5CXPA

X-ray crystallographic protein structure of the glycoside hydrolase family 30 subfamily 8 xylanase, xyn30a, from clostridium acetobutylicum
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
387
structure length
387
Chain Sequence
SNDATINVAAKHQTIRGFGASSAWCGALSDTCMDTLYKNAGLDILRVRIAPNEGWNRGDYRAWADELSNAKKVRARGGIVFATPWTPPASMKTNNTTTGANKGSLKPSSYAAYAAYLKTFVKYMSDNGAPLYALSLQNEPDWAPDYDACTWTAQQFHDFLKQYGASLSSTIKIIMPESLGFNPAMSDPTLNDPTTAQYVSIIGGHLYGSPIRDYPLARNKGKDIWMTEHYLEGNDPGTCVKLAKEIHDCMTIGNMNAYVYWWISGDQNGLYNTRTNETYKKTYVMGQFSKFIGNGYSRVDATNSPQSNVYVSAYTGNNKVVIVAINQGTYPVNQSFNVQNSTVSNVSSWVSSGTLNMAKTNSNISAANGRFNASLPAQSVTTFVADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a GH30 xylanase
rcsb
source organism Clostridium acetobutylicum (strain atcc 824 / dsm 792 / jcm 1419 / lmg 5710 / vk
molecule tags Hydrolase
molecule keywords Possible xylan degradation enzyme (Glycosyl hydrolase family
total genus 143
structure length 387
sequence length 387
ec nomenclature
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02055 Glyco_hydro_30 Glycosyl hydrolase family 30 TIM-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5cxpA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cxpA02
4MDOA 2BY1A 1WNOA 3AQUA 3U5UA 3OLGA 1EO7A 3ARWA 4JAWA 4CD8A 1TUXA 1XSKA 2QLYA 3CTTA 3ARYA 4UQCA 4UQDA 1ZBCA 3GXTA 4FLOA 1OT2A 1KCKA 3BUIA 2EACA 3VGFA 1V0NA 1A3HA 3WNLA 5IFTA 4PEEA 2D24A 2WMKA 3PZGA 3A47A 2EBNA 1W1YA 3GBEA 3B9DA 4AD0A 4GIAA 4S3KA 4BF7A 3HZ3A 5IDIA 3EMCA 1GVYA 4WSJA 2A3AA 3GXMA 2VVSA 1UD6A 2PBOA 2W92A 2W67A 2D73A 1V0MA 2VQTA 3CZSA 1F4HA 3NJ3A 1E43A 3TTYA 1Q4NX 3CMJA 1ZBKA 1XCWA 2VMFA 3FW6A 2G3JA 4W8BA 1BYAA 4ZFMA 3WH9A 3ZJ6A 1MWOA 1LF1A 2X09A 2XYLA 1MW1A 1XYZA 5DEZA 3FHAA 3OA5A 2XHYA 3AROA 2JFEX 4JKLA 4C7GA 3DX0A 5A2AA 3W0KA 4NXSA 2ZXQA 1GJUA 1E15A 4D6GA 2UY2A 1M01A 5DMYA 4Y7EA 3W27A 1WDSA 4TTGA 3BLBA 1UHVA 3N18A 2D23A 3ZMRA 3PZTA 3GXFA 2ZWYA 2JALA 4CD6A 1TA3B 1PJ9A 3BGAA 1I1XA 3SCWA 2D1ZA 2XSBA 4J28A 3AJ7A 2F7OA 3TONA 2VZOA 1K6AA 3KL3A 1GOQA 1LG1A 2Z1KA 3WQWA 3S5YA 1C93A 3WH6A 1ECEA 1T0OA 1R46A 3OLEA 3GZAA 2FYVA 3VNYA 1OBAA 4NSBA 4DO4A 2PI6A 1FA2A 3VGDA 2Y4SA 2Z1SA 2F61A 4UQAA 1WZAA 2X2HA 3MS8A 3A5VA 2GSJA 2EPLX 2QHAA 4CGTA 3T0DA 1JXJA 1C3FA 2PF0A 3KE0A 3WH5A 3QOMA 3VU2A 1SFSA 1J0KA 1DHKA 3WKZA 1B90A 3T08A 3L4XA 1Q6CA 2VL4A 3I3EA 1G0CA 3N11A 5A94A 3CUGA 3NUKA 1BSIA 4XX6A 5E1QA 1IT0A 3SCVA 5I6SA 1TVPA 3TV8A 3A4WA 3PBGA 3AFBA 2UY5A 2WSKA 4M80A 1PZ3A 1QNOA 1H11A 3N9KA 1GQKA 1HVQA 4J3TA 1GOIA 1ZU8A 2VC9A 5HPOA 3TTQA 3NSMA 4RE2A 4PMDA 5CXPA 1VEOA 5CGMA 2WZHA 1V6VA 5CPTA 3LMYA 3SUSA 1FH8A 2JIWA 3BCDA 4UZUA 2X2YA 4OOUA 4H8HA 2DGAA 3MI6A 1KR0A 3LRLA 3EJQA 2J8FA 1QX1A 3UG4A 1H3GA 5IHRA 3VIIA 3EMQA 4OGZA 4HPHA 3FY1A 3AIRA 1JZ3A 1JI2A 4JFSA 2YJQA 4YHEA 2PWEA 1TMQA 3PN8A 1KBKA 3A24A 2BY3A 1B3ZA 1LL7A 3HJEA 2VTFA 1DWJM 4MB3A 2YA2A 1W2PA 2OLHA 2FHFA 1G01A 3FNDA 4H8UA 3KLLA 1LLOA 5JBFA 2WBKA 2PBGA 3ZJKA 4D72A 4CKQA 3CMGA 1US2A 4KGJA 5FOOA 2WMJA 1NOFA 1CGYA 1W32A 2F1AA 2J7EA 1LJYA 2J8GA 1XRVA 4AZGA 1JAKA 2VX7A 5M17A 4PTMA 3ZJ8A 2DPEA 3L4UA 5HDRA 1E6PA 3HN3A 1BG9A 2IXVA 3A3HA 2EQDA 4U2YA 2XSAA 3WEOA 1V6WA 2GDVA 3MSDA 4W7VA 5D9MA 2DSWA 2DH3A 1BF2A 4UTFA 3N13A 2GVYA 3KWXA 4W84A 2QV4A 4E8DA 4PYSA 1NOUA 3RM8A 4AISA 2VCAA 1XV8A 1GQJA 3MUZ1 1O7AA 1W9XA 1UZ4A 4AZBA 1ZL1A 2XM2A 1MVYA 3BAXA 3OLIA 1JD9A 1CNVA 3MV11 2WLZA 2O92A 5LA0A 2EADA 5I0DA 2V5CA 1J0ZA 5HNNA 1E72M 2WC7A 1UR8A 3WQ4A 2W63A 4BQ4A 3W6MA 2HVMA 4H2CA 2XN2A 3W82A 5EB8A 3IAPA 3SUUA 3AZRA 3CHCA 4A3HA 3CZEA 3W25A 1EO5A 1UR9A 3AIWA 4N0RA 3ZT6A 1GZJA 3LPGA 3GH7A 5BCAA 4EKJA 1BQCA 4LGXA 4UOQA 5E70A 1JG9A 3U7VA 4CD5A 1MQPA 3VD3A 4D1IA 2JF6A 5C71A 1M53A 3SUVA 3KL5A 1V0KA 2GUYA 3VM7A 3O6AA 2ZWZA 4CD4A 1QI2A 3VX0A 1CZ1A 3VNZA 5E6ZA 3UG3A 1CLVA 5D8WA 2NW0A 1W3HA 2B31A 4RE4A 1G5AA 3GXDA 3EMZA 4WK9A 1XCXA 2G3MA 3D5HA 1J10A 2D0GA 4W87A 2WAGA 7A3HA 5A1AA 5HPCA 4QCEA 3AS2A 3PTQA 1LL6A 3W26A 2UY4A 3WF0A 4B15A 5A6MA 1PS3A 3NDYA 1NWSA 3SUWA 4CCDA 1TR1A 4S3JA 1VFUA 2XIIA 3VSTA 3S2CA 2BHYA 2WK2A 4PRWA 4KMQA 3FXYA 1VFFA 3EDEA 1QNPA 4F9DA 1JZ8A 2UWFA 1E6XM 1V3JA 1LWJA 4W86A 5D9PA 5D4YA 1PIFA 1QHPA 2OWXA 2OYLA 4AMXA 1WP6A 5TD4A 5AYBA 1WAWA 2CKSA 1XD0A 4JL2A 5CG0A 3FN9A 4WIWA 3WFZA 2CPUA 3VIFA 4WF7A 3A6OA 3D4ZA 1BYDA 3NSXA 1KR1A 3OIHA 4HMDA 4E2OA 2E8YA 1ISWA 3AHVA 4IUGA 4EAMA 2V3FA 1CPUA 2JIEA 2X2IA 1E4LA 4JKKA 3WH7A 4IPNB 3WDHA 2PWDA 5A8QA 2VNCA 4GQRA 5F7UA 3MUIA 1ITXA 4HP5A 2WZEA 3IGUA 4GI6A 3MO4A 5EBAA 2V5DA 2CITA 2ZX7A 5BRPA 1V08A 1W91A 1YQ2A 3MUY1 4MNMA 2UY3A 4MNKA 3VD9A 2J7DA 1XHGA 5LA2A 3BLPX 1HJUA 4NI3A 4W8AA 3IAQA 3F5LA 3U5YA 3BCFA 3N04A 1CWYA 3WQ8A 4GO9A 2F2HA 4KRUA 4X0NA 1X6NA 3WDIA 4P7OA 5FIPA 4M8UA 1JZ6A 1BVZA 2J7BA 1MQRA 3WUGA 4EANA 2XIBA 1BFNA 1H41A 1J11A 4XZWA 1AVAA 5D9OA 2WMIB 4HA1A 1KGUA 4PCTA 4AD2A 2G3NA 2J4GA 2O9RA 2XFFA 1ESWA 5GNXA 3RM4A 1W9DM 3VM5A 2WKGA 1WDRA 3T2OA 3BUBA 3JUGA 4AIEA 4EE9A 1PX8A 3IANA 1JDDA 2A3HA 4WLCA 3CHDA 2E3ZA 4JFTA 1W3LA 1J12A 1HXJA 1HJSA 1JF6A 3H54A 3W81A 4PUDA 5A6BA 5ABFB 5A8PA 4HZ8A 1KXTA 4H41A 1RPKA 1W9UA 3CUFA 3U57A 2YL6A 2XGBA 1CXKA 1R8LA 2VO5A 1CXHA 2YBTA 2CBVA 5E09A 1PPIA 3EBVA 3VGHA 2GJPA 4TVCA 4CVUA 4J3WA 3GH5A 1JYWA 1VFOA 2DSZA 3QGVA 1CEOA 5FD0A 1D3CA 1EIBA 3T09A 4OBSA 1IZKA 1J9YA 5GNYA 3WNOA 3AIBA 1J0IA 3WY4A 3J7HA 3KLKA 4PMOA 4U5KA 1SR0A 2X1IA 2BY0A 2ZUMA 4W5UA 1E70M 2VX6A 3WF2A 3ZT7A 2XVPA 1UH4A 4NZJA 2D20A 3LPPA 2DT1A 4B16A 3WBEA 3W4RA 1C7TA 2BHZA 3LRKA 5CLTA 4ML4A 4W8LA 3T2QA 2FDMA 1HL9A 4FNQA 2OWCA 4J3XA 1JIBA 2BHUA 3EJTA 3VGBA 4P7RA 1HP4A 1B3XA 1CECA 1UKTA 4NRSA 3VOCA 1UKPA 4PTVA 1IV8A 2VT0A 3WNMA 2E8ZA 3IK2A 2YA1A 1R87A 4XUYA 1JNDA 2VURA 4JL1A 1E6ZA 4OBRA 2OW6A 1QNRA 2J25A 1UWSA 2GJXA 1WZKA 1PAMA 3TTSA 1ZS2A 5D8ZA 4P8WA 3AYRA 1NARA 4OKDA 3WDRA 1VRXA 1V02A 1B0IA 2OYKA 3VGEA 2OWWA 2GJRA 4DO5A 5A6LA 2WWDA 2TAAA 3SCQA 4Q22A 1KQYA 1UR0A 2NT0A 4TVUA 4CN4A 4F9JA 1XSIA 3WIJA 1TQUA 4JFUA 1ZBWA 5A8MA 4DUWA 1Q6FA 2ZXBA 1GVIA 2Y8KA 4EK7A 4N42A 3WDPP 4W93A 7TAAA 4V2XA 3OGSA 2EABA 2GK1B 1WDQA 5HXMA 1JZ5A 3RO8A 3AHYA 2YFOA 5LA1A 1E40A 2XVKA 1Q6EA 4AZ7A 2PC8A 4ZEPA 1WO2A 2J62A 4CCCA 2QPUA 2FHBA 4OZOA 2WMFA 4UQ9A 3BSHA 1UA3A 7CGTA 3RJXA 3WDJA 2CYGA 1CENA 4UQEA 5JIPA 3BUDA 4XB3A 2AAAA 1E6SM 1CGXA 1UR1A 3GYCA 4QLKA 1QPKA 1FOBA 4ACZA 2X8RA 3WQVA 1C92A 4Z2IA 1M7XA 1UH3A 3AXXA 2YL5A 1BTCA 5DT5A 1WDPA 5M3WA 1ISYA 3IJ9A 3UESA 4ZE5A 3PZOA 1YHTA 4E8CA 2W5FA 4LXFA 3M46A 3SCOA 1HT6A 3BXWA 1CGVA 3G6MA 2J77A 3K1DA 3I3DA 2DIJA 1RP9A 1CLXA 2WHMA 2X0YA 4AWEA 4CUCA 1ZB5A 3VUPA 3CZKA 1E73M 1E4NA 5KEZA 3L4ZA 3ARRA 4C7FA 4QCFA 3CZLA 3SEPA 3CZNA 3TP4A 1CXIA 1OM0A 1UR4A 4B3LA 1C91A 1UD4A 2WW5A 4V27A 2WB5A 4MJ4A 3EDDA 3BVXA 4H7VA 5BXPA 1GQLA 2PB1A 2V38A 1EQCA 1R7OA 4JHOA 2BS9A 4U5IA 4U3CA 2J79A 1OWQA 5CJ5A 4PMQA 3WY2A 4J3SA 2WCSA 2XTKA 3ARPA 2V3EA 1QNQA 3EJPA 3VIGA 2YFNA 5BXTA 3CH9A 2CBJA 4AZHA 3LXAA 3CUIA 2XPKA 1SYTA 5A6SA 5EMYA 4W88A 1N82A 1NP0A 1UWTA 3N1AA 3KZSA 3KL0A 2F7PA 3L4YA 2BVTA 4E4PA 5A3HA 4PTXA 3K4DA 1R75A 3EDFA 4BS0A 3O2LA 3DHUA 1EOKA 2BVYA 4JKMA 4MB1A 3MKKA 2Y8VA 5I23A 1NWUA 1JZ7A 3EJRA 3D50A 1J0YA 4GO8A 4UR9A 5E0FA 5EFDA 1ODZA 4PMXA 3CZJA 2ZUSA 2XN1A 1E6NA 5I3DA 1K9DA 1E56A 1WZMA 1E6QM 1FP9A 3M7SA 3M6DA 1GNXA 3UETA 4X0VA 4U33A 4B9ZA 3WMCA 5BXRA 1FFQA 2VCCA 4P7NA 5BRQA 3AMGA 4AW7A 3ARXA 3MU7A 3ZQ9A 5LYRA 3WF4A 1FHLA 4HA4A 4C7DA 4BQ3A 3EJSA 3K8MA 2DT2A 2HISA 1HP5A 3DYMA 3GNOA 3THCA 4AZCA 2XVNA 3MSGA 3HU7A 1H5VA 3VILA 4PMUA 2XGIA 3S5ZA 4CU6A 2EEXA 5ABFA 1JD7A 1H49A 3CO4A 1OGGA 3DYOA 4D1JA 2Y5EA 3VD5A 2DIEA 3D4YA 3BAWA 3NCOA 1QWNA 1RH9A 1C7SA 1KCLA 2C8NA 3N15A 4HMEA 2WANA 4KGLA 5JIWA 3VSUA 2EPNA 3THDA 4NF7A 3RIKA 2GDUA 3A4AA 3ZR5A 1V3KA 5A6AA 2EPOA 3AI0A 3MMDA 4PBGA 2D2OA 1MXDA 3EJUA 3PZIA 1OCQA 4NZCA 2ZUVA 4TTUA 2C0HA 4UFLA 3T0AA 5E9AA 4JZ5A 5A6JA 3CUJA 1QBAA 3T0BA 3WD4A 5I2UA 2WNWA 2YOCA 2G41A 3B9AA 2WMGA 3PZ9A 2QMKA 4LQ1A 3POCA 1EDQA 1CYGA 1JZ2A 2JF7A 4MDPA 4Z2JA 1E0VA 4MNLA 1ZJAA 4JCMA 2ZX8A 3UG5A 3N12A 1UWUA 2WHLA 3N17A 1EDTA 2D0FA 4BQ2A 1NOWA 3VD4A 2BVDA 2WM0A 1KXQA 1XC6A 3AS3A 2JEQA 1EQPA 1HVXA 3F5JA 1TE1A 2YBUA 2VCBA 1HIZA 1UQYA 3SCNA 1U33A 4XV0A 1XYFA 4AD4A 3ARUA 3VIMA 3VX1A 2J7HA 1TQSA 1QHZA 2E40A 4IISA 2AMGA 1B3VA 2F1BA 3AICA 2EPMX 1CXFA 5AY7A 1WCGA 4D6DA 2ZXDA 5C70A 1WPCA 2ZICA 4HZ6A 3WF1A 1MFUA 3BAJA 4CVWA 2WVTA 1C8QA 1X6LA 1R86A 4YN5A 2J7FA 4Z2GA 3PHAA 3BUPA 4AZCB 2DEPA 2BXYA 4BCEA 5IXEA 2VRJA 4HOXA 4PMNA 1MFVA 1GHRA 5AC5A 4P8XA 1AQMA 3HG2A 4LPCA 2BV9A 2YL8A 1QW9A 1TQTA 5I5RA 3OBAA 5D9NA 4YPJA 2VVNA 2CHOA 4P8VA 1W1PA 4LYQA 4AZIA 5CPQA 2CBIA 3I3BA 1JFXA 2F8QA 3D52A 8A3HA 4P7LA 1DWGM 2IUZA 2W4XA 1PX4A 4HTYA 2GK1A 5GNZA 1JDAA 1DP0A 4FNTA 1HNYA 4IM4A 2YLAA 4UZSA 2ZUTA 1Q6DA 2D3LA 6TAAA 1GONA 2F7QA 1R33A 1TQVA 3VIPA 2WMHA 1J01A 1OD0A 3CBWA 3MV01 5BYWA 3KEHA 4FMVA 2J74A 4J3UA 3WY1A 3PZMA 1CGTA 4LYPA 3FAXA 3F4VA 4MNJA 1E6RA 2WPGA 3DDGA 1PX3A 2ZUWA 4ATLA 2VRQA 1MW2A 3VPLA 1E3XA 3UCQA 3OZPA 4M24A 5JBDA 2ZX6A 3QHMA 5I77A 1B2YA 2X05A 3AZSA 4WJXA 3L2LA 5BXSA 2WCAA 5I24A 2J75A 4MTVA 4FLSA 1M04A 1H09A 2WHJA 4DUXA 1UKQA 1HJQA 1EH9A 4FK9A 3CV5A 4J27A 4HU0A 1BYCA 1HF6A 2DSVA 3U7BA 3GTNA 3WD1A 8CGTA 1C8YA 4QDMA 1XGZA 3PTMA 1OINA 2VZVA 1JYNA 3W37A 1E71M 4U2ZA 3BVUA 4UFJA 1C90A 1A47A 1JAEA 4B3KA 3SCSA 3ZR6A 1JI1A 1J0JA 4H04A 2FE0A 4CN1A 4QLLA 1EA9C 4Z2LA 2CHNA 4PN2A 3GBDA 4Z2HA 2CXGA 5GQBA 2BXZA 1H4PA 4CCEA 5M5DA 4WKFA 1JFHA 3B9EA 3AMKA 2Y24A 3W38A 3VSVA 1BLIA 1TZ7A 4KWUA 2W62A 4ACZB 3F5KA 2ZX9A 3NSNA 1VB9A 5JBEA 2VX4A 2FGZA 2ZX5A 5CZKA 5A8OA 2NSXA 3TOPA 4AMWA 5I78A 2FHCA 1OD8A 1E1EA 3EYPA 3WMBA 3AOFA 2VZTA 2BFGA 4RE3A 5BROA 4PMRA 3AMCA 1B30A 3AHZA 2O9PA 2VZSA 4DWSB 3ECQA 1W1VA 2IGTA 4A4AA 4AIUA 3AIEA 1B3WA 1W9BM 2ZOXA 3L4VA 1ZBVA 2EXOA 3LX9A 1M03A 1UWIA 1R47A 1UOKA 3IJ7A 3VIOA 4URIA 3BVVA 3PZNA 3G6LA 3VIJA 4J3VA 1UD3A 1QVBA 2DSUA 1V0LA 2VI0A 3DC0A 1V6UA 1JZ4A 3BAYA 2OYMA 1BPLB 4MB5A 4ATDA 2ZIDA 3HMCA 1QWUA 1B3YA 1D7FA 2DQXA 3LXBA 3VO0A 4AZ5A 1VFMA 1KBBA 3BSGA 2V3DA 4GZEA 3VDHA 1XH0A 2C7FA 3BMWA 1G9HA 5A6KA 3VMPA 1QI5A 4AIOA 1RD6A 2CCRA 3WNNA 3VDCA 2BY2A 3GXIA 2Q8XA 4IPLA 3NYDA 1QI3A 3ARSA 1XD1A 3OZOA 3DX2A 4RL3A 1E4IA 1HJWA 2E9MA 1QOXA 1PIGA 2CEQA 4M81A 1B31A 4ZENA 3L4TA 4CU8A 4D6FA 3WUEA 4CU7A 2Y2WA 4AEFA 4A3YA 1BGAA 4ZXLA 1E55A 4HA3A 4MPKA 2EJ1A 1HJVA 2WYSA 2DT0A 3BLKA 3WENA 3W28A 3AIQA 1L0PA 3WNPA 1AQ0A 4QP0A 1K9EA 1V02E 1XSJA 2IXUA 3ZOAA 4HZ7A 3CZ8A 2VOTA 5A95A 3HG4A 3CPUA 2OSWA 1XH1A 4JIEA 2CNCA 4UOZA 1VENA 1LG2A 3WQ6A 3AXHA 3APGA 4BQ5A 2YA0A 3S6TA 1HKKA 4D71A 4W7UA 6A3HA 3VIHA 2W91A 2YL9A 4FNPA 2YKKA 1G1YA 2WCGA 3K46A 2XWEA 3UERA 2OSXA 3H55A 1H0GA 4AYSA 1UKOA 5A69A 3A23A 3WEMA 3PZUA 3SCRA 2ESCA 3DX3A 1ISXA 1ITCA 1PZ2A 3SCUA 2F18A 4DUVA 4AC1X 3VKKA 5ABEA 4OUEA 1V6XA 3WL1A 4GINA 2G3IA 3NDZA 4L4PA 4D6JA 3GH4A 3GNPA 3RJYA 3ZJ7A 1VJZA 1GQIA 3BAIA 4W89A 4UFMA 2A3CA 1WKYA 4M1RA 3OG2A 3W53A 4D6EA 2WVVB 1ISZA 3BC9A 1K9TA 2OSYA 1GW1A 5FKYA 1DTUA 1VBRA 3MMWA 3SUTA 1NP2A 1Y7VA 1FP8A 3B8SA 1SMAA 1HTYA 3CIVA 1V3LA 3CHEA 3FAWA 5I79A 4X9YA 1B9ZA 4AMCA 4KH2A 4CN6A 5JUVA 4ZE4A 5CSYA 1R34A 4GPNA 1E0XA 4NZFA 4QLJA 1BGGA 2WSPA 2W66A 3AHXA 3AISA 5E0CA 3ZT5A 1LL4A 3E1F1 3CHFA 3UR8A 4TX6A 2XVLA 3EDKA 2F7RA 4B9YA 5CLWA 2DDXA 5DF0A 1KXVA 2EO7A 1EDGA 1I1WA 1MYRA 3IJ8A 4W5ZA 1Q6GA 4L4OA 3LPOA 4AXNA 4D6CA 2XWDA 2ZUUA 2YDQA 3AYSA 2JEPA 1FFRA 3II1A 2G8ZA 1KWKA 2PWGA 2PWHA 4TUFA 1KGWA 1P6WA 4NRRA 3WQ5A 4FLRA 1NWTA 2WBGA 1UD8A 4NXKA 1DWFM 2CBUA 1TG7A 1OGSA 1HL8A 1JNEA 4FLQA 4UFIA 1KQZA 1KTBA 5AYIA 1EXPA 3GDBA 1EHAA 2XFRA 5CGTA 1SZNA 3SIMA 3UEQA 1ISVA 2QMJA 3CGTA 1R7AA 1U2YA 4WSKA 4GXPA 3W6LA 4KRTA 3AMLA 2WKLA 5IFPA 3QHNA 4H8VA 1UA7A 4PMYA 1CGWA 2WXDM 3QR3A 1GORA 1KTCA 1UASA 4UFHA 2G4FA 4F66A 1FH9A 4GQQA 2FGLA 3MUAA 1SMDA 1IZJA 1TFVA 4MAVA 4AYGA 3EDJA 1JF5A 1H2JA 3WD0A 3O9NA 1D2KA 1K9FA 2PWFA 1EHNA 1MW3A 4XZBA 3AZTA 3M07A 3RMEA 4AEEA 2CKRA 1JXKA 1QI4A 4FF5A 1UH2A 4ZXOA 5CSUA 1UD5A 5ECUA 2WMIA 3RDKA 1MW0A 1EOMA 3T2PA 4PTWA 1E1FA 1XH2A 4OJYA 4PUEA 3GXNA 2V3GA 3CC1A 4W7WA 3QOKA 1VEMA 4GI9A 2WVSA 3TTOA 1ODUA 2XUCA 3WN6A 3RCNA 4BA0A 2VZUA 3LXCA 1H1NA 1E5NA 3DHPA 3WELA 4DWSD 4Z2KA 1UQZA 3HG3A 4FNRA 3W24A 3K8LA 1GPFA 2E0PA 3VD7A 1VEPA 4PMZA 1VF8A 1GHSA 1EGZA 1GCYA 5M03A 5EFFA 2EPKX 3VIKA 2VUYA 2VX5A 4UQBA 1J0HA 2X0HA 2ZXAA 6CGTA 4M82A 1W2VA 2FH6A 4HOZA 3MANA 2QF8A 1V3MA 1E5JA 3RM9A 5CQ1A 1UKSA 3OGRA 3AIVA 4DO6A 1DWIM 3BMVA 1UYQA 1CXLA 3A22A 2YDRA 5CPSA 3BVWA 5FL0A 3WD3A 3TA9A 2ZUNA 1VAHA 3ARVA 1JYVA 2VQUA 2D22A 1CGUA 3VDBA 4QAWA 1NQ6A 1O7DC 4CD7A 3DYPA 4ACYA 3WUFA 4M29A 4P8UA 1PEZA 3PZQA 1E0WA 1NH6A 3AS0A 4AZ6A 5GPRA 3WF3A 3L2MA 1KFWA 1V3IA 3WBAA 4HMCA 2ZE0A 2WC4A 4AD5A 1BG4A 1GOKA 1R85A 3GNRA 3CZGA 1WB0A 5DO8A 1VJSA 4AD3A 2GJXB 1MXGA 2DSKA 1I75A 1HJXA 1BHGA 3PTKA 1W9VA 1GJWA 2BNJA 4U3AA 1O6IA 3VDAA 1UD2A 3MMUA 4QFUA 1TA3A 3VINA 2XVGA 1VBUA 4BZYA 2AOSA 4U31A 1OT1A 2RGMA 1LQ0A 1JYXA 3AMDA 1HX0A 3D51A 3DDFA 1W3KA 4D6IA 2VJXA 1GOMA 4WKHA 4M56A 2A3EA 1TCMA 2J78A 2JE8A 3K4AA 2OW7A 3ZO9A 2WC3A 2CIPA 5A6BD 1NM9A 4NX0A 1L8NA 1VIWA 3RILA 4DM1A 3GXPA 4MJ2A 2MANA 4F79A 1U30A 3ZSTA 2D0HA 2QPSA 3OGVA 2FH8A 3D3AA 5E6YA 1FH7A 3BH4A 2WHKA 1NWRA 1HKIA 1QNSA 3SURA 3W29A 4LX4A 2CERA 3K8KA 1OIFA 1JDCA 5A8NA 1E3ZA 2YLLA 4AD1A 1OB0A 5ABHA 2O9OA 3BVTA 5DFAA 3WFLA 4P7QA 1TQWA 3H53A 2VR4A 4DM2A 1KGXA 4Q7NA 2DT3A 4FNSA 1Z32X 4GKLA 3LRMA 2DH2A 1W1TA 2VRKA 3WNKA 4TXEA 3WH8A 2W61A 4AY1A 3DX4A 3ZIZA 4MB4A 1UWQA 3BAKA 5HBFA 2E9BA 5KZ6A 1CXEA 2RGLA 1W9PA 9CGTA 4V28A 1CBGA 4FNUA 1CTNA 1MQQA 1GUVA 1KXHA 4DWSC 3ALFA 5C8BB 1HXKA 3FHQA 4HU8A 3AXIA 4OIFA 1HKJA 4JCLA 4W85A 4F8XA 1BYBA 3DECA 5HOSA 3WD2A 1JL8A 3AIUA 2WWCA 2XFYA 3VVGA 1DEDA 2YDSA 2J7GA 2YIHA 3WMSA 4TOQA 1KB3A 4DWSA 4HPGA 3GM8A 2D3NA 4J7RA 3NIYA 3WSUA 3VGGA 3AS1A 1ZJBA 3BUQA 2O9TA 4PSPA 1J18A 1US3A 4PSRA 4PCSA 1GOOA 4R27A 1V03A 1UG6A 3A4XA 4MAZA 1W3JA 4HOWA 3CUHA 2E9LA 2XJ7A 2E4TA 1B1YA 1H0IA 1S46A 1UWRA 2NT1A 4ATWA 3WEZA 4UOJA 3OLDA 1UZ1A 2A3BA 5FCZA 5AC4A 2XN0A 4K68A 3OB8A 1E4MM 5A2CA 1HN1A 3SCPA 4UFKA 1F4AA 3VMOA 2XG9A 3POHA 1DWHM 1QW8A 1G94A 3DX1A 1QHOA 5FL1A 1LWHA 1V6YA 3HG5A 3A21A 1CDGA 4UCFA 4JHZA 4PMVA 1QBBA 3PZVA 1OIMA 3ZM8A 1HKMA 1BAGA 2ALWA 2EAEA 3L4WA 1DWAM 4YHGA 3ZSSA 3ARTA 4GI8A 4OOZA 4GZIA 1QI0A 5IHSA 4D6HA 5ABGA 3ARQA 3SCTA 3WDQA 1X1NA 3LPFA 3WL0A 4WKAA 3QHOA 4UNIA 2GFTA 3UR7A 1JGIA 1OGBA 1WE5A 3CLWA 4TVDA 2WVVA 1V3HA 1UR2A 3WUBA 2VR5A 4MADA 3ARZA 1UUQA 5A2BA 3ALGA 1WZLA 4R5EA 2WVUA 1C8XA 3VTRA 2XM1A 1HWWA 4TX8A 2WZIA 1AMYA 4GZJA 4LYRA 4JFVA 5BWFA 3VMNA 3WY3A 1E9LA 2CESA 3RPMA 2CETA 1GOWA 1TVNA 3AHTA 2J7CA 1AQHA 1FHDA 2J47A 2WLYA 1RP8A 1CIUA 2X2JA 4JFWA 1PBGA 5DT7A 1BVNP 1OSEA 1KWGA
chains in the Genus database with same CATH superfamily
1CDIA 2DQEL 5AUMA 3TJEH 4XP6L 1P5BA 2NX3A 5IBXC 4XNQB 3U5UA 3D0VB 1AANA 3JZUA 1NCWH 3QG7L 3GW3A 3NQMA 3IJYB 3U6RB 3QEUA 1JCJA 1TUXA 4FIRA 1D7DA 5B1JC 3P4OA 3F62A 4O14A 3SPIA 3JU2A 2C9VA 3EYQD 4G9FE 5I5MA 3L68A 3W00A 4XPHL 4D94A 4WU7B 1ZHBA 2EACA 3H9ZA 4JHBA 3KRZA 5MENE 1ZA6A 2MOVA 1A3HA 1V0NA 1CB2A 1E9QB 1KCUH 4M62L 2M2DA 3PZGA 1KJMA 4WUKL 5C8JA 2YXXA 4C91A 3SDXA 2R0KH 3Q01A 1EJVC 3NAAH 3SKJH 5HVHC 1OWWA 4GIAA 4K94L 1OVZA 3MLYL 2ZBTA 3W76A 4DBDA 4UF7C 3WN5A 2CG9X 2NY6C 3Q48A 3O4LE 3T9WA 1INEL 3M5ZA 1ZRUA 1OADA 5IMKB 3S1UA 1EVUA 2A3AA 4TUJA 4L3AA 2NUTA 1MCPL 4GG6F 3HHSB 1U92B 3VG9B 3NQ8A 5AVRB 3OXRA 4NFDA 1XT5A 3TAKA 2CDGA 2W92A 1PKYA 3MCKB 3UTZB 1WGVA 2W67A 2D9CA 1TELA 4IQHA 3DFSA 3WQPA 3CYVA 4ERAA 4QOKA 3CZSA 1GQNA 4DCQA 1BX2B 3FFDB 3PAOA 2ZZ7A 4WU5B 5IMKA 3CMJA 1F18A 4MRBA 5LUMA 5AC7A 1P6CA 5EN2A 4TUOA 2HXTA 4XZMX 1W37A 4TLUA 5LDUA 1BYAA 3WH9A 3WLBB 5LBVA 1F58H 1TJXA 4ODHL 3T81A 1L6PA 1NWPA 3ES8A 1MW1A 2W65B 4ORZC 5JXAL 4EWJA 3H3BC 1U93A 3EG9B 4MA1C 3FHAA 3JS3A 3B0UX 1Q9OB 4IOTA 2XHYA 1E9PB 3VUAA 2X1PA 1U4FA 4I6KA 3CAVA 2W8CA 2IBGA 4JKLA 4WI5A 3HI6H 2AGJH 3P69A 5AOKA 2RTTA 4GJTB 5KSUA 5L8LB 2HTLC 5KJRH 1EHLH 3W1XA 4WJ8A 5AHNA 1THFD 1YEEH 1B4LA 3I50L 1UB3A 3TYBA 2G5UA 3OJDB 4IU2B 3BZ5A 2WUBL 4PLJC 2ZAGA 1IEBA 3W0WE 4KNSA 1NGWA 2DMKA 3LS5L 2IQ9H 3MRPA 3QUML 4UOW1 5HI4D 4ZMPA 1F3TA 1QT1A 5B3SB 1LZOA 2PTZA 4EXQA 2YSWA 4KCUA 4KXCA 4ZMQA 5IOKA 2H32B 3B56A 5DMYA 3QW4B 4UAOB 3SPCA 4HQVA 3W27A 1A4BA 4CVZA 3WUWA 5IEHB 3N4EA 2VERA 1UHVA 1G9NL 3QO0A 2WYHA 2A7PA 1U41A 3TYFB 2F0CA 3IGFA 4FFYA 2BIMA 1IGCH 2ZWYA 3W2DH 3IKKA 1VERA 3BXNA 3MYJA 1FO0L 3FU8A 4HUUA 2XTJE 3RPIA 2VXQL 5C0DB 3OBKA 5L6UA 2E75C 5EH1A 3DOHA 1DQDL 4NAFB 4A22A 4TMCA 3QXUA 3ABOA 3BKCH 2EC9U 2BSBA 2GGGA 6PAZA 1LCOA 3WKQA 1EX0A 3TONA 4B60A 3KJ4C 4XPFL 2BPBA 3STBA 1KN4L 1FWGC 4WENB 5AZEL 1IGTB 2CZNA 3FT4B 3IETA 4PGEA 4P3WA 4IJTA 3JV0A 1LG1A 4ZQPA 3T6QC 4OQTH 2X16A 3BFQG 3CUPB 5DEFB 2Y5JA 2YPVA 4OLWL 1U2HA 1KRMA 4O11A 1Q6RA 1PKQB 2OZ8A 3VRJB 2A6LA 1R46A 2ICWA 3KNBA 4NOBA 3RAOA 3NDOA 5K4ZA 1NFAA 4Y19B 2HUHA 1XGRA 3IJEB 5ANMA 4HW6A 2AK4D 3NXFA 4WI0B 3MLTB 2VD8A 4DO4A 5L4MA 4L23A 3V0WL 2F8XC 1FA2A 1I8MB 4LCQA 2Z1SA 3VFGL 3V0AC 1VIZA 4WWKB 3UYCA 1SOSA 5IMOB 2BM3A 5FHAL 5F1NB 1XB8A 4P5MA 2P8PB 1LRQA 4Y2OB 2V33A 4CGTA 4XVOA 3HTLX 4HCGA 1EANA 1C3FA 4LCIL 4JN2A 4NSKA 3KE0A 3WFEH 2HV5A 5IBLD 3UXLA 4PRNB 3EO9H 5BS0B 2QUUA 1ZVSA 2I9UA 4NN6B 1DORA 4RRPM 1SQMA 3QZOA 3E0IA 2BVOB 1B90A 4AYBA 3UTTD 4PS8A 1XQKA 4DAFA 2VL4A 3ARBC 1OCWH 5DJDB 1IM3D 3M16A 2D03L 5J12C 2QCMA 1NEZG 1MCWM 1O6TA 5IGXH 3VYLA 5IQOA 1SUXA 1CG9B 5IFJB 2E56A 4QEEA 3DV4B 1UB5B 3SCVA 2AJYH 1MFNA 3A4WA 3PBGA 4P59H 4XX5A 1S2AA 4OVUA 4F1ZA 1TZOA 3N40F 1AGEB 3WKML 2V9RA 4LL4A 2O26U 5D1ZC 1HKLL 1H11A 3N9KA 5T8GA 1CW2A 4UTTC 1V7NH 2UZIH 1YN7A 2X30A 4AHPA 5HYSG 1GOIA 4AIZB 1Z7JA 3TBSA 1U8JA 3FSVA 4ADSA 4RE2A 1RVFL 2L8AA 1VEOA 3K0WA 4ENZA 5CGMA 5IQ9A 3S3PA 4MQ7B 3HO8A 3K3QA 4PJ8D 1I8KB 1QSFE 1T7VA 5I09A 3PGFL 2JIWA 3HQPA 4KMTH 1CD1B 1XCTB 4OGAC 3N29A 4Q7BA 2NW2A 3CAWA 2RB8A 4D9RE 2IPTL 2X2YA 4OOUA 3F58H 4H8HA 5D2TA 2UZXB 2DGAA 5HVFB 4Z7WA 2FWUA 2XWBB 1KACB 1KR0A 1E4KC 5T26A 4FADA 4F7EA 1EMTL 1JXFA 5LO7A 4FA3A 5ANMB 4GKNA 4OJFH 1Y6KR 2DLFL 4JRYB 4UYQA 5B1CA 2FVNA 2ZG3A 1FWSA 4ONVA 2NQCA 4G8EB 4GBXB 1LOSA 2EVIA 5GSVB 4MVAA 4HPHA 4PJDF 4N2CA 4RW5A 4LP8A 2K4AA 2NNRA 4XR8C 3ZDXE 4P46D 1JI2A 3ZDYF 1OVDA 1R3VA 4GZ7A 1MIEL 5D1XB 1DDHA 5CSBA 3QQ4A 3E3HA 5AFAA 3N50A 2O93L 1QQDA 5C0AE 1TMQA 4AYFA 2DRUA 4QHLB 3GMLB 1XPGA 1NIBA 3RZCA 2A83B 1B3ZA 5EMLA 2VFDA 4HYTB 4P57A 4UANA 4YLBA 1EAJA 2CM6A 3D4CA 1E67A 1J05B 1CLOH 1SM3L 2CJSA 3GC3A 2YA2A 4MB3A 3U0PB 3U7WL 1XYAA 1DLHA 2TSBA 5HQEA 1KCRL 2FHFA 4N5ED 3B0VC 4XH2B 4KK5C 4GW4A 1RALA 3NFUA 3QC3A 3CSTA 1OK6A 4X8JB 4Y5XC 4RQQA 5LNEA 3SM0A 2WBKA 5G2HA 1FPTH 3NZGA 2GUUA 4YJ5A 3CAKA 1OP9A 1R3TA 3EYFB 2GTWA 1P43A 1X44A 1CFVL 3IMBA 4FFWD 4I0PB 3T3PB 1P1XA 4LUIA 2D03H 3FC8A 3R0DA 2CLLA 4V15A 5I71C 2G9KA 4Y1AD 4Q97A 2PS2A 1UXSA 3MI3A 3F2CA 3P2TA 2ZNWA 5C08D 2J8GA 5F2IA 4B3EA 3V5FA 1E27A 4U1JB 1UXMA 1ZQ5A 2H6RA 3SN1A 4R8WL 3ALPA 1PZAA 3QHFH 4ELDA 1U0QA 1V55B 1WFNA 5C09E 1SHWA 1MNUL 3DGGB 1Z0NA 4PTMA 3ZJ8A 4NAEA 3STEA 1D5BB 5K9OA 3U1QA 5IW1A 1BG9A 1E6PA 3H2QA 4OH2A 1MDRA 3VXPA 1K85A 5FF7A 2XSAA 4LLUA 4LP5A 3HZMA 4GQZA 5IBTL 1AI1L 3LV3B 3RTQC 2XDFA 3W3BA 3HQOA 3GEWB 3FCBA 3ESMA 1GYWA 4NM8H 4P4RB 4ZUVA 3TFBA 2DSWA 5D9MA 2YCKX 5D02A 2PUQT 2KYIA 4ACTA 3H9SD 3GR7A 2XV2A 3B7TA 3GKWL 4AC2A 1XL4A 5I18L 2Z8WC 1C12B 2IMNA 4N86A 3S0PA 3IGLA 3FB5B 2HRWA 2QV4A 4MY1A 4X7TA 4N3UA 4YSEA 5LIYX 2FBOJ 4PAZA 4AWJC 4FKKA 4TTDD 4F58L 1OZUA 2XA8H 4QIRA 4FQLH 1GQJA 2HRGA 1S1PA 1VGEL 2YJLA 1SN2A 1W9XA 2L4OA 4JPIA 4YHLL 1XF5B 3VIPA 3PDGA 2YBRA 4PJDA 1ZL1A 4KTGA 1YNYA 1YEGL 1GOXA 1MVYA 2XM2A 4LNCA 3KBEA 1F8MA 4A7VA 1WKFA 4CVXB 3UWEA 3BWAB 2OJEB 2WLZA 3LH2L 4PI2A 4H8QA 4QHNA 1V5JA 4BYHA 5D96B 1QATA 2BNUA 1HFUA 2QKIA 3GSNB 3PUCA 3E9UA 3BOLA 2NNXA 4UDTB 2A0NA 1IKFL 2V5CA 3LNEA 3TA4D 2BOBA 1T6WA 1IEBB 5HNNA 4OLXL 4E9SA 3ELFA 2LABA 1DFXA 3MR9B 4LSBA 4UNKA 4E9YA 4HYWA 1N8ZB 2YARA 2XWTA 3ATBA 4JFFD 3QRHA 1N5YL 3W7DA 3BQUB 4G7QB 4O2EA 5IR1B 4GUCA 4G83A 5HY9B 1LQAA 3IAPA 2QUNA 3CHCA 4KI1A 3TA3A 3QO1B 3GB7B 3TO4C 4X6FB 1MJUL 1KRCC 4N68A 4JVPA 3GHSA 1UR9A 1T5XB 3AIWA 4N0RA 3APYA 5JH1A 1C9WA 2Y7FA 3ZT6A 2CHZA 4R84A 5HI3D 3T1GA 4LNRA 4J5VA 3GTFA 5C08B 3MREA 3TASA 4XIAA 5GZOA 5BCAA 4EKJA 4GBUA 3WJJC 3SGUA 3GZQA 1N5AB 5CGBA 1OTSC 5DJ6A 2LR4A 4UOQA 4PRTA 3DVGA 3KFTA 1B3JA 3QR1A 3UTPD 4AV4A 4C6CA 1FORL 3C5ZA 1MQPA 3EAUA 5DWUL 1M53A 4B41A 4N1CA 3SUVA 5HD8D 4OQ1A 2GUYA 4LCUA 1MNUH 4ODHH 4Q8PA 4WI8A 5BWAA 2ZWZA 3W87A 3NR0A 1FHGA 4HBCH 4HJSA 3JWDL 4MFDA 1QWGA 1OFDA 3RFZC 3QEQA 5E6ZA 3UG3A 4Z7WF 3GC2A 5D8WA 1E2WA 3MU3A 2EVHA 3MV7B 1KMGA 2GSIB 1G5AA 1VZHA 2YAMA 3JV5A 3TPUA 1MO0A 2HFFA 4DJED 2A77L 3JWOH 4G8GB 4MQSB 3D5HA 4M7JL 4TPRH 5CCJA 5KSAA 1KCXA 3EGDA 2DQTL 2PTYA 3FCPA 4W87A 2WAGA 2FJUB 3ATAA 5F70A 5IBLC 1B6DA 2A4ZA 5A1AA 5D55A 4B9IA 2A1WL 3EXLA 3HOJA 3QLDA 4R7NA 1RZKH 3W26A 1TIUA 4NPYA 3GGWA 3O9WB 3QUZC 4HH9A 1R5YA 4WU7A 3UTQB 2OZTA 1YC7A 4NO3B 2VKZG 1KC5L 5DMMA 3MP3A 3RU8X 3CIAA 3BX7C 4CCDA 5MKGB 1JHKH 1IGCL 4UDTA 1I1AB 4S0TD 3VSTA 3S2CA 1GC1H 2ARJB 2GZXA 1F4YH 5D2NA 1FH5L 3PULA 5KAQG 5XINA 4BEQA 5HHNA 2BW5A 3C2OA 3PWVA 2BMKA 2YUZA 4X4KA 1ET5A 1FL3B 5H2BA 5LXVA 2YAEA 1XXXA 1IXPA 1I9IH 3HR5A 2ADGA 3HRZC 3ZL4L 2UWFA 4S3FA 4N1HB 3KBWA 4W86A 3WK3A 3FONB 4WDTA 2YCJA 3QFEA 4RQQB 1UWEL 2PLTA 3K13A 4Q8OA 4QKTA 1YVLA 2ESVE 4JPWL 1K7XA 3PP3H 1SDDA 4AQAA 2ODOA 5LIUX 1PIFA 4CC1A 3EHBD 5LNWA 2WM1A 1OB1B 2ZF9A 2F6XA 1MCRA 1WP6A 2VH5H 3AUVA 1GVEA 2EEBA 2HE8A 3HA1A 3M4HA 3MUGB 2VR3A 4P46B 2FT8A 2AC0A 1LP6A 2H26A 1BXVA 5AKVA 3REQB 1NDZA 4F7MB 5CG0A 3W7CA 4BXSV 2XG4A 2EG7A 1ADQH 2CPUA 3G5VB 3R19A 5FYJH 5F9JA 2YQ2A 5AOMA 4GRSA 1D5BA 4KCWA 4G8EA 3SY1A 2P8LA 3IFLL 3OIHA 2IQDA 4UTJA 3GLEA 4J40A 2E8YA 2ROYA 3AHVA 3BP7B 5EZOL 4XBSA 4YBQD 4IUGA 4F15C 3C2EA 3VFUB 5GS0D 1ML1A 3E0LA 4Z5RA 3FGCB 4PJCF 1A9EB 3NFPA 1NKOA 2BVPA 1US0A 3BDYL 3P9MA 3RGHA 1BREA 3WDHA 3VRIA 3H9HB 1A4KB 5F7UA 3MUIA 4CMMB 1BM7A 4Z76A 1KKOA 3WLNA 4B92A 5IP4A 3KPSA 4Y2LA 5GGSY 3VNMA 4ES4A 2W60A 3SO7A 1O9ZA 3IGAB 1IC7L 1G7IB 3IKCB 1QPOA 1QYGL 2KT6A 2XY2A 4ZTXA 1GHFL 1P84K 2VLRD 2RMNA 3TH4T 2CMRH 1D3HA 3W7OA 2DQFB 3P9MB 2ZYRA 3HG1D 4RGOL 2AAMA 4FFWC 5KVDE 2B9BA 3AXLB 1JVOA 4IIQB 1XHGA 2CZFA 2P76A 4IGMA 1LO0L 3MHFA 5LA2A 4NI3A 5EOQH 3HGRA 3F5LA 2X4SA 5DC0A 4HFUH 2B0SH 2ENYA 3N04A 4K8HA 4ADUA 3UO8B 5D7EA 2X4RB 4NNAA 1ITBB 5IM51 3RITA 4X0NA 2QPEB 2R56H 1U8CB 2VDRH 3CSGA 4GAGL 4X6DB 1YJDC 2IQTA 2A74A 3MMEA 4M8UA 4F7CB 4ZMOA 1J8HE 2MNUA 1GJPA 5T3XL 4WHYG 3U0WH 4JIPA 1XSOA 5LNSA 1NGPH 2EE2A 4LS2A 3FSTA 1PLCA 1DBTA 3JTTB 3WLIA 3RGBA 3WK2A 4LEXH 2AV1B 3L48A 5JPNC 4PFHA 5EZLB 4ZYKB 3KW8A 1J11A 1OL0A 2OR7A 3LHPH 7REQB 3EH4B 1TPXB 2F5AL 4M7LH 2NY1D 4X6CE 1KULA 2CDFB 2D2GA 1UMLA 4PCTA 4JFEE 2G3NA 1SBSH 2CDEB 3LKSB 2J4GA 2O9RA 5GNXA 3HMWL 1EVTC 1CD1A 4HKXB 3C5SB 2WO2B 5F1NA 3UTOA 4BBWA 1KTNA 2HFTA 1T1YA 3KM8A 2VDOB 4JXCA 3ZHDA 1I8KA 2WKGA 3VM5A 3WHE1 3IRPX 1O9VA 5JO5A 3T2OA 1ZIBA 4D9RD 5J56B 1OFPA 1KPRB 2R1PA 1LUCB 5L8JB 2VLKB 4AX3A 2FQDA 4GXVL 3ONBA 2X1SA 3MLTA 1DV7A 1U5HA 3EO1B 3GKZA 3QEHB 4WLCA 4IDJL 3SY5A 2VUOA 2FD6H 3O3BB 4A3UA 2OT0A 2D2CC 3AQDA 1UGNA 4FP1A 1EJ8A 3E02A 4HZ8A 1OCRB 4QHKI 1KFEA 4H41A 4EI5A 1RPKA 4XZ4A 1KDIA 3P81A 4CNTA 3EKGA 2VO5A 3U82B 3QFJA 3BDYH 1RJYB 2I5YH 4P9MH 2IW0A 5D71H 2AJSL 4XCNA 3UY7A 5CBJA 1SUJA 5DRIA 4I5XA 4LSSH 2XTSA 2V9TA 1BZ7A 3Q6FA 3QA3A 4XBEL 5HYQB 4PH8A 3NH7H 3DMMD 4Y9FA 4RNHA 4JRXE 3D6NA 3LHVA 1PIIA 3VXNB 2IAAC 3U0TA 1CEOA 2A74B 3MMEB 4F7CA 1NIUA 2DSZA 5FD0A 2XQBL 3QIBB 5FYKL 1GAFL 3FTWA 5F44A 1U1UA 5I74B 1AYOA 3II3A 1CYWA 5CEXA 4WFGD 1KEGL 1IIGA 1XFCA 3US1A 3CFJB 4CVZB 4FMFA 5IEHA 4HWNA 1OF8A 2DBLH 3LD8B 4R26H 3WNOA 1J0IA 2FL5A 2FTYA 3NZRA 2ISDA 3RX5A 3RNQA 3TNMB 3J7HA 2VQ1B 3CH1B 3G7TA 3L3JB 4TVPE 4YXHH 3KLKA 4M43L 1L9WA 4KDTA 1A3RL 3CZFA 1HKWA 2X1IA 5ISZE 4U5KA 5L2KA 1XCQA 4UTWC 3UAFA 2YD6A 2ED8A 2EDBA 1XLEA 2BY0A 4LLYB 3S8HA 1J8HA 4KHXL 2VX6A 1AC0A 3L3OB 3WF2A 1SR9A 5EBMB 3T8QA 3U0WL 1Z7AA 4K2SA 2HKFL 3AACA 5G4EA 3V7AE 1UH4A 4YEEA 1YY8A 1NL0L 2PDQA 2BO0A 3OAZH 2QAPA 3LPPA 4U3SA 2WLJA 4WTQA 4EIBA 3NTYA 3BZFA 1L9PA 4HEMA 1NCOA 2J57A 2NY0D 3A6BH 1A5UA 2GI7A 1TPB1 4B2DA 4YHIB 4C57C 4DJEC 5DVLA 4XD6A 1TMLA 4DLMA 1E1CB 1S5WA 4JIRA 4X7DC 2FDMA 3VRLE 2OWCA 4PJ9B 1BRLB 4PGBA 1ZRQA 1A5FH 2CKBA 3VGBA 3EO9L 1KV3A 2N1KA 3MA9L 4K7FA 5DUMH 1OTTC 3AY4A 1AJ0A 3GM0A 3T4AC 1H7NA 3RNKB 1FWJC 1SVDA 3RF9A 3QUZD 3EWZA 2ERJB 2XA3A 4L8SC 1UKPA 1LO2H 4IU3A 4ZX3A 4R2GB 5HDWA 3RBSA 3HFTA 1TTUA 1A65A 4KRPB 2VDQH 1H5YA 4Z1BA 3IK2A 4RMSA 1MQ8A 3ZHFA 1OE1A 3K72A 5T5NF 1CURA 4YHPB 1F0LA 2EC9T 5CZVH 3IMTA 3N2JA 3S36L 1YDNA 4LB3A 3QEQE 1L2QA 1E4WL 3LLFA 3RLGA 1R87A 5BO1L 1GVSA 2GHWB 2C1OA 2X0SA 4XUYA 1FHNA 4NKQB 3HA0A 2X10A 3CXHK 3UBHA 1E6ZA 1H0DA 4HFWB 1OF6A 4OBRA 1TMHA 3PGCA 3B9KB 2DZAA 2HS6A 4AUJA 4XMVA 1V7YA 2BASA 4KRLB 3T4YA 2PEVA 4ABWA 4DHLA 4L1TA 3SDXF 3RX4A 5EU4A 1Y5WA 1NDGB 1T1ZA 2ZRZA 4GUPA 2E4FA 1U95B 5K1NA 1S7WA 5I1CL 1LOLA 4LCSA 2F7FA 2OJPA 3H12A 1NARA 2OQJB 4EN3C 2NTFB 4EPKA 5F1KC 5F3BB 1VFSA 2IFFH 1X3DA 1Z0MA 5B4MD 5C09B 2P48B 4HIEB 2HMID 3NSDA 4XXCA 5CKGA 3QUKB 2X6BA 2HLAA 5H35B 3SJVB 2QVKA 3QRGH 5E00B 1IGJB 5AVQB 1KCWA 2OWWA 4NX5A 3NCFB 1YLVA 3W86A 5HNRA 3MX0A 2J24A 3ZGHA 12E8L 3MLVL 4OZHB 4L9YA 4TR9A 2OTUA 2Y7MA 4LGRB 3C60D 3RG1C 3NZSA 3D0LB 3B43A 2CXEA 3PPGA 4I85A 3N85H 1PD1A 5KS9B 1UR0A 4QRQB 2I17A 4O1DA 6PTDA 1XSIA 2VD9A 3BWWA 4K3DL 3T3PE 3V3WA 1TQUA 4XHJD 3GIVB 6REQA 4KHTH 1O7DE 3WG7B 3OKEB 1TTGA 1Q85A 1MRFL 1NA8A 1FGNH 3WAJA 4HTBA 4NO0B 4QGCA 3OXSA 3I7SA 1JGVL 4GUHA 1P5VA 3CVCA 2MPVA 2E7DA 2XY1A 3QARA 4IP7A 4QRFA 1ERNA 2G75A 4QIUA 4M9OA 2H2SC 3VE9A 2K6YA 2Z9TA 3QJTB 2NWSA 4W93A 1PYFA 3R94A 3K5SA 1XBYA 3V1PA 3ONCA 7TAAA 2LHAA 2Z6JA 3B9VA 3TO4A 4R88A 2HKHH 2XX1A 3EOSA 3OGSA 4NNPH 5FCUH 4BIKA 1YPFA 2DWDB 3B8IA 2AEWA 3G3LA 4LL9A 4YL9A 3MNWA 3KGUA 5C0BA 4R4BB 4XBGA 1MCBA 2JKRM 2FRGP 4LLAA 3KR3L 4NO5B 4W9CC 5BW7A 3DVNB 5HXMA 1JZ5A 4ZB5A 3S2LA 1VHNA 3K30A 3NPVA 2I7OA 4I3RL 4BK5A 4FQHA 3R4IA 3MXWH 1MCOH 1JGUH 1E40A 4HWZA 4ODSH 5D93C 3T77A 1HNGA 4B95C 4YAQB 4DESA 3TQVA 1SJCA 4MAUL 2Y1AA 1QQDB 4XP6H 1HKFA 4ERSL 1F6PA 1WO2A 1P6FA 2AMXA 2INFA 4WFEE 2J62A 4CCCA 3DCPA 3B9OA 1Z8AA 4OZOA 2O30A 2WMFA 4UQ9A 1UA3A 3HHRB 1QSVA 4BKSC 3RJXA 3NJIA 3WDJA 5CEYA 4UT6H 4N6RB 1Z41A 1JV2B 5FAJA 4Q8UA 1CFSB 3V7PA 4BI5A 2FWOB 4GP8B 3C0QA 3OG3A 5IKCA 3QPZA 3TA3B 4XB3A 3H6JA 5FUZH 5AW9B 1CDCA 4QTIH 5JORA 2G0WA 2AZAA 1CGXA 3FUEA 3PPEA 4XCYA 3VXME 4XCCL 4X7FC 4OV4A 2VELA 4ODUB 3MXVL 3GYCA 3AU0A 3QIUB 4WNQB 2Q0ZX 5KSAC 2E7BA 2PZNA 2K3HA 4NJIA 4JPVH 5KS9F 2A6NA 3VG0L 4ZO6A 4U6XA 1QLRA 5CIPH 5CJXC 5CZRA 3TEYA 1Z3GL 3N14A 1NC2B 4MJIB 5DA0B 5SWSD 3RVWC 4B5WA 4WK2B 4PUMA 5DHEA 2YL5A 5DT5A 4JRXD 4HVBA 3TWAA 4RMBA 4Y8DC 1WV7T 2WTPA 2PTTB 3DROA 5EZOH 3W39A 2L04A 2H9GB 3KVJA 1J8SA 5HDBB 3GIVA 4PREA 5JZ7C 1A6ZB 2M8XA 3PZOA 4I9TA 4F3FA 5PTDA 2BCKA 2HQAA 4PJCE 1U8IA 5HWNA 5B3NA 3HMWH 3PV7A 4L4VB 5FDWB 5K39B 4IIBA 2QCEA 1NCCL 2QCNA 3JV6B 1TPWA 2V5KA 4GW1A 4QSFA 1CGVA 1X8CA 4HYRA 4Q6IA 1U3HA 5E9XA 1UPPA 3LH2H 1RK0B 4QJ5B 1X7FA 4N2BA 2WHMA 2CO6A 2FB4L 2X0YA 3TVAA 4F57L 4UV4L 3MNZB 5SV4A 1OARH 3VH8B 2W07B 1ZB5A 2P28B 3KJ6H 1PLBA 3MRMA 3VUPA 4PGCA 5ETUA 4C5ZA 4XN4A 2H5UA 3BIKA 5AKSA 1OX5A 4EOWH 5D4QA 5IK3B 4NT0A 4HJGA 1ZVSB 3TPKA 2FEJA 3LCXA 1TRIA 1TJHL 2XZ9A 2Q2LA 2B0MA 3BZ4B 3TMQA 2QGEA 1BZQK 3TV3H 4N2FA 4ICXA 4EDWL 3KVQA 3ARRA 2P3EA 4P48A 4IMKA 5EUOB 4K8RL 3CZNA 1MNZA 3RTQB 2R56L 4G7RB 4PJBA 3SKMA 1M56B 2IWKA 2ZUYA 1CXIA 4AVKA 1OM0A 3CASA 4JYDA 4B3LA 3U2OA 1QUMA 1KCSH 3LG3A 3R06B 2FL5B 4PV8B 3QFJD 3DBXB 5D2LE 5C0IB 4EIGB 4M6AA 4PHXA 3T3PF 1P4IH 1EHKB 2PYEA 3EDDA 3BVXA 4N8CL 1KFAL 2HJLB 2O56A 1Q9WA 1T22A 1EQCA 5EF0A 4KBPA 5DD3H 2WQUA 1R7OA 2VRAA 2ICWB 4ZTOL 5KWYC 1PSCA 4FMKA 4KWVA 1H6TA 2BS9A 3RWGA 1KFBA 4GVHA 5FEPA 5EC1B 2QQNL 3D2TA 4FXGA 4H5SB 5HHQB 1A6AB 1MRQA 5CUSL 3OV6A 4PMQA 3WY2A 2HRPL 2WCSA 1DVFB 5JW3L 3BH8B 1U8PA 3ARPA 4O1BA 2I24N 5F1VA 4GAAA 3MTRA 5KTLA 3VFCA 2P53A 4ZQRA 3NACH 4UBDD 5BMFL 4B9KC 2DW6A 2NY0C 3NCEB 4OT1H 3DK0A 3DKHA 5GISL 4RAUB 5ABDE 2GSEA 5BXTA 2CBJA 4YDIH 1DUZB 1QTPA 4OZ4B 3CUIA 2IJ0C 3KBFA 2XPKA 4DGUA 1SYTA 3LCFA 5EMYA 3S3DB 3DPBA 3L6FB 3QQ9C 4GFTB 4K9EH 4GJJA 5DCBA 1CFBA 3PL6B 3KZSA 3URQA 3RPDA 2WJ7A 3KL0A 2RQEA 2H6UA 1EUUA 2F7PA 1N9PA 3M8OL 3VXSE 2VEPA 1TQJA 3MVTA 1FO0B 3L4YA 4ZZ9A 1H6FA 2ACRA 1IXNA 2M26A 3W1ZA 1WKEA 3EB2A 2PCPB 3EDFA 4PTXA 4DELA 5ABFA 4GG8A 3ZKMC 3C6LB 3MJ8A 3MSRA 3LHZA 2QLVB 4TQIA 3WKYA 3HVNA 1T4WA 5CWSA 5I23A 3CTLA 3WE6A 2BGNE 4Q8NA 1J0YA 3D50A 5E8NB 4PJ7A 3ULAB 2J1KA 3FT3B 1I9IL 3GHTA 3LDBB 5C3IA 4P0DA 5E0FA 3TIMA 3H2MA 4AG4L 3GDCA 5EFDA 4AIZA 4PMXA 4YX2H 3WD5H 4JIQA 4AQ8A 2LGNA 3HFFA 4JGUA 1MG2C 1BCIA 2R4RH 5C2GA 3GHEH 3TYZA 2WAHA 2R82A 3IU3B 3QFDA 5D7JA 3QNFA 1QVOB 2C3WA 1L6ZA 2FJSA 3HS0A 3K7UA 5FYJU 3QVAA 4XAPA 2F5BL 5I7GA 5AVTB 4U33A 1LLAA 4B9ZA 1U8QB 4NQED 5GJTL 3S7GA 4BSWA 4Z78A 1TIWA 2Z93B 2NY7H 5BXRA 4GY7A 1NAMB 2BJML 3T8MA 1NBCA 3WMQA 5KSWA 1QLEH 3IWPA 3CWGA 2OM5A 1IIIA 5D1ZB 3COOA 5HNUA 2G2NA 1GTNA 1E8ZA 4TUKH 4XK2A 1IXQA 2W9LA 4U1GB 3NA4A 3BE1L 3LNHA 2G0LA 2DLEA 4XHJC 4HA4A 1EJFA 3K8MA 4XMKH 5EO0A 5L4JA 5C9XA 3IXTA 2I27N 1VBJA 3ML8A 3ME0B 1HP5A 4PULA 3OKDA 4AZCA 1OSZA 5MENB 5EU5A 2KLRA 4Q58C 1AQFA 2VIRB 1QK0A 4GQ9L 1P48A 4PJXB 2D7PA 3V7AG 6XIMA 1MLCA 3DKLA 5GSRB 2H2PC 1MCDA 3C2SA 5L88H 2Y7DA 3VILA 4IX0A 2GCYB 1CDHA 2FLBT 4PMUA 3MPGA 4GAJH 1I3GH 5D1XE 2H90A 1EIXA 3S5ZA 4CU6A 4Q4OA 4GUJA 1EMTH 3VE0B 1DQLL 5FUCC 3UAJD 4AYID 5FB8B 3F04A 4WHTA 4WI0A 4A2DA 4FSAA 2VDMH 3DYOA 5IB3B 5C0QA 4D1JA 3W0WA 1HE8A 2XZCH 4HK5A 1ZTXL 3DHJA 1I4FA 3BAWA 3X3FL 2BZDA 2OSLB 1FWTA 2BOCA 3NCOA 3QEUB 3DVFA 4KDTC 4YAQA 1RH9A 4OLZL 4NQVB 5IB2B 3NA9H 3PS6A 5DLML 5EIIA 3MGTB 2E28A 3RNDA 4DVOA 1KM3A 4X9HA 2WANA 1NLBH 4DVRH 3V0UA 5JIWA 5CR1A 3IXAB 2ZADA 3RA7H 3VSUA 4TO8A 4PRHD 3QRBA 5J1AB 1IO4C 4NF7A 3RIKA 1GGOA 1KB5A 5D2LF 4P2OD 5L7XL 3WBXA 4LAZA 1V3KA 2EIKB 4A6YH 1HJCA 4KETA 4O17A 3KPLA 5ALCH 4JFQA 3WL9B 1OFAA 3QV8A 4PRPE 1OPGH 4OU3A 5C0FB 3EJUA 3IDYC 1ELSA 1OCQA 3LXUX 5E5LA 1L0YA 3RB7A 2DVUA 2PDHA 3TUUA 4PW3A 1EEZB 4X6CF 4QY8B 5KVGE 5KITA 3BP4B 1KT2A 1DVUA 4XNYL 4KZ0A 2YZ8A 3WU1A 1S9WB 2N7AA 3GMOA 1Y0LB 5DD3L 2OZ4L 4ODVL 4GOAA 3N5AA 3FCSB 4A8LA 1M71B 1DR9A 4AE1A 1KN4H 3JTSA 2JKIS 2BSLA 5D7HA 3B9AA 1WQ5A 4KUZL 2QMKA 4YHZL 1EBGA 1YYLL 3QUKA 1F3RB 4YDKL 3S9DB 3TYAA 4I2XE 5JZ7D 3KPOA 1ADQA 1P1ZA 1QFWL 3MX0B 4XE5B 2DZUA 4YMZA 3TN5A 2FGBA 1KJ2L 4MNLA 3X1FA 4K71B 5F93C 3V0SA 1ZJAA 1BFTA 4QTGA 1CT8A 5KVGL 3GX9A 2ICSA 5C54A 3CPLB 3OKOA 4ELME 1EF2A 1XBXA 2J56A 3RVUD 4Z7VF 3GKWH 4Z3EA 1UWUA 1XCFA 3D47A 3M0IA 5FJTA 4YXGA 1N8IA 1HHHA 2YEQA 3ZE2F 2DVTA 4UU9B 2BSCA 3ITTA 1UJPA 3Q8EA 4J6IA 4NRYA 43CAA 1NOWA 2BVDA 3KRSA 2Y1ZA 3MV7A 3NCWA 1RMFL 2E7LC 4XCFH 2ZZ6A 3BJSA 3AVEA 3VXUB 3WGVB 4K39A 2IFGA 4X22A 2C1OB 4FTVA 3KGTA 2VCBA 1AZCA 4A2EA 2FQFA 4LU5L 3BAEL 3MODH 3QC6X 5KG9B 5KSBB 1V93A 5KS9E 2PU1A 3KCLA 3E3QE 4M7KH 4XMUA 2E25A 2QPXA 4BH7B 4F57H 5IHWA 2XZCL 1OGTA 3V52L 4NUMA 3W57A 4DN3L 1KXTB 1MCNA 3LZFL 3DX6B 4L2YA 4OCYL 4HS8L 1SYVA 4KNTA 2CLVA 1LO3L 5DEJA 3VSQA 3GKAA 1FP5A 2EPMX 4WD0A 3SN0A 1QBLL 1J9CT 2P52A 3EUUA 1L7TH 1H7PA 3GKFA 4PVLA 4HD9A 4OI8A 4H9VA 4PM1A 1SGJA 1ICPA 2ZICA 3NL3A 4LAJH 4TX9A 1QLFA 1AGCA 2ZOUA 3ECUA 4KV5E 3E0FA 5EY5A 3MYZA 3VXNA 3JR2A 5I75C 1IT9H 3BAJA 4HZ6A 2PETA 1CVSC 5CBBA 5PAZA 1XLAA 2PA6A 3COTA 4M1CD 3I7RA 3MQTA 2J7FA 3FSOA 1Z3GH 1GVFA 1F9CA 4Q4EA 4X6DF 4N26A 4Y4KA 5C08E 4RJEA 1HXMA 1EDYA 2O6PA 3HPFA 1MRDL 4PRPA 3QMSA 4UMAA 1SQ7A 4AZCB 2DEPA 5BQDA 2YSSA 3V0TA 1R4XA 5JW5B 4JD4A 3R7MA 1T8XA 3EWWA 4LEOB 3SKNB 2VRJA 1KIPA 4JPGA 1UC6A 3REWB 1KYAA 4PMNA 1CFTB 1I9RH 1X4XA 1AQMA 4P8XA 2Y3AA 3HG2A 2YGPA 4MAYA 1Q0EA 3ZLFA 2DLFH 4RA0C 5LCVA 4APXB 2PPGA 2WCPA 2APSA 5DS1A 4LLYA 1D9KD 2IDFA 1YPZA 1RVKA 2CLKA 4YCPA 5IIEA 4PL1A 2ZCHH 2XZQH 2MNWA 4X5PA 4ZAKD 2QCDA 3FIGA 3S3BB 3HI6L 4OZIB 4FYQA 4HPNA 1NBVL 5IQ7L 1E9ZB 3WIAA 4QO1B 2VXUH 1MY5A 3HKZA 2P3YA 3T8VA 2EF9A 1KJ2H 2H6OA 3TEZA 1I31A 3W22A 5FO7A 3D52A 4H88L 1XUZA 1C12A 1OSPL 1EP1A 4JJHA 3ZKMD 1WV2A 4P7LA 1RBAA 1RCYA 1ZWIA 3QDGB 5D7IF 4HTYA 4MKNA 3GUTA 4GRWF 2Y7NA 2XQ0A 4DTGL 2GK1A 1NM4A 5ESVB 4FNTA 2EXSA 2Y72A 3CV7A 3CMOL 4GS7C 1WDAA 4Y9GA 4YO0B 2E86A 4I88A 2FEEL 2YC1B 2ZUTA 5I6MA 3MFFA 3RB5A 1JQVA 1T2QL 4Y2NA 4O4WA 1WIUA 2WMHA 3HPLB 2NY3B 4XX1E 4V1DA 1I8LC 2H3KA 5D1QC 2A79A 3N34A 5E56A 2PNDA 2YRPA 1UADC 5EGRA 1OGAD 1UWXH 3WJWA 2Y06L 5BYWA 1T2XA 4LZKA 4RFNB 3SE3C 1QSFD 3VXSA 3AJXA 4M5SA 5E4EB 3DZ1A 4AUYA 2XXMB 5J13C 3W6YA 1CFVH 5LBGA 3D4GA 4CQDA 3WJMA 4MNJA 5FV1L 2YQ3A 2V7HA 2Q8AH 3T6VA 1CU4L 1RJZA 12E8H 1R17A 3MLVH 2YAPA 4O9HL 2F9RA 4J5NA 1RURL 3QJAA 3VXRB 2BK8A 1JCLA 3OAUL 2XKNB 1JGLL 3QWOA 1FUYA 1SJAA 4QQUA 1AGDB 2V9QA 2R14A 3W1PA 3UAJA 4LC6A 4QCIA 3QQ0A 3L9RA 4MMZC 1SLVA 1FCCA 3KPQB 2B1OA 4RK8A 3ZKQD 5LCVL 2YPLA 4ATLA 2FATH 2VRQA 3ARDC 1BBJA 3DK2A 4G9FB 5HHVL 3JTTA 4QF1A 3L1EA 4XXWC 3VFGH 4OFPA 4PJIE 4Z5RB 1ZV5A 5JBDA 5LZLA 4OV5A 3BH8A 3P2VA 5L2JB 3WTUA 1SJMA 4PJCB 5FHAH 1L9MA 2W0FB 5TE6L 5HHQA 3L9CA 3VFRA 2DZEA 2X05A 4GC4A 1S7RA 2Y5TB 3LV3A 3FU5A 2UXVA 1CBJA 3IFNH 3AZSA 3CQFA 3WLRA 5I1JH 3NQ6A 4RUBA 4JN1H 1BM3L 3CV2A 4IJRA 4GRWB 4NYUA 2WIIA 4P2OA 2Z8SA 4DGWC 4ZFOL 1OGTB 3MDUA 4GKNB 2Q71A 4EXAA 1GGCL 1QRQA 1T7LA 1PL3A 2MOGA 2DZXA 4NNYB 4AU0A 1CDYA 2Y6TE 1UKQA 2WKJA 1QPPA 4BH8B 1HJQA 2GQ3A 3PS7A 3PG2A 3H3KA 4EUPG 1LLZA 2DWEB 4DJFA 3ATFA 4RBPH 2NLJA 4JFEB 2OMAA 2OTWA 1NCAH 1U8OA 3IF1A 4HU0A 5EF1A 4JIHA 3P5YA 4PJGF 4HXBL 1R9FA 3GB6A 1QHQA 1X5AA 5AW4B 4BY3A 3KPSD 1BIIA 5T1DH 4KOCA 3T65B 4RCXA 1HC1A 3NCXA 1VLXA 4L3ED 4F9PC 5C0NC 3CDGA 5IHBA 2XICA 1FYTB 5FXCH 3HR5B 3TLLA 2P5WE 4PUWA 3WIIH 3EYVB 5E8PB 4PRPB 3ZR6A 4PBVC 2Q8LA 2H6PA 5DS8B 1XKYA 1OP5K 3P0WA 5E2TL 1TSHA 2H8PA 1QFWM 2IALB 2KQMA 5HJ3A 1DIKA 1FWFC 1HQ4B 4QG8A 3VXMB 1L0XA 4NN5C 3SKOA 2JK5B 1D8WA 1YEFL 4B50A 4E42A 2GSGA 4PJ5A 3FO9A 2LTQB 2CD0A 5CLXA 2A9DA 5GQBA 1EZVX 5FOBA 5IBTH 5E4EC 3MJGX 2V5MA 1H4PA 1ZPTA 3SAZA 4POUB 3FCSA 4IP5A 4BQ6A 2P5NA 3SCMD 1SO3A 2P10A 5M5DA 2DM7A 3BW4A 3C8FA 1N3NA 4MNGB 2IC2A 3FXGA 2Y24A 1NTHA 4GRLA 3LH9A 5D7JD 3FBKA 5JQ6H 1OW0C 3O4OB 3ERPA 3QH3A 4ZX4A 1PS9A 5FA4B 1TZ7A 1GW0A 4NQUA 1AO7E 3AADB 4F7MA 1YEIH 2YD7A 4EZMA 3MUGA 4GO6B 3F5KA 4XAKD 2GQ8A 3NSNA 5IUCA 3I6RA 4IL0A 1FL6A 1QZ1A 3SCMA 4QRUB 1IAIH 1FG2B 2ZX5A 3DIFA 1PG7X 4WHCA 3RVUC 2EG8A 4I77H 4PJIA 5E94B 3C2FA 4LBUA 1LORA 4LUTB 4JK0D 4NRYB 43CAB 4LYKA 5I78A 3M9YA 4H8NA 2FHCA 2BINA 3T0VA 2XPGB 4ZMTA 1IRAY 3P0VL 5J9PB 3WMBA 3TWYA 5JOFB 1XLDA 3AOFA 3WIFB 2DKMA 2ALRA 4M7TA 3AMCA 4PMRA 4RE3A 3O0RH 2FPTA 1A5SA 4L5FE 1OAJA 2DPKA 4PJGB 3AHZA 4IJBA 4JFYA 4CJ0A 2P88A 2VZSA 4PB4A 3AB0C 1W1VA 2IGTA 4A4AA 5CC5A 1KJ3L 1MMFA 2XPYA 3MJ9H 3N41B 1B3WA 2XTJC 1AFSA 1N6QH 3L4VA 3CCHB 4E5XG 3GJFK 3CL8A 1F11B 1AGEA 1ETJA 4KDWA 2QKIC 4PUBH 2RHGA 4Z95L 2ALAA 1M03A 5EBWA 1UWIA 5EPDA 1XFPA 1UOKA 2OCFD 2ICWJ 3MRLB 4MZRA 3FQWB 2BFVL 2MKWA 1FKWA 1MDAA 3QO1A 2AJSH 3ZYIA 3PZNA 4TNVK 3PABB 5CP7A 3T0TA 4FR6A 1L9TA 1BWKA 4O2EB 4KFNA 1OANA 3II2A 4J3VA 2Y07L 4PGLA 1OP3K 3T1WA 4XC1L 5F7EH 1G7VA 3HUJB 3WLMA 3P73A 1LK2B 2VI0A 3GYRA 1P0NA 3DERA 1F5WA 5K9QG 3M5VA 2XWXA 2JFCA 4AQLA 4WTZG 2HCVA 3PY2A 3UJTH 4LKCA 2JKNA 4Y1AE 1LMIA 3HMCA 3UY8A 3G04B 4OD1L 3TBCA 4LB4A 1RURH 2WNKA 4Y2WA 1C1EH 3M7FB 1EUTA 3OHXA 4QRQA 4KPHL 4G9DB 4LRTA 5INCB 1AQ8A 3H42L 4N22A 3Q13A 5DT1L 2MQ0A 4U6VL 2ALDA 4HSAC 1E5CA 3DXIA 4I8YA 3BSGA 3KBSA 3VDHA 3QUGA 1H7RA 3DVGB 5CMAA 4BFOA 3UZZA 4YVPA 3BMWA 1SFTA 5A6KA 4U1NB 4NILA 5EBUA 1YEHH 2X4UA 3MJWA 3FH8A 2L3BA 1HOCB 5FWRA 3HRPA 2FR4B 2VFHA 1PKQA 2A5HA 1IAMA 4YE4L 3D85B 3N1PC 3CUXA 5JIIA 1S7TA 1H1ZA 1UP0A 4KIEA 3GTHA 2VC5A 3QUHA 1WAUA 1UFUA 3GXIA 3LVTA 3P9LA 4YBLB 4JN1L 2Q8XA 3GDRA 3PC0A 4LSRL 1D9KA 3NYDA 4IPLA 2PDFA 3GI9H 2HEJA 5DXYA 1XD1A 5FS5A 3QWQB 4K4KA 5I16B 2FK9A 3IN2A 4OGXL 3HIZA 1E4IA 1LWIA 3HZYA 1VPOL 4JDZA 1AJ2A 1HO1A 4KY1H 5DJCB 4QHRA 1B31A 4XO6A 1LO0H 1J48A 1DLFL 4Z0SA 5D1QD 4D6FA 4M5PA 4WI4A 1ZHNA 5BMWA 4WHBA 3WG6A 2OJEA 2NQHA 5CSZA 1FFTB 2EDNA 1R3YA 1V51A 3M64A 3O3DB 5GRWA 4XOBA 4JDZB 3UWVA 2WYSA 4RGOH 3BLKA 3QXAB 3N2BA 1FXPA 3W28A 4KDVA 3FB8B 5EMMA 3WNPA 5ICYA 4OZHA 4PZVA 5T3ZD 4QP0A 3O45A 3ZOAA 4NAMA 4G7YH 1IGJA 1VPQA 4XODA 1TRDA 1MFAH 1URIA 3FOMA 3O81A 4M5YL 4OJAA 3BSMA 3CZ8A 1FWAC 3HG4A 3JWNC 5A95A 2HPTA 2OSWA 1N8FA 5F7DB 4H5SA 1G0DA 4PQXA 1Z42A 1WBYA 3BKML 1VZGA 4HG4K 2C4FU 2QHLA 4H25A 5H37A 4XRCA 1YLBB 4XPFH 2BWQA 5BZZA 3RGVA 1MCSA 3WFCL 2VM8A 2Z29A 4WGXA 3GDLA 3DTXA 4BQ5A 4E38A 4Z77A 1HKKA 2EAWA 3KBJA 5AYUL 4EF3A 6A3HA 2W91A 3MUUA 2YL9A 3OKLA 5HYJA 3GG0A 4QNEA 5LXGH 4AKOA 4JTCA 2FJGB 4JB9L 1G1YA 2E46A 3MUHL 5HHVH 5I3IA 2EXWD 4WU5A 1A9BA 3UERA 2KPWA 2OSXA 3H55A 1XO8A 2Y23A 3GNMH 3HPSA 2GC7C 4E0RA 1FL5B 2FFIA 3GDMA 4IQEA 4UXDA 4UTWA 4RMQA 2DQDH 3A23A 3H2WA 3ILPA 1KFJA 3PZUA 4GNKB 5EU6B 1KYDA 4NN5B 2ZFAA 4X8JA 3F12A 1E9OA 3DX3A 4GAYA 1ISXA 3F4WA 5ETUB 3CFEA 2CGRH 1PZ2A 1N64L 1NMCB 4DUVA 4K7FB 3ULSB 1YMHB 2X0VA 4Q8WA 1DEEA 2BS71 4K9EC 5GJPA 1ICQA 4MUPA 1WBZB 1NAKL 1OQOA 1U58B 4UWMA 2J43A 4DGVL 1Q8AA 4DT2A 4RLDA 3PQYE 5IQMA 4DPPA 2Y06H 3L5XL 3E2SA 2QELA 4L4PA 4PCPA 3RWEA 3ZL4H 1K3UA 2X4QB 2JKPA 3GUWA 4Y5VA 3OG4B 4NC1E 1MH5A 1ZHBB 3V0VA 3RJYA 3ZWSA 4F7TA 2ICEA 3O3AA 4RGNC 4LGPB 4H9ZA 3STLB 3IARA 1NCBL 1M65A 5JUEL 2R1KA 4IK7A 3BAIA 3IS4A 3AT9A 2O6EA 2WTRA 3B5TA 1DJHA 1J8HB 5L2KE 5EDXA 3GSRA 1WKYA 2AGTA 2J8TA 3RPTA 1FVDA 3S37L 4I5RA 1LDPH 4WJ5B 5DC9B 5FKPB 1Q7ZA 1BPVA 2YPIA 2HNHA 2NV2A 1WQVT 3TJHD 3LKOA 1ZCRA 1OGAB 2YD0A 4HKJB 5HHOD 3CFDA 1S3RA 1X5FA 2WLLB 1GW1A 1VBRA 3EWXA 5FKYA 3UJSA 4YXHL 3DBSA 1Y7VA 1FP8A 3V4VL 2NUYA 4IHCA 3TAOA 1QWHA 1SMAA 1HI6B 1TSRA 2EDLA 2NY5L 3Q8BA 5J6HA 2OXHA 4ODWB 4ZSOA 5ICZB 2WXJA 3EBIA 2QFPA 5EA0H 3NZ8B 2W0PA 4XB8A 1JCNA 2DQWA 2F6UA 3UT0A 4I2XB 4WI9A 1LDSA 4XO8A 4MHHI 1E0XA 3AISA 1RZMA 3RWHB 1DBAL 3SECA 1N8OE 4JM2D 5D1QA 4UZGA 1I1RA 3CLFL 3KVDD 3PHQA 1L4IA 1RK0A 3G24A 2ZF8A 3GJEB 4JCWA 3ZE1F 1P7QB 4U1SA 1IBDA 2R7EB 4Y19A 3SE3A 5J1TC 3LBOA 4FEZA 3UTSE 2XVLA 2BSEA 1BTMA 5DF0A 4EI5B 1BZ9B 2P5EA 3SE4A 2WLHA 2AJ3B 4A66A 4CL7A 1B0RA 4HUWA 1GHFH 1LK3H 1MYRA 2RH9A 1E2ZA 5KBMA 4GACA 1FVCA 4IBLT 4HCRA 3CWOX 5I07A 5E2VL 1I7UA 3K6SB 4W5ZA 4NO5A 3EBHA 4Q8TA 2A73A 2PR9A 4WIQA 4L4OA 3AO0A 3QF0A 1OQFA 2WXGA 3O6KL 2DWDA 4O00A 3P9WB 4P3DA 3VKJA 1XZ0B 4BZ1A 3MLZL 4AXNA 4I9XA 1Q72L 4N1EA 4ZO7A 4ZUUB 2VC2L 3W11C 3J8F7 2IDTA 2OX5A 2PPAA 1WEJL 1FFRA 1IT9L 1RK7A 2CRZA 1QDSA 5DVPA 1U5JA 4NBXB 4ORMA 2ZQ0A 5SWZB 1N59B 4PB0H 4OFIA 5AB0A 3IGAA 2I5QA 4TUFA 4P23C 1GKQA 2I57A 4JG1L 3WQ5A 4BDVB 2BIQA 4KS0A 1QFPA 4I3SH 4R4FH 3G6JE 4FLRA 4W9TA 3MQIA 1K6WA 3LM7A 2WBGA 3TC9A 2W59A 4NXKA 3S37X 2CBUA 1S5TA 2GITB 3KYNA 3KYKL 1HL8A 1DKWA 5KS9A 1I7RB 1A4CA 2Z91A 4JANB 4UUJA 2IPGA 4N6RA 1FV1B 4F2ME 2AQRA 4MPKA 2PR4H 4YL2A 5AYIA 3HAEH 1EHAA 2Y61A 2YXMA 4A67A 1J6OA 4YS1A 5JMOC 3MVSA 5HJYA 1U8CA 3Q45A 5LGXA 4FLHA 1OCZB 4B9GA 4GH3A 4WEEA 3VFRB 1D5ZB 1ZLVK 3UEQA 4HULB 3LDVA 1IBHA 4MMYB 1CTOA 5L2JA 2XZQL 5C0CA 2C34A 2QMJA 3EOTH 4IFKB 2PPCA 2PDMA 4GXPA 3W6LA 5E2WL 4QF1B 1FY6A 3W9DA 4KRTA 1N6VA 5BUGA 4PJEA 3F7JA 4P4KB 1TQBB 4F9PA 1OWRM 5CINH 4H8VA 5EMKA 1UEYA 1UZ6E 4V11A 2FNBA 1CGWA 4Y2DB 5F7NC 2WOBA 5AW8B 5FJRA 1QNOA 5EN2B 5IJBC 3BURA 3T78A 4BR1A 4PLOB 4E9VA 1SDAB 3OO2A 3D08A 1KTCA 3LMJL 4OI7A 1U8NB 4MG4A 2BP3A 2XN9B 3QDJB 3SOBL 1AY1L 2J71A 4FNLL 3E2QA 3SSZA 3UPBA 5K4XA 5EBGA 2DMBA 3V7MA 4NZ3A 4NUPA 4ZVJA 3GBLA 2NZLA 1HCFX 3V5HB 2X4TB 4G7FA 4O2CA 1P5UC 1TOXA 4JJ5A 3P4MB 2VO8A 4H00A 4MAVA 3EUDA 1XIIA 3QJFA 1CZ8L 1CLYL 1NIAA 3CVHA 2ZNXA 4K5LA 4P49A 2O61A 1KOAA 2UV8G 4HH8A 2HRHA 3UCCA 3NG3A 4PY8J 1FDZA 3RMEA 2XXFA 2C9PA 4DZBB 1YYMH 3ABZA 2DKUA 1UT2A 4HF5H 1KGIA 4PP1D 1YY9C 5FM5O 4QY8A 4TS6A 1GIGL 3TC7A 2APVA 5IJCC 5CGYC 1AH4A 5CSUA 7FABH 3LHYA 4KKRA 1UD5A 5F9DC 3VFWA 2F68X 4BZ2A 2WMIA 4OE7A 2PDWA 1LDPL 3YPIA 1X6UA 4KWSA 5AFDA 2ZJSL 3T2PA 2POZA 4G9PA 1CN4A 2Z4TA 1OX4A 2XCMC 3M44A 4NZ1A 5IOPB 5CR8A 4OQTA 1E1FA 1RUKH 2CLEA 3UU0A 2RJGA 4PRIB 2VDLH 4QS6A 2V3GA 1UVQB 3HLAA 4HEPA 3NQ2A 3W1RA 2GYIA 1TVBA 2Y62A 2QSQA 1PLAA 2PW1A 3INUH 2QDDA 4P06A 5TDOB 2EXWC 4ZS7L 2XUCA 2VZUA 4XMKL 2W1NA 5LG6A 2H41A 5DZJA 2DEWX 3U83A 5F9OH 3MJMA 4O1EA 3TKFA 4IUOA 4C65A 2ZAHA 5FECA 3KHDA 2UY6B 1MFDL 3OGCA 1UM6L 4IBZA 5ICUA 4EZLA 5JR1L 4S3GA 4N0FA 3D39D 2VDKB 3QJRB 1NCTA 3GGWB 4FFYH 3HR6A 2UX6A 3K8LA 3QE5A 5DQDL 2OZ4A 4PRRA 1N2RB 2E0PA 3VD7A 1X7QA 1NAL1 4PJDE 1VF8A 4ML9A 4OFDA 4GJIA 1S2TA 4QX4A 1R3IL 4HKZB 3KCJA 4LS1A 5M03A 4FULA 3QJFB 1JWMB 5HYJE 1W3IA 1KCUL 1TXKA 2JKTM 4BK5C 4YFEA 1E4XL 3R8QA 1QNVA 1DN0B 1CFQA 3W2UA 4WTXA 2G30A 3OYZA 2Z24A 1J0HA 3D0VA 4RGND 2X0HA 6CGTA 2NUPA 3O3RA 2QKIB 4Z7UA 3QTPA 4M82A 5IUSA 1XRTA 2EE9A 3S34H 1M9WA 1W2VA 3CZFB 2C5DC 4O58H 2ZQKA 3BMXA 1A14H 4ZJ9A 1UYWH 1FH5H 1ZT7A 1ACZA 3F03K 3RNQB 3TNMA 2QF8A 3QYSA 2B4CH 3I65A 5CQ1A 3AB0B 3U7AA 4BSWB 4Z78B 3SBRA 3OGRA 4JX6A 3WK0A 4QUOA 2Y6SC 1I82A 1DWIM 1KBGH 3DX5A 1XB3A 6FABL 1CXLA 2P80D 4IK6A 5AW3B 3VXUD 4BXVA 4RNRA 1OKEA 5FL0A 2PWUA 1OTUD 1T5XA 3WS6C 3FQYA 4LLQB 4PVMA 4YS4A 5M94B 1XIWA 2W38A 2QXWA 2VENA 5FEZA 1Q8JA 5C5YA 3IFOB 4NHUA 1SW7A 3L5MA 2J3SA 2X7LA 3T40A 2VMEA 1EXHA 3ZZQA 2VDLB 1BD2A 1B3IA 1TR9A 4K9EL 2OVLA 5D09A 1YMME 2QCHA 2UWEF 3MA7A 4YHOH 4IF2A 3EOYG 3OGOE 4KRPC 2GT9A 2HKHL 2VDLL 1AHWB 3H2FA 3WUFA 1MIML 1DVZA 1OARL 2ERJC 4L8SB 4M29A 1ZEAH 2BNRB 1OM3L 2OLAA 4E41B 1KA9F 1PEZA 1R3JA 3KBVA 4W6WB 5CBEA 2X4TA 2OZNA 3QCTH 2K6WA 3LQAC 1EPXA 2OFJA 1NH6A 2VDKH