5CXPA

X-ray crystallographic protein structure of the glycoside hydrolase family 30 subfamily 8 xylanase, xyn30a, from clostridium acetobutylicum
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
387
structure length
387
Chain Sequence
SNDATINVAAKHQTIRGFGASSAWCGALSDTCMDTLYKNAGLDILRVRIAPNEGWNRGDYRAWADELSNAKKVRARGGIVFATPWTPPASMKTNNTTTGANKGSLKPSSYAAYAAYLKTFVKYMSDNGAPLYALSLQNEPDWAPDYDACTWTAQQFHDFLKQYGASLSSTIKIIMPESLGFNPAMSDPTLNDPTTAQYVSIIGGHLYGSPIRDYPLARNKGKDIWMTEHYLEGNDPGTCVKLAKEIHDCMTIGNMNAYVYWWISGDQNGLYNTRTNETYKKTYVMGQFSKFIGNGYSRVDATNSPQSNVYVSAYTGNNKVVIVAINQGTYPVNQSFNVQNSTVSNVSSWVSSGTLNMAKTNSNISAANGRFNASLPAQSVTTFVADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a GH30 xylanase
rcsb
source organism Clostridium acetobutylicum (strain atcc 824 / dsm 792 / jcm 1419 / lmg 5710 / vk
molecule tags Hydrolase
molecule keywords Possible xylan degradation enzyme (Glycosyl hydrolase family
total genus 143
structure length 387
sequence length 387
ec nomenclature
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02055 Glyco_hydro_30 Glycosyl hydrolase family 30 TIM-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5cxpA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cxpA02
3D3AA 2J7FA 3WQ6A 3N1AA 3M46A 3AMKA 1R47A 1OGSA 4PMQA 1VFFA 3PTKA 3WD2A 2VX4A 3DX1A 1TQWA 1KWGA 3OZPA 4PMRA 4OJYA 2C7FA 1M7XA 2VZOA 4XB3A 2EPNA 4P8VA 2YKKA 4MADA 2GUYA 3VDAA 5IFPA 1FOBA 5BYWA 5I79A 4OKDA 5A6BA 1CWYA 3S5ZA 3BUIA 2V5DA 4DO6A 3PZNA 4Z2HA 2CETA 3GBDA 2DT0A 3PZQA 4WF7A 1K9DA 2VO5A 1QNQA 3D51A 1UZ1A 1WZAA 3CZKA 1J0HA 1G94A 3J7HA 1C8YA 4MNMA 1FFRA 1C93A 1R8LA 3VIHA 1JD7A 3VGGA 3GTNA 3BLBA 4YHEA 3OZOA 4HMDA 1UD3A 2VVSA 4GZJA 1YQ2A 3DX0A 1NARA 3T0AA 4DUVA 3EJUA 1IZJA 3VIKA 1GHSA 3BMVA 5FIPA 3I3BA 4XZWA 4BZYA 1E4IA 1W9UA 1H0GA 2XVLA 2F7QA 3N13A 4BQ2A 3BAIA 3W82A 1ISYA 2QMKA 3T0DA 3ZJ6A 3QOKA 4BA0A 4OZOA 1ISWA 3WUEA 2WK2A 5HPOA 4MDPA 5M5DA 1G1YA 1FFQA 1UWQA 3L4YA 3WH5A 4EKJA 3LPOA 4HOWA 4Z2IA 1ZBCA 2BVTA 5EB8A 4YN5A 4CU6A 4DWSA 4CUCA 4CCDA 3PTQA 4AMCA 1XC6A 3ARRA 4UTFA 2VJXA 1V3MA 1M53A 1LLOA 2WHMA 4OIFA 2XWDA 1WCGA 3AHXA 1TQTA 1US3A 3HU7A 3K4DA 4P7OA 3BVUA 3WMBA 1BYCA 3WMCA 2J25A 3WY3A 3OIHA 2GSJA 1PZ3A 2G3NA 1UD8A 3WFLA 1EO7A 1B3WA 3ZJ7A 4MNJA 1E73M 3POCA 3WDQA 5FD0A 1QBAA 3CHCA 4UQCA 4W7UA 3PTMA 1VBUA 2A3HA 3LMYA 3GYCA 2J7CA 4GXPA 1B3XA 1E1FA 2VR4A 9CGTA 2X8RA 3GXFA 4U5KA 4D6EA 4JKKA 2FHFA 3NDZA 1MXGA 1UH3A 4HU0A 4QAWA 1XSKA 1US2A 2MANA 3PZ9A 1E4LA 4D6DA 5IFTA 3GXPA 1EDGA 4LX4A 4U31A 3NSNA 4LYPA 3EJSA 5I5RA 4GIAA 3DC0A 3SCPA 2JFEX 1W9DM 1TVPA 3WDJA 3FW6A 3MUZ1 2JIEA 1V3JA 4AMXA 2J79A 1GORA 3GM8A 4AD3A 3WMSA 4U5IA 2VUYA 3NYDA 3CO4A 5HBFA 1CBGA 4X0VA 4AZ7A 3F5KA 1F4HA 5I2UA 1M04A 4PMVA 1MW1A 3WN6A 3MMUA 1UZ4A 3A4WA 1LWHA 2X2JA 1C7SA 4M24A 1JFHA 2XVGA 5ABEA 1CXLA 2F7PA 1QHOA 1JNEA 3K46A 3WBAA 2VMFA 3FXYA 2V3FA 3EBVA 1UYQA 1E5JA 3TA9A 4CU8A 1QI5A 1KBKA 1PJ9A 3ZQ9A 4W87A 1JG9A 3OGSA 1B31A 1UQZA 4R5EA 4FLRA 1XGZA 3CC1A 2G4FA 5E1QA 1PPIA 5FL0A 4MNKA 2XPKA 4PBGA 4W86A 4ZENA 3NSXA 1XSIA 2XWEA 4M29A 5BROA 4J3WA 3WEMA 4UFLA 3T08A 4Q7NA 3LXAA 2Y4SA 2ZX8A 1SZNA 4HOZA 2V38A 1E72M 2EO7A 3CZGA 2NT1A 3L4TA 1W91A 4PUEA 1ZBVA 1B3VA 1TQUA 1V02E 1E15A 3WF0A 3VX1A 1SYTA 1U30A 2VX6A 4GQQA 2G41A 5A6KA 5ABFB 3FHAA 1DP0A 4BF7A 2YA1A 1UD5A 2JEQA 2XM2A 1LG1A 3EJTA 1Q6CA 4Z2GA 1LWJA 1OD8A 5I3DA 4MAZA 1QHZA 3B8SA 1PS3A 5CPSA 2YL6A 3ARQA 1TG7A 4U33A 4CCEA 4EK7A 2X05A 1KQZA 4FLOA 1K6AA 4F66A 4UOQA 2YLAA 3SURA 3APGA 3ZO9A 2BNJA 1ZL1A 2XM1A 2ESCA 4AY1A 4OOZA 4U2YA 4DO5A 4Z2LA 1KGXA 4KWUA 1JIBA 1BGAA 2X2HA 4AZBA 4OGZA 4YHGA 1M03A 1CGXA 3D4ZA 3WD1A 1JF5A 1VEMA 3W27A 4UZUA 3WF1A 1OWQA 1U33A 4B3KA 2CHNA 5ECUA 2VZSA 3GNPA 4QLLA 2X1IA 1PX3A 4TTGA 1CYGA 1CXHA 5I6SA 3FNDA 4TXEA 3A4AA 3WQ5A 3CZLA 2J7GA 2D0GA 1BVZA 4EE9A 1J9YA 2GDUA 1AQHA 2WLYA 3K8KA 3RMEA 3AIWA 2BY2A 2G8ZA 4UNIA 1KFWA 1UKSA 3OBAA 2QF8A 4HMEA 1QI0A 4WSKA 1WE5A 1LF1A 1C8XA 3K8LA 2ZIDA 2NW0A 1V6VA 1XRVA 4HPHA 4E2OA 5CGMA 4H41A 3DECA 4GZEA 1OCQA 2VC9A 3TTQA 4OOUA 5C71A 2WC7A 2DSUA 3EJQA 1HJSA 4UOJA 1JZ8A 2WWCA 4AD5A 2F7RA 4PMZA 3WH6A 3RJYA 3WSUA 4MAVA 4W8BA 4QLJA 4D72A 4E4PA 4AYSA 6CGTA 1W3HA 3N17A 4AZGA 2FGZA 3BUBA 1B3ZA 1Y7VA 1FHDA 1PAMA 1QOXA 1J0ZA 3G6LA 4CD5A 4H04A 3PZMA 3B9AA 4UR9A 5FKYA 4WKFA 4D6GA 3OLEA 2EPOA 1TMQA 1TE1A 1JXKA 2GK1A 1CLVA 5AYIA 1V3LA 1CECA 1W3KA 3AXXA 3W4RA 1NOFA 2DDXA 3AIRA 3DHPA 1H0IA 2WHJA 1C92A 3VD4A 4IUGA 5E0FA 1CEOA 1B9ZA 2IXVA 4B15A 4J28A 1NWRA 3TV8A 5I0DA 5LA1A 2EEXA 4NXKA 5BXSA 1ZS2A 3A4XA 3MV11 1Q4NX 1MVYA 4P8WA 1QNOA 3D5HA 2PWDA 4M8UA 4FK9A 3AYRA 4W93A 3W53A 3ZT7A 1WDRA 3GXNA 3UETA 4OUEA 2DQXA 1KXVA 4JFSA 4UFKA 1JZ6A 3AIBA 4GI8A 4B16A 1QW8A 3CPUA 1OT1A 3WQ8A 3S2CA 4DUWA 2VX7A 4UQBA 3AMGA 5HNNA 3F5JA 3N11A 3CV5A 1E0XA 4U2ZA 2E3ZA 1JZ5A 2QHAA 4GQRA 4W85A 3UG3A 4PMUA 1WDSA 2W5FA 3DYPA 1OINA 3CZNA 4CGTA 1L0PA 1DWIM 1I1WA 3KLLA 1K9FA 1BSIA 1CGTA 3W29A 2XVPA 5BCAA 3WQ4A 2WC4A 4C7GA 2ZX7A 3GXMA 3SUVA 1JNDA 3A21A 4CD4A 3AHVA 3GZAA 4GO9A 1HWWA 2BHZA 4JCMA 3VGDA 2GJXB 3SCNA 3ZJ8A 1WZMA 1AMYA 2YL9A 4KRUA 4MB3A 1WKYA 1VB9A 1CLXA 1E6XM 5A6AA 4J7RA 4M80A 4K68A 1UWIA 1QI4A 5EFDA 1JF6A 4CD6A 1LJYA 2XYLA 6A3HA 3A5VA 3BUDA 1DTUA 2ALWA 2VRQA 2HISA 5JIPA 3AMCA 1WNOA 1V02A 2VT0A 3FY1A 5DT5A 2OLHA 5D9OA 2ZXAA 2WKLA 3WH9A 3VSVA 1ZBKA 3ZM8A 3I3DA 2EJ1A 1DWHM 2XJ7A 4AC1X 1X6NA 3IAPA 3LRLA 2ZUSA 1TZ7A 2A3CA 3EDKA 2VZVA 5FL1A 4AIUA 2PWFA 5D8WA 1R46A 1QX1A 1E6PA 4UFMA 4FLQA 2WLZA 2J77A 1WZLA 3WENA 4AW7A 2BY3A 3K8MA 2OWXA 3I3EA 3SCVA 1ODUA 2OW6A 1PBGA 4D6IA 4D6HA 1G9HA 5C70A 2O9PA 1EIBA 3VD9A 1JYWA 1CGYA 2OSWA 2YL8A 5A6SA 1AQ0A 4A3YA 3DYMA 3L4VA 4P8UA 1KXHA 1E6QM 2J8GA 4TTUA 1EO5A 4GI6A 2G3JA 5E0CA 8CGTA 1JFXA 3CZEA 4AD4A 5GNXA 3A6OA 2WBGA 3RIKA 3ARZA 4MTVA 4P7RA 4AISA 8A3HA 2D23A 4CKQA 2V5CA 1GZJA 2D3LA 4MB4A 3SCTA 4CCCA 1KTCA 1HN1A 2F8QA 1ZJAA 1J11A 2ZICA 1EOKA 1V6YA 1JGIA 3VMNA 4CN4A 2CBUA 2EPLX 3SEPA 4U3CA 4HA4A 4X9YA 4JFWA 4NXSA 1H11A 3O2LA 3PZUA 5D4YA 5CXPA 1AQMA 2VCCA 3FAWA 3VINA 3MSGA 1GVIA 1JYXA 1VJSA 4N42A 3ARWA 3UR7A 3DHUA 3UESA 1BG4A 4H8VA 4HA3A 4DM2A 1TR1A 1X1NA 2WC3A 2VRJA 5A94A 3BAJA 3VD7A 5CJ5A 2J7BA 4GKLA 3L2LA 4MJ4A 4AD0A 2V3DA 1FH9A 1UR1A 1UA7A 4BQ3A 7CGTA 1EHAA 2E9LA 1BFNA 4AWEA 1B1YA 3MUIA 2Y5EA 2VRKA 3WL1A 1HJUA 1H49A 4XZBA 2O9TA 2VNCA 3NUKA 4BQ4A 1J0IA 3PBGA 1ECEA 3AI0A 3WFZA 5AYBA 4PMXA 2YJQA 1I1XA 2WW5A 1DWJM 1WB0A 4PUDA 3ARVA 2J78A 1LQ0A 1HNYA 3A22A 3F4VA 4CN6A 3VMOA 2XFYA 3ZT5A 3MS8A 4AZ5A 2XIBA 1BPLB 3LX9A 4AEFA 1E4NA 1EDQA 5JIWA 1WPCA 3DX2A 1W9BM 1RPKA 4N0RA 1J0KA 2ZOXA 3SCWA 3AZSA 1UWRA 4UQEA 1UWTA 3PZTA 1CXIA 1HXKA 1MQPA 5D9MA 2WHLA 2ZX5A 3VD5A 1ESWA 1VFOA 3M6DA 1GJUA 2EAEA 1ZB5A 2V3EA 2WWDA 3RJXA 5GQBA 4AZIA 2J47A 1UQYA 1ODZA 1A47A 1UR0A 3N12A 1VBRA 3SUUA 1MFVA 3WF3A 1EA9C 2O9RA 4LPCA 4CD8A 5BRPA 1LG2A 1T0OA 4FNPA 4RL3A 3QGVA 4GI9A 3MI6A 4IM4A 2FHBA 4W89A 2WCSA 5C8BB 3KL5A 4HOXA 2J7EA 1E1EA 3AIQA 4WSJA 3SUTA 1WDPA 2E40A 2W92A 5GNZA 3DX3A 2EACA 3SCRA 1C90A 2BXYA 1CZ1A 3ZJKA 4AIEA 1TA3B 4DWSC 3H54A 4R27A 4KRTA 1VFMA 3CH9A 1YHTA 2F61A 2CCRA 3SCSA 3PZVA 4FNUA 1V08A 2WAGA 3BLPX 3PHAA 4WLCA 5M3WA 4Z2KA 1E6SM 3VIIA 2WCGA 1HTYA 1H2JA 4D6JA 3ZT6A 3AQUA 4JKLA 2WMKA 3OG2A 2BFGA 1R7AA 4OBSA 2W91A 3CBWA 4W7WA 3WELA 1RD6A 2WVSA 5CG0A 2CBJA 4W7VA 4D71A 3CIVA 3VVGA 2DT2A 1UH4A 2FDMA 3HG2A 2ZX6A 4DO4A 3U57A 1MXDA 1ZJBA 3VX0A 4CD7A 1GONA 4WJXA 4AZ6A 4GZIA 1GQLA 3WD4A 2VZTA 2VR5A 3WH8A 3TOPA 1KXTA 1KR0A 2J4GA 3LPFA 1S46A 2D20A 3VIGA 3WL0A 2D22A 3MUAA 4JFUA 4TVUA 1R33A 2CITA 1KGWA 3GH4A 3AIEA 2DEPA 3RCNA 5ABFA 2FE0A 1BGGA 1XD0A 2D0HA 2CBIA 1BYBA 1V3IA 3TTSA 1NP2A 5BXPA 3SUWA 3WBEA 1EQCA 6TAAA 2CKSA 1H1NA 4MPKA 2V3GA 1PIFA 1R87A 4QCFA 5JBEA 3VMPA 1ITXA 1E3ZA 4J3SA 1TA3A 3M7SA 5DFAA 1E5NA 3G6MA 3CUGA 2VURA 1TCMA 2FH8A 2CBVA 2DIJA 3W0KA 5AC4A 4JIEA 2XTKA 4KGJA 1CTNA 2A3AA 3CUJA 1C91A 3BCFA 3FAXA 3OA5A 4DWSB 3WNPA 1J18A 1E9LA 2VCBA 3MANA 2XN2A 1GOMA 2QLYA 4GO8A 3VM5A 1UR4A 3AMLA 3BGAA 4NSBA 3CZ8A 3F5LA 2FGLA 4AZHA 3BUQA 1NH6A 4AD1A 2D2OA 2QPUA 3WQVA 1WAWA 5A8MA 2A3BA 4DWSD 1GPFA 1C3FA 2TAAA 5DT7A 2ZUWA 3CMGA 3W25A 1W32A 1JZ3A 1IZKA 4HMCA 4KH2A 5BXRA 3CZJA 3BVXA 2W4XA 3POHA 3WDPP 4TX8A 2F7OA 3BUPA 2UY4A 4F8XA 3RPMA 1BAGA 4LQ1A 2O9OA 1TQSA 2CKRA 1XV8A 3W81A 2E0PA 2YBTA 1BG9A 4Y7EA 2AAAA 1V0NA 3BVTA 3ECQA 4WKAA 1UHVA 3ARYA 5ABGA 1UR8A 3IJ9A 5A95A 3RM9A 4AD2A 3BVWA 1E40A 1O7DC 5HPCA 2BY0A 2W61A 1Q6EA 4FMVA 4HZ7A 4ZEPA 4J3XA 4S3JA 1HL8A 1G5AA 2WANA 1WZKA 3RM8A 1Q6GA 4MNLA 4LXFA 3IGUA 3WF2A 1KXQA 1OB0A 1WO2A 2ZUUA 3VM7A 1CPUA 3WNNA 4TUFA 4TVDA 1MYRA 1OD0A 2VCAA 1MWOA 2J62A 3NJ3A 1VJZA 1D2KA 3OGRA 3KL0A 5CPTA 3LRMA 4Q22A 4JL2A 3N9KA 3EDJA 3WUFA 2ZE0A 2FHCA 2EXOA 2OW7A 2XN1A 1E0WA 2YFNA 3PN8A 3VIOA 4J3TA 1OBAA 5D8ZA 2BS9A 1E43A 4NF7A 1VIWA 2WZIA 4HTYA 5E9AA 4QFUA 5I24A 4E8CA 1UD6A 3EJRA 1RP8A 4EANA 4P8XA 2VL4A 4MB1A 3CMJA 1CIUA 1V03A 2PC8A 3EMQA 5LA0A 3BLKA 3MMWA 3D50A 1MW2A 1C7TA 4UZSA 1KGUA 1R7OA 1GOKA 3W38A 3E1F1 3VGFA 1OT2A 4FNRA 4ATLA 2XHYA 2ZUTA 4H2CA 4X0NA 4FNSA 1JI1A 4U3AA 2CESA 1ISXA 1E70M 3RDKA 4WK9A 1PEZA 3BAWA 4AYGA 2CNCA 3AS0A 3MMDA 1JAEA 1R86A 1JYNA 1EHNA 1QI2A 2WZEA 1BLIA 3O6AA 1HKKA 3ZR5A 4Z2JA 3HG4A 4HP5A 1H5VA 1Z32X 2EPKX 1NWSA 1VFUA 4JKMA 4RE3A 2Z1KA 1VENA 2CIPA 2JALA 4ZXOA 4V2XA 1QNRA 3WQWA 2VQTA 3VDHA 1CGVA 4RE4A 3CGTA 1E55A 2OYMA 3QHOA 3H55A 4ATWA 4NZFA 5A8NA 2ZWZA 4CVUA 4FNQA 3ZR6A 2XVKA 1ITCA 2HVMA 4UQAA 1JI2A 4PCTA 2YA0A 4PTWA 1B0IA 1OM0A 2X09A 1UR2A 1DWFM 5LYRA 4F79A 1SR0A 2E8ZA 4W88A 2ZXDA 3HZ3A 2NSXA 1HP4A 1EQPA 5A6JA 3A47A 4ACYA 5F7UA 2J75A 3RO8A 4KMQA 2CEQA 3OLGA 2JF6A 4AXNA 2VZUA 3LXCA 2OWCA 3DDGA 1N82A 1E56A 4JHOA 3QHNA 3M07A 3DX4A 1SMAA 3HG3A 3CUFA 1BQCA 3FN9A 3KEHA 1LL7A 2RGMA 5CGTA 3AFBA 3CUHA 3N15A 1B30A 3OB8A 2VQUA 2XG9A 3CHDA 1MW0A 4JAWA 3MSDA 5LA2A 4BQ5A 2WPGA 2XVNA 2YLLA 1HKJA 4JZ5A 5BWFA 1VF8A 1E4MM 3IANA 4NZCA 5IHSA 2ZX9A 2YFOA 2BVDA 2J8FA 3AZRA 1MFUA 3GNOA 4HA1A 1VEPA 3DYOA 1BF2A 1UD4A 1UKOA 3EMZA 3T2OA 3IJ7A 4PEEA 3WDIA 1GOWA 2PBOA 4MJ2A 3VIMA 3TONA 4QDMA 3OGVA 1NWUA 1B2YA 3THDA 3EJPA 5DEZA 2Y8KA 1J0JA 4XV0A 2UY5A 2WVVA 1FH8A 1V3HA 4ZXLA 2PF0A 2X0HA 4AEEA 3NSMA 2D1ZA 1PIGA 4JFVA 2WXDM 2ZXQA 1PX8A 3W26A 3ALFA 1UKTA 4PMNA 5EFFA 3S5YA 3JUGA 3VU2A 1GQIA 1HIZA 1TUXA 3ZMRA 1O6IA 4W8AA 2J7HA 4H8UA 2CXGA 1ZU8A 2BV9A 5CQ1A 3B9EA 4KGLA 3A24A 4AZCA 4UFJA 3PZIA 4A3HA 1V6XA 1BHGA 1V6UA 1GJWA 1G0CA 2F18A 4EAMA 5FCZA 2WVTA 3BSGA 2JF7A 3U7BA 3TTOA 3AROA 1E6ZA 2QV4A 2X2IA 4L4PA 1GW1A 3OLIA 1UOKA 3L4ZA 3CUIA 5A3HA 3BAXA 3D4YA 1A3HA 5EBAA 4QP0A 3IAQA 3W6LA 4AZCB 1QBBA 4D6FA 4C7DA 1XYFA 5IXEA 1TVNA 1HJWA 5IHRA 3AHZA 4H7VA 3U5YA 1UR9A 4PSRA 3MKKA 1CGUA 5HDRA 1M01A 4PN2A 1QWUA 1Q6DA 1H4PA 2YDRA 3D52A 4NRSA 1HJXA 1CDGA 4HPGA 1I75A 1PX4A 2CYGA 3QHMA 2FH6A 2GFTA 1UASA 2E4TA 1V6WA 1EXPA 4BS0A 1E71M 2VI0A 2UY3A 3ARXA 1W9XA 3CLWA 1UWSA 2BHUA 3AS3A 4PMYA 5A8QA 3W24A 1HJQA 2ZWYA 1GQJA 1UWUA 2WMFA 3ARTA 4TOQA 3WY2A 4PMOA 1OIFA 3MV01 3S6TA 3BXWA 2C8NA 3WKZA 1E0VA 2UY2A 5CLTA 3AIUA 1GOIA 1CXFA 4PTMA 1DEDA 3HN3A 3AHYA 4AMWA 4ZE4A 2OSYA 4M81A 1QVBA 3UG4A 2C0HA 3VNZA 3ZOAA 3L4XA 4DM1A 4B3LA 1JL8A 4M82A 3AS2A 3NIYA 3MUY1 2YA2A 4NI3A 3VNYA 1VAHA 5KEZA 2D73A 1JDAA 3AMDA 5CZKA 4WIWA 1XCWA 1W1YA 1GQKA 1P6WA 2WCAA 4M1RA 2WMGA 1XSJA 4W84A 3GXDA 3BMWA 5CSUA 5E6ZA 1W1TA 1NWTA 2WMJA 1SFSA 4PTXA 1OSEA 4UCFA 1MQQA 3GNRA 3T0BA 2WSPA 2A3EA 4J27A 1JXJA 3LPGA 3O9NA 2VVNA 2VOTA 3VTRA 3WEZA 5JBFA 1RP9A 4IPLA 2Y24A 4NX0A 3RM4A 2DT3A 4YPJA 2XGIA 3GDBA 3EDEA 4WKHA 4GPNA 1GUVA 2GDVA 2XN0A 1V0LA 4MB5A 2ZUMA 5A2CA 2X2YA 1XD1A 3MO4A 1ZBWA 2JEPA 4IPNB 3VGEA 3HMCA 1UD2A 1CNVA 3GBEA 5A6BD 4B9ZA 2GJPA 5IDIA 2G3IA 3VD3A 1EOMA 2WMIB 3L2MA 4RE2A 1GNXA 1DWAM 4QLKA 2DT1A 3CHEA 4FF5A 1QWNA 4F9JA 1HP5A 2WMHA 4D1JA 1J0YA 4JFTA 2F1BA 3BAYA 2DIEA 1H09A 3SCUA 3WD0A 1QPKA 4TVCA 4PRWA 4D1IA 5DF0A 2WMIA 1CGWA 4HU8A 4J3UA 3UEQA 1W1PA 3VDBA 3L4WA 1XCXA 2Z1SA 1GCYA 5A8PA 1BTCA 3GH5A 2Q8XA 5HXMA 2JIWA 4A4AA 1K9EA 5JUVA 2EQDA 5I77A 1KQYA 1NM9A 1JD9A 5GPRA 2GJRA 3OLDA 2D24A 2JE8A 2WHKA 1W3LA 1HKIA 1W2VA 3VOCA 1KBBA 1FP8A 4DUXA 3ZSTA 1RH9A 3CTTA 1B90A 2RGLA 1IT0A 4V27A 1KB3A 4P7LA 1HT6A 2AMGA 2UWFA 2WZHA 2F2HA 2B31A 2BXZA 2WKGA 1JZ7A 5CLWA 5A6LA 1W9PA 2Y8VA 2WYSA 3IJ8A 1V0KA 3T2PA 2WNWA 3W28A 1JZ2A 1UUQA 3VSUA 1XH2A 3TP4A 3HJEA 3ARPA 4ZE5A 2J7DA 4OBRA 5EMYA 1W3JA 2GK1B 2G3MA 2PWGA 2XSAA 3NDYA 3ZIZA 4JCLA 5I23A 3AHTA 5E09A 3GH7A 1GVYA 5CSYA 3SUSA 1ISZA 3IK2A 5ABHA 4W8LA 2VX5A 3WD3A 3II1A 3AXHA 4PTVA 3N04A 3NCOA 3BVVA 4PYSA 4LYRA 2DH2A 3WH7A 4CN1A 2F1AA 3QR3A 2YDSA 4P7NA 4ATDA 2E9MA 1D3CA 1XH1A 1B3YA 3BSHA 5I78A 1QHPA 5A6MA 3T2QA 2E9BA 2IGTA 2PB1A 3A3HA 3AICA 3SCOA 3MU7A 5A1AA 4ZFMA 1H41A 1UKPA 5M03A 3RILA 3WNOA 1J10A 3VILA 2OYKA 2ZUNA 3CHFA 1KCLA 3KLKA 5TD4A 1L8NA 4XX6A 1DHKA 1JDCA 2W63A 4LGXA 1CENA 3U7VA 1W2PA 1HJVA 2YDQA 3BAKA 1LL6A 3UR8A 1J01A 2D3NA 2W67A 3PZGA 1R34A 2Y2WA 3VGBA 3KL3A 3AYSA 1QNSA 2WVVB 3EDFA 4FNTA 2GVYA 3H53A 2OSXA 1OGBA 3UG5A 1V0MA 3AIVA 3UERA 4QCEA 4M56A 2WM0A 5CPQA 1UKQA 3ARUA 1HVXA 2ZXBA 2J74A 3AJ7A 3WUBA 3TTYA 1EH9A 2DSKA 2W62A 2X0YA 1O7AA 4MDOA 2XIIA 3UCQA 3DDFA 2WBKA 1BVNP 2FYVA 3VSTA 3VIPA 5A8OA 1TQVA 4LYQA 1DWGM 4PCSA 5AC5A 1GHRA 4UFIA 3BH4A 1GOOA 2CPUA 4PMDA 1VRXA 1JDDA 2E8YA 2PBGA 4XUYA 2XFFA 3N18A 2IXUA 1HL9A 1HKMA 2ZUVA 1FHLA 1Q6FA 2XSBA 4UOZA 1FA2A 3VO0A 5A2AA 2D0FA 3GXIA 4W5UA 1PZ2A 1EDTA 1BYDA 1F4AA 1FP9A 5HOSA 1NOWA 2DSZA 1UA3A 4S3KA 4NRRA 3KZSA 3AISA 1KWKA 1UH2A 3VIJA 4FLSA 1BYAA 4E8DA 2W66A 3K4AA 1ISVA 3ALGA 4CU7A 2DGAA 1E3XA 1HX0A 3SCQA 5A2BA 2QMJA 1MW3A 4IISA 3AS1A 2EABA 2PI6A 1SMDA 3VGHA 3HG5A 4PSPA 1MQRA 1V3KA 1GOQA 3W37A 4URIA 4TX6A 5FOOA 5JBDA 1NP0A 3L4UA 3CZSA 2DSVA 3K1DA 5E6YA 3B9DA 5M17A 7A3HA 3AOFA 4HZ8A 1E6RA 2BVYA 4HZ6A 4GINA 2PWEA 3FHQA 2NT0A 2CHOA 3EDDA 2OWWA 1VEOA 4JHZA 1JZ4A 3BC9A 2XUCA 4H8HA 4UQ9A 3KE0A 3LPPA 1J12A 2AOSA 3VPLA 1TFVA 1R85A 3VUPA 1IV8A 3WNMA 1C8QA 5DO8A 3VKKA 3A23A 5BXTA 2DH3A 4JL1A 3W6MA 3KWXA 2XGBA 2QPSA 3BCDA 3WY1A 4B9YA 1QI3A 1HVQA 3U5UA 1OGGA 1CXEA 1W1VA 1KR1A 1AVAA 5BRQA 4UQDA 2OYLA 1NQ6A 3EYPA 4C7FA 3VDCA 2YOCA 1D7FA 1KCKA 4UFHA 1XHGA 2WSKA 2YL5A 4NZJA 3AZTA 4J3VA 1JYVA 4L4OA 1K9TA 5DMYA 3SIMA 3WDRA 1WP6A 1U2YA 1KTBA 1QNPA 3LRKA 1E6NA 2EADA 2DSWA 2WB5A 1HF6A 1CXKA 1UG6A 4BCEA 1NOUA 4D6CA 3WF4A 5AY7A 2IUZA 2CERA 3WNLA 1OIMA 3VIFA 1JAKA 2BY1A 1LL4A 3WY4A 4V28A 2YBUA 3ARSA 3PZOA 3T09A 2WVUA 4ACZB 2EPMX 2PWHA 1XH0A 7TAAA 5KZ6A 3EMCA 3THCA 2GJXA 3QOMA 1QW9A 2YIHA 3AXIA 4ACZA 4P7QA 3WEOA 4F9DA 1W9VA 1EGZA 1G01A 2XFRA 2DPEA 2VTFA 3WIJA 1X6LA 5E70A 4W5ZA 4ML4A 5D9PA 4CVWA 4AIOA 1HXJA 5A69A 3WDHA 3WNKA 1H3GA 5GNYA 2O92A 1R75A 5D9NA 1FH7A 3LXBA 3GXTA 2BHYA 1XYZA 3WUGA 3ZSSA 1WDQA 2EBNA
chains in the Genus database with same CATH superfamily
2K4AA 3UJTH 5CZTA 1ZEAL 3QDME 1GYCA 4DKFL 4YHPA 3ZZ1A 3F04A 4M4RB 4NVTA 1R47A 1G4PA 2HVKA 2EILB 1UWFA 3QJQB 4BZ1L 4JTTA 3WJZA 2D3VA 3WD2A 2VX4A 2EAWA 2MPVA 3HC4H 4CNSA 5EZJA 1TQWA 3LKNA 1ZLVH 4PIRF 3WLHA 3V9FA 5DS8B 1NINA 3O3AB 4N2MA 4GS7C 4MUZA 3NVQA 1O66A 5EUOE 4JR5A 2C7FA 5F3BA 2FT7A 2QCDB 1M7XA 2VZOA 2XWJA 3QRGH 3OYZA 4GX8A 5F6IB 3BZFB 4NQTA 3RWIB 2GUYA 3QCUL 1SHXA 5EN2B 1TJ2A 1DBAH 2X38A 4JJ5A 4MG4A 7PTDA 4MMZA 2WQUA 5H8DA 2W80C 3ZTDC 1B3JA 2V5DA 4IXHA 1EJOH 2DEWX 3LQAL 4I3RH 1K4GA 5CR1A 4B53A 5CZJA 1MCWM 1PMYA 2PDIA 2GJJA 4LSDA 4C4UA 2Q8BL 4H5SA 5D72H 4A04A 3SO5A 4WZHA 5C0GB 1ZLEA 2KDGA 3HKZA 4E9VA 3HZVA 3MA8A 3PZQA 1RHFA 2DQUL 4Z95L 1K9DA 2VO5A 2AL1A 2PP0A 4ZX3A 2CWNA 5D37A 2F0CA 1D5MA 4MXVF 1U91A 1J8VA 1KXVC 4TNWF 4XVSL 3VCLA 5KG9A 4IRSD 2ZYFA 3CXHJ 5PCYA 4F91B 3WO8A 1BFVH 2A7RA 3VE0A 1C93A 5K9JL 4UDUA 1JXFA 2DEXX 3BD5A 2X0WA 1UB5A 3BPLC 3DOHA 4RAVA 1HQ4B 1DFXA 1Z3RA 1ZA3A 3GTNA 5FW8A 5FUZL 3R8BB 3GIPA 3JV6A 1U8QB 4YHEA 4YHNB 4KQ3L 1CG9B 2AEIT 1CE6A 2JF1A 2P8MA 4HMDA 5FK9A 1AW1A 3TBWB 2YJLA 1RCYA 1S9YB 2Y1AA 3CHXA 3EYFA 2NR6C 3IRSA 5FKPA 1P4BL 3IMBA 3W1LA 2OWWA 3QZPA 5HBBA 3TZVC 4FXGC 4KI5E 1X1ZA 3HG1D 2A2IA 1H3PH 4NM4H 4WRHA 3UZWA 3DX0A 2WNGA 2W59A 1B6DA 2VIRA 4G8TA 5FO7A 4K5OA 4JKWA 2P0IA 2A6JB 1WA0X 2GCYA 5DC4B 1Q6LA 1KBVA 3CYJA 4BSVB 2XOTA 4CMHB 3QFDA 2HXUA 3GIYA 3ISIX 1AG0A 1W72L 2G9HB 3H7LA 4RA0C 1LWRA 4KKBD 1KFAH 3LCXA 3KG5A 1JPKA 2X89A 4XQ6A 4ZQRA 1O5DT 3ULVH 4FS9A 1W9UA 3B5TA 5T3XH 4F33A 1RL1A 3MRHA 5DCEA 2DLGA 5F3HB 5IB3A 1Q65A 2F7QA 4ADJA 2DBJA 3AAZB 1I60A 3IV3A 5TTRA 3BAIA 5D9SB 3W82A 4E5TA 1ISYA 3P82A 2BOCA 4D0BB 5BZAA 2CWRA 2QMKA 5GS2D 3ZJ6A 4DESA 2ZNWA 1QFUL 5FM5O 3UEZA 1GHFH 2TYSA 4DW2H 3EWBX 2PRMA 3VXRE 1ISWA 4JG0L 3FIGA 4KKXA 4K23L 3QXAB 4FQLL 5HPOA 4MDPA 1R3KA 1LP6A 2ZTBA 4D0CB 4AEOA 2HEJA 3QUXD 2C1PA 3EUUA 2OXGB 2TPSA 3NO5A 4XBGB 2X4UB 4NQXB 1L6FA 4OCWH 1OC5A 4WFHD 4M0XA 3BQUB 2PN5A 3L4YA 3EGXA 5F96L 1FWFC 4EKJA 4JN7A 4YSOA 4OV4A 4Z2IA 2FFIA 1H9VA 1LP9B 3P0YL 4XZ4A 4DWSA 4PUWA 2OQLA 5HHNA 3OKKA 4R7OA 4FA8A 3WTWA 3PTQA 3W6YA 1XC6A 4DQOH 3BGJA 5FYKE 4NI8A 4Z17A 4YCPA 2VJXA 3VFGL 1TX2A 4WY0B 3SFWA 4NQDE 4ZGYA 3T4YB 3S88H 5L8LB 3H9SB 2P28B 1WCGA 1TQTA 1US3A 4O1EA 3DSNA 3K4DA 5B39G 1HGYA 4Q6KA 1BGXH 2J1YA 2L7EA 1VBJA 4Q6IA 3EYSH 4TNVF 2HPOA 3ID7A 3WMBA 3SE3A 3FUMA 4DYKA 3NSDA 1B4JL 4RZ4A 1OVDA 3V36A 1JTTA 2IKHA 1JV2B 2ZPKH 3WMCA 1HCFX 1ROCA 1AFVH 1Z6JT 3A6CH 2R7EA 1S7TA 2R4RH 3DO3A 1QNIA 5IBLD 3CAVA 4WUIA 2R82A 4X6DF 5KN5B 2BSSB 1TJPA 3NQ6A 1O5QA 2FGBA 4BI6A 1TTCA 2OI9B 3NZHL 3C2FA 4DJMA 4MSSA 4OU3A 5DEFB 5LNEA 3WTYA 2C15A 1JCNA 3RY6C 2VH5H 1MJ8H 2CH8A 5D71H 4L1XA 1E73M 3D25A 3GHRA 2UVEA 3DPDA 1MO0A 6ALDA 1RU9H 3DC8A 3CHCA 5K59E 4F7PB 3LLXA 3K2UL 4LOEA 2ADAA 3EYVA 5DURB 1YEFH 1YN6A 2AAVA 3EOUA 2A0LD 1XRSA 4HHHA 4L4LA 1OM9A 5IMLA 3W0WD 3GYCA 2BVEA 1HXYB 4LSUL 5CJOH 4GXPA 1E1FA 1EEYA 2DL9A 1T1WB 1TTGA 2VR4A 9CGTA 1Z3NA 2QPFA 4EF3A 2EHHA 2PRHA 1CDCA 4D6EA 4AG4L 2ZA2A 1P1VA 1MXGA 2AJVH 1Z0NA 4LE8A 5GGRY 1ZALA 3QTPA 2VITB 3HC3L 2XV0A 5JIIA 1AZBA 1US2A 2OX1A 4XTIA 1P7TA 1I1FA 4DAGH 2RKXA 4U31A 1IB5A 1JUEA 5BQ7A 1POKA 1SM9A 3NSNA 4KEMA 4LYPA 3EJSA 4S1DC 5EU6D 1OM3H 1CD8A 2VLKA 4HLZH 3QAZC 3Q8CA 3T6ZA 5BUGA 3Q8AA 3QULB 1CFSB 2Z0IA 2IH3A 4Y2DA 4BJLA 2QDDA 2FATH 4O57A 4JG9A 3F05A 1DE4B 2O72A 3NIGB 1P84K 2G2NA 5C8BB 2PR9A 3WDJA 4CAGA 4YSUA 1BM3H 1IQWH 3FW6A 5I19H 5D2LA 3CQIA 3ZE0E 2JIEA 5TDOB 4WI0A 3TWCL 4MYAA 4XCNB 3OKMA 4Y9FA 1GGTA 2ITEA 3FFOA 1O7VA 1VADB 1VCBC 4JPWL 1IBDA 1NFDB 1S6NA 4MGXA 4MNQD 4LRSA 2VXTL 2HK0A 3NYDA 2WCPA 3KDMB 3UBFA 4QNWA 2WHVA 2KX9A 4ZI8A 4X0VA 4AZ7A 3F5KA 4N6RA 2FMOA 4PMVA 3I6LE 1QYGH 4PWIA 3N4EA 3ALWA 4PY8J 5AOKA 1SNRA 3QEQE 3LHVA 1LEGA 2QADC 3SCMD 1TEGA 1USQA 2ITDB 3A4WA 4C1NB 2YD6A 2X2JA 3ZHFA 5LXEA 1AHWC 2L8AA 4X9FA 5D6CB 2HXAA 3P9LB 4AVOA 1K6QL 3SGDH 3N40F 3S9DB 1XB3A 3SY0A 5CN3A 2NQLA 3Q3GB 3LHPL 5INDB 3AADB 2VMFA 5DYOA 1WG3A 4G6JH 4BSWB 1OADA 3B3IA 1W31A 5DELA 3P77B 1EGJA 3I4KA 5DK3A 5AZ1A 3SN4A 1AGFA 1FGVH 2WXGA 1I1AC 4A7UA 4N0FB 4CU8A 4ELME 1SGJA 3UZ5A 1M3JA 2D7TH 2DIAA 3PIQA 3EYQC 1FWBC 4RNRA 3WEXB 4AUYA 1JG9A 3VFTB 1UQZA 4YXLL 3U0PA 3RLGA 4NAFB 1TZHB 1URZA 4R7VA 3G7TA 3CC1A 4Q4RA 4X22A 2G4FA 4L4VD 2QZQA 3NA4A 4MMZC 1L2UA 2DUZA 3BOFA 1L3WA 3KOXA 3WEXA 2J2ZA 4PBGA 4UWMA 1E4KC 1Z9MA 2A6IB 3WE1A 3F62A 3QE5A 4ATTA 4ZX4A 1E8XA 1XSIA 1D6VH 1E7VA 1Y18A 2ZWKA 3QXUA 4M29A 4X6DA 1ZV2A 3O45A 5AEAA 3T4AB 3WEMA 3GPEA 5GHWH 1O9VA 4EPEC 5FYKU 5CEZD 4BFJA 5D1XB 3LXAA 4JFQA 5LGHL 2WLLB 1OE3A 2Y4SA 1F11A 1SZNA 2ZX8A 3ABLB 1E67A 2F08A 3RN6A 1KBGL 5CC5A 1IKNA 2YCEA 3BEVA 1E72M 3W39B 3D3VB 2QKIC 3CZGA 2NT1A 3L4TA 4HEME 4JRXE 1YO4A 3RGBA 4PUEA 4HHLA 3UJRA 4A35A 1TQUA 4JCWA 4OZIB 1KD0A 3QRHA 1KT2A 1W72H 1XGTA 2Y5TB 3VX1A 3WF0A 2NTFB 3BQUD 5DHVA 1WH0A 4J23A 4OGAD 4XWGH 4F15B 3HE6D 5T33H 1HEJC 4YWIA 4OLEA 5ABFB 4N8VG 2YA1A 4JHBA 4LP8A 1VF5C 2R27A 5IOPA 3LOWA 2QKSA 2XM2A 2V9DA 5I8OL 1Q6CA 4FQ1L 4F7CB 1IBGL 1LWJA 1U8JB 5EUKB 4R5XA 2FQGA 4FQCH 4J1UA 4MAZA 2YCJA 2ICEB 2ZOKA 3B8SA 3U79A 1G5GA 1PS3A 3H4WA 1TG7A 4EK7A 1OSZA 2X0SA 3NJJA 1NBYB 4GSDH 4LALA 2CU0A 5D2VA 5ECJE 1T7XA 5C0QA 4FLOA 1OCBA 2QVMA 3MLZL 4PCPA 3QVQA 1P5VB 2IDUA 5HDLA 1RHHA 4F27A 4P3CH 1L8PA 2YLAA 5JO5B 3APFA 2P80A 1PG7W 3C60A 1ZL1A 3ZDYE 4HZLB 2ESCA 4L64A 2DD8L 2WBWB 2OZ4L 3TJPA 1ZGLB 3E0IA 4NO2A 4P5TC 4DO5A 1CO1A 4HK3N 1BGAA 2X2HA 3PE9A 3M0HA 1HG3A 3NJKA 2A0LC 4OGZA 3WF2A 3SBQA 1H63A 4NIYE 3D4ZA 1JWMB 1M03A 4D9LL 1SXNA 4HZ1A 4PJBE 4JTGA 3WF1A 1TPUA 1GGCH 4Q2ZB 3EA3A 3T0WA 1DE6A 1OWQA 1U33A 1OWWA 2NXYD 3TN0B 5KAQG 4TUUA 2GY5A 4GXWA 3F7PC 4OLUL 5DZAA 2VZSA 1YN7B 5DD1H 1EPXA 5BOPA 5T3ZD 1PX3A 4G6FB 3DVNA 4JHWH 1LLZA 3BQ6A 5I6SA 4S2SB 1RI8A 4LVNB 2PW1B 4NN5C 2ZWSA 3E96A 3MKGA 1PUDA 5IRPA 3O0LA 2ADFH 3B4UA 4OZIF 1TRDA 5ILTH 3G1HA 4X2RA 1A1OB 1KZYA 4GGHA 4N22A 3WE6A 3SB0A 4AZ8A 2X1OA 4YWGL 4X4ZA 3OJMB 1AQKH 2QHLA 2GDUA 4N6FA 3DDMA 3HVNA 1FQ0A 3G77A 3RMEA 3W7KA 4HX1B 4MJJA 2BY2A 1KC5L 2H1LM 3MRJB 4LCWD 4UNIA 1U93B 1LBFA 4ZFCA 2B59A 2PODA 4Q4QA 1IAIH 3FONA 3OBAA 4G8FB 2V2CA 2Z4TA 4Q3MA 3OG6B 3REQA 1W5NA 1ZAGA 1FBIH 3SCNA 4WSKA 3PXLA 4E2DA 1C8XA 4Q8BA 2FBOJ 3ULSA 4F9LC 2Z8VC 1DXIA 1RLDA 1JDFA 2ZUYA 1P7QA 2GT9A 1A3RH 2IH1B 4RZCA 3EWZA 2P52A 3HRZC 3FTVA 3HQNA 1IAOB 1U8OB 2JKTM 3Q13A 1W0WB 1GOGA 3DECA 3GK8L 1YEJH 4HT1L 3BP5B 4NO0B 1AHWB 5AOJA 1ZENA 1A5SA 3SSGA 5FF3A 5C08B 1IC4H 4QJ4B 2WC7A 1TYRA 4A2DA 3D46A 4YHNA 1AQDB 5LGHH 4GY4A 4QGYA 1AFVL 3GRWL 3PU7A 1PG7H 5T3ZL 1PGRB 1JZ8A 3QCTL 5EIIA 5BV7B 2DLFL 3BQUC 5CD3B 4JX4A 1L3NA 2F7RA 4ZDHA 4DLMA 2FD6H 2WLLA 3DARA 2IG2L 4JPVH 4UNLA 4N2HA 4FOMA 4G6ML 4Z7QF 4W8BA 4UBDC 4D72A 2AF2A 4LF3A 1EOKA 5KZCB 2OMVA 6CGTA 3CUPB 4Q4PA 4MPQA 2YQGA 4AZGA 1S7UA 3BUBA 4TV5A 3FT9A 3QV8A 4S1FA 3U4AA 3L12A 4DEPC 4KFOA 5KYUB 4FQIL 1CT8A 1OCJA 3MJMA 3P0WA 3TFKD 3KXFB 4Z9KB 3IGAA 4WUUD 4PGBA 4ZSOA 4F3FA 3ZW3A 3G6LA 3P2VA 1OG6A 3QIWD 3DHDA 4CD5A 2P3ZA 1OKEA 2XY1A 4DF2A 3QDGA 2NY5L 2WPBA 2RACA 3QXDA 3CQFA 2UZ9A 2XICA 4H04A 9RUBA 3KBHE 3W2NA 4JN2A 3TPUA 1W0VA 3FH8A 5JHLA 3D05A 5FKYA 5E03A 1NSNH 1B2WH 1NCOA 1PTZA 1ZLDA 2JWYA 3KPNA 3VYPA 4O53A 2GTWB 4TX9A 1BIIB 3WLRA 4TQ8A 4J2XA 2GCYB 4MQXD 2GK1A 3MYJA 3U30C 4DPPA 3BWUF 3QJZA 2RA1A 1W3KA 3LDBB 1P6FA 4WXZA 4YE4L 5IFAL 3KH4A 2N1KA 2WOQA 2DQTL 1FVEA 2C5DC 2NXYC 5HGHB 4G59C 2CZNA 2F1EA 3BFQG 4YUEH 3W4RA 2DDXA 2GIYA 3AIRA 1EFZA 1A9BB 1RMFL 3MDWA 3IKKA 3TX4A 5E2WL 1PCWA 2QPXA 2WHJA 4H26A 1JWSA 1C92A 2QDGA 1RFDH 1NDGB 2QSQA 1J8KA 3F84A 3G5XB 3IS4A 4XSLA 4J28A 3RX5A 1PYWA 3O8XB 4I1NB 4CQAA 1KM2A 2JMRA 3T1GA 4YS4A 2Y1HA 1Q8JA 1R3JA 1CDJA 1F6FB 3GNXA 1S3HA 2DWYA 2PXYC 1A6ZB 4NUQA 5LGJB 3A4XA 4GUJA 2ZWNA 4JO5A 1MY7A 5LCVA 4DP7X 1XIWD 3HC2A 3NJIA 3MV11 4PJCB 4AK2A 4F5CE 4NJKA 2YCLA 1MFCL 1A22B 5IQ7L 1CB2A 4UTWA 3CQPA 5D5MA 4X9SA 2YN3A 4DBUA 2BINA 1F3EA 1I0BA 3BH8B 3TO2A 4YHLH 2J1KA 3N0AA 3WXWH 3M0VA 4FK9A 5F6IC 2OQYA 2PMQA 3T40A 4F2BA 1MHEA 1WDRA 4ZCWA 4WWOA 3MSYA 4UXDA 2BIQA 2OFQA 2V7HA 5CCJA 3HR5B 1U1HA 3GFYA 3CYVA 4K7PH 2ESVA 4U0RB 4DJDC 3K80A 4X5XA 5C9JA 1ZP3A 3G0XA 3TTEA 1SQMA 3I7RA 3AU1B 4QXUH 5BOJA 1ZWIB 2PABA 1QW8A 3LH2H 4Q89A 4QYOA 2HVKB 2ZKMX 2OZ0A 5T5NG 1OT1A 5F70A 3RYMA 3NAVA 3W1AA 3KPRA 1FORH 3ZDYF 4FLHA 3LHYA 4GUGA 1YPFA 5LAPA 2IWGA 4WJG3 2VLJD 5A8GA 4H1LG 5I1CL 3QWOA 2ILLA 5I8CA 2BSSA 3E8UL 1JZ5A 2E3ZA 1UUMA 2AABL 2IAND 4GQRA 3FC8A 4UDTA 1RULH 1M7DA 3LS5H 3ATYA 5ANMA 1QD0A 5GXBB 1AL7A 2CDGA 4IGNA 1IJ9A 1NUGA 5EO1A 4C91A 3AWOA 4BKLA 3ECBA 4WFGD 3MQTA 3QQ3A 3SE4C 4RCAA 3VB8A 5HYJA 2Q2LA 1OAZL 1W3IA 3L3GB 4F57L 2Q9OA 3MFFB 1L0PA 2ZCHH 5IBTH 1DWIM 2JJWA 5E4IA 1XLAA 1MCJA 1BSIA 3LQGA 5AWNH 5E9NA 4A6YB 3O7UA 2D7NA 1WBZB 1Q0YL 3OR6A 5CZ0A 2DWDA 2R39A 2B9AA 3QFWA 3WQ4A 4BI5A 3HBGA 4MQXC 4ACTA 3RMJA 2BP3A 2WP3O 4YVUA 5HHNB 1JNDA 1RVFH 4JFZL 4UTTA 5ACZB 1I1CA 4DYJA 1UVQB 2W0FB 3D2UA 3Q1SL 2NUWA 2VO8A 4Q8TA 2WQXA 4E41B 3VGDA 5C2GA 2VISB 5EIQA 2NXZD 2W8CA 5D72L 2Q8BH 4EIGB 4IMGA 3U82B 4PJ9C 5CUSL 4OFDA 4DGYH 3CQJA 3EB3A 3FV9A 5F7NC 1O1HA 4TN9A 1E9OA 1CLXA 2WXRA 5AZEH 3KMDA 4K8EA 4J7RA 4HS8L 4NQXA 4ZFGL 5J13B 4R97C 1XGDA 3E2VA 3S3SA 4HH9B 4FZEH 5E6ID 1BSLA 3H2WA 2RAGA 1LJYA 1FH2A 2A7BA 4ZBJA 2XYLA 5E2WH 12E8H 1RMFH 4P46C 5D7SL 1TZ8A 2R1LA 1QLRA 1KLGA 1U8NB 1OB1A 5IVXE 2Y7MA 1AD4A 1Y65A 1KELL 2PP9A 2V67A 1WNOA 3AMCA 2QQNH 3MNVB 4Q97A 5AB3A 4LVOC 4GX9A 1FNEA 5C0CD 3DGBA 4DEUA 2HP4A 3PDGA 3FY1A 2ZXAA 1FL3A 5F71A 4ANUA 4MQTB 3LV6A 5D9OA 3OGCB 5AOUA 4HCHA 1KLFB 1I7RB 1UCBL 5IHZB 4LEFA 4AWUA 1NCCH 3OJ2C 2WKLA 2WIIB 1PL9A 1HAUA 2J24A 1NPJA 3SECA 4IRZA 5AW8B 2WLNA 3LCFA 3MV7D 3QI9B 2R15A 1N7ML 4QTHA 3TO2B 3CSTA 1FHUA 4LLDA 1PKYA 1SJXA 1BXCA 4S3GA 1TZ7A 3D39D 3H23A 1I3GL 5D30A 3UBPC 2WAHA 2I1OA 3F6IA 4RWYH 1REQB 1NCDL 1IM9A 3H9SE 3IDIA 1WAAF 4X7EC 3MRGB 1PZAA 4QHNA 1A4MA 4Y4KA 1TNMA 4YTRA 1SOKA 4X2UA 5FL1A 1YBQA 3MQIA 4AIUA 4YSDA 5F0MB 5SX5K 3W23A 3LHWA 3CD4A 1JGVH 4JX0A 5AUMB 2F7FA 2E86A 3VI4B 4D3CH 2W9DH 2G4EA 3QJXA 4KOBA 3P5YA 1G6RH 4ZQPA 2FT8A 2YC1B 3MSRA 4O51A 3MREB 4N28A 2IBZY 3VACA 4L3ED 1SZRA 3MU3A 2I5YL 4PRHB 4YH6A 1WZLA 3N06B 2J77A 1U3HD 5I18H 5T9CE 1A1NB 2JIXD 4JMXA 4X6BB 4MLSA 4CNOA 3FT1A 3OWEA 2BOGX 1VZGA 1G87A 1VRSA 4QRTB 3VXOA 5D7EA 4IBUA 3SCVA 5J8OA 1RKRA 4FQLH 3S8FB 1SR9A 1N64L 2H9AA 4LB3A 1NOLA 2BLFA 4MXQD 3ZQXA 2E6DA 4ZPTA 2CBPA 1OZQA 5I1CH 3QUYC 1IM3B 3KPOA 4AI7A 1FNHA 4C1LA 1EVTC 3GJFH 4FXLA 3QJOA 3KEDA 4KEVA 1AHKA 4OZ4B 3MV9B 3V6OE 3HMJG 4AB4A 4YX2L 4BDVB 1V7AA 5GGSB 5CZXD 4F37F 1K03A 3UDWC 5DJ2B 4GW4A 1MSSA 2EDQA 3QUYA 4BE5A 3CO8A 3TS8A 4P8UA 4OGXH 1VFAB 4LNRA 1ZT7A 3P3UA 1TQXA 1QUPA 3C5JB 2AP2A 2J8GA 4S2CA 3QSKB 2O55A 2WZPD 3ARFA 4LLQA 4MWFB 2QJNA 1X5LA 3A6OA 4OR1A 2YRBA 3AU6A 4BV1A 4GAJL 2JV6A 1IGYA 5FB8B 1YX1A 4MTVA 4YJ5A 2HFTA 2B0MA 1C12A 6REQB 1NF7A 4CKQA 3EG9B 4MMWA 2K3TA 4F0LA 3T8MA 2UX6A 1TSIA 2Z92B 2JELH 1X96A 5KAQF 4TM9A 4MB4A 4TLTA 2X1WL 1A5BA 1UXSA 4LOVA 4CCCA 5JR1L 3O6CA 2X0UA 5AVSB 3D18B 2YSSA 3DX8A 1HL5A 1QFPA 2ZAIA 1JMZA 5DMKB 4JY5H 3INOA 1KFBA 2V82A 4L29B 4Q8MA 1BWVA 3T0VA 2PUZA 2AKRB 4ENZA 3S8WA 5DJYB 1V6YA 3DX6B 1KNOA 2CCLA 2DV6A 4HKZA 3FDWA 3R1GH 3VMNA 4OCRL 1V6TA 2XBTA 4HIBA 1M6OB 1VADA 2D9CA 1U92A 1FDZA 3VCRA 1DYZA 1FZJA 2YUVA 4U3CA 3PWLA 4K55A 3OAYK 4YPGA 4GLRH 3UP1A 5KJ7E 2UZIL 3EOEA 3TYUA 1JPTL 3QO0A 1H11A 4S1RL 3O2LA 1LO2H 5AW2B 1KRBC 5D4YA 5I8OH 1Y6NR 3CCHB 3GIQA 2VSCA 1IYXA 3IU3B 3MSGA 3VINA 3R8RA 1LM8V 1NCCL 3R19A 5DRXB 2A9ML 2EUVA 1GVIA 1EC7A 2GGJA 2WWOA 2FGWL 5IMMB 3G5EA 4WFFE 4NPYA 1GZHA 1ELSA 2ZA3A 3IDIB 1UACL 1UB6B 4JN2B 2ADJB 5TE7H 3SB3A 4DFIA 5BQ7B 2Q3ZA 2A74B 4ADUA 2HRWA 3FTGA 3HNTH 4NP7A 2VR3A 2WC3A 3IWPA 4JM4L 4OJFL 5FM5M 3N1MC 2NY2B 4QTHB 2CMRH 1WHOA 5KANG 1I53A 2I5IA 3MCMA 1F4YH 1BQHG 3L2LA 4E9XA 3KOYA 2UZYA 5F4SA 2OB3A 1HXYA 3VNKA 5TF1L 4X4XA 1U8MB 4K36A 1PDKB 2GUOB 1OF0A 2FGWH 3VXSA 1FH9A 4HNUA 2UWEE 4KK6C 1N5AA 5FYJD 4HUVA 2QGBA 5LGYA 4J8QA 3QFJD 4PJAE 1JVOA 5EEYA 4PJXB 1QACA 5J12C 1QSFB 4O28A 4Y9PA 2GITA 2HZHA 3ZTNH 5K1NA 3CFJA 1UQSB 4MA1C 1D6EA 4ETQB 1AODA 3AQZA 8XIAA 3JWNH 2HH0H 2NLJA 4ZFFB 3NN8B 3HFYA 1ADOA 1EQWA 4IEFA 2QZRA 3EMZA 1H49A 4QHLB 1QUNA 3NTCH 4MNHA 5CGYD 1NCTA 3UNTA 4ERSL 3NUKA 4LRIC 3HF3A 2P3YA 3TEUA 1DJNA 3NIFF 2Q87A 4Z7VB 5FDWA 1IAOA 1NPNA 4KY1H 4OCSL 3D0CA 3NL6A 2OMZA 3AI0A 5ICUA 1DQTA 2C3VA 3IN2A 4EPBC 3D0VA 3URAA 4PRPA 4V2BA 3FTYA 4FSAA 4IQEA 1RJQA 1TZIA 1ORSB 3W7IA 3ZE0F 1QTWA 3MUCA 4HWNA 3UZXA 2YJQA 5JXED 3JWOC 4I2XB 5C0IB 4U1SB 3K2IA 1FG2A 5IVXF 1FH5H 3DTXB 4CNTA 5KSWA 2WW5A 4PUDA 1KLZA 3MP3A 3X14A 2CZDA 1PZCA 4UTBL 3A22A 3F4VA 3TA6A 4CN6A 4JFFE 1NQKA 3PJSB 1YJDC 4U3HA 3VMOA 4WKZB 4M8QA 4A2SA 3WE6B 2Z8RA 1E4XL 4I90A 4AZ5A 2XIBA 1BPLB 1DQQA 4OQTH 1IBBA 1WXJA 1D5BA 4MASA 4RR4A 2OTWB 3CAFA 4AEFA 4I3SL 4K94C 4B27A 5JIWA 4AZCA 1EDHA 2L7JA 2N01B 1ERNA 3MRNA 3L16A 3FO9A 4IDJH 2RDWA 3CM4A 1AGBA 4I9TA 1NGZB 3LIZH 2WN2A 4OLXH 4YFLI 1ALDA 3AZSA 3UIYA 2YBVA 5D2NE 4K3EH 2QUVA 3VXUB 4E36A 5D9MA 2WXLA 2YD3A 5G4OA 3SD5A 4AQ8A 1R3TA 3CFJB 3QQWA 1JWMA 4YDMA 5B3JE 1TKWB 3KWWB 4HJUA 4IM8A 3WQOA 4PB0H 4JE0A 5I26A 4DOHB 1CDHA 2EDNA 2VM9A 4A6GA 3SO3C 2J47A 3I9PA 1KGCE 4JS7A 5JZ7D 1ZGLA 5AOMA 1ODZA 3MZGB 4WJ5B 5AQ0A 3DBPA 3F2DA 3GS0A 3E7JA 1LT8A 2EH7L 3H0TB 4ZJ9A 3DO4A 3LB0A 1IFHL 1MFVA 5AD0B 3UPRB 1MWAB 2AQQA 1EZSA 1T6VN 3QRBA 4QEGA 5IHUH 3T42A 2EVHA 1QO2A 4LPCA 4RPPA 2BGSA 2QUMA 4AGNA 3KVKA 1LG2A 1E27A 4H3DA 3GKFA 3WLNA 3PP4L 3DBSA 3QZNA 2UXGA 1U8PA 3Q06A 4GRWB 5CN1A 1RUQH 4GI9A 1XP3A 2MCPH 3VXUA 2FHBA 4NPYB 2OZ8A 4DPBX 4WQ6A 4PJCA 5JDJA 3RNQA 4O8RA 4ZOCA 4BCXA 3G5WA 4P5KB 3AIQA 3ILQD 4WSJA 1IKFL 3I9GL 2OZ3A 4Z0SA 2FJHA 4KJPD 3SUTA 2AGTA 3LCGA 2XKNB 1QFHA 4DFHA 3T8VA 2WSDA 3LRHA 3WIHH 4AXWB 2XRAH 4LL1A 4YE4H 3ZE1B 2OTWA 3DI1A 2BXVA 4HVXA 5E2VH 3AY4A 4PRNA 2F6XA 5BMFL 3GVWA 2PCQA 3PGCB 2BCMA 2AEQH 3QZWB 4ONHA 5AVXB 5KSUB 1QVOB 4O2EA 2J6EA 3GH4A 1OARH 2BXYA 2AK4D 1C16A 3PANA 1MLBB 4WO4A 4FHAA 1YY9C 3L3IA 4LAOA 4LWWA 2EDFA 4N2KA 1Q38A 5CIPA 4O9HL 1UW9A 1H7WA 3MMTA 1YJDH 4R27A 4RUBA 4KRTA 2W0KA 3R25A 3QXVA 4KTYA 5DJDB 5CCHE 2J1ZA 3UC0L 3U9PL 1Z5HA 4TQHA 3PZVA 1SHWA 5ETUA 2ZP0T 4HKXB 4RGMB 2WAGA 3QY8A 5LZLA 4PFMA 2Z92A 1P4UA 2LU7A 2J2ZB 1NFAA 4WLCA 1AZ1A 1PYMA 3CNYA 5JH1A 4NNYA 1TMCB 3LIZA 3IRDA 5ALBL 5DC2A 2Q2EB 4XPHH 4ASTA 6FABH 3ANYA 1ZRUA 4I8YA 7REQB 3QULA 3BZFA 3FFCE 2GJZB 3H7BA 3WFBH 1QUMA 3AITA 2E5CA 1PO9A 5IIEB 2VB5A 2FUQA 1Q85A 5DBUA 2XDHA 1DE5A 1ZDQA 1ECYA 4N9EA 3KHDA 5GJTH 2GITB 1GMIA 1GIGL 2UY6A 3MRMA 4FIRA 1KCRL 4POUB 3QIWA 4CMMA 2VEFA 1UM4L 4D71A 1QASA 2DB8A 4WDIB 2DIBA 2VDKL 2DMGA 3HZMB 3MRIA 2ICWA 1MZYA 4JREC 5ALBH 5EWIL 5J6GA 4IUOA 5FR3A 3JVGC 4DO4A 3HGRA 4TIMA 3W7CA 1XLMA 4ZFQA 3UBXG 3B8VA 4FXRA 4CD7A 3AABA 4PUBL 4Y4FC 1GONA 2QCGA 3QC0A 1GQLA 3C12A 5ESAA 4TUJB 5T1KD 5T26A 4GH3A 3WH8A 3M44A 4C56E 7FABH 2Q86B 4TV6A 1KR0A 4GCAA 1OAJA 1RIVH 5L6UA 4N2BA 5T8GA 2AZUA 4R83A 5RUBA 4FQPA 4CC1A 1IXPA 3M5VA 2WZ0A 2AAMA 3BLLA 3HO8A 3DV6B 2DL2A 4Q4IA 4O8AA 1DZBA 3WIHA 3TEVA 4Y4HB 1YEFL 1KGWA 5F9AC 1HYSC 3AIEA 4JZNA 3RCNA 4S3CA 2HPTA 1XD0A 4K71C 5AYYA 2AERT 3DIDA 1E8YA 3EBIA 2D0HA 3HE7B 1NUFA 5AYUH 3QRFM 4I87A 5EO0B 3VXUD 4XNAA 2J9YA 4XG1A 2C3XA 3TTSA 3WIIH 1YBQB 1T66C 2FQEA 3FJLA 3M0ZA 4L23A 2BSDA 2DM3A 2HK1A 3WBEA 2R0KH 1Z69A 5C0ND 2MFNA 5EU3A 4YSCA 3KTXA 2ZG2A 3IFLL 3LB6C 1E5UI 1OGAE 1S7XB 4YNYB 1HNGA 5EU4B 3UYCA 3BISA 1OP9A 4EX4A 2JKIS 1YPZF 5EO1B 2G0LA 4HSQA 2ZOWA 3B2VL 3FOLB 1RZPA 4OLWL 4Y16D 2FSEA 3GDMA 4FTVD 1P0NA 1A7OH 5IQNA 3MJWA 2FDSA 3HG1A 3TH3T 3DNKA 1ZTVA 3QHFH 3C0SA 1E3ZA 4XO7A 4ZFZA 2BLEA 1AG1O 2WOYA 4GYBA 1QFWL 4WDIA 5DFAA 3RTQC 4N0CC 3G6MA 3T65A 2VURA 4ZS6C 2CBVA 3RJQB 3W0KA 2WUCH 1AH0A 4PJGE 3LRSA 4OLYH 2O4QA 3DZ1A 3FJ4A 1DLFL 3GSNL 4KQ3H 1TRIA 2JB5H 4P9ML 4O4VA 3TR9A 1ACXA 1DUZA 3UO8B 4DQOL 3Q2DA 5ITBH 5G2HA 2EKCA 4HPOH 3F7KA 4E9YA 4YQXL 2Y7QB 4PG2C 3RWJA 3MRDB 3GX9A 2OCFD 3FH5A 5JORA 1IUZA 1IGFL 2DY3A 1ETZA 3RWHA 2OV0A 3CH0A 1DQVA 1MNSA 1WA1X 4QXIA 1CU4L 1PU0A 2J71A 1XQ4A 2B1HL 5JIKA 1ZTMA 1PE1A 1O5PA 1RJRA 5C0AA 3WNPA 1I8KB 5KVEE 1GTEA 4WJEA 4GB9A 5D1ZD 1L6YA 5CBJA 4LF1A 4KKLD 1GOMA 5DD6B 2A74C 1M7UA 4GO8A 1NBVH 3GSRA 4XO9A 1AXTH 3VM5A 3AMLA 4NSBA 3QCVH 2FZMA 3TCSA 3T71A 3F5LA 1E9YB 1MJUH 2ED9A 1SJMA 4MYPA 2YQ2A 3BUQA 3Q6FA 4R0LA 4JQXC 4XPGH 4US6A 2VDMH 1NH6A 2DQMA 2VAJA 3QEHB 2HKFL 4WWKD 3ES8A 3B1UA 2D2OA 2VE6B 4MKNA 3W71A 2VIRB 1CU4H 3G5XA 3JUZA 4KWVA 1WAWA 4I48B 4HWBH 1KN4H 4F7EB 4GQGA 2WLJA 3KWTA 4L0ZA 3MPGA 2ZF9A 4AMKL 3C0LA 1QLFA 4URKA 1W32A 2YC1A 4UWQB 3UMTA 3VJ6A 5GZOD 5JOEA 1CLKA 1NUNB 3TLRA 3FKKA 3BQUA 3QIBB 4KH2A 4AENA 3NRPA 5CJMA 2CLVA 4UILL 3CZJA 2BVWA 1NCWH 4JIHA 2O4MA 3W1UA 4DF0A 4QKXB 3POHA 1DQMH 1KF9B 1E7UA 3FUHA 4WI2A 1MHCB 1HGWA 2WNXA 3S3PA 1XLCA 3OVRA 5DY2A 1KDJA 2V63A 4GRLB 1JRHH 2JJTA 2F7OA 1VLXA 5F9JA 3KYMB 3H2CA 4GUIA 3BUPA 1SSDA 1RVFL 1X9LA 4IU2A 4LQ1A 2BSTB 5AZ2H 2P4AB 1O6TA 3FN0L 2GTWA 1W15A 3I6SA 4Y2NA 5F6HJ 5AVQB 1EF2A 2NY1B 3DOSA 3CFKB 1MI5D 2V2DA 3QJFA 5CBBA 2YD7A 3NSCA 3QA3A 2C4FT 3V75A 2CKRA 5IB3B 3OU8A 4RFEA 1CDYA 2XG5A 2Y36H 1T2QL 4Y7EA 2AAAA 4HFWB 2OJZH 1R5IA 4NJIA 2RR3A 4FB7A 5IFJB 5C54A 3U6RA 5EBGA 3OYXA 1XDMA 4B3KA 5C7VA 4YL9A 1B5TA 2GW5A 2J13A 4Y4FA 3OAUH 3IGAB 2DZAA 5CLYA 2XTJE 1EP1A 4OM0H 3DGGA 3IMVA 3RM9A 4AD2A 1ETZB 1E40A 1R5IB 2VLKE 1AGCA 4DCQB 3IGXA 3DTUB 4EMZA 3L0GA 3L23A 2WLIA 2VD8A 4HZ7A 4ODTH 4J3XA 4S3JA 4WI4A 2WANA 1ZVSA 3SYAA 1XB8A 2KZHA 3KBNA 3RZWA 5FOBB 1Q6GA 4OFVA 2Y1ZA 2YPVL 3D39A 4NP4H 4UB0H 1KXQA 1QFWH 3ECUA 1X97A 2B16A 3IEBA 1WO2A 5AOIA 2X1XR 4GXVL 4FDWA 5D6CA 3T3PB 1YRRA 4BELD 4KZDL 1G7JA 4JQVA 5TDNA 1MYRA 1QU4A 2IQ9L 4FHJA 3L7FA 4NQCD 2GSMB 4MJIE 3U4EB 4KCTA 1HQ4A 4JQ2A 2J62A 3EXJA 4LBUA 3ZE2B 2DTML 3QHZH 32C2A 1E5AA 1MREH 3KL0A 1KCWA 2RFGA 3EXRA 2P43B 5LBVA 3CXOA 3U9UA 4CA4A 1WBZA 1XZ0B 3OR6B 3S37L 3UP6A 2XH4A 1T66D 5D7HA 3ARED 1FWTA 2NXIA 3NJNA 3N9KA 3EDJA 3L2NA 1LQ2A 3WUFA 4BK9A 3FQTB 1OQOA 1QDSA 5DI8A 3EH1A 3JZYA 2FHCA 4HS3B 1EHLL 2YMXH 2PP3A 3DHMA 1VKXA 2XZAH 2Q6WA 3MHUA 5EMLA 2VDLH 5F8RC 2H3NB 3H3KA 3HC3H 5DGRA 4XCNA 2VSDA 3CFTA 3HOJA 5DD5L 4M6QA 1S7RA 3MNZB 2O5XL 5D8ZA 3WK2A 4EACA 3LN4B 3MKVA 1DVFB 2NNCA 5AHMA 1TVLA 3EFDL 4PLNC 2ALAA 3DFPA 4O12A 1F3JB 2VL4A 2CDFA 2XT1B 1JGMA 1IZCA 1GVQA 1VP5A 3ETTA 3O1NA 3OTRA 3CMJA 1MHPH 4P2RB 4PJDF 1WV2A 1PZ5A 1T89C 1YMMA 4AZIA 3MMWA 5I3IA 4Z1YA 5F93C 3BQVA 4ETQA 1MW2A 2V5JA 4IP7A 1AO7D 4M3HA 3LIZL 1EZ2A 2XDFA 3W38A 5CO1A 1XH3B 3CHOA 3VGFA 2UXFA 1A2YB 2VABB 1MQKH 1OT2A 4ATLA 4U05A 5G4WA 2PCPA 4H2CA 5GIRA 1KKRA 4IRSB 4NC0B 5E8NB 2Z31B 4BFKA 1MCWW 3FO0L 2R1PA 2ESVB 4X2PA 4KRLB 1F41A 4NGHL 5DJ8A 1CFTB 1E70M 1KGCD 1L6XA 1R3IH 2FLIA 3QEGH 4QROA 3ISWA 4UQ3A 1PEZA 4JFDB 1Q0XL 3ATDA 1XIHA 4AYGA 3AS0A 2OS7A 4MCZA 4EUPA 3TJ4A 3D25B 3MLWH 5ADPL 3H2QA 4IJCA 3TC6A 2ON3A 3DXAA 4MKSA 1N64H 2J5LC 2XWCA 4Y88A 3QIUD 1QRND 3SY1A 2YGNA 1HXMB 1BLIA 3WS3B 2DZUA 3HG1B 4HIIA 4OW6A 4PBFA 2D31B 4AQ1B 5IMMA 3FUJA 5HHXL 4B5ZA 4Z2JA 3WEBA 4MJ6A 2CPCA 5K9KA 1H5VA 1LO4L 3MLTA 2E09A 3GI8H 2Z7UA 5D7JC 3UOAB 1TPVA 2H32H 3SIZA 4JKMA 2Z1KA 3PPSA 5ANME 1VENA 1POJA 3T0TA 2YAHA 2YAQA 4LH8A 2XA8L 3ILQC 4JPQA 3PBWA 2E59A 3AREA 2XNAB 1NCGA 4R4FL 2ACRA 5DI8B 1ZS8B 3EBAA 2ZSWB 5HY9A 3UTPD 1E55A 3LV3A 4JRXB 3AU2A 2EUXA 4OV5B 2O1AA 3QHOA 3ASWA 1EWHA 4ATWA 1I2NA 2BSBA 2ZWZA 4XPTL 3IDGA 3OKOB 4XO4A 5IQ9A 2BW4A 1ZJIA 4JTQA 4LLYB 3QDJE 1GZGA 1YE4A 1CQYA 3D8MA 1ITCA 4LHUA 3VXTA 4O4WA 4IGBB 3S5OA 4OZIA 4NN5B 1DQLH 4JY6B 5EBMA 4NUJB 1LEIB 1WBJA 2FB3A 4JDEA 3IJIA 4XCYB 5SWQA 1E2WA 2EIMB 3QY7A 3JBG7 2EICA 1I85C 3NGBB 4PCTA 4PRHD 5LB1A 4R0LB 1OM0A 3DMMA 5D32A 3FGCB 4FAAB 5LYRA 3H85A 2OXGA 3AT9A 4PG2A 4TMPA 2ZYHA 1SR0A 1RQHA 3N1FC 3B7RL 2ZXDA 4HJSA 1YQVL 2LTQB 1XTMA 1KFAL 5B39B 3W5MA 2R94A 3O0KA 2WUBH 3LZNA 4ZMGA 4ZMZA 4XAWL 2ACSA 3A47A 2NXYB 4GKSA 2CIKA 4LNRB 3SE9H 2HVBA 3TN0D 4GSQA 4X50A 4D7PA 4U3SB 4DP5X 1RCQA 3MB9A 1ET8A 4NQEE 5KTLA 1DANT 1IFHH 1WS8A 2EXYD 3U46B 2EH7H 5IHUL 5BPPA 3OLGA 3IGSA 5T91A 3F4NA 4AXNA 2O5ZH 2P76A 2OWCA 1RALA 3DDGA 4ZUWB 3ZDXF 2PZ0A 5I8KH 4X6CF 2YXMA 2YLHA 4P23B 1AS8A 4O2CA 2BIMA 3ZE2F 1KULA 2R0ZL 4O17A 5FJJA 3MRRA 1YTKA 1BBDH 1GZPB 3HG3A 3LV5A 5CC3A 1W80A 2KHAA 2XWZA 1JPDX 3CUFA 3FCSA 2P50A 5BO1H 2IPJA 3CLEH 4JFXB 4YJZL 3ARDB 2RGMA 3CUHA 1BQKA 3GC5A 5KVGL 3A12A 2R83A 3K81A 3C6EA 1PZUB 3W73A 1B30A 4L3CA 4ERSH 4DTGL 4EZLA 3OB8A 5FO8B 2YBRB 3SDCC 2YGVA 3BW9A 4M1DH 2XG9A 4ZB5A 5F1UA 4AT6B 4CSZA 3E80A 3MUJA 4U4IA 5IQ9B 4F0RA 1FV1A 3RFRA 2Y3AA 5C08D 3V0EA 5I76B 5KSAD 1XIGA 3MSDA 3IMSA 4PR4A 1UJTA 4N2NA 5JMOC 1HKJA 5IB2B 2Z6FA 4NYYA 4M1BA 2ZSWA 3SDYH 1QRNA 1TIWA 2NSQA 2R29A 1R9FA 2J8FA 3RL2A 4RKAA 3REQB 5E00A 1VEPA 4HEPA 2HJLB 1EJOL 4NZRL 2NOYA 4R2GB 2ERJC 2JCCA 2VDPL 4HCFA 1SO4A 3GTFA 3MT1A 4FKEA 1A3QA 5KS9A 2AEPL 5IB5A 1QKZH 4YEEA 3IFLH 3MRQA 1XYAA 5ACLA 1HO4A 4LB4A 4YMPA 5J06A 3VIMA 3NRFA 2J27A 1Z5LB 1XIMA 3OGVA 3R10A 2EIJB 1B2YA 3B2VH 1G84A 3THDA 5D1XD 2BSEA 1U8PB 1D8WA 4X4MA 1G6CA 4XV0A 4O13A 1MHHA 4E4UA 4GG6E 2UY5A 5FV1L 3PSVA 4FPSA 4GQ0A 2WVVA 4I0PB 2C9AA 5FS5A 1GYUA 2PP1A 4UUIA 4Y5XB 5D96C 1V3HA 4TRPL 2C0AA 4LSBA 2X0HA 4AEEA 1I9IL 4MMYB 4RBPK 5GJTL 3BG3A 2DWTA 1WT5C 4JFVA 4ZFFA 5DMGC 4AZUA 3CDZB 3UH8A 3W26A 2CHXA 4N0FA 2WQSA 1JHTA 3G04B 3S5YA 3QUMH 4GYKA 3MUGA 1P0EA 5GRZA 3IMUA 4EQ2A 4Y5VB 3S1XA 3MKCA 1XGRA 5DJCB 5D04C 3BDBA 3L1OL 4QRPB 5BOZG 2CXGA 3O2DH 5AC8A 2OZTA 1TETL 5FM4A 1W5OA 3RBSA 4IBZA 4PGDB 3PZIA 4UFJA 4OGYL 5D8JH 4LHUB 1U2HA 2DZPA 3BP4B 3FF7A 3CIQA 1IMHC 4ZK8A 1WOAA 3E6EA 1BHGA 3UAEA 4G1EA 1G0CA 2Z1WA 4XNZB 1NUDA 3QUZD 4G2DA 2PPDA 1Q5MA 7ENLA 2H6PA 2R7EB 2ATAA 4OZFH 1BZ8A 3KNBA 3BSGA 2HG5A 3D09A 1VR6A 3U7BA 4HJ0C 3SE8L 1AZCA 1QRKA 1IE7C 3ZS4A 3HBQA 3WFAA 5JQ9A 4REQB 1OW0C 2XPGB 4UU9A 1U8JA 4XBMA 3VRJA 2MOVA 4XN9A 1GW1A 4JDTL 4KKCD 5DRNA 1FHVA 3L5XH 2FPVA 3UTSD 3FU6A 1UOKA 3V52L 3X14B 5GJMA 3BGMA 4FZIA 2JKPA 1W5PA 1A3HA 3PS7A 3HE6B 4P4RA 5FJTA 2QCLA 4CNIA 1NEYA 4OUIA 1KYUA 1KB9K 1QBBA 1Z9SA 2IKJA 5EMKA 3O6LH 2E7MA 3BPCB 3BP4A 4ANVA 1G6RB 5BOOA 1SN2A 3K7UA 1DEEA 4KDTA 1TYJA 4XXCC 3NZQA 3GHEH 1JDEA 1MEWA 2GGEA 5IXEA 4H7VA 4EZKA 3BPLB 1EKOA 3U5YA 4ZW8A 1P0SE 3DIVA 2PD5A 2VITA 2HVJA 2XPZA 1AR1B 3C5QA 1CL7I 3VFWB 4F7MA 3NQAA 4MNHB 4HQVA 4Z0JA 1PLAA 4XCEB 4TSBL 1ZCOA 2YDRA 3D52A 1XEDA 3VXME 1CS6A 1T1YA 5JA8B 3TN0C 2PDHA 1BVKB 3CT2A 4HPGA 3OBEA 4BZ2H 4QSFA 4YZFE 1MJ7L 4N1EA 2G3ZA 3IF1A 2F8VA 3FO2B 4FG6C 4HHAB 5IM7B 4AQAB 1LM1A 2GFTA 3KPSE 2FL5A 1RERA 1FVDA 5C9UA 4DWHA 2ISVA 1Y0EA 1UCTA 1FAIH 1W9XA 1J5HA 1UWSA 5HYIA 4PMYA 2D2JA 2FX7H 1F90L 1MFDL 1TPWA 4PPTA 3ARTA 3MZNA 3PBGA 1YMMD 2QBWA 4GP4B 3OXSB 3S5LA 2VDKH 5AL8A 3X1EA 4TOQA 4KWSA 4QOKA 1Z8AA 4L37A 2EDKA 3KBFA 3QT2A 2ZVIA 5KITA 4M9PA 4TYUA 5DANA 4JTDA 5K9OB 4PUBH 2DQUH 5HTSA 3SQOL 1FCVA 3F03K 1Q6OA 4WK2B 4R97B 1H3TA 4PTMA 1H61A 1DEDA 2OSYA 2XX1A 4EPSA 4LVBA 1C5CH 3QJSB 4UMGA 2YPKA 3UG4A 3WFBL 5JHDB 1QVBA 2C0HA 3KUMA 4ZTOL 4KBPA 1OZMA 3R94A 3L4XA 4KUCF 4DM1A 3EYSL 3HPLB 5EC1A 3ES6A 5CILL 3ZZLA 3GS7A 2VW7A 1HW6A 4M82A 2QTVA 5G2WA 4JRYE 5K1VA 3H6JA 3AS2A 2M83A 2IXQB 5HMSA 3DAQA 3T9PA 2YA2A 4FFYL 3DXAD 4FTVB 3VNYA 5LHDA 4P49A 5FYKD 5B22A 3L95A 4AVKA 1U42A 5GRJL 3QNXA 4Q14A 3CAQA 4OLVL 1EGMA 5DK2A 3GS4A 1NMBL 1AIFB 3NFSH 1A7QL 2XZAL 4G6AD 4EN3D 1GQKA 1W1YA 4ZYKA 3WYRA 2CJSA 5D8JL 4M1RA 5DMLA 1XSJA 2REQA 1RY0A 1D5MB 1U8IA 2ODHA 2XHNA 4NUPA 5EG6C 3BVNB 5CSUA 1TDQA 1NWPA 1TJIH 3MLYH 3NJFA 5IVZA 2YXXA 1H6FA 5AZ2L 3FQWA 1AGCB 3KAAA 1DVSA 2XX0A 5DS2A 4DCQA 1EB3A 4D8ZA 1SFSA 4G8GA 5FIEA 4HU2A 4WY0F 4LLAA 1RR2A 4DQAA 3GSQB 3NRQA 2NUTB 2WSPA 4QY8B 1P7BA 1UWGH 3B34A 2A3EA 2CCVA 5CPNA 5C6WH 3WLKX 3ESMA 2VVNA 2VOTA 5CC7A 4LVFA 1UOWA 4PLJC 5AWNL 5LGZA 4WI8A 3KGUA 4KZ0A 4QRPE 5GJPA 2DT3A 5AYXA 2GL5A 3EFFA 1QZ1A 1EV2E 2BVOA 4BKTC 2V2TB 2BSTA 4GLEA 1EVUA 4PBWD 4BYHA 3GDBA 3TYEA 4ZAKC 5LG1A 2X4RB 2P7TA 3CU1A 1EBAA 3L5WA 3LZ5A 3STGA 1L9WA 4LCSA 1V8HA 2RCSL 3D6GA 1U5VA 3VXSE 5EZIL 3VGGA 3QZOA 3SKOA 3B2DC 4IMFA 1IEBA 4QNPF 4A7TA 4MB5A 3BOXA 4OKVB 5A2CA 3RR4A 4R0LC 1BWLA 1A6AB 1DCLA 1E5BA 3ZKXC 4M7SA 1ULVA 1HILB 2AVFA 3DIPA 1PD0A 4M5ZH 3EXSA 4PAZA 4HUWB 3R79A 1J1PH 1I1RA 5AB9A 1ADWA 3NPZB 4HS6B 2YWZA 3UCCA 1MRDL 2PDFA 3HE6A 3GVRA 1I9IH 1PLGL 3E38A 2YZ1A 5ILTL 5CSZB 3TA3C 3V8OA 4A6YA 1UXMA 1AH4A 1DWAM 1S9KC 2VDLL 1IGFH 4FF5A 4KUCD 4KC3B 1KJVA 3GE7A 1AGEA 1PJWA 4NZ8A 3GQYA 1QWNA 5GHWL 1PNDA 4EXBA 2MJWA 3TPKA 1MI3A 1VGEL 4D1JA 3VXPB 1F76A 2Y7LA 1VHCA 1YYML 1RY7B 4IF2A 4NUWA 4C4KO 3ZQWA 4JFTA 5D7JB 1IEAA 4JDZB 3H2AA 2O6DA 2PYEE 4R3SA 1NFKA 3FA4A 1A5NC 1WIUA 3GKWL 4L8SB 3AUOA 4TUJA 4WDWA 3U8GA 4UDTB 4JDVA 2DLFH 1DN2A 5DX7A 3IDYB 2VDML 4OFYA 4OCYH 5DF0A 4ZTOH 3RWJB 4XC3H 5IJCC 3OOQA 4PCNA 2WMIA 1CGWA 4PB0L 2H8XA 4UTBH 3VRIB 4HU8A 1RQEA 3FDKA 3IARA 5GVJA 3EG9A 3GG7A 2EXTA 2WXJA 1KV5A 4NU7A 3VDBA 1V7NH 2A1WH 3T8XA 2PEVA 3L4WA 4JX5A 2UZIH 3FB8B 4X6EB 5KYXB 4QXUL 4XOBA 2DZSA 2Z1SA 1GCYA 2OA9A 1YDYA 3CK0L 1R0AL 1SRDA 2XXCB 1BTCA 4S0TD 3GD1C 4LL9A 3GH5A 2X89D 3RPIB 5HXMA 2Q8XA 3RDJA 4A4AA 2EEAA 3QUZC 5A3IC 1J05A 3DETD 5AYUL 4N4PA 2AJZA 3KYNA 1UWYA 2HVOA 2VXNA 2EP6A 4BH8B 5ESQB 2RHGA 3ZX1A 1NM9A 2Z0UA 4K2UH 1JD9A 2ID5A 3K2MC 3ZTJH 2NWRA 3RX3A 4XPAH 2G0WA 4ZS7H 4DELA 1ADQA 4UBDD 2VISA 5IROC 3EX2A 1ME7A 3LSCA 1QWKA 3TU6A 1C1EL 3DHJA 3RVXC 2D24A 2AGJL 2JE8A 3O9WD 5H4YA 2Q09A 3D87B 1SXBA 3VW3L 1Z5LA 1Q9WA 2ZKYA 5GRVK 2RDXA 1BZ9B 3F2BA 2HFGL 1OFRA 4E9RA 4ANKA 2X30A 3T4WA 5LNSA 4IL0A 2VFIA 3L1EA 4WKXA 2B7QA 4LS0A 3NQDA 1NIEA 4DUXA 4Y1AB 4H1LA 4OZHA 3ILDA 2E75C 3ARBB 2QGHA 5AKQA 3M1CA 3VI2A 5LSMA 3S37H 4JQVC 3AB0C 3GSXB 3DO7A 3SN0A 2P5ED 2ZOLB 1XG4A 3LDBC 1EBPA 4H26B 4HOMA 2B15A 4TVPD 3IJLA 2EIZA 1A21A 2YPLD 5DD3H 4X5LA 1BLNB 4H1LB 5PAZA 1J4EA 2QUUA 3C56A 1VHPA 2PWUA 5LNDA 1YDPA 1H7PA 3TH2T 1MPAH 3KPLB 1MCNA 1LMKA 3ZYIA 5GGTH 5B8CB 2Y8VA 3BUTA 4KFZC 2Z2AA 4Q8NA 2WNWA 3NEXA 5LXGL 4TPRL 4YVXA 1TITA 3H9SD 4I9WE 3TP4A 3HJEA 3OJVC 3JWNG 6FABL 3P4NA 1J8HD 4I0PD 1DR9A 4POYA 1QSFD 2J7DA 1C12B 1CUOA 2NQHA 6REQA 1K5NA 2CLMA 2HWZL 3PHQA 4RW3A 3GSUA 5FEBA 3I74A 3FUIA 3E0WA 4Y5YB 3I75A 3NDYA 4JCLA 3RVTD 5E09A 1BVLB 2VRAA 4RFOH 4F9PA 3RO6A 1HH6A 1K85A 3HR5A 5B38B 4ZOAA 4AE1A 5K9DA 1R3VA 3SGGA 1OTTC 1UWXH 3U1PA 2IMRA 3DOPA 1U8NA 3IK2A 5DXYA 3S6DA 4GW4B 4X5WB 5A7EA 1ITBB 5BXFA 1QLEL 1RIUH 1T80A 4BGLA 3TU9A 5KANI 3MBDA 4RIRA 5D7LD 4YS1A 4AVIA 3B06A 2V8LA 2J66A 4ZSTA 2CBOA 3JSSA 4IKKA 3BVVA 4KAQH 1HHHB 4N8CH 2WGNB 4LYRA 3ZDZE 3WH7A 3HC0B 4YSPA 3HM7A 3ENLA 3TN6A 3MOBH 4G6MH 1TENA 3L7EB 3T6XA 3U36A 1H3VA 3FPXA 4UYPA 1R0MA 4F8TA 5DURD 4NJGA 1UA6H 1Z9AA 4HULB 2EIZB 2X3BA 2DQCH 4CCZA 5GGSY 2ADYA 3UA4A 4ZQTA 1B3YA 1HL4A 1RPQA 3HN5A 4JG1L 3RIAF 5I78A 3VFUB 1MNUH 1T40A 4HYRA 3B0VC 4EXPX 3B40A 2BZNA 1QHPA 3KHOA 5A6MA 1CBJA 3PS6A 2BZDA 2E9BA 4IKIA 2R2HB 2FJHB 3H9ZA 3E3HA 5AB0A 2DRUA 3L17A 4HWBA 5FKAB