O6VD 3DOWA 4MDKE 1U4AA 4ANWA 3QC8B 1IP9A 2BYEA 2HE7A 4JQWC 2QHOA 1XT9B 2N7EA 4FJYA 4AOFA 4MM3A 1WZ0A 2MBEA 2RSUA 4WWOA 1WRDB 4BOSC 2ZZPB 2L3ZA 3PRZA 4IM0A 2KMAA 2MLBA 2NBWB 4BFRA 4W9KA 4K7UA 4M8NA 3HM3A 3PHXB 2G3QB 1LFDA 3A4RA 4LJOB 1H4RA 2A4ZA 4GSWA 4IWQA 1SGHA 2LXCA 4ANXA 4WJOA 1A5RA 1WY8A 4KDIC 3RUIB 4AUQC 3RD2A 3WAMA 1HE8A 3TBLD 3QCAA 4BKGA 1V6EA 4BVUC 3ZDTA 4JGHB 2CKHB 1WXSA 4DDID 2C9WB 4KZ0A 3TL5A 3WAOA 2FNJB 1I35A 3ZRFA 1E7UA 2DZKA 4OVVA 2KJRA 4CYEA 4W9FA 1GUAB 3ZTDA 1L7YA 2CHXA 3WALA 1AARA 1YJ1A 3NOBA 4I6PA 1WF9A 4GDLA 1UZXB 1LQBA 2MQJA 1ZGUB 3VH4B 5DPSA 1E8XA 4CO7A 4BOZB 4JLCA 2VRRB 3KW5B 3ZRCA 3K9PB 2AWTA 2JRHA 5AZFA 3OLMD 3AXCA 2GBNA 3LDZE 2KC2A 4KSLC 2CS4A 2L05A 3RULA 1WJ4A 1WGRA 3VFKA 4MSMB 2EMSA 3W1SA 3T8MA 2K8HA 2LGDA 4ZDVA 1ISNA 2G4SA 4W9HA 2KMCA 2LGYA 3QHTA 4WJNA 4WWNA 3DBSA 4HXDA 2L0TA 1YX5B 5IA7A 3KVFB 3H1UA 5D2MB 4IM3A 2MBHA 3C0RB 2FIFA 2K8CA 3H7PB 4RM8A 1GNUA 2LWPA 3QX1A 3W1YA 4NPNA 2BWES 3KUDB 2KD0A 3RZWC 2KX3A 3TCAA 2O6VB 4GOCA 2KK8A 2ZCBA 4NJ6A 4ANUA 4W9JA 2CHZA 2LRUA 2K39A 4ZRKA 3HIZA 2KWCA 2L7RA 1P3QU 1RLFA 2RGFA 5DPTA 4ZYNA 1ZKHA 2NPTA 2DZMA 1IPGA 4GDKA 3UIOB 3VXWA 2L76A 3L0WB 3CF6E 3QA8A 4E71A 2R2QA 4EUTA 2Z59B 2IO0B 1OTRB 3NZUA 3ZVVA 4DHZB 4W9CA 4AWJA 3MJWA 1NDDA 2PE9A 2L00B 2ZNVC 4W9LA 3UINB 5DPWA 1R4NI 3V60A 4MH0E 2FCNA 4HK2A 5KHQA 3X23A 2KTFA 3VUXA 4MGZE 2L0FA 2MP2A 3ENEA 2JY6A 4FADA 1J19A 1GC7A 2BYVE 4KIKB 3L08A 4ZRJA 5E6PA 1UH6A 2IO1B 3TJPA 2NVUI 3A9JA 3L54A 1WJUA 2G4DB 2M0XA 3ALBA 4DXAB 2PEAA 4ZRIA 2FCQA 2AYOB 1NBFC 4GU2A 1WM2A 5JHBA 1WIAA 4E3CA 1D3ZA 2ZCCA 3DPDA 2KTRA 1E8YA 3Q3FA 3DDCB 1CMXB 2FCSA 4II2B 1E8WA 2N7DA 2KZRA 1YIWA 1WH3A 4URKA 1WMHA 3PS6A 2I1KA 4PYUA 3DVGY 3EHVA 3L10B 5L95C 1SIFA 4IWOA 2XK5A 4K1RB 2DYMA 3VVWB 4WJPA 1WJ6A 3JSVB 3OJ4B 2WWZA 2LJ5A 2C5LC 2LVPA 4HCNB 3ZUNA 1G6JA 2JZZA 3VDZA 3LJ3A 1PQSA 3WIMA 3PV1A 3PHWB 5DCNA 2C60A 4ANVA 3VUWA 2NBVB 2G45B 2KVRA 2IY0B 2AL3A 1UELA 2J0JA 2IBIB 2M4NA 5IAAC 2ZPYA 4LCDE 2OJRA 3IHPC 4AJYB 4E74A 1V9JA 1EO6A 1E7VA 3KUCB 3UIPB 3PZDA 3QAQA 2KLCA 2N9EB 3V62A 4NY0A 2LVOA 2MSED 2Z0DB 2KOXA 2GBKA 2GBRA 3SDLC 3MHSD 2PE6B 2MCNB 2BYFA 3ZNHB 3VTWA 4WWPA 1WE6A 4EEWA 2DAFA 1KOTA 4JIOU 1UGMA 2N9PC 3U7DA 2V1YA 2BWFA 2K1FA 3CSTA 1WE7A 4G50A 2GBMA 3KYCD 4EZKA 3EFUA 5D6JB 2Y5BB 3UGBB 3PRMB 2JUOA 1V86A 2WX0A 1TBEA 1TZ1A 3DVNU 2YVCA 4DDGD 1T0YA 4IM2A 3NZSA 3V6EB 3QIJA 2KNBA 1LM8B 2KKCA 2O2VA 3AU4A 1C3TA 3APDA 3RYTA 3B0AA 1OGWA 4BKSA 1E8ZA 4PS7A 2NCNA 2RPQA 3UQAA 2CHWA 3R3MA 2V4LA 1WXVA 3A9KA 4GDLB 5C1ZA 1KLVA 3VH3B 1WXAA 5JZEB 3ONSA 3PRPB 5LLIA 4GN1A 1P9DU 3QQ8B 2LZ6A 3WA0A 3VTUA 2ASQA 5JH5C 2IY1B 4TKNA 4HCPB 2K25A 1EF5A 2BF8B 2HTHA 2NR2A 4MGYE 4TQ0A 4GGQA 4GB9A 2K6DB 3A9KB 3DQVA 4KVGB 5J2RA 4F1SA 3MTNB 2UWQA 5G55A 2IZVB 1Z5SB 2MW5A 3VUYA 3PSEB 4ICVA 4WJQA 4PYZA 3H6NA 3TMPB 5FR6A 2KFKA 1TTNA 5J17A 1RRBA 3KYDD 4IWPA 2C7MB 1P1AA 4HDOA 4B9KA 4HPLB 3ZNID 2B3AA 1WX8A 1WGDA 2D10A 2GBJA 1UBQA 2KDIA 2KFJA 2OOBB 1ZW7A 3HK0A 3B08A 3ZIMA 2K8BA 3UF8A 4TQ1A 4DHJD 3CMMB 1GC6A 4II3B 4B95A 1GJZA 2GOWA 2JXXA 2W9NA 2KLGA 4BBNF 2LASA 1OEYJ 2FIDA 2I1JA 1WYWB 5JHAA 5E6NA 1WGGA 2RD0A 2LVQA 4TV3A 3APFA 4HPMB 4GMVA 2KC1A 3ZW3A 4G3XB 1GG3A 1K8RB 4EZLA 2KDFB 3A1QA 1XD3B 4DBGA 2NPTB 1WXMA 4NAWA 4GDKB 3S2AA 2NS5A 5BO4B 3CSFA 2ZNVB 2N4FA 3JVZX 2EKEC 3BY4B 3QJZA 1VCBA 2ZVNA 2PJHA 2CU1A 1X1MA 3A1QB 1WJNA 4DHZE 1KM7A 4G11A 4J6IA 4BKSD 2JRIB 3JW0X 3GZNI 3KUZA 1TGZB 2N9XA 4HDQA 2M1MA 3PLVA 3ZLZA 3T9LA 2MP2B 1P98A 1V5OA 5AEKB 4EFOA 2JZ3B 3KH0A 3H7SA 3I3TB 3QK0A 3A33B 1YQBA 4NQLB 4NJ7A 2YLMA 1YD8U 1V49A 3A9JB 2BGFA 3BINA 4N9F4 2N1VA 3V6CB 4MGKE 1WX7A 2IYDB 3NY5A 2DX5B 2FCMA 2JWZA 4FHJA 1QZEA 1EF1A 2D07B 2KQSA 2Z0EB 4EOYA 2GMIC 4P7IA 3O65B 2V3SA 2KX0A 2KTRB 4JL9A 4YL8A 3ZTCA 3M95A 1F9JA 2RR9A 1RFAA 2FUHB 4A3OA 3PGEA 2D2QA 2DYOA 4K7SA 1FXTB 4KV2A 5EDSA 1JRUA 1WMHB 3A4SC 3GOEA 1Q0WB 4RMAA 2CR5A 4IW0A 4G0NB 2LI5A 3R7QA 1WZ3A 2ZEQA 2KN5A 3DBRI 2C7NB 2XK5B 4AJWA 2IO3B 3WANA 1NI2A 2J7QB 3QARA 4K81A 1S1QB 5DPRA 5C23A 4EZJA 3U30A 4FLHA 4W9EA 2HJ8A 1M94A 2XEWA 1WM3A 3DBHI 4GIVA 2JPHA 2AL6A 5AZGA 1S3SG 3OJ3A 2KQ7A 3EC8A 2KDEB 4DHJB 4HWIB 1P0RA 4I6LB 4ASWC 1E90A 4HJKA 4XZ4A 4K7WA 2DHZA 4WAAA 2ZJDA 5L83A 2ZPNA 4BKTA 2N1WA 2WX1A 2K6QA 3DVNV 4XC2A 2KANA 2XBBC 1XQQA 2HD5B 4MGIE 2NBUA 2DZJA 2MRPA 4IC7B 3TIXA 3VHTC 1UD7A 3ZNZB 1Q1OA 3N30A 2DENB 3ML9A 4BBNC 2M17A 3D32A 2KJHB 1H8CA 3VTVA 1WGYA 1Z2MA 5G2NA 1SE9A 3H9DA 2O2VB 3EECA 3R66C 4XX5A 4FJZA 3ZNGC 2LUEA 1OQYA 3AULA 4RM9A 4MJSA 5CHFA 3OAWA 3HHMA 2J0MA 2MBBB 5GMVA 4W9GA 1L2NA 2KDBA 1WR6E 3X0WA 1UBIA 2J0KA 2IO2B 3ECIA 2MWSB 2MA9B 3PLUA 3UQBA 2M8SA 3M62B 2JF5A 4CHKA 3R7RA 2UYZB 3IVFA 3L16A 5E6OA 3IBEA 4MJSB 2DAJA 3H7PA 3P2BA 2DYBA 2LD9A 3IFWB 3N3KB 4PS3A 3U8ZA 2LGXA 1YX6B 2MX2A 2ZVOA 3PVLA 3RZFA 3L13A 1MG8A 1Y8RC 1WR1A 2BKFA 3W1SC 2KFKB 4FULA 1V2YA 4DWFA 2A5UA 1E5WA 2O6VA 4MELA 1I42A 4ICUA 2C7HA 3SHQA 5D94A 4F7ZA 5AZHA 4MSQB 2FAZA 1RAXA 2JVCA 4B6WA 4EKUA 2KWUB 5TR5A 4F8CB 4TUUA 4FBJB 4KDLB 1IYFA 4LDTB 4A20A 3DBLI 5KHOA 3N32A 2L8JA 4LJPB 2BKRB 4FN2A 2D3GA 3PREA 4IUMB 3K9OB 5CX3A 1J8CA 4M0WB 1WGHA 1EUVB 2LXAA 2AEHA 3AI5A 5CHWA 3RT3B 4FHKA 3RCZA 2KHWB 4I6NB 3QWZB 3ZKJC 4M8MA 2JT4B 1R4MI 1WFYA 1WI0A 4NAWB 4W9DA 2WYQA 1V81A 3DCGA 3ZO5B 4KIKA 3AU5A 5LXIB 2WDTB 4KZCA 3PTFC 4IG7B 1LXDA 4DK5A 2MBOA 3Q3JA 5CHVC 1KJTA 3SD5A 3HM6X 2KWVB 2REXA 4WQOB 2PPHA 3IG3A 4W9IA 2R2OA 5CTRC 4HVBA 2KJ6A 3APCA 4MEMA 3ZDMC 1Q5WB 1V80A 3JYUA 2KO3A 3M3JA 4FA6A 3WAPA 3M63B 3B1LX 2MBQA 4KSKC 2KXJA 3PPAA 3VQIA 4FJVB 5D7GA 3NHEB 3ML8A 4NNJB 1J0GA 3VAWA 5HKHA 3L17A 3NS8A 3PT2B 1OEYA 4GXBA 4AP4C 4OVUA 4HLEA 1BT0A 4NQKE 4PS8A 4X57B 5LXHA 3V61A 1WX9A 3JSVA 5J18A 1C1YB 2D11A 2DZIA 1V5TA 2BPSA 2EMTA 3DVGX 4LDTD 1VD2A 4A3PA 2LRWA 3SU8X
chains in the Genus database with same CATH superfamily
3DOWA 1UF0A 4ANWA 2LHEA 5MPOA 2HE7A 1XT9B 2N7EA 4RGOS 1JWUD 4FJYA 5BYRA 4MM3A 1TS2A 1WRDB 4BOSC 4W9KA 1JMLA 3IAM1 4M8NA 3HM3A 2G3QB 1LFDA 4RF0A 4GSWA 5IP4D 4RGNA 2BB6A 1A5RA 4KDIC 2E3TA 3AH7A 1IBXA 4JGHB 3NJTA 4DDID 2L32A 4C4VA 3TUOA 1I35A 1E7UA 4OVVA 3ZTDA 1L7YA 4I6PA 1WF9A 4GDLA 1LQBA 1IBXB 1BUIC 5DPSA 3P1MA 4C4VB 3KW5B 3BYTB 5AZFA 3OLMD 3AXCA 3LDZE 1L4DB 4MACA 3RULA 1WGRA 4MSMB 2EMSA 3W1SA 2K8HA 2LGDA 2UU7A 1ISNA 2G4SA 2HTME 4WJNA 4HXDA 4N58A 4IM3A 1HZ6A 1BMLC 1FXIA 3H7PB 3KWLA 3B9JA 1GNUA 1QOFA 2QEJC 1ZUD2 3KUDB 4M02A 4XE0A 2LRUA 2KWCA 4RGTA 4ZYNA 3UIOB 3VXWA 4E71A 2WXNA 3TEWA 1WRIA 4C00A 4EUTA 2Z59B 3Q8EA 4DHZB 4NAMA 4AWJA 1QKZA 2PE9A 2L00B 2ZNVC 1I4RA 4MH0E 2FCNA 5KHQA 3X23A 2KTFA 2L0FA 2MP2A 1J19A 4OZAA 2BYVE 3L54A 3ALBA 4DXAB 1L0VB 2XNAC 1WIAA 4US8A 2QC8A 3PZ8A 4MT5A 2KTRA 3AV8A 3Q3FA 3DDCB 4II2B 3I63C 2GB1A 2KZRA 4URKA 1WGKA 2Y5PA 5L95C 2XK5A 2DYMA 3VVWB 1QF6A 3JSVB 1EM7A 1G6JA 3ZJUA 4L23A 1F77A 2C60A 3FKYA 4BAXA 2AL3A 1FRRA 2IBIB 3CIRB 4E74A 3IHPC 1E7VA 2WXFA 4C7YA 2N9EB 4KX6B 4M00A 4OVZA 3AB5A 2J42A 3AE7B 2MCNB 2BYFA 4KKIA 3E56A 3VTWA 1UGMA 1TKYA 2Y3AA 4EZKA 1YOVB 3EFUA 4LNFA 2K0PA 3DVNU 4DDGD 4IM2A 3TSSA 2D3BA 3PZ7A 4NZLB 2KKCA 3AU4A 2LHDA 3ZXRA 1FMAD 1E8ZA 2DNFA 3VRAB 2NCNA 1VZ6A 3N9YC 1SB3C 1D5MC 3WA0A 5EE1A 1XO3A 2ASQA 1HTOA 4TKNA 2BF8B 2NR2A 4MGYE 3AE4B 4GB9A 1FIQA 3MTNB 2IZVB 5BMHA 4ICVA 2GRIA 4PYZA 3H6NA 3I57A 3TMPB 1N63A 4HDOA 1WX8A 2KFJA 4XWTA 1KLUD 2PVOD 4DHJD 1GC6A 2W9NA 1R7SA 3V05A 1OEYJ 2FIDA 2RD0A 2AX5A 2LVQA 3MP9A 4GMVA 3ZW3A 4ZOHC 4G3XB 1K8RB 1MJDA 4EZLA 1WXMA 1UGJA 1T0RC 3GZNB 1VCBA 2KYWA 3BK2A 2I38A 3NZ3A 5D3IB 1P98A 5AEKB 3H7SA 3P4PB 2EKIA 4N59A 1V49A 3Q8FA 1AN8A 4ZHPA 2IGDA 1QZEA 2WXOA 1YQ3B 2V3SA 4JL9A 1GAQB 1PYWD 4YL8A 5HFYA 2RR9A 3P63A 2PIAA 2D2QA 1FXTB 1WMHB 2LI5A 1YJJA 3W5VB 2C7NB 2IO3B 2J7QB 5IKCM 4K81A 1BXTA 2QSDA 2K3UA 4W9EA 2XEWA 1M94A 2DBYA 3OJ3A 3EC8A 2KDEB 1P0RA 4I6LB 2QCZA 4ASWC 3MFGA 4WAAA 2OJWA 5L83A 4BKTA 2N1WA 1KLGD 2WX1A 3DVNV 4XC2A 2NBUA 2CJOA 2RDHA 3HRDD 1UD7A 1QILA 2JZPA 4RFBA 3ZYYX 4J3OD 3AEDB 2XN9C 1JRPA 2O2VB 3EECA 3ZXVA 2YEPF 4FJZA 2K5PA 3ZNGC 1UWMA 3DWMA 1MG4A 1WSPA 1KRHA 4W9GA 3X0WA 2J0KA 2MA9B 3UQBA 1YJIA 2M8SA 3M62B 1C4AA 2UYZB 3DWGC 2N0SB 3IBEA 2DAJA 4B95A 2LD9A 3IFWB 3PVLA 3RZFA 2MEKA 1MG8A 2HJ1A 3RMKC 4FULA 1V2YA 4DWFA 3SFDB 1E5WA 2PMVA 5D3DA 4MSQB 5AZHA 1RAXA 2JVCA 1I4GA 4FBJB 4LDTB 5KHOA 2WXLA 2MJDA 1RFKA 3PREA 1AWDA 4XWWA 1J8CA 1ROEA 3L4PA 1WGHA 3RCZA 4OHJA 2JT4B 1LGRA 4ACFA 4NAWB 3IT6B 5LXIB 4A6QA 4DK5A 4IG7B 4WWMA 2KJ6A 2HDEA 2QMTA 4MEMA 3ZDMC 1NYRA 2KO3A 1N6ZA 4KSKC 3VAWA 5HKHA 2Q5WD 3NS8A 2MJEA 1OEYA 1YN3A 4NQKE 2LUMA 5J18A 1C1YB 2D11A 4LDTD 4A3PA 1VD2A 2ON8A 2LRWA 5G5GA 3SU8X 1E0ZA 4MDKE 3QC8B 2BYEA 2QHOA 2IGHA 1JROA 4REZA 1WZ0A 4WWOA 3AE3B 3NVVA 2KMAA 2X38A 2NBWB 4HKZE 4BFRA 1VZ8A 3PHXB 2ZW1A 2A4ZA 1SGHA 4ANXA 2IPKD 3RUIB 3RD2A 2N9LA 3WAMA 1HE8A 3TBLD 3QCAA 2CKHB 1WXSA 4RF1A 4K3BA 3WAOA 2DZKA 2KJRA 3EUB2 4RGMA 1AARA 1YJ1A 3NOBA 3URYA 3EGRA 3VH4B 1E8XA 4CO7A 1CJEA 4BOZB 2G9HD 2VRRB 3ZRCA 2JRHA 1YMHE 2GBNA 2KC2A 2NTTA 4KSLC 4C56C 2L05A 1FCLA 3P4SB 2KMCA 3C19A 3QHTA 2BB5A 1FO4A 4WWNA 5IA7A 3DBSA 4HEA1 1YX5B 5D2MB 2PKOA 1C76A 2FIFA 4LK0M 3QX1A 4A90A 2BWES 2KD0A 1P7EA 3TCAA 2KX3A 2ZCBA 4W9JA 2CHZA 2WNMA 4ZRKA 1OFFA 4B0MA 2L7RA 1RLFA 2RGFA 1ZKHA 4GDKA 3L0WB 3QA8A 4IOIE 4ZRQA 4S17A 3N20C 2IO0B 1SBBB 3N1XC 3NZUA 1K51A 3Q14C 4W9CA 4WIPA 1C78A 1R4NI 1TY2A 3V60A 4MGZE 1GC7A 1YQ4B 2B76B 5E6PA 3NS1A 2G4DB 2PEAA 5T8IA 1Y56A 1HTQA 1TKEA 1EWCA 3R2TA 3MC0B 4B0EA 1N62A 1WWTA 2N7DA 3DVGY 1TKGA 4Q2JA 1SIFA 4C7ZA 1RWSA 1JWSD 1GPXA 1WJ6A 1JWMD 1ZP0B 2LJ5A 1F1HA 2QDFA 3LJ3A 1PQSA 1QT9A 5H92C 1FM0D 2NMQA 3VUWA 2G45B 3Q8AA 2IJ0A 2J0JA 4MM3B 3KUCB 1D5ZC 1RYJA 4WH4A 2VZKD 2OHFA 1NENB 4NY0A 2LVOA 2MSED 2Z0DB 2KOXA 4FXCA 3MHSD 2PE6B 1WE6A 4EEWA 1KOTA 2D5GA 2CJNA 4ARIA 3U7DA 2BWFA 1GB4A 2JUOA 1TZOA 1YN5A 1T0YA 2DWQA 2JQRB 1K53A 3NZSA 3HUIA 3B0AA 4BKSA 2W3RA 4GDLB 1WXVA 5C1ZA 1WXQA 1KLVA 3VH3B 1WXAA 3OWEB 4YSYB 3ONSA 3VTUA 5JH5C 1ENFA 4HCPB 1EF5A 3GP7A 5C3JB 4GGQA 1XEEA 2WP9B 2JXTA 1Z5SB 3VUYA 3PSEB 4WJQA 5FR6A 2KFKA 5IO9A 1FNWA 4HPLB 2B3AA 2D10A 1WGDA 2GBJA 2KDIA 1UBQA 1L0YB 2OOBB 3IAS1 2V9HA 3HK0A 2WXMA 4TQ1A 4II3B 2MH7A 2KVZA 4KGSA 2JSVX 4WQMA 1TS3A 2I1JA 1WYWB 1OQRA 2GLSA 1HQRD 3BK1A 1FFVA 1NVID 2KDFB 3A1QA 4DBGA 1VRAB 4LNKA 2WDQB 5BO4B 2ZNVB 2N4FA 3QJZA 2CU1A 1X1MA 3A1QB 4BKSD 2JRIB 2N9XA 3ZLZA 2MP2B 1V5OA 4EFOA 2JZ3B 3KH0A 3I3TB 3QK0A 2IDYA 3MJ5A 2YLMA 3BVGA 4P1BC 2BGFA 2BS4B 1D4BA 2N1VA 1DOYA 2W54A 1HA5A 2GMIC 4P7IA 2KX0A 3DBRB 2KTRB 3ZTCA 1N60A 1RFAA 2FUHB 1TY0A 4K7SA 4KV2A 1JRUA 3A4SC 1IGDA 3GOEA 4RMAA 2RDBC 3R7QA 4AJWA 2XK5B 3WANA 1NI2A 3RNGC 2BQQA 1C9FA 3U30A 2PW9A 3B2GA 1I4QA 4GIVA 3DBHI 2AL6A 2LGIA 4HKQA 4LNOA 5AZGA 1EU4A 4DHJB 3AE1B 4DXFA 1XLNA 1K50A 1C4PA 2LFIA 1E90A 4HJKA 4XZ4A 4K7WA 5FK9C 2ZJDA 1C77A 2VH1A 2M19A 1AYFA 2K6QA 1DGJA 2KANA 1DOXA 2XBBC 2DZJA 4IC7B 3VHTC 3ZNZB 1Q1OA 3N30A 2E6XA 3AEFB 3R66C 4XX5A 1OQYA 3H8HA 4MJSA 4A8XC 2J0MA 5GMVA 2KDBA 1UBIA 2IO2B 1ESFA 2JF5A 2V3NA 4CHKA 3L16A 4MJSB 3ZJTA 4PS3A 3P2BA 2DYBA 3U8ZA 2MX2A 3L13A 1WR1A 2INDC 3DHGC 2O6VA 3DBLB 3NVYA 4F8CB 2KWUB 4KDLB 1IYFA 5EE0A 4LJPB 2BKRB 2QJLA 5CX3A 3K9OB 5BYQA 4WAFA 2LXAA 2AEHA 3AI5A 5FKAC 4I6NB 3U7ZA 3ZKJC 1R4MI 1V81A 2INCC 3DCGA 4KIKA 1L5PA 1LXDA 2KACA 3Q3JA 3HM6X 2KWVB 1F2RI 2R2OA 2WLBA 5CTRC 4HVBA 4JWSC 1Q5WB 4P16A 1P7FA 4FA6A 2FE8A 4LNIA 3B1LX 2MBQA 2KXJA 3VRBB 1D6EC 4FJVB 4NNJB 1J0GA 2V4IB 3L17A 2J52A 4GXBA 4AP4C 4PS8A 1JCKB 3P4QB 4X57B 2MJ3A 1FD6A 1WX9A 3RNEC 1L6VA 4G0NB 2O6VD 1IP9A 1MVKA 3Q6BA 3UI3A 3J9CA 1TS4A 1YNTE 4TSSA 2MBEA 3FILA 2ZZPB 4IM0A 3PRZA 2MLBA 2YEPB 1ZE3D 4K7UA 1XF5L 4LJOB 3AEGB 2AQ1B 3FILB 4WJOA 4AUQC 4BKGA 3ZDTA 4KZ0A 3TL5A 3ZRFA 3GS2A 1GUAB 2JYTA 1ZGUB 2AQ3B 3Q69A 1SEBD 5JXVA 2AWTA 1NEKB 3N1YC 3RPFC 4DXGA 2CS4A 3RNFC 1I4HA 3VR8B 3AEBB 4ZDVA 2W82A 4W9HA 2LGYA 1VJKA 1VDVA 2J53A 1T5XD 3N1ZC 1ZDVA 3RNCC 3C0RB 4JWUC 2K8CA 4RM8A 3C8YA 4KGRA 2FBWB 4M01A 2KN4A 2RDGA 3RZWC 4GOCA 5E6JA 4LTUA 4ANUA 4KGTA 1P3QU 2NPTA 2JWUA 2DZMA 1IPGA 3ABVB 3CF6E 1OTRB 3ZVVA 4YWGG 1XLOA 1HEZE 1N61A 1NDDA 3UINB 1ET9A 1I7HA 1ET6A 4HK2A 1NYQA 2W3SA 1IUEA 2JY6A 4FADA 2I2YA 3L08A 1C79A 1STEA 3A9JA 1GOZA 4RCOA 2AYOB 4N6EB 1WM2A 3WCQA 4E3CA 3T3NA 2L52A 4ITKA 1E8YA 2FCSA 1N5WA 1E8WA 2WXJA 3AE8B 3PS6A 1E9MA 4PYUA 3EHVA 2G1EA 4IWOA 2PTLA 4WJPA 2W55A 2V3PA 3NVWA 2WWZA 1T0QC 4HCNB 2LVPA 3ZUNA 3VDZA 2LEKA 3WIMA 3W2DA 3PV1A 3DBHB 3ETRA 2KVRA 2IY0B 3RN9C 3AECB 2M4NA 5IAAC 4AJYB 4LCDE 2OJRA 4NJCA 3QAQA 1PUTA 3MHZA 3V62A 4S0RA 3R8BA 1FRDA 2GBRA 3SDLC 2WS3B 4YTNB 2N9PC 4YSZB 2K1FA 4G50A 3KYCD 2Y5BB 3SFEB 2WX0A 1TBEA 1TZ1A 2YVCA 1PDXA 3W9CB 1KH0A 3V6EB 1SJHD 1V1PA 1LM8B 1C3TA 2RPQA 2L1AA 3A9KA 4XDCA 1FPYA 2WXKA 5LLIA 1PGBA 2IY1B 2K25A 1TIFA 3NRZA 3A9KB 2ACZB 3T3OA 3DQVA 1EU3A 1MHXA 2WDVB 3PO0A 2UWQA 5G55A 1TTNA 3KYDD 2C7MB 1P1AA 4B9KA 1HZ5A 4ZHOA 1ZW7A 3ZIMA 3UF8A 3CMMB 3Q8CA 2KLGA 1RM6C 4BBNF 2LASA 5C2TB 1JWAD 5E6NA 4CQNA 3DHHC 4HPMB 3APFA 2KC1A 2D3CA 1GG3A 4ARCA 2INNE 1MPEA 4GDKB 3S2AA 2NS5A 4L1BA 3CSFA 2VZKB 4P1CC 3GB1A 3JVZX 3AE5B 4O1NA 1F2RC 2RPVA 4DHZE 4EE2A 1KM7A 4J6IA 2WXRA 3JW0X 3GZNI 1TGZB 4HDQA 3PLVA 3T9LA 3LXFA 3Q8BA 1ACCA 4HRSA 4NQLB 4NJ7A 1YD8U 1UWXA 4MGKE 2IYDB 3NY5A 3TEZA 2JWZA 2FCMA 3R2IA 1SE2A 1EF1A 2KQSA 1I4XA 5HI1A 2Z0EB 4EOYA 2R61A 3FC4A 2RMMA 1DYQA 3O65B 3PGEA 2QIEB 1Q0WB 4IW0A 2KQ4X 1WZ3A 3OG5A 2KN5A 3IXSA 3QARA 1S1QB 5I4DA 4PT5A 1WM3A 5FR3A 3KWVA 3NVZA 2JPHA 1S3SG 2BVCA 2KQ7A 1TYGB 4AS1A 1J7BA 2IGGA 2DHZA 2ZPNA 3Q3NC 1ZOYB 1V97A 1T0SC 1MI0A 1V1OA 1XQQA 3HVZA 2HD5B 4MGIE 3U4EG 2MRPA 5BMIA 4RH6A 1SE3A 2DENB 3I5JC 5IN7A 3D32A 1SJED 2JYEA 3VTVA 1F0ZA 1NI3A 2DLBA 5G2NA 4D2KA 1TS5A 1B9RA 1SIJA 3AULA 2J4XA 3MC9A 3AE6B 2MBBB 5AUIA 1WR6E 1AW7A 2MWSB 3BZDB 1VLBA 3IVFA 2K9XA 3H7PA 3N3KB 1QOAA 2ZVOA 1Y8RC 1L6UA 3W1SC 2KFKB 2AQ2B 2A5UA 1I42A 2C7HA 4F7ZA 1C4CA 4B6WA 3P42A 4TUUA 5GXGB 1ZXHA 3N32A 4FN2A 2D3GA 4IUMB 4HPPA 1EUVB 2KMMA 3MC8A 2SEBD 4WURA 2KHWB 1WI0A 4YXDB 3ZO5B 3KLSX 3PTFC 5CHVC 3SD5A 2REXA 4WQOB 3IG3A 4W9IA 1Q10A 2KWDA 3APCA 1V80A 1I4PA 2QILA 3Q3MC 3NHEB 3ML8A 3PT2B 2WXIA 2WXHA 1ZXIA 3V61A 3JSVA 1PFDA 2DZIA 2EMTA 1SXTA 3RNBC 4XYCA 1U4AA 3NG0A 4JQWC 1TT5B 1UUPA 3NUHB 2WQYB 4AOFA 1QLBB 1VR9A 1N5XA 2H89B 2WXPA 1ZPSA 2RSUA 2L3ZA 2MHJA 3A4RA 1E7PB 1J7AA 1H4RA 4IWQA 2LXCA 2Y5CA 2PLPA 1WY8A 1K52A 1V6EA 4HROA 4BVUC 1T3QA 2C9WB 2FNJB 4BZAA 4CYEA 4W9FA 2CHXA 3WALA 1UZXB 1FXAA 2MQJA 4A55A 1FNUA 4JLCA 3K9PB 3BYYB 5EE9A 1WJ4A 3VFKA 2BYTA 3T8MA 3TEXA 4IKGA 2K22A 2BS2B 2M0AA 3U2SC 1QOGA 2L0TA 1XCQL 3KVFB 4OZBA 4P6VF 3AM9A 3H1UA 2MBHA 3CWIA 2LWPA 2WDRB 3W1YA 2ZW0A 4NPNA 1FEHA 1EWYC 2O6VB 5EE3A 2KK8A 4NJ6A 4XDDA 2K39A 1QQRA 3HIZA 1J7CA 5DPTA 1SE4A 3V3XA 3B2FA 2L76A 1YN4A 1D5XC 2CU3A 1R4NB 2BTEA 2R2QA 5AUKA 1CZPA 3MJWA 4JPSA 4W9LA 5DPWA 4YSXB 1V8CA 2H88B 1HXYD 3O13A 3VUXA 3BVMA 1PGXA 3ENEA 1E10A 1KTKA 4KIKB 2JX5A 2PVGC 4ZRJA 3TJPA 1UH6A 2IO1B 2NVUI 5G5HA 1TJEA 1KF6B 1WJUA 2M0XA 4ZRIA 1E6EB 2FCQA 1NBFC 2WXQA 4GU2A 5JHBA 1UNSA 1D3ZA 2ZCCA 4USAA 3DPDA 1T6BX 1CMXB 4L2YA 4PK1A 1YIWA 1WH3A 5BMGA 1WMHA 2I1KA 2WU5B 3L10B 4K1RB 5LNK1 4C80A 3OJ4B 1SF0A 2N7JA 2C5LC 2JZZA 3EFCA 1XXGA 1JWBD 3PHWB 5DCNA 3E9SA 4ANVA 3HVDA 2NBVB 3AE2B 1UELA 3IT4B 2ZPYA 1V9JA 1EO6A 3UIPB 1ZDXA 3PZDA 2KLCA 4OW0A 5HHDG 2GBKA 3ZNHB 2BS3B 4ZYSA 4XGAB 4WWPA 2DAFA 4ZRPA 4JIOU 3GE3C 2V1YA 2BBCA 3CSTA 1WE7A 2INPE 2GBMA 5D6JB 1KFYB 3UGBB 4YT0B 1CK1A 3TEYA 3PRMB 2L83A 1V86A 3QIJA 2KNBA 2O2VA 3APDA 3RYTA 1L4ZB 1OGWA 1OQQA 2ICIA 4PS7A 3UQAA 2CHWA 4UDUC 3R3MA 2V4LA 3AEAB 5JZEB 2BT6A 3PRPB 4GN1A 1P9DU 3QQ8B 2LZ6A 1FCCC 2HTHA 4TQ0A 2K6DB 4KVGB 5J2RA 4F1SA 2D3AA 2MW5A 3SR6A 5J17A 1RRBA 4IWPA 4JE3B 2WXGA 3ZNID 1M4VA 5BYSA 3B08A 1JALA 2K8BA 4A9AA 1GJZA 2GOWA 2JXXA 3Q2AC 1LO5D 4K3CA 5JHAA 4LNNA 3BVZA 1WGGA 3I9V1 4TV3A 5H8YE 2KDMA 3SEBA 2X8XX 1XD3B 2NPTB 4NAWA 3BWUD 2EKEC 3BY4B 2ZVNA 2PJHA 1WYGA 1WJNA 3AEEB 4G11A 1B1ZA 2LGSA 2KAJA 3KUZA 2V0GA 1F52A 2M1MA 4QAYA 2Z8LA 3A33B 1YQBA 3A9JB 3BINA 4N9F4 3V6CB 4YTMB 1WX7A 3LYYA 2DX5B 4FHJA 1A70A 2D07B 3U52E 4TMAB 2OEDA 4LLGM 3M95A 4HJGE 1F9JA 2WU2B 4A3OA 2DYOA 5EDSA 2CR5A 2N9KA 2LMCA 2SAKA 2ZEQA 3DBRI 4R3DA 3ZQ4A 2JU6X 5DPRA 5C23A 4EZJA 4FLHA 1XLPA 2HJ8A 1CQVA 1QOBA 4HWIB 3GE8C 5TSSA 2BW2A 4AQ7A 4YTPB 3RNAC 1XLQA 2WGSA 3TIXA 2NTSA 4OZCA 3ML9A 3DHIC 4BBNC 2M17A 2ONQA 3KQ4A 2KJHB 1H8CA 4H2AA 1WGYA 1Z2MA 1V1PB 3RFZB 3ZJVA 1SE9A 3H9DA 3VR9B 2LJIA 1L0XB 2LUEA 3P4RB 4RM9A 5CHFA 3OAWA 4IDIA 3HHMA 1FFUA 1L2NA 3EA6A 3ECIA 3PLUA 2KT7A 3RI7C 4RNAA 3R7RA 1SSNA 5E6OA 3ZGZA 3AN1A 2LGXA 1YX6B 4KKJA 1GB1A 2BKFA 3W5UB 2M56B 4MELA 4ICUA 3SHQA 2FUG1 5D94A 2FAZA 3AMZA 4M0WA 4EKUA 3LB8C 5TR5A 2WHIA 4A20A 3DBLI 2L8JA 1IGCA 1R4MB 4M0WB 4US9A 5CHWA 3RT3B 4FHKA 4GLSC 1JW9D 3QWZB 2GI9A 4M8MA 1PGAA 1WFYA 4DQOC 4W9DA 2WYQA 3AU5A 1FNVA 1VZ7A 2WDTB 4KZCA 2MBOA 4JX1C 1KJTA 3AE9B 2PPHA 1JQ4A 3JYUA 3FAHA 5HG2A 3M3JA 3WAPA 3M63B 3PPAA 3VQIA 5D7GA 1MFWA 3Q3OC 2TSSA 1DOIA 1MHHE 2EELA 5IOIA 4OVUA 4HLEA 1BT0A 4MH8A 5LXHA 2VH2A 3BIID 1V5TA 2BPSA 3DVGX 1XCTL
chains in the Genus database with same CATH topology
2O6VD 3DOWA 4MDKE 1U4AA 4ANWA 3QC8B 1IP9A 2BYEA 2HE7A 4JQWC 2QHOA 1XT9B 2N7EA 4FJYA 4AOFA 4MM3A 1WZ0A 2MBEA 2RSUA 4WWOA 1WRDB 4BOSC 2ZZPB 2L3ZA 3PRZA 4IM0A 2KMAA 2MLBA 2NBWB 4BFRA 4W9KA 4K7UA 4M8NA 3HM3A 3PHXB 2G3QB 1LFDA 3A4RA 4LJOB 1H4RA 2A4ZA 4GSWA 4IWQA 1SGHA 2LXCA 4ANXA 4WJOA 1A5RA 1WY8A 4KDIC 3RUIB 4AUQC 3RD2A 3WAMA 1HE8A 3TBLD 3QCAA 4BKGA 1V6EA 4BVUC 3ZDTA 4JGHB 2CKHB 1WXSA 4DDID 2C9WB 4KZ0A 3TL5A 3WAOA 2FNJB 1I35A 3ZRFA 1E7UA 2DZKA 4OVVA 2KJRA 4CYEA 4W9FA 1GUAB 3ZTDA 1L7YA 2CHXA 3WALA 1AARA 1YJ1A 3NOBA 4I6PA 1WF9A 4GDLA 1UZXB 1LQBA 2MQJA 1ZGUB 3VH4B 5DPSA 1E8XA 4CO7A 4BOZB 4JLCA 2VRRB 3KW5B 3ZRCA 3K9PB 2AWTA 2JRHA 5AZFA 3OLMD 3AXCA 2GBNA 3LDZE 2KC2A 4KSLC 2CS4A 2L05A 3RULA 1WJ4A 1WGRA 3VFKA 4MSMB 2EMSA 3W1SA 3T8MA 2K8HA 2LGDA 4ZDVA 1ISNA 2G4SA 4W9HA 2KMCA 2LGYA 3QHTA 4WJNA 4WWNA 3DBSA 4HXDA 2L0TA 1YX5B 5IA7A 3KVFB 3H1UA 5D2MB 4IM3A 2MBHA 3C0RB 2FIFA 2K8CA 3H7PB 4RM8A 1GNUA 2LWPA 3QX1A 3W1YA 4NPNA 2BWES 3KUDB 2KD0A 3RZWC 2KX3A 3TCAA 2O6VB 4GOCA 2KK8A 2ZCBA 4NJ6A 4ANUA 4W9JA 2CHZA 2LRUA 2K39A 4ZRKA 3HIZA 2KWCA 2L7RA 1P3QU 1RLFA 2RGFA 5DPTA 4ZYNA 1ZKHA 2NPTA 2DZMA 1IPGA 4GDKA 3UIOB 3VXWA 2L76A 3L0WB 3CF6E 3QA8A 4E71A 2R2QA 4EUTA 2Z59B 2IO0B 1OTRB 3NZUA 3ZVVA 4DHZB 4W9CA 4AWJA 3MJWA 1NDDA 2PE9A 2L00B 2ZNVC 4W9LA 3UINB 5DPWA 1R4NI 3V60A 4MH0E 2FCNA 4HK2A 5KHQA 3X23A 2KTFA 3VUXA 4MGZE 2L0FA 2MP2A 3ENEA 2JY6A 4FADA 1J19A 1GC7A 2BYVE 4KIKB 3L08A 4ZRJA 5E6PA 1UH6A 2IO1B 3TJPA 2NVUI 3A9JA 3L54A 1WJUA 2G4DB 2M0XA 3ALBA 4DXAB 2PEAA 4ZRIA 2FCQA 2AYOB 1NBFC 4GU2A 1WM2A 5JHBA 1WIAA 4E3CA 1D3ZA 2ZCCA 3DPDA 2KTRA 1E8YA 3Q3FA 3DDCB 1CMXB 2FCSA 4II2B 1E8WA 2N7DA 2KZRA 1YIWA 1WH3A 4URKA 1WMHA 3PS6A 2I1KA 4PYUA 3DVGY 3EHVA 3L10B 5L95C 1SIFA 4IWOA 2XK5A 4K1RB 2DYMA 3VVWB 4WJPA 1WJ6A 3JSVB 3OJ4B 2WWZA 2LJ5A 2C5LC 2LVPA 4HCNB 3ZUNA 1G6JA 2JZZA 3VDZA 3LJ3A 1PQSA 3WIMA 3PV1A 3PHWB 5DCNA 2C60A 4ANVA 3VUWA 2NBVB 2G45B 2KVRA 2IY0B 2AL3A 1UELA 2J0JA 2IBIB 2M4NA 5IAAC 2ZPYA 4LCDE 2OJRA 3IHPC 4AJYB 4E74A 1V9JA 1EO6A 1E7VA 3KUCB 3UIPB 3PZDA 3QAQA 2KLCA 2N9EB 3V62A 4NY0A 2LVOA 2MSED 2Z0DB 2KOXA 2GBKA 2GBRA 3SDLC 3MHSD 2PE6B 2MCNB 2BYFA 3ZNHB 3VTWA 4WWPA 1WE6A 4EEWA 2DAFA 1KOTA 4JIOU 1UGMA 2N9PC 3U7DA 2V1YA 2BWFA 2K1FA 3CSTA 1WE7A 4G50A 2GBMA 3KYCD 4EZKA 3EFUA 5D6JB 2Y5BB 3UGBB 3PRMB 2JUOA 1V86A 2WX0A 1TBEA 1TZ1A 3DVNU 2YVCA 4DDGD 1T0YA 4IM2A 3NZSA 3V6EB 3QIJA 2KNBA 1LM8B 2KKCA 2O2VA 3AU4A 1C3TA 3APDA 3RYTA 3B0AA 1OGWA 4BKSA 1E8ZA 4PS7A 2NCNA 2RPQA 3UQAA 2CHWA 3R3MA 2V4LA 1WXVA 3A9KA 4GDLB 5C1ZA 1KLVA 3VH3B 1WXAA 5JZEB 3ONSA 3PRPB 5LLIA 4GN1A 1P9DU 3QQ8B 2LZ6A 3WA0A 3VTUA 2ASQA 5JH5C 2IY1B 4TKNA 4HCPB 2K25A 1EF5A 2BF8B 2HTHA 2NR2A 4MGYE 4TQ0A 4GGQA 4GB9A 2K6DB 3A9KB 3DQVA 4KVGB 5J2RA 4F1SA 3MTNB 2UWQA 5G55A 2IZVB 1Z5SB 2MW5A 3VUYA 3PSEB 4ICVA 4WJQA 4PYZA 3H6NA 3TMPB 5FR6A 2KFKA 1TTNA 5J17A 1RRBA 3KYDD 4IWPA 2C7MB 1P1AA 4HDOA 4B9KA 4HPLB 3ZNID 2B3AA 1WX8A 1WGDA 2D10A 2GBJA 1UBQA 2KDIA 2KFJA 2OOBB 1ZW7A 3HK0A 3B08A 3ZIMA 2K8BA 3UF8A 4TQ1A 4DHJD 3CMMB 1GC6A 4II3B 4B95A 1GJZA 2GOWA 2JXXA 2W9NA 2KLGA 4BBNF 2LASA 1OEYJ 2FIDA 2I1JA 1WYWB 5JHAA 5E6NA 1WGGA 2RD0A 2LVQA 4TV3A 3APFA 4HPMB 4GMVA 2KC1A 3ZW3A 4G3XB 1GG3A 1K8RB 4EZLA 2KDFB 3A1QA 1XD3B 4DBGA 2NPTB 1WXMA 4NAWA 4GDKB 3S2AA 2NS5A 5BO4B 3CSFA 2ZNVB 2N4FA 3JVZX 2EKEC 3BY4B 3QJZA 1VCBA 2ZVNA 2PJHA 2CU1A 1X1MA 3A1QB 1WJNA 4DHZE 1KM7A 4G11A 4J6IA 4BKSD 2JRIB 3JW0X 3GZNI 3KUZA 1TGZB 2N9XA 4HDQA 2M1MA 3PLVA 3ZLZA 3T9LA 2MP2B 1P98A 1V5OA 5AEKB 4EFOA 2JZ3B 3KH0A 3H7SA 3I3TB 3QK0A 3A33B 1YQBA 4NQLB 4NJ7A 2YLMA 1YD8U 1V49A 3A9JB 2BGFA 3BINA 4N9F4 2N1VA 3V6CB 4MGKE 1WX7A 2IYDB 3NY5A 2DX5B 2FCMA 2JWZA 4FHJA 1QZEA 1EF1A 2D07B 2KQSA 2Z0EB 4EOYA 2GMIC 4P7IA 3O65B 2V3SA 2KX0A 2KTRB 4JL9A 4YL8A 3ZTCA 3M95A 1F9JA 2RR9A 1RFAA 2FUHB 4A3OA 3PGEA 2D2QA 2DYOA 4K7SA 1FXTB 4KV2A 5EDSA 1JRUA 1WMHB 3A4SC 3GOEA 1Q0WB 4RMAA 2CR5A 4IW0A 4G0NB 2LI5A 3R7QA 1WZ3A 2ZEQA 2KN5A 3DBRI 2C7NB 2XK5B 4AJWA 2IO3B 3WANA 1NI2A 2J7QB 3QARA 4K81A 1S1QB 5DPRA 5C23A 4EZJA 3U30A 4FLHA 4W9EA 2HJ8A 1M94A 2XEWA 1WM3A 3DBHI 4GIVA 2JPHA 2AL6A 5AZGA 1S3SG 3OJ3A 2KQ7A 3EC8A 2KDEB 4DHJB 4HWIB 1P0RA 4I6LB 4ASWC 1E90A 4HJKA 4XZ4A 4K7WA 2DHZA 4WAAA 2ZJDA 5L83A 2ZPNA 4BKTA 2N1WA 2WX1A 2K6QA 3DVNV 4XC2A 2KANA 2XBBC 1XQQA 2HD5B 4MGIE 2NBUA 2DZJA 2MRPA 4IC7B 3TIXA 3VHTC 1UD7A 3ZNZB 1Q1OA 3N30A 2DENB 3ML9A 4BBNC 2M17A 3D32A 2KJHB 1H8CA 3VTVA 1WGYA 1Z2MA 5G2NA 1SE9A 3H9DA 2O2VB 3EECA 3R66C 4XX5A 4FJZA 3ZNGC 2LUEA 1OQYA 3AULA 4RM9A 4MJSA 5CHFA 3OAWA 3HHMA 2J0MA 2MBBB 5GMVA 4W9GA 1L2NA 2KDBA 1WR6E 3X0WA 1UBIA 2J0KA 2IO2B 3ECIA 2MWSB 2MA9B 3PLUA 3UQBA 2M8SA 3M62B 2JF5A 4CHKA 3R7RA 2UYZB 3IVFA 3L16A 5E6OA 3IBEA 4MJSB 2DAJA 3H7PA 3P2BA 2DYBA 2LD9A 3IFWB 3N3KB 4PS3A 3U8ZA 2LGXA 1YX6B 2MX2A 2ZVOA 3PVLA 3RZFA 3L13A 1MG8A 1Y8RC 1WR1A 2BKFA 3W1SC 2KFKB 4FULA 1V2YA 4DWFA 2A5UA 1E5WA 2O6VA 4MELA 1I42A 4ICUA 2C7HA 3SHQA 5D94A 4F7ZA 5AZHA 4MSQB 2FAZA 1RAXA 2JVCA 4B6WA 4EKUA 2KWUB 5TR5A 4F8CB 4TUUA 4FBJB 4KDLB 1IYFA 4LDTB 4A20A 3DBLI 5KHOA 3N32A 2L8JA 4LJPB 2BKRB 4FN2A 2D3GA 3PREA 4IUMB 3K9OB 5CX3A 1J8CA 4M0WB 1WGHA 1EUVB 2LXAA 2AEHA 3AI5A 5CHWA 3RT3B 4FHKA 3RCZA 2KHWB 4I6NB 3QWZB 3ZKJC 4M8MA 2JT4B 1R4MI 1WFYA 1WI0A 4NAWB 4W9DA 2WYQA 1V81A 3DCGA 3ZO5B 4KIKA 3AU5A 5LXIB 2WDTB 4KZCA 3PTFC 4IG7B 1LXDA 4DK5A 2MBOA 3Q3JA 5CHVC 1KJTA 3SD5A 3HM6X 2KWVB 2REXA 4WQOB 2PPHA 3IG3A 4W9IA 2R2OA 5CTRC 4HVBA 2KJ6A 3APCA 4MEMA 3ZDMC 1Q5WB 1V80A 3JYUA 2KO3A 3M3JA 4FA6A 3WAPA 3M63B 3B1LX 2MBQA 4KSKC 2KXJA 3PPAA 3VQIA 4FJVB 5D7GA 3NHEB 3ML8A 4NNJB 1J0GA 3VAWA 5HKHA 3L17A 3NS8A 3PT2B 1OEYA 4GXBA 4AP4C 4OVUA 4HLEA 1BT0A 4NQKE 4PS8A 4X57B 5LXHA 3V61A 1WX9A 3JSVA 5J18A 1C1YB 2D11A 2DZIA 1V5TA 2BPSA 2EMTA 3DVGX 4LDTD 1VD2A 4A3PA 2LRWA 3SU8X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6V D;  3DOW A;  4MDK E;  1U4A A;  4ANW A;  3QC8 B;  1IP9 A;  2BYE A;  2HE7 A;  4JQW C;  2QHO A;  1XT9 B;  2N7E A;  4FJY A;  4AOF A;  4MM3 A;  1WZ0 A;  2MBE A;  2RSU A;  4WWO A;  1WRD B;  4BOS C;  2ZZP B;  2L3Z A;  3PRZ A;  4IM0 A;  2KMA A;  2MLB A;  2NBW B;  4BFR A;  4W9K A;  4K7U A;  4M8N A;  3HM3 A;  3PHX B;  2G3Q B;  1LFD A;  3A4R A;  4LJO B;  1H4R A;  2A4Z A;  4GSW A;  4IWQ A;  1SGH A;  2LXC A;  4ANX A;  4WJO A;  1A5R A;  1WY8 A;  4KDI C;  3RUI B;  4AUQ C;  3RD2 A;  3WAM A;  1HE8 A;  3TBL D;  3QCA A;  4BKG A;  1V6E A;  4BVU C;  3ZDT A;  4JGH B;  2CKH B;  1WXS A;  4DDI D;  2C9W B;  4KZ0 A;  3TL5 A;  3WAO A;  2FNJ B;  1I35 A;  3ZRF A;  1E7U A;  2DZK A;  4OVV A;  2KJR A;  4CYE A;  4W9F A;  1GUA B;  3ZTD A;  1L7Y A;  2CHX A;  3WAL A;  1AAR A;  1YJ1 A;  3NOB A;  4I6P A;  1WF9 A;  4GDL A;  1UZX B;  1LQB A;  2MQJ A;  1ZGU B;  3VH4 B;  5DPS A;  1E8X A;  4CO7 A;  4BOZ B;  4JLC A;  2VRR B;  3KW5 B;  3ZRC A;  3K9P B;  2AWT A;  2JRH A;  5AZF A;  3OLM D;  3AXC A;  2GBN A;  3LDZ E;  2KC2 A;  4KSL C;  2CS4 A;  2L05 A;  3RUL A;  1WJ4 A;  1WGR A;  3VFK A;  4MSM B;  2EMS A;  3W1S A;  3T8M A;  2K8H A;  2LGD A;  4ZDV A;  1ISN A;  2G4S A;  4W9H A;  2KMC A;  2LGY A;  3QHT A;  4WJN A;  4WWN A;  3DBS A;  4HXD A;  2L0T A;  1YX5 B;  5IA7 A;  3KVF B;  3H1U A;  5D2M B;  4IM3 A;  2MBH A;  3C0R B;  2FIF A;  2K8C A;  3H7P B;  4RM8 A;  1GNU A;  2LWP A;  3QX1 A;  3W1Y A;  4NPN A;  2BWE S;  3KUD B;  2KD0 A;  3RZW C;  2KX3 A;  3TCA A;  2O6V B;  4GOC A;  2KK8 A;  2ZCB A;  4NJ6 A;  4ANU A;  4W9J A;  2CHZ A;  2LRU A;  2K39 A;  4ZRK A;  3HIZ A;  2KWC A;  2L7R A;  1P3Q U;  1RLF A;  2RGF A;  5DPT A;  4ZYN A;  1ZKH A;  2NPT A;  2DZM A;  1IPG A;  4GDK A;  3UIO B;  3VXW A;  2L76 A;  3L0W B;  3CF6 E;  3QA8 A;  4E71 A;  2R2Q A;  4EUT A;  2Z59 B;  2IO0 B;  1OTR B;  3NZU A;  3ZVV A;  4DHZ B;  4W9C A;  4AWJ A;  3MJW A;  1NDD A;  2PE9 A;  2L00 B;  2ZNV C;  4W9L A;  3UIN B;  5DPW A;  1R4N I;  3V60 A;  4MH0 E;  2FCN A;  4HK2 A;  5KHQ A;  3X23 A;  2KTF A;  3VUX A;  4MGZ E;  2L0F A;  2MP2 A;  3ENE A;  2JY6 A;  4FAD A;  1J19 A;  1GC7 A;  2BYV E;  4KIK B;  3L08 A;  4ZRJ A;  5E6P A;  1UH6 A;  2IO1 B;  3TJP A;  2NVU I;  3A9J A;  3L54 A;  1WJU A;  2G4D B;  2M0X A;  3ALB A;  4DXA B;  2PEA A;  4ZRI A;  2FCQ A;  2AYO B;  1NBF C;  4GU2 A;  1WM2 A;  5JHB A;  1WIA A;  4E3C A;  1D3Z A;  2ZCC A;  3DPD A;  2KTR A;  1E8Y A;  3Q3F A;  3DDC B;  1CMX B;  2FCS A;  4II2 B;  1E8W A;  2N7D A;  2KZR A;  1YIW A;  1WH3 A;  4URK A;  1WMH A;  3PS6 A;  2I1K A;  4PYU A;  3DVG Y;  3EHV A;  3L10 B;  5L95 C;  1SIF A;  4IWO A;  2XK5 A;  4K1R B;  2DYM A;  3VVW B;  4WJP A;  1WJ6 A;  3JSV B;  3OJ4 B;  2WWZ A;  2LJ5 A;  2C5L C;  2LVP A;  4HCN B;  3ZUN A;  1G6J A;  2JZZ A;  3VDZ A;  3LJ3 A;  1PQS A;  3WIM A;  3PV1 A;  3PHW B;  5DCN A;  2C60 A;  4ANV A;  3VUW A;  2NBV B;  2G45 B;  2KVR A;  2IY0 B;  2AL3 A;  1UEL A;  2J0J A;  2IBI B;  2M4N A;  5IAA C;  2ZPY A;  4LCD E;  2OJR A;  3IHP C;  4AJY B;  4E74 A;  1V9J A;  1EO6 A;  1E7V A;  3KUC B;  3UIP B;  3PZD A;  3QAQ A;  2KLC A;  2N9E B;  3V62 A;  4NY0 A;  2LVO A;  2MSE D;  2Z0D B;  2KOX A;  2GBK A;  2GBR A;  3SDL C;  3MHS D;  2PE6 B;  2MCN B;  2BYF A;  3ZNH B;  3VTW A;  4WWP A;  1WE6 A;  4EEW A;  2DAF A;  1KOT A;  4JIO U;  1UGM A;  2N9P C;  3U7D A;  2V1Y A;  2BWF A;  2K1F A;  3CST A;  1WE7 A;  4G50 A;  2GBM A;  3KYC D;  4EZK A;  3EFU A;  5D6J B;  2Y5B B;  3UGB B;  3PRM B;  2JUO A;  1V86 A;  2WX0 A;  1TBE A;  1TZ1 A;  3DVN U;  2YVC A;  4DDG D;  1T0Y A;  4IM2 A;  3NZS A;  3V6E B;  3QIJ A;  2KNB A;  1LM8 B;  2KKC A;  2O2V A;  3AU4 A;  1C3T A;  3APD A;  3RYT A;  3B0A A;  1OGW A;  4BKS A;  1E8Z A;  4PS7 A;  2NCN A;  2RPQ A;  3UQA A;  2CHW A;  3R3M A;  2V4L A;  1WXV A;  3A9K A;  4GDL B;  5C1Z A;  1KLV A;  3VH3 B;  1WXA A;  5JZE B;  3ONS A;  3PRP B;  5LLI A;  4GN1 A;  1P9D U;  3QQ8 B;  2LZ6 A;  3WA0 A;  3VTU A;  2ASQ A;  5JH5 C;  2IY1 B;  4TKN A;  4HCP B;  2K25 A;  1EF5 A;  2BF8 B;  2HTH A;  2NR2 A;  4MGY E;  4TQ0 A;  4GGQ A;  4GB9 A;  2K6D B;  3A9K B;  3DQV A;  4KVG B;  5J2R A;  4F1S A;  3MTN B;  2UWQ A;  5G55 A;  2IZV B;  1Z5S B;  2MW5 A;  3VUY A;  3PSE B;  4ICV A;  4WJQ A;  4PYZ A;  3H6N A;  3TMP B;  5FR6 A;  2KFK A;  1TTN A;  5J17 A;  1RRB A;  3KYD D;  4IWP A;  2C7M B;  1P1A A;  4HDO A;  4B9K A;  4HPL B;  3ZNI D;  2B3A A;  1WX8 A;  1WGD A;  2D10 A;  2GBJ A;  1UBQ A;  2KDI A;  2KFJ A;  2OOB B;  1ZW7 A;  3HK0 A;  3B08 A;  3ZIM A;  2K8B A;  3UF8 A;  4TQ1 A;  4DHJ D;  3CMM B;  1GC6 A;  4II3 B;  4B95 A;  1GJZ A;  2GOW A;  2JXX A;  2W9N A;  2KLG A;  4BBN F;  2LAS A;  1OEY J;  2FID A;  2I1J A;  1WYW B;  5JHA A;  5E6N A;  1WGG A;  2RD0 A;  2LVQ A;  4TV3 A;  3APF A;  4HPM B;  4GMV A;  2KC1 A;  3ZW3 A;  4G3X B;  1GG3 A;  1K8R B;  4EZL A;  2KDF B;  3A1Q A;  1XD3 B;  4DBG A;  2NPT B;  1WXM A;  4NAW A;  4GDK B;  3S2A A;  2NS5 A;  5BO4 B;  3CSF A;  2ZNV B;  2N4F A;  3JVZ X;  2EKE C;  3BY4 B;  3QJZ A;  1VCB A;  2ZVN A;  2PJH A;  2CU1 A;  1X1M A;  3A1Q B;  1WJN A;  4DHZ E;  1KM7 A;  4G11 A;  4J6I A;  4BKS D;  2JRI B;  3JW0 X;  3GZN I;  3KUZ A;  1TGZ B;  2N9X A;  4HDQ A;  2M1M A;  3PLV A;  3ZLZ A;  3T9L A;  2MP2 B;  1P98 A;  1V5O A;  5AEK B;  4EFO A;  2JZ3 B;  3KH0 A;  3H7S A;  3I3T B;  3QK0 A;  3A33 B;  1YQB A;  4NQL B;  4NJ7 A;  2YLM A;  1YD8 U;  1V49 A;  3A9J B;  2BGF A;  3BIN A;  4N9F 4;  2N1V A;  3V6C B;  4MGK E;  1WX7 A;  2IYD B;  3NY5 A;  2DX5 B;  2FCM A;  2JWZ A;  4FHJ A;  1QZE A;  1EF1 A;  2D07 B;  2KQS A;  2Z0E B;  4EOY A;  2GMI C;  4P7I A;  3O65 B;  2V3S A;  2KX0 A;  2KTR B;  4JL9 A;  4YL8 A;  3ZTC A;  3M95 A;  1F9J A;  2RR9 A;  1RFA A;  2FUH B;  4A3O A;  3PGE A;  2D2Q A;  2DYO A;  4K7S A;  1FXT B;  4KV2 A;  5EDS A;  1JRU A;  1WMH B;  3A4S C;  3GOE A;  1Q0W B;  4RMA A;  2CR5 A;  4IW0 A;  4G0N B;  2LI5 A;  3R7Q A;  1WZ3 A;  2ZEQ A;  2KN5 A;  3DBR I;  2C7N B;  2XK5 B;  4AJW A;  2IO3 B;  3WAN A;  1NI2 A;  2J7Q B;  3QAR A;  4K81 A;  1S1Q B;  5DPR A;  5C23 A;  4EZJ A;  3U30 A;  4FLH A;  4W9E A;  2HJ8 A;  1M94 A;  2XEW A;  1WM3 A;  3DBH I;  4GIV A;  2JPH A;  2AL6 A;  5AZG A;  1S3S G;  3OJ3 A;  2KQ7 A;  3EC8 A;  2KDE B;  4DHJ B;  4HWI B;  1P0R A;  4I6L B;  4ASW C;  1E90 A;  4HJK A;  4XZ4 A;  4K7W A;  2DHZ A;  4WAA A;  2ZJD A;  5L83 A;  2ZPN A;  4BKT A;  2N1W A;  2WX1 A;  2K6Q A;  3DVN V;  4XC2 A;  2KAN A;  2XBB C;  1XQQ A;  2HD5 B;  4MGI E;  2NBU A;  2DZJ A;  2MRP A;  4IC7 B;  3TIX A;  3VHT C;  1UD7 A;  3ZNZ B;  1Q1O A;  3N30 A;  2DEN B;  3ML9 A;  4BBN C;  2M17 A;  3D32 A;  2KJH B;  1H8C A;  3VTV A;  1WGY A;  1Z2M A;  5G2N A;  1SE9 A;  3H9D A;  2O2V B;  3EEC A;  3R66 C;  4XX5 A;  4FJZ A;  3ZNG C;  2LUE A;  1OQY A;  3AUL A;  4RM9 A;  4MJS A;  5CHF A;  3OAW A;  3HHM A;  2J0M A;  2MBB B;  5GMV A;  4W9G A;  1L2N A;  2KDB A;  1WR6 E;  3X0W A;  1UBI A;  2J0K A;  2IO2 B;  3ECI A;  2MWS B;  2MA9 B;  3PLU A;  3UQB A;  2M8S A;  3M62 B;  2JF5 A;  4CHK A;  3R7R A;  2UYZ B;  3IVF A;  3L16 A;  5E6O A;  3IBE A;  4MJS B;  2DAJ A;  3H7P A;  3P2B A;  2DYB A;  2LD9 A;  3IFW B;  3N3K B;  4PS3 A;  3U8Z A;  2LGX A;  1YX6 B;  2MX2 A;  2ZVO A;  3PVL A;  3RZF A;  3L13 A;  1MG8 A;  1Y8R C;  1WR1 A;  2BKF A;  3W1S C;  2KFK B;  4FUL A;  1V2Y A;  4DWF A;  2A5U A;  1E5W A;  2O6V A;  4MEL A;  1I42 A;  4ICU A;  2C7H A;  3SHQ A;  5D94 A;  4F7Z A;  5AZH A;  4MSQ B;  2FAZ A;  1RAX A;  2JVC A;  4B6W A;  4EKU A;  2KWU B;  5TR5 A;  4F8C B;  4TUU A;  4FBJ B;  4KDL B;  1IYF A;  4LDT B;  4A20 A;  3DBL I;  5KHO A;  3N32 A;  2L8J A;  4LJP B;  2BKR B;  4FN2 A;  2D3G A;  3PRE A;  4IUM B;  3K9O B;  5CX3 A;  1J8C A;  4M0W B;  1WGH A;  1EUV B;  2LXA A;  2AEH A;  3AI5 A;  5CHW A;  3RT3 B;  4FHK A;  3RCZ A;  2KHW B;  4I6N B;  3QWZ B;  3ZKJ C;  4M8M A;  2JT4 B;  1R4M I;  1WFY A;  1WI0 A;  4NAW B;  4W9D A;  2WYQ A;  1V81 A;  3DCG A;  3ZO5 B;  4KIK A;  3AU5 A;  5LXI B;  2WDT B;  4KZC A;  3PTF C;  4IG7 B;  1LXD A;  4DK5 A;  2MBO A;  3Q3J A;  5CHV C;  1KJT A;  3SD5 A;  3HM6 X;  2KWV B;  2REX A;  4WQO B;  2PPH A;  3IG3 A;  4W9I A;  2R2O A;  5CTR C;  4HVB A;  2KJ6 A;  3APC A;  4MEM A;  3ZDM C;  1Q5W B;  1V80 A;  3JYU A;  2KO3 A;  3M3J A;  4FA6 A;  3WAP A;  3M63 B;  3B1L X;  2MBQ A;  4KSK C;  2KXJ A;  3PPA A;  3VQI A;  4FJV B;  5D7G A;  3NHE B;  3ML8 A;  4NNJ B;  1J0G A;  3VAW A;  5HKH A;  3L17 A;  3NS8 A;  3PT2 B;  1OEY A;  4GXB A;  4AP4 C;  4OVU A;  4HLE A;  1BT0 A;  4NQK E;  4PS8 A;  4X57 B;  5LXH A;  3V61 A;  1WX9 A;  3JSV A;  5J18 A;  1C1Y B;  2D11 A;  2DZI A;  1V5T A;  2BPS A;  2EMT A;  3DVG X;  4LDT D;  1VD2 A;  4A3P A;  2LRW A;  3SU8 X; 
#chains in the Genus database with same CATH topology
 3DOW A;  1UF0 A;  4ANW A;  2LHE A;  5MPO A;  2HE7 A;  1XT9 B;  2N7E A;  4RGO S;  1JWU D;  4FJY A;  5BYR A;  4MM3 A;  1TS2 A;  1WRD B;  4BOS C;  4W9K A;  1JML A;  3IAM 1;  4M8N A;  3HM3 A;  2G3Q B;  1LFD A;  4RF0 A;  4GSW A;  5IP4 D;  4RGN A;  2BB6 A;  1A5R A;  4KDI C;  2E3T A;  3AH7 A;  1IBX A;  4JGH B;  3NJT A;  4DDI D;  2L32 A;  4C4V A;  3TUO A;  1I35 A;  1E7U A;  4OVV A;  3ZTD A;  1L7Y A;  4I6P A;  1WF9 A;  4GDL A;  1LQB A;  1IBX B;  1BUI C;  5DPS A;  3P1M A;  4C4V B;  3KW5 B;  3BYT B;  5AZF A;  3OLM D;  3AXC A;  3LDZ E;  1L4D B;  4MAC A;  3RUL A;  1WGR A;  4MSM B;  2EMS A;  3W1S A;  2K8H A;  2LGD A;  2UU7 A;  1ISN A;  2G4S A;  2HTM E;  4WJN A;  4HXD A;  4N58 A;  4IM3 A;  1HZ6 A;  1BML C;  1FXI A;  3H7P B;  3KWL A;  3B9J A;  1GNU A;  1QOF A;  2QEJ C;  1ZUD 2;  3KUD B;  4M02 A;  4XE0 A;  2LRU A;  2KWC A;  4RGT A;  4ZYN A;  3UIO B;  3VXW A;  4E71 A;  2WXN A;  3TEW A;  1WRI A;  4C00 A;  4EUT A;  2Z59 B;  3Q8E A;  4DHZ B;  4NAM A;  4AWJ A;  1QKZ A;  2PE9 A;  2L00 B;  2ZNV C;  1I4R A;  4MH0 E;  2FCN A;  5KHQ A;  3X23 A;  2KTF A;  2L0F A;  2MP2 A;  1J19 A;  4OZA A;  2BYV E;  3L54 A;  3ALB A;  4DXA B;  1L0V B;  2XNA C;  1WIA A;  4US8 A;  2QC8 A;  3PZ8 A;  4MT5 A;  2KTR A;  3AV8 A;  3Q3F A;  3DDC B;  4II2 B;  3I63 C;  2GB1 A;  2KZR A;  4URK A;  1WGK A;  2Y5P A;  5L95 C;  2XK5 A;  2DYM A;  3VVW B;  1QF6 A;  3JSV B;  1EM7 A;  1G6J A;  3ZJU A;  4L23 A;  1F77 A;  2C60 A;  3FKY A;  4BAX A;  2AL3 A;  1FRR A;  2IBI B;  3CIR B;  4E74 A;  3IHP C;  1E7V A;  2WXF A;  4C7Y A;  2N9E B;  4KX6 B;  4M00 A;  4OVZ A;  3AB5 A;  2J42 A;  3AE7 B;  2MCN B;  2BYF A;  4KKI A;  3E56 A;  3VTW A;  1UGM A;  1TKY A;  2Y3A A;  4EZK A;  1YOV B;  3EFU A;  4LNF A;  2K0P A;  3DVN U;  4DDG D;  4IM2 A;  3TSS A;  2D3B A;  3PZ7 A;  4NZL B;  2KKC A;  3AU4 A;  2LHD A;  3ZXR A;  1FMA D;  1E8Z A;  2DNF A;  3VRA B;  2NCN A;  1VZ6 A;  3N9Y C;  1SB3 C;  1D5M C;  3WA0 A;  5EE1 A;  1XO3 A;  2ASQ A;  1HTO A;  4TKN A;  2BF8 B;  2NR2 A;  4MGY E;  3AE4 B;  4GB9 A;  1FIQ A;  3MTN B;  2IZV B;  5BMH A;  4ICV A;  2GRI A;  4PYZ A;  3H6N A;  3I57 A;  3TMP B;  1N63 A;  4HDO A;  1WX8 A;  2KFJ A;  4XWT A;  1KLU D;  2PVO D;  4DHJ D;  1GC6 A;  2W9N A;  1R7S A;  3V05 A;  1OEY J;  2FID A;  2RD0 A;  2AX5 A;  2LVQ A;  3MP9 A;  4GMV A;  3ZW3 A;  4ZOH C;  4G3X B;  1K8R B;  1MJD A;  4EZL A;  1WXM A;  1UGJ A;  1T0R C;  3GZN B;  1VCB A;  2KYW A;  3BK2 A;  2I38 A;  3NZ3 A;  5D3I B;  1P98 A;  5AEK B;  3H7S A;  3P4P B;  2EKI A;  4N59 A;  1V49 A;  3Q8F A;  1AN8 A;  4ZHP A;  2IGD A;  1QZE A;  2WXO A;  1YQ3 B;  2V3S A;  4JL9 A;  1GAQ B;  1PYW D;  4YL8 A;  5HFY A;  2RR9 A;  3P63 A;  2PIA A;  2D2Q A;  1FXT B;  1WMH B;  2LI5 A;  1YJJ A;  3W5V B;  2C7N B;  2IO3 B;  2J7Q B;  5IKC M;  4K81 A;  1BXT A;  2QSD A;  2K3U A;  4W9E A;  2XEW A;  1M94 A;  2DBY A;  3OJ3 A;  3EC8 A;  2KDE B;  1P0R A;  4I6L B;  2QCZ A;  4ASW C;  3MFG A;  4WAA A;  2OJW A;  5L83 A;  4BKT A;  2N1W A;  1KLG D;  2WX1 A;  3DVN V;  4XC2 A;  2NBU A;  2CJO A;  2RDH A;  3HRD D;  1UD7 A;  1QIL A;  2JZP A;  4RFB A;  3ZYY X;  4J3O D;  3AED B;  2XN9 C;  1JRP A;  2O2V B;  3EEC A;  3ZXV A;  2YEP F;  4FJZ A;  2K5P A;  3ZNG C;  1UWM A;  3DWM A;  1MG4 A;  1WSP A;  1KRH A;  4W9G A;  3X0W A;  2J0K A;  2MA9 B;  3UQB A;  1YJI A;  2M8S A;  3M62 B;  1C4A A;  2UYZ B;  3DWG C;  2N0S B;  3IBE A;  2DAJ A;  4B95 A;  2LD9 A;  3IFW B;  3PVL A;  3RZF A;  2MEK A;  1MG8 A;  2HJ1 A;  3RMK C;  4FUL A;  1V2Y A;  4DWF A;  3SFD B;  1E5W A;  2PMV A;  5D3D A;  4MSQ B;  5AZH A;  1RAX A;  2JVC A;  1I4G A;  4FBJ B;  4LDT B;  5KHO A;  2WXL A;  2MJD A;  1RFK A;  3PRE A;  1AWD A;  4XWW A;  1J8C A;  1ROE A;  3L4P A;  1WGH A;  3RCZ A;  4OHJ A;  2JT4 B;  1LGR A;  4ACF A;  4NAW B;  3IT6 B;  5LXI B;  4A6Q A;  4DK5 A;  4IG7 B;  4WWM A;  2KJ6 A;  2HDE A;  2QMT A;  4MEM A;  3ZDM C;  1NYR A;  2KO3 A;  1N6Z A;  4KSK C;  3VAW A;  5HKH A;  2Q5W D;  3NS8 A;  2MJE A;  1OEY A;  1YN3 A;  4NQK E;  2LUM A;  5J18 A;  1C1Y B;  2D11 A;  4LDT D;  4A3P A;  1VD2 A;  2ON8 A;  2LRW A;  5G5G A;  3SU8 X;  1E0Z A;  4MDK E;  3QC8 B;  2BYE A;  2QHO A;  2IGH A;  1JRO A;  4REZ A;  1WZ0 A;  4WWO A;  3AE3 B;  3NVV A;  2KMA A;  2X38 A;  2NBW B;  4HKZ E;  4BFR A;  1VZ8 A;  3PHX B;  2ZW1 A;  2A4Z A;  1SGH A;  4ANX A;  2IPK D;  3RUI B;  3RD2 A;  2N9L A;  3WAM A;  1HE8 A;  3TBL D;  3QCA A;  2CKH B;  1WXS A;  4RF1 A;  4K3B A;  3WAO A;  2DZK A;  2KJR A;  3EUB 2;  4RGM A;  1AAR A;  1YJ1 A;  3NOB A;  3URY A;  3EGR A;  3VH4 B;  1E8X A;  4CO7 A;  1CJE A;  4BOZ B;  2G9H D;  2VRR B;  3ZRC A;  2JRH A;  1YMH E;  2GBN A;  2KC2 A;  2NTT A;  4KSL C;  4C56 C;  2L05 A;  1FCL A;  3P4S B;  2KMC A;  3C19 A;  3QHT A;  2BB5 A;  1FO4 A;  4WWN A;  5IA7 A;  3DBS A;  4HEA 1;  1YX5 B;  5D2M B;  2PKO A;  1C76 A;  2FIF A;  4LK0 M;  3QX1 A;  4A90 A;  2BWE S;  2KD0 A;  1P7E A;  3TCA A;  2KX3 A;  2ZCB A;  4W9J A;  2CHZ A;  2WNM A;  4ZRK A;  1OFF A;  4B0M A;  2L7R A;  1RLF A;  2RGF A;  1ZKH A;  4GDK A;  3L0W B;  3QA8 A;  4IOI E;  4ZRQ A;  4S17 A;  3N20 C;  2IO0 B;  1SBB B;  3N1X C;  3NZU A;  1K51 A;  3Q14 C;  4W9C A;  4WIP A;  1C78 A;  1R4N I;  1TY2 A;  3V60 A;  4MGZ E;  1GC7 A;  1YQ4 B;  2B76 B;  5E6P A;  3NS1 A;  2G4D B;  2PEA A;  5T8I A;  1Y56 A;  1HTQ A;  1TKE A;  1EWC A;  3R2T A;  3MC0 B;  4B0E A;  1N62 A;  1WWT A;  2N7D A;  3DVG Y;  1TKG A;  4Q2J A;  1SIF A;  4C7Z A;  1RWS A;  1JWS D;  1GPX A;  1WJ6 A;  1JWM D;  1ZP0 B;  2LJ5 A;  1F1H A;  2QDF A;  3LJ3 A;  1PQS A;  1QT9 A;  5H92 C;  1FM0 D;  2NMQ A;  3VUW A;  2G45 B;  3Q8A A;  2IJ0 A;  2J0J A;  4MM3 B;  3KUC B;  1D5Z C;  1RYJ A;  4WH4 A;  2VZK D;  2OHF A;  1NEN B;  4NY0 A;  2LVO A;  2MSE D;  2Z0D B;  2KOX A;  4FXC A;  3MHS D;  2PE6 B;  1WE6 A;  4EEW A;  1KOT A;  2D5G A;  2CJN A;  4ARI A;  3U7D A;  2BWF A;  1GB4 A;  2JUO A;  1TZO A;  1YN5 A;  1T0Y A;  2DWQ A;  2JQR B;  1K53 A;  3NZS A;  3HUI A;  3B0A A;  4BKS A;  2W3R A;  4GDL B;  1WXV A;  5C1Z A;  1WXQ A;  1KLV A;  3VH3 B;  1WXA A;  3OWE B;  4YSY B;  3ONS A;  3VTU A;  5JH5 C;  1ENF A;  4HCP B;  1EF5 A;  3GP7 A;  5C3J B;  4GGQ A;  1XEE A;  2WP9 B;  2JXT A;  1Z5S B;  3VUY A;  3PSE B;  4WJQ A;  5FR6 A;  2KFK A;  5IO9 A;  1FNW A;  4HPL B;  2B3A A;  2D10 A;  1WGD A;  2GBJ A;  2KDI A;  1UBQ A;  1L0Y B;  2OOB B;  3IAS 1;  2V9H A;  3HK0 A;  2WXM A;  4TQ1 A;  4II3 B;  2MH7 A;  2KVZ A;  4KGS A;  2JSV X;  4WQM A;  1TS3 A;  2I1J A;  1WYW B;  1OQR A;  2GLS A;  1HQR D;  3BK1 A;  1FFV A;  1NVI D;  2KDF B;  3A1Q A;  4DBG A;  1VRA B;  4LNK A;  2WDQ B;  5BO4 B;  2ZNV B;  2N4F A;  3QJZ A;  2CU1 A;  1X1M A;  3A1Q B;  4BKS D;  2JRI B;  2N9X A;  3ZLZ A;  2MP2 B;  1V5O A;  4EFO A;  2JZ3 B;  3KH0 A;  3I3T B;  3QK0 A;  2IDY A;  3MJ5 A;  2YLM A;  3BVG A;  4P1B C;  2BGF A;  2BS4 B;  1D4B A;  2N1V A;  1DOY A;  2W54 A;  1HA5 A;  2GMI C;  4P7I A;  2KX0 A;  3DBR B;  2KTR B;  3ZTC A;  1N60 A;  1RFA A;  2FUH B;  1TY0 A;  4K7S A;  4KV2 A;  1JRU A;  3A4S C;  1IGD A;  3GOE A;  4RMA A;  2RDB C;  3R7Q A;  4AJW A;  2XK5 B;  3WAN A;  1NI2 A;  3RNG C;  2BQQ A;  1C9F A;  3U30 A;  2PW9 A;  3B2G A;  1I4Q A;  4GIV A;  3DBH I;  2AL6 A;  2LGI A;  4HKQ A;  4LNO A;  5AZG A;  1EU4 A;  4DHJ B;  3AE1 B;  4DXF A;  1XLN A;  1K50 A;  1C4P A;  2LFI A;  1E90 A;  4HJK A;  4XZ4 A;  4K7W A;  5FK9 C;  2ZJD A;  1C77 A;  2VH1 A;  2M19 A;  1AYF A;  2K6Q A;  1DGJ A;  2KAN A;  1DOX A;  2XBB C;  2DZJ A;  4IC7 B;  3VHT C;  3ZNZ B;  1Q1O A;  3N30 A;  2E6X A;  3AEF B;  3R66 C;  4XX5 A;  1OQY A;  3H8H A;  4MJS A;  4A8X C;  2J0M A;  5GMV A;  2KDB A;  1UBI A;  2IO2 B;  1ESF A;  2JF5 A;  2V3N A;  4CHK A;  3L16 A;  4MJS B;  3ZJT A;  4PS3 A;  3P2B A;  2DYB A;  3U8Z A;  2MX2 A;  3L13 A;  1WR1 A;  2IND C;  3DHG C;  2O6V A;  3DBL B;  3NVY A;  4F8C B;  2KWU B;  4KDL B;  1IYF A;  5EE0 A;  4LJP B;  2BKR B;  2QJL A;  5CX3 A;  3K9O B;  5BYQ A;  4WAF A;  2LXA A;  2AEH A;  3AI5 A;  5FKA C;  4I6N B;  3U7Z A;  3ZKJ C;  1R4M I;  1V81 A;  2INC C;  3DCG A;  4KIK A;  1L5P A;  1LXD A;  2KAC A;  3Q3J A;  3HM6 X;  2KWV B;  1F2R I;  2R2O A;  2WLB A;  5CTR C;  4HVB A;  4JWS C;  1Q5W B;  4P16 A;  1P7F A;  4FA6 A;  2FE8 A;  4LNI A;  3B1L X;  2MBQ A;  2KXJ A;  3VRB B;  1D6E C;  4FJV B;  4NNJ B;  1J0G A;  2V4I B;  3L17 A;  2J52 A;  4GXB A;  4AP4 C;  4PS8 A;  1JCK B;  3P4Q B;  4X57 B;  2MJ3 A;  1FD6 A;  1WX9 A;  3RNE C;  1L6V A;  4G0N B;  2O6V D;  1IP9 A;  1MVK A;  3Q6B A;  3UI3 A;  3J9C A;  1TS4 A;  1YNT E;  4TSS A;  2MBE A;  3FIL A;  2ZZP B;  4IM0 A;  3PRZ A;  2MLB A;  2YEP B;  1ZE3 D;  4K7U A;  1XF5 L;  4LJO B;  3AEG B;  2AQ1 B;  3FIL B;  4WJO A;  4AUQ C;  4BKG A;  3ZDT A;  4KZ0 A;  3TL5 A;  3ZRF A;  3GS2 A;  1GUA B;  2JYT A;  1ZGU B;  2AQ3 B;  3Q69 A;  1SEB D;  5JXV A;  2AWT A;  1NEK B;  3N1Y C;  3RPF C;  4DXG A;  2CS4 A;  3RNF C;  1I4H A;  3VR8 B;  3AEB B;  4ZDV A;  2W82 A;  4W9H A;  2LGY A;  1VJK A;  1VDV A;  2J53 A;  1T5X D;  3N1Z C;  1ZDV A;  3RNC C;  3C0R B;  4JWU C;  2K8C A;  4RM8 A;  3C8Y A;  4KGR A;  2FBW B;  4M01 A;  2KN4 A;  2RDG A;  3RZW C;  4GOC A;  5E6J A;  4LTU A;  4ANU A;  4KGT A;  1P3Q U;  2NPT A;  2JWU A;  2DZM A;  1IPG A;  3ABV B;  3CF6 E;  1OTR B;  3ZVV A;  4YWG G;  1XLO A;  1HEZ E;  1N61 A;  1NDD A;  3UIN B;  1ET9 A;  1I7H A;  1ET6 A;  4HK2 A;  1NYQ A;  2W3S A;  1IUE A;  2JY6 A;  4FAD A;  2I2Y A;  3L08 A;  1C79 A;  1STE A;  3A9J A;  1GOZ A;  4RCO A;  2AYO B;  4N6E B;  1WM2 A;  3WCQ A;  4E3C A;  3T3N A;  2L52 A;  4ITK A;  1E8Y A;  2FCS A;  1N5W A;  1E8W A;  2WXJ A;  3AE8 B;  3PS6 A;  1E9M A;  4PYU A;  3EHV A;  2G1E A;  4IWO A;  2PTL A;  4WJP A;  2W55 A;  2V3P A;  3NVW A;  2WWZ A;  1T0Q C;  4HCN B;  2LVP A;  3ZUN A;  3VDZ A;  2LEK A;  3WIM A;  3W2D A;  3PV1 A;  3DBH B;  3ETR A;  2KVR A;  2IY0 B;  3RN9 C;  3AEC B;  2M4N A;  5IAA C;  4AJY B;  4LCD E;  2OJR A;  4NJC A;  3QAQ A;  1PUT A;  3MHZ A;  3V62 A;  4S0R A;  3R8B A;  1FRD A;  2GBR A;  3SDL C;  2WS3 B;  4YTN B;  2N9P C;  4YSZ B;  2K1F A;  4G50 A;  3KYC D;  2Y5B B;  3SFE B;  2WX0 A;  1TBE A;  1TZ1 A;  2YVC A;  1PDX A;  3W9C B;  1KH0 A;  3V6E B;  1SJH D;  1V1P A;  1LM8 B;  1C3T A;  2RPQ A;  2L1A A;  3A9K A;  4XDC A;  1FPY A;  2WXK A;  5LLI A;  1PGB A;  2IY1 B;  2K25 A;  1TIF A;  3NRZ A;  3A9K B;  2ACZ B;  3T3O A;  3DQV A;  1EU3 A;  1MHX A;  2WDV B;  3PO0 A;  2UWQ A;  5G55 A;  1TTN A;  3KYD D;  2C7M B;  1P1A A;  4B9K A;  1HZ5 A;  4ZHO A;  1ZW7 A;  3ZIM A;  3UF8 A;  3CMM B;  3Q8C A;  2KLG A;  1RM6 C;  4BBN F;  2LAS A;  5C2T B;  1JWA D;  5E6N A;  4CQN A;  3DHH C;  4HPM B;  3APF A;  2KC1 A;  2D3C A;  1GG3 A;  4ARC A;  2INN E;  1MPE A;  4GDK B;  3S2A A;  2NS5 A;  4L1B A;  3CSF A;  2VZK B;  4P1C C;  3GB1 A;  3JVZ X;  3AE5 B;  4O1N A;  1F2R C;  2RPV A;  4DHZ E;  4EE2 A;  1KM7 A;  4J6I A;  2WXR A;  3JW0 X;  3GZN I;  1TGZ B;  4HDQ A;  3PLV A;  3T9L A;  3LXF A;  3Q8B A;  1ACC A;  4HRS A;  4NQL B;  4NJ7 A;  1YD8 U;  1UWX A;  4MGK E;  2IYD B;  3NY5 A;  3TEZ A;  2JWZ A;  2FCM A;  3R2I A;  1SE2 A;  1EF1 A;  2KQS A;  1I4X A;  5HI1 A;  2Z0E B;  4EOY A;  2R61 A;  3FC4 A;  2RMM A;  1DYQ A;  3O65 B;  3PGE A;  2QIE B;  1Q0W B;  4IW0 A;  2KQ4 X;  1WZ3 A;  3OG5 A;  2KN5 A;  3IXS A;  3QAR A;  1S1Q B;  5I4D A;  4PT5 A;  1WM3 A;  5FR3 A;  3KWV A;  3NVZ A;  2JPH A;  1S3S G;  2BVC A;  2KQ7 A;  1TYG B;  4AS1 A;  1J7B A;  2IGG A;  2DHZ A;  2ZPN A;  3Q3N C;  1ZOY B;  1V97 A;  1T0S C;  1MI0 A;  1V1O A;  1XQQ A;  3HVZ A;  2HD5 B;  4MGI E;  3U4E G;  2MRP A;  5BMI A;  4RH6 A;  1SE3 A;  2DEN B;  3I5J C;  5IN7 A;  3D32 A;  1SJE D;  2JYE A;  3VTV A;  1F0Z A;  1NI3 A;  2DLB A;  5G2N A;  4D2K A;  1TS5 A;  1B9R A;  1SIJ A;  3AUL A;  2J4X A;  3MC9 A;  3AE6 B;  2MBB B;  5AUI A;  1WR6 E;  1AW7 A;  2MWS B;  3BZD B;  1VLB A;  3IVF A;  2K9X A;  3H7P A;  3N3K B;  1QOA A;  2ZVO A;  1Y8R C;  1L6U A;  3W1S C;  2KFK B;  2AQ2 B;  2A5U A;  1I42 A;  2C7H A;  4F7Z A;  1C4C A;  4B6W A;  3P42 A;  4TUU A;  5GXG B;  1ZXH A;  3N32 A;  4FN2 A;  2D3G A;  4IUM B;  4HPP A;  1EUV B;  2KMM A;  3MC8 A;  2SEB D;  4WUR A;  2KHW B;  1WI0 A;  4YXD B;  3ZO5 B;  3KLS X;  3PTF C;  5CHV C;  3SD5 A;  2REX A;  4WQO B;  3IG3 A;  4W9I A;  1Q10 A;  2KWD A;  3APC A;  1V80 A;  1I4P A;  2QIL A;  3Q3M C;  3NHE B;  3ML8 A;  3PT2 B;  2WXI A;  2WXH A;  1ZXI A;  3V61 A;  3JSV A;  1PFD A;  2DZI A;  2EMT A;  1SXT A;  3RNB C;  4XYC A;  1U4A A;  3NG0 A;  4JQW C;  1TT5 B;  1UUP A;  3NUH B;  2WQY B;  4AOF A;  1QLB B;  1VR9 A;  1N5X A;  2H89 B;  2WXP A;  1ZPS A;  2RSU A;  2L3Z A;  2MHJ A;  3A4R A;  1E7P B;  1J7A A;  1H4R A;  4IWQ A;  2LXC A;  2Y5C A;  2PLP A;  1WY8 A;  1K52 A;  1V6E A;  4HRO A;  4BVU C;  1T3Q A;  2C9W B;  2FNJ B;  4BZA A;  4CYE A;  4W9F A;  2CHX A;  3WAL A;  1UZX B;  1FXA A;  2MQJ A;  4A55 A;  1FNU A;  4JLC A;  3K9P B;  3BYY B;  5EE9 A;  1WJ4 A;  3VFK A;  2BYT A;  3T8M A;  3TEX A;  4IKG A;  2K22 A;  2BS2 B;  2M0A A;  3U2S C;  1QOG A;  2L0T A;  1XCQ L;  3KVF B;  4OZB A;  4P6V F;  3AM9 A;  3H1U A;  2MBH A;  3CWI A;  2LWP A;  2WDR B;  3W1Y A;  2ZW0 A;  4NPN A;  1FEH A;  1EWY C;  2O6V B;  5EE3 A;  2KK8 A;  4NJ6 A;  4XDD A;  2K39 A;  1QQR A;  3HIZ A;  1J7C A;  5DPT A;  1SE4 A;  3V3X A;  3B2F A;  2L76 A;  1YN4 A;  1D5X C;  2CU3 A;  1R4N B;  2BTE A;  2R2Q A;  5AUK A;  1CZP A;  3MJW A;  4JPS A;  4W9L A;  5DPW A;  4YSX B;  1V8C A;  2H88 B;  1HXY D;  3O13 A;  3VUX A;  3BVM A;  1PGX A;  3ENE A;  1E10 A;  1KTK A;  4KIK B;  2JX5 A;  2PVG C;  4ZRJ A;  3TJP A;  1UH6 A;  2IO1 B;  2NVU I;  5G5H A;  1TJE A;  1KF6 B;  1WJU A;  2M0X A;  4ZRI A;  1E6E B;  2FCQ A;  1NBF C;  2WXQ A;  4GU2 A;  5JHB A;  1UNS A;  1D3Z A;  2ZCC A;  4USA A;  3DPD A;  1T6B X;  1CMX B;  4L2Y A;  4PK1 A;  1YIW A;  1WH3 A;  5BMG A;  1WMH A;  2I1K A;  2WU5 B;  3L10 B;  4K1R B;  5LNK 1;  4C80 A;  3OJ4 B;  1SF0 A;  2N7J A;  2C5L C;  2JZZ A;  3EFC A;  1XXG A;  1JWB D;  3PHW B;  5DCN A;  3E9S A;  4ANV A;  3HVD A;  2NBV B;  3AE2 B;  1UEL A;  3IT4 B;  2ZPY A;  1V9J A;  1EO6 A;  3UIP B;  1ZDX A;  3PZD A;  2KLC A;  4OW0 A;  5HHD G;  2GBK A;  3ZNH B;  2BS3 B;  4ZYS A;  4XGA B;  4WWP A;  2DAF A;  4ZRP A;  4JIO U;  3GE3 C;  2V1Y A;  2BBC A;  3CST A;  1WE7 A;  2INP E;  2GBM A;  5D6J B;  1KFY B;  3UGB B;  4YT0 B;  1CK1 A;  3TEY A;  3PRM B;  2L83 A;  1V86 A;  3QIJ A;  2KNB A;  2O2V A;  3APD A;  3RYT A;  1L4Z B;  1OGW A;  1OQQ A;  2ICI A;  4PS7 A;  3UQA A;  2CHW A;  4UDU C;  3R3M A;  2V4L A;  3AEA B;  5JZE B;  2BT6 A;  3PRP B;  4GN1 A;  1P9D U;  3QQ8 B;  2LZ6 A;  1FCC C;  2HTH A;  4TQ0 A;  2K6D B;  4KVG B;  5J2R A;  4F1S A;  2D3A A;  2MW5 A;  3SR6 A;  5J17 A;  1RRB A;  4IWP A;  4JE3 B;  2WXG A;  3ZNI D;  1M4V A;  5BYS A;  3B08 A;  1JAL A;  2K8B A;  4A9A A;  1GJZ A;  2GOW A;  2JXX A;  3Q2A C;  1LO5 D;  4K3C A;  5JHA A;  4LNN A;  3BVZ A;  1WGG A;  3I9V 1;  4TV3 A;  5H8Y E;  2KDM A;  3SEB A;  2X8X X;  1XD3 B;  2NPT B;  4NAW A;  3BWU D;  2EKE C;  3BY4 B;  2ZVN A;  2PJH A;  1WYG A;  1WJN A;  3AEE B;  4G11 A;  1B1Z A;  2LGS A;  2KAJ A;  3KUZ A;  2V0G A;  1F52 A;  2M1M A;  4QAY A;  2Z8L A;  3A33 B;  1YQB A;  3A9J B;  3BIN A;  4N9F 4;  3V6C B;  4YTM B;  1WX7 A;  3LYY A;  2DX5 B;  4FHJ A;  1A70 A;  2D07 B;  3U52 E;  4TMA B;  2OED A;  4LLG M;  3M95 A;  4HJG E;  1F9J A;  2WU2 B;  4A3O A;  2DYO A;  5EDS A;  2CR5 A;  2N9K A;  2LMC A;  2SAK A;  2ZEQ A;  3DBR I;  4R3D A;  3ZQ4 A;  2JU6 X;  5DPR A;  5C23 A;  4EZJ A;  4FLH A;  1XLP A;  2HJ8 A;  1CQV A;  1QOB A;  4HWI B;  3GE8 C;  5TSS A;  2BW2 A;  4AQ7 A;  4YTP B;  3RNA C;  1XLQ A;  2WGS A;  3TIX A;  2NTS A;  4OZC A;  3ML9 A;  3DHI C;  4BBN C;  2M17 A;  2ONQ A;  3KQ4 A;  2KJH B;  1H8C A;  4H2A A;  1WGY A;  1Z2M A;  1V1P B;  3RFZ B;  3ZJV A;  1SE9 A;  3H9D A;  3VR9 B;  2LJI A;  1L0X B;  2LUE A;  3P4R B;  4RM9 A;  5CHF A;  3OAW A;  4IDI A;  3HHM A;  1FFU A;  1L2N A;  3EA6 A;  3ECI A;  3PLU A;  2KT7 A;  3RI7 C;  4RNA A;  3R7R A;  1SSN A;  5E6O A;  3ZGZ A;  3AN1 A;  2LGX A;  1YX6 B;  4KKJ A;  1GB1 A;  2BKF A;  3W5U B;  2M56 B;  4MEL A;  4ICU A;  3SHQ A;  2FUG 1;  5D94 A;  2FAZ A;  3AMZ A;  4M0W A;  4EKU A;  3LB8 C;  5TR5 A;  2WHI A;  4A20 A;  3DBL I;  2L8J A;  1IGC A;  1R4M B;  4M0W B;  4US9 A;  5CHW A;  3RT3 B;  4FHK A;  4GLS C;  1JW9 D;  3QWZ B;  2GI9 A;  4M8M A;  1PGA A;  1WFY A;  4DQO C;  4W9D A;  2WYQ A;  3AU5 A;  1FNV A;  1VZ7 A;  2WDT B;  4KZC A;  2MBO A;  4JX1 C;  1KJT A;  3AE9 B;  2PPH A;  1JQ4 A;  3JYU A;  3FAH A;  5HG2 A;  3M3J A;  3WAP A;  3M63 B;  3PPA A;  3VQI A;  5D7G A;  1MFW A;  3Q3O C;  2TSS A;  1DOI A;  1MHH E;  2EEL A;  5IOI A;  4OVU A;  4HLE A;  1BT0 A;  4MH8 A;  5LXH A;  2VH2 A;  3BII D;  1V5T A;  2BPS A;  3DVG X;  1XCT L; 
#chains in the Genus database with same CATH homology
 2O6V D;  3DOW A;  4MDK E;  1U4A A;  4ANW A;  3QC8 B;  1IP9 A;  2BYE A;  2HE7 A;  4JQW C;  2QHO A;  1XT9 B;  2N7E A;  4FJY A;  4AOF A;  4MM3 A;  1WZ0 A;  2MBE A;  2RSU A;  4WWO A;  1WRD B;  4BOS C;  2ZZP B;  2L3Z A;  3PRZ A;  4IM0 A;  2KMA A;  2MLB A;  2NBW B;  4BFR A;  4W9K A;  4K7U A;  4M8N A;  3HM3 A;  3PHX B;  2G3Q B;  1LFD A;  3A4R A;  4LJO B;  1H4R A;  2A4Z A;  4GSW A;  4IWQ A;  1SGH A;  2LXC A;  4ANX A;  4WJO A;  1A5R A;  1WY8 A;  4KDI C;  3RUI B;  4AUQ C;  3RD2 A;  3WAM A;  1HE8 A;  3TBL D;  3QCA A;  4BKG A;  1V6E A;  4BVU C;  3ZDT A;  4JGH B;  2CKH B;  1WXS A;  4DDI D;  2C9W B;  4KZ0 A;  3TL5 A;  3WAO A;  2FNJ B;  1I35 A;  3ZRF A;  1E7U A;  2DZK A;  4OVV A;  2KJR A;  4CYE A;  4W9F A;  1GUA B;  3ZTD A;  1L7Y A;  2CHX A;  3WAL A;  1AAR A;  1YJ1 A;  3NOB A;  4I6P A;  1WF9 A;  4GDL A;  1UZX B;  1LQB A;  2MQJ A;  1ZGU B;  3VH4 B;  5DPS A;  1E8X A;  4CO7 A;  4BOZ B;  4JLC A;  2VRR B;  3KW5 B;  3ZRC A;  3K9P B;  2AWT A;  2JRH A;  5AZF A;  3OLM D;  3AXC A;  2GBN A;  3LDZ E;  2KC2 A;  4KSL C;  2CS4 A;  2L05 A;  3RUL A;  1WJ4 A;  1WGR A;  3VFK A;  4MSM B;  2EMS A;  3W1S A;  3T8M A;  2K8H A;  2LGD A;  4ZDV A;  1ISN A;  2G4S A;  4W9H A;  2KMC A;  2LGY A;  3QHT A;  4WJN A;  4WWN A;  3DBS A;  4HXD A;  2L0T A;  1YX5 B;  5IA7 A;  3KVF B;  3H1U A;  5D2M B;  4IM3 A;  2MBH A;  3C0R B;  2FIF A;  2K8C A;  3H7P B;  4RM8 A;  1GNU A;  2LWP A;  3QX1 A;  3W1Y A;  4NPN A;  2BWE S;  3KUD B;  2KD0 A;  3RZW C;  2KX3 A;  3TCA A;  2O6V B;  4GOC A;  2KK8 A;  2ZCB A;  4NJ6 A;  4ANU A;  4W9J A;  2CHZ A;  2LRU A;  2K39 A;  4ZRK A;  3HIZ A;  2KWC A;  2L7R A;  1P3Q U;  1RLF A;  2RGF A;  5DPT A;  4ZYN A;  1ZKH A;  2NPT A;  2DZM A;  1IPG A;  4GDK A;  3UIO B;  3VXW A;  2L76 A;  3L0W B;  3CF6 E;  3QA8 A;  4E71 A;  2R2Q A;  4EUT A;  2Z59 B;  2IO0 B;  1OTR B;  3NZU A;  3ZVV A;  4DHZ B;  4W9C A;  4AWJ A;  3MJW A;  1NDD A;  2PE9 A;  2L00 B;  2ZNV C;  4W9L A;  3UIN B;  5DPW A;  1R4N I;  3V60 A;  4MH0 E;  2FCN A;  4HK2 A;  5KHQ A;  3X23 A;  2KTF A;  3VUX A;  4MGZ E;  2L0F A;  2MP2 A;  3ENE A;  2JY6 A;  4FAD A;  1J19 A;  1GC7 A;  2BYV E;  4KIK B;  3L08 A;  4ZRJ A;  5E6P A;  1UH6 A;  2IO1 B;  3TJP A;  2NVU I;  3A9J A;  3L54 A;  1WJU A;  2G4D B;  2M0X A;  3ALB A;  4DXA B;  2PEA A;  4ZRI A;  2FCQ A;  2AYO B;  1NBF C;  4GU2 A;  1WM2 A;  5JHB A;  1WIA A;  4E3C A;  1D3Z A;  2ZCC A;  3DPD A;  2KTR A;  1E8Y A;  3Q3F A;  3DDC B;  1CMX B;  2FCS A;  4II2 B;  1E8W A;  2N7D A;  2KZR A;  1YIW A;  1WH3 A;  4URK A;  1WMH A;  3PS6 A;  2I1K A;  4PYU A;  3DVG Y;  3EHV A;  3L10 B;  5L95 C;  1SIF A;  4IWO A;  2XK5 A;  4K1R B;  2DYM A;  3VVW B;  4WJP A;  1WJ6 A;  3JSV B;  3OJ4 B;  2WWZ A;  2LJ5 A;  2C5L C;  2LVP A;  4HCN B;  3ZUN A;  1G6J A;  2JZZ A;  3VDZ A;  3LJ3 A;  1PQS A;  3WIM A;  3PV1 A;  3PHW B;  5DCN A;  2C60 A;  4ANV A;  3VUW A;  2NBV B;  2G45 B;  2KVR A;  2IY0 B;  2AL3 A;  1UEL A;  2J0J A;  2IBI B;  2M4N A;  5IAA C;  2ZPY A;  4LCD E;  2OJR A;  3IHP C;  4AJY B;  4E74 A;  1V9J A;  1EO6 A;  1E7V A;  3KUC B;  3UIP B;  3PZD A;  3QAQ A;  2KLC A;  2N9E B;  3V62 A;  4NY0 A;  2LVO A;  2MSE D;  2Z0D B;  2KOX A;  2GBK A;  2GBR A;  3SDL C;  3MHS D;  2PE6 B;  2MCN B;  2BYF A;  3ZNH B;  3VTW A;  4WWP A;  1WE6 A;  4EEW A;  2DAF A;  1KOT A;  4JIO U;  1UGM A;  2N9P C;  3U7D A;  2V1Y A;  2BWF A;  2K1F A;  3CST A;  1WE7 A;  4G50 A;  2GBM A;  3KYC D;  4EZK A;  3EFU A;  5D6J B;  2Y5B B;  3UGB B;  3PRM B;  2JUO A;  1V86 A;  2WX0 A;  1TBE A;  1TZ1 A;  3DVN U;  2YVC A;  4DDG D;  1T0Y A;  4IM2 A;  3NZS A;  3V6E B;  3QIJ A;  2KNB A;  1LM8 B;  2KKC A;  2O2V A;  3AU4 A;  1C3T A;  3APD A;  3RYT A;  3B0A A;  1OGW A;  4BKS A;  1E8Z A;  4PS7 A;  2NCN A;  2RPQ A;  3UQA A;  2CHW A;  3R3M A;  2V4L A;  1WXV A;  3A9K A;  4GDL B;  5C1Z A;  1KLV A;  3VH3 B;  1WXA A;  5JZE B;  3ONS A;  3PRP B;  5LLI A;  4GN1 A;  1P9D U;  3QQ8 B;  2LZ6 A;  3WA0 A;  3VTU A;  2ASQ A;  5JH5 C;  2IY1 B;  4TKN A;  4HCP B;  2K25 A;  1EF5 A;  2BF8 B;  2HTH A;  2NR2 A;  4MGY E;  4TQ0 A;  4GGQ A;  4GB9 A;  2K6D B;  3A9K B;  3DQV A;  4KVG B;  5J2R A;  4F1S A;  3MTN B;  2UWQ A;  5G55 A;  2IZV B;  1Z5S B;  2MW5 A;  3VUY A;  3PSE B;  4ICV A;  4WJQ A;  4PYZ A;  3H6N A;  3TMP B;  5FR6 A;  2KFK A;  1TTN A;  5J17 A;  1RRB A;  3KYD D;  4IWP A;  2C7M B;  1P1A A;  4HDO A;  4B9K A;  4HPL B;  3ZNI D;  2B3A A;  1WX8 A;  1WGD A;  2D10 A;  2GBJ A;  1UBQ A;  2KDI A;  2KFJ A;  2OOB B;  1ZW7 A;  3HK0 A;  3B08 A;  3ZIM A;  2K8B A;  3UF8 A;  4TQ1 A;  4DHJ D;  3CMM B;  1GC6 A;  4II3 B;  4B95 A;  1GJZ A;  2GOW A;  2JXX A;  2W9N A;  2KLG A;  4BBN F;  2LAS A;  1OEY J;  2FID A;  2I1J A;  1WYW B;  5JHA A;  5E6N A;  1WGG A;  2RD0 A;  2LVQ A;  4TV3 A;  3APF A;  4HPM B;  4GMV A;  2KC1 A;  3ZW3 A;  4G3X B;  1GG3 A;  1K8R B;  4EZL A;  2KDF B;  3A1Q A;  1XD3 B;  4DBG A;  2NPT B;  1WXM A;  4NAW A;  4GDK B;  3S2A A;  2NS5 A;  5BO4 B;  3CSF A;  2ZNV B;  2N4F A;  3JVZ X;  2EKE C;  3BY4 B;  3QJZ A;  1VCB A;  2ZVN A;  2PJH A;  2CU1 A;  1X1M A;  3A1Q B;  1WJN A;  4DHZ E;  1KM7 A;  4G11 A;  4J6I A;  4BKS D;  2JRI B;  3JW0 X;  3GZN I;  3KUZ A;  1TGZ B;  2N9X A;  4HDQ A;  2M1M A;  3PLV A;  3ZLZ A;  3T9L A;  2MP2 B;  1P98 A;  1V5O A;  5AEK B;  4EFO A;  2JZ3 B;  3KH0 A;  3H7S A;  3I3T B;  3QK0 A;  3A33 B;  1YQB A;  4NQL B;  4NJ7 A;  2YLM A;  1YD8 U;  1V49 A;  3A9J B;  2BGF A;  3BIN A;  4N9F 4;  2N1V A;  3V6C B;  4MGK E;  1WX7 A;  2IYD B;  3NY5 A;  2DX5 B;  2FCM A;  2JWZ A;  4FHJ A;  1QZE A;  1EF1 A;  2D07 B;  2KQS A;  2Z0E B;  4EOY A;  2GMI C;  4P7I A;  3O65 B;  2V3S A;  2KX0 A;  2KTR B;  4JL9 A;  4YL8 A;  3ZTC A;  3M95 A;  1F9J A;  2RR9 A;  1RFA A;  2FUH B;  4A3O A;  3PGE A;  2D2Q A;  2DYO A;  4K7S A;  1FXT B;  4KV2 A;  5EDS A;  1JRU A;  1WMH B;  3A4S C;  3GOE A;  1Q0W B;  4RMA A;  2CR5 A;  4IW0 A;  4G0N B;  2LI5 A;  3R7Q A;  1WZ3 A;  2ZEQ A;  2KN5 A;  3DBR I;  2C7N B;  2XK5 B;  4AJW A;  2IO3 B;  3WAN A;  1NI2 A;  2J7Q B;  3QAR A;  4K81 A;  1S1Q B;  5DPR A;  5C23 A;  4EZJ A;  3U30 A;  4FLH A;  4W9E A;  2HJ8 A;  1M94 A;  2XEW A;  1WM3 A;  3DBH I;  4GIV A;  2JPH A;  2AL6 A;  5AZG A;  1S3S G;  3OJ3 A;  2KQ7 A;  3EC8 A;  2KDE B;  4DHJ B;  4HWI B;  1P0R A;  4I6L B;  4ASW C;  1E90 A;  4HJK A;  4XZ4 A;  4K7W A;  2DHZ A;  4WAA A;  2ZJD A;  5L83 A;  2ZPN A;  4BKT A;  2N1W A;  2WX1 A;  2K6Q A;  3DVN V;  4XC2 A;  2KAN A;  2XBB C;  1XQQ A;  2HD5 B;  4MGI E;  2NBU A;  2DZJ A;  2MRP A;  4IC7 B;  3TIX A;  3VHT C;  1UD7 A;  3ZNZ B;  1Q1O A;  3N30 A;  2DEN B;  3ML9 A;  4BBN C;  2M17 A;  3D32 A;  2KJH B;  1H8C A;  3VTV A;  1WGY A;  1Z2M A;  5G2N A;  1SE9 A;  3H9D A;  2O2V B;  3EEC A;  3R66 C;  4XX5 A;  4FJZ A;  3ZNG C;  2LUE A;  1OQY A;  3AUL A;  4RM9 A;  4MJS A;  5CHF A;  3OAW A;  3HHM A;  2J0M A;  2MBB B;  5GMV A;  4W9G A;  1L2N A;  2KDB A;  1WR6 E;  3X0W A;  1UBI A;  2J0K A;  2IO2 B;  3ECI A;  2MWS B;  2MA9 B;  3PLU A;  3UQB A;  2M8S A;  3M62 B;  2JF5 A;  4CHK A;  3R7R A;  2UYZ B;  3IVF A;  3L16 A;  5E6O A;  3IBE A;  4MJS B;  2DAJ A;  3H7P A;  3P2B A;  2DYB A;  2LD9 A;  3IFW B;  3N3K B;  4PS3 A;  3U8Z A;  2LGX A;  1YX6 B;  2MX2 A;  2ZVO A;  3PVL A;  3RZF A;  3L13 A;  1MG8 A;  1Y8R C;  1WR1 A;  2BKF A;  3W1S C;  2KFK B;  4FUL A;  1V2Y A;  4DWF A;  2A5U A;  1E5W A;  2O6V A;  4MEL A;  1I42 A;  4ICU A;  2C7H A;  3SHQ A;  5D94 A;  4F7Z A;  5AZH A;  4MSQ B;  2FAZ A;  1RAX A;  2JVC A;  4B6W A;  4EKU A;  2KWU B;  5TR5 A;  4F8C B;  4TUU A;  4FBJ B;  4KDL B;  1IYF A;  4LDT B;  4A20 A;  3DBL I;  5KHO A;  3N32 A;  2L8J A;  4LJP B;  2BKR B;  4FN2 A;  2D3G A;  3PRE A;  4IUM B;  3K9O B;  5CX3 A;  1J8C A;  4M0W B;  1WGH A;  1EUV B;  2LXA A;  2AEH A;  3AI5 A;  5CHW A;  3RT3 B;  4FHK A;  3RCZ A;  2KHW B;  4I6N B;  3QWZ B;  3ZKJ C;  4M8M A;  2JT4 B;  1R4M I;  1WFY A;  1WI0 A;  4NAW B;  4W9D A;  2WYQ A;  1V81 A;  3DCG A;  3ZO5 B;  4KIK A;  3AU5 A;  5LXI B;  2WDT B;  4KZC A;  3PTF C;  4IG7 B;  1LXD A;  4DK5 A;  2MBO A;  3Q3J A;  5CHV C;  1KJT A;  3SD5 A;  3HM6 X;  2KWV B;  2REX A;  4WQO B;  2PPH A;  3IG3 A;  4W9I A;  2R2O A;  5CTR C;  4HVB A;  2KJ6 A;  3APC A;  4MEM A;  3ZDM C;  1Q5W B;  1V80 A;  3JYU A;  2KO3 A;  3M3J A;  4FA6 A;  3WAP A;  3M63 B;  3B1L X;  2MBQ A;  4KSK C;  2KXJ A;  3PPA A;  3VQI A;  4FJV B;  5D7G A;  3NHE B;  3ML8 A;  4NNJ B;  1J0G A;  3VAW A;  5HKH A;  3L17 A;  3NS8 A;  3PT2 B;  1OEY A;  4GXB A;  4AP4 C;  4OVU A;  4HLE A;  1BT0 A;  4NQK E;  4PS8 A;  4X57 B;  5LXH A;  3V61 A;  1WX9 A;  3JSV A;  5J18 A;  1C1Y B;  2D11 A;  2DZI A;  1V5T A;  2BPS A;  2EMT A;  3DVG X;  4LDT D;  1VD2 A;  4A3P A;  2LRW A;  3SU8 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...