5CXLA

Crystal structure of rtx domain block v of adenylate cyclase toxin from bordetella pertussis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
148
structure length
148
Chain Sequence
GSARDDVLIGDAGANVLNGLAGNDVLSGGAGDDVLLGDEGSDLLSGDAGNDDLFGGQGDDTYLFGVGYGHDTIYESGGGHDTIRINAGADQLWFARQGNDLEIRILGTDDALTVHDWYRDADHRVEIIHAANQAVDQAGIEKLVEAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional hemolysin/adenylate cyclase
publication title Calcium-Driven Folding of RTX Domain beta-Rolls Ratchets Translocation of RTX Proteins through Type I Secretion Ducts.
pubmed doi rcsb
source organism Bordetella pertussis (strain tohama i / atcc baa-589 / nctc 13251)
molecule tags Toxin
total genus 47
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 5cxlA00
5D7WA 1OMJA 4I35A 3WP8A 3A70A 3LAAA 1GO8P 1P9HA 2ML2A 2YO1A 1OM7A 3A6ZA 3U1RA 2YO0A 1SMPA 2Z8XA 5CVWA 3ULTA 2ZVDA 3HDAP 1K7QA 1OM8A 3S6LA 1O0TA 3HBVP 1O0QA 3VI1A 3NTNA 2Z8ZA 2ZJ7A 1AKLA 1H71P 2AGMA 1JIWP 2QUBA 1SRPA 1K7IA 2ZJ6A 5CXLA 1K7GA 3HB2P 2XQHA 3LA9A 1GO7P 1AF0A 1G9KA 1OM6A 1SATA 2QUAA 3HBUP 1KAPP
chains in the Genus database with same CATH superfamily
5D7WA 1OMJA 4I35A 3WP8A 3A70A 3LAAA 1GO8P 4DT5A 1P9HA 2ML2A 2YO1A 1OM7A 3A6ZA 3U1RA 2YO0A 1SMPA 2Z8XA 5CVWA 3ULTA 2ZVDA 3HDAP 1K7QA 1OM8A 3S6LA 1O0TA 3HBVP 1O0QA 3VI1A 3NTNA 2Z8ZA 2ZJ7A 1AKLA 1H71P 2AGMA 1JIWP 2QUBA 1SRPA 1K7IA 2ZJ6A 5CXLA 1K7GA 3HB2P 2XQHA 3LA9A 1GO7P 1AF0A 1G9KA 1OM6A 1SATA 2QUAA 3HBUP 1KAPP
chains in the Genus database with same CATH topology
5D7WA 1OMJA 4I35A 3WP8A 3A70A 3LAAA 1GO8P 1P9HA 2ML2A 2YO1A 1OM7A 3A6ZA 3U1RA 2YO0A 1SMPA 2Z8XA 5CVWA 3ULTA 2ZVDA 3HDAP 1K7QA 1OM8A 3S6LA 1O0TA 3HBVP 1O0QA 3VI1A 3NTNA 2Z8ZA 2ZJ7A 1AKLA 1H71P 2AGMA 1JIWP 2QUBA 1SRPA 1K7IA 2ZJ6A 5CXLA 1K7GA 3HB2P 2XQHA 3LA9A 1GO7P 1AF0A 1G9KA 1OM6A 1SATA 2QUAA 3HBUP 1KAPP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D7W A;  1OMJ A;  4I35 A;  3WP8 A;  3A70 A;  3LAA A;  1GO8 P;  1P9H A;  2ML2 A;  2YO1 A;  1OM7 A;  3A6Z A;  3U1R A;  2YO0 A;  1SMP A;  2Z8X A;  5CVW A;  3ULT A;  2ZVD A;  3HDA P;  1K7Q A;  1OM8 A;  3S6L A;  1O0T A;  3HBV P;  1O0Q A;  3VI1 A;  3NTN A;  2Z8Z A;  2ZJ7 A;  1AKL A;  1H71 P;  2AGM A;  1JIW P;  2QUB A;  1SRP A;  1K7I A;  2ZJ6 A;  5CXL A;  1K7G A;  3HB2 P;  2XQH A;  3LA9 A;  1GO7 P;  1AF0 A;  1G9K A;  1OM6 A;  1SAT A;  2QUA A;  3HBU P;  1KAP P; 
#chains in the Genus database with same CATH topology
 5D7W A;  1OMJ A;  4I35 A;  3WP8 A;  3A70 A;  3LAA A;  1GO8 P;  4DT5 A;  1P9H A;  2ML2 A;  2YO1 A;  1OM7 A;  3A6Z A;  3U1R A;  2YO0 A;  1SMP A;  2Z8X A;  5CVW A;  3ULT A;  2ZVD A;  3HDA P;  1K7Q A;  1OM8 A;  3S6L A;  1O0T A;  3HBV P;  1O0Q A;  3VI1 A;  3NTN A;  2Z8Z A;  2ZJ7 A;  1AKL A;  1H71 P;  2AGM A;  1JIW P;  2QUB A;  1SRP A;  1K7I A;  2ZJ6 A;  5CXL A;  1K7G A;  3HB2 P;  2XQH A;  3LA9 A;  1GO7 P;  1AF0 A;  1G9K A;  1OM6 A;  1SAT A;  2QUA A;  3HBU P;  1KAP P; 
#chains in the Genus database with same CATH homology
 5D7W A;  1OMJ A;  4I35 A;  3WP8 A;  3A70 A;  3LAA A;  1GO8 P;  1P9H A;  2ML2 A;  2YO1 A;  1OM7 A;  3A6Z A;  3U1R A;  2YO0 A;  1SMP A;  2Z8X A;  5CVW A;  3ULT A;  2ZVD A;  3HDA P;  1K7Q A;  1OM8 A;  3S6L A;  1O0T A;  3HBV P;  1O0Q A;  3VI1 A;  3NTN A;  2Z8Z A;  2ZJ7 A;  1AKL A;  1H71 P;  2AGM A;  1JIW P;  2QUB A;  1SRP A;  1K7I A;  2ZJ6 A;  5CXL A;  1K7G A;  3HB2 P;  2XQH A;  3LA9 A;  1GO7 P;  1AF0 A;  1G9K A;  1OM6 A;  1SAT A;  2QUA A;  3HBU P;  1KAP P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...