5CXLA

Crystal structure of rtx domain block v of adenylate cyclase toxin from bordetella pertussis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
148
structure length
148
Chain Sequence
GSARDDVLIGDAGANVLNGLAGNDVLSGGAGDDVLLGDEGSDLLSGDAGNDDLFGGQGDDTYLFGVGYGHDTIYESGGGHDTIRINAGADQLWFARQGNDLEIRILGTDDALTVHDWYRDADHRVEIIHAANQAVDQAGIEKLVEAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional hemolysin/adenylate cyclase
publication title Calcium-Driven Folding of RTX Domain beta-Rolls Ratchets Translocation of RTX Proteins through Type I Secretion Ducts.
pubmed doi rcsb
source organism Bordetella pertussis (strain tohama i / atcc baa-589 / nctc 13251)
molecule tags Toxin
total genus 47
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 5cxlA00
1OM7A 1JIWP 5D7WA 2Z8XA 1O0TA 2YO1A 3HB2P 2AGMA 2ZVDA 2QUAA 2Z8ZA 3NTNA 1GO8P 2ZJ7A 1O0QA 1G9KA 4I35A 3HDAP 1K7QA 2YO0A 3VI1A 1H71P 1SATA 2QUBA 1OM8A 3ULTA 2XQHA 3S6LA 1AKLA 3LA9A 1K7GA 1OMJA 2ML2A 3HBUP 3A6ZA 3U1RA 1AF0A 3WP8A 1SMPA 1P9HA 3HBVP 5CXLA 3LAAA 1KAPP 5CVWA 1SRPA 3A70A 2ZJ6A 1K7IA 1GO7P 1OM6A
chains in the Genus database with same CATH superfamily
1OM7A 1JIWP 5D7WA 2Z8XA 1O0TA 2YO1A 3HB2P 2AGMA 2ZVDA 2QUAA 2Z8ZA 3NTNA 1GO8P 4DT5A 2ZJ7A 1O0QA 1G9KA 4I35A 3HDAP 1K7QA 2YO0A 3VI1A 1H71P 1SATA 2QUBA 1OM8A 3ULTA 2XQHA 3S6LA 1AKLA 3LA9A 1K7GA 1OMJA 2ML2A 3HBUP 3A6ZA 3U1RA 1AF0A 3WP8A 1SMPA 1P9HA 3HBVP 5CXLA 3LAAA 1KAPP 5CVWA 1SRPA 3A70A 2ZJ6A 1K7IA 1GO7P 1OM6A
chains in the Genus database with same CATH topology
1OM7A 1JIWP 5D7WA 2Z8XA 1O0TA 2YO1A 3HB2P 2AGMA 2ZVDA 2QUAA 2Z8ZA 3NTNA 1GO8P 2ZJ7A 1O0QA 1G9KA 4I35A 3HDAP 1K7QA 2YO0A 3VI1A 1H71P 1SATA 2QUBA 1OM8A 3ULTA 2XQHA 3S6LA 1AKLA 3LA9A 1K7GA 1OMJA 2ML2A 3HBUP 3A6ZA 3U1RA 1AF0A 3WP8A 1SMPA 1P9HA 3HBVP 5CXLA 3LAAA 1KAPP 5CVWA 1SRPA 3A70A 2ZJ6A 1K7IA 1GO7P 1OM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OM7 A;  1JIW P;  5D7W A;  2Z8X A;  1O0T A;  2YO1 A;  3HB2 P;  2AGM A;  2ZVD A;  2QUA A;  2Z8Z A;  3NTN A;  1GO8 P;  2ZJ7 A;  1O0Q A;  1G9K A;  4I35 A;  3HDA P;  1K7Q A;  2YO0 A;  3VI1 A;  1H71 P;  1SAT A;  2QUB A;  1OM8 A;  3ULT A;  2XQH A;  3S6L A;  1AKL A;  3LA9 A;  1K7G A;  1OMJ A;  2ML2 A;  3HBU P;  3A6Z A;  3U1R A;  1AF0 A;  3WP8 A;  1SMP A;  1P9H A;  3HBV P;  5CXL A;  3LAA A;  1KAP P;  5CVW A;  1SRP A;  3A70 A;  2ZJ6 A;  1K7I A;  1GO7 P;  1OM6 A; 
#chains in the Genus database with same CATH topology
 1OM7 A;  1JIW P;  5D7W A;  2Z8X A;  1O0T A;  2YO1 A;  3HB2 P;  2AGM A;  2ZVD A;  2QUA A;  2Z8Z A;  3NTN A;  1GO8 P;  4DT5 A;  2ZJ7 A;  1O0Q A;  1G9K A;  4I35 A;  3HDA P;  1K7Q A;  2YO0 A;  3VI1 A;  1H71 P;  1SAT A;  2QUB A;  1OM8 A;  3ULT A;  2XQH A;  3S6L A;  1AKL A;  3LA9 A;  1K7G A;  1OMJ A;  2ML2 A;  3HBU P;  3A6Z A;  3U1R A;  1AF0 A;  3WP8 A;  1SMP A;  1P9H A;  3HBV P;  5CXL A;  3LAA A;  1KAP P;  5CVW A;  1SRP A;  3A70 A;  2ZJ6 A;  1K7I A;  1GO7 P;  1OM6 A; 
#chains in the Genus database with same CATH homology
 1OM7 A;  1JIW P;  5D7W A;  2Z8X A;  1O0T A;  2YO1 A;  3HB2 P;  2AGM A;  2ZVD A;  2QUA A;  2Z8Z A;  3NTN A;  1GO8 P;  2ZJ7 A;  1O0Q A;  1G9K A;  4I35 A;  3HDA P;  1K7Q A;  2YO0 A;  3VI1 A;  1H71 P;  1SAT A;  2QUB A;  1OM8 A;  3ULT A;  2XQH A;  3S6L A;  1AKL A;  3LA9 A;  1K7G A;  1OMJ A;  2ML2 A;  3HBU P;  3A6Z A;  3U1R A;  1AF0 A;  3WP8 A;  1SMP A;  1P9H A;  3HBV P;  5CXL A;  3LAA A;  1KAP P;  5CVW A;  1SRP A;  3A70 A;  2ZJ6 A;  1K7I A;  1GO7 P;  1OM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...