5CXPA

X-ray crystallographic protein structure of the glycoside hydrolase family 30 subfamily 8 xylanase, xyn30a, from clostridium acetobutylicum
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
387
structure length
387
Chain Sequence
SNDATINVAAKHQTIRGFGASSAWCGALSDTCMDTLYKNAGLDILRVRIAPNEGWNRGDYRAWADELSNAKKVRARGGIVFATPWTPPASMKTNNTTTGANKGSLKPSSYAAYAAYLKTFVKYMSDNGAPLYALSLQNEPDWAPDYDACTWTAQQFHDFLKQYGASLSSTIKIIMPESLGFNPAMSDPTLNDPTTAQYVSIIGGHLYGSPIRDYPLARNKGKDIWMTEHYLEGNDPGTCVKLAKEIHDCMTIGNMNAYVYWWISGDQNGLYNTRTNETYKKTYVMGQFSKFIGNGYSRVDATNSPQSNVYVSAYTGNNKVVIVAINQGTYPVNQSFNVQNSTVSNVSSWVSSGTLNMAKTNSNISAANGRFNASLPAQSVTTFVADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible xylan degradation enzyme (Glycosyl hydrolase family
publication title Crystal structure of a GH30 xylanase
rcsb
source organism Clostridium acetobutylicum (strain atcc 824 / dsm 792 / jcm 1419 / lmg 5710 / vk
molecule tags Hydrolase
total genus 143
structure length 387
sequence length 387
ec nomenclature
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02055 Glyco_hydro_30 Glycosyl hydrolase family 30 TIM-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5cxpA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cxpA02
3L4XA 1UR8A 1SMDA 1TUXA 3N11A 5LA2A 3CMGA 4LXFA 3AXXA 2J4GA 3WELA 4BQ4A 2DT0A 1TCMA 1HJXA 3AZTA 5BRPA 3T2OA 2Y8KA 4P8VA 4UOZA 3HZ3A 1T0OA 2NSXA 2ALWA 3MI6A 4RE3A 1C91A 1QNQA 1TQVA 2E9MA 4V27A 1HIZA 4OIFA 4NI3A 3WY4A 3OGRA 4TUFA 1IZKA 1OINA 1W1TA 4H41A 1U30A 3ARZA 3ZT5A 3A47A 3AMKA 5EMYA 3UR8A 2XTKA 5E09A 2CXGA 4ZFMA 4AZ5A 3AHXA 1CGXA 1TR1A 1FFQA 2VZSA 3M46A 4A4AA 2WSPA 1UKSA 3L4YA 3BGAA 1FA2A 1ISVA 1DTUA 1NP0A 2Y2WA 5DEZA 1R85A 1MWOA 5A6BA 2BY0A 2VVNA 4UQDA 1K9TA 3LPGA 2BHUA 2A3BA 4HZ6A 3BVWA 2BVTA 5JIPA 1B31A 3D52A 3WH9A 1OCQA 4PTXA 2CBIA 2XVPA 5DMYA 4B15A 2ZWYA 1V3IA 2OYMA 4FNUA 1VEPA 4PUDA 1EHAA 3W53A 1DHKA 1CXEA 1SMAA 3TTSA 1E0WA 2XYLA 1G01A 4D6GA 2FHBA 5C70A 1C7TA 2WVUA 2XN2A 3LXBA 5KEZA 1E73M 1NH6A 5D9NA 1ZBKA 1AQHA 3VNZA 3GH4A 2EPNA 1HKMA 2YLAA 2ZUVA 3W6MA 5IFTA 1QI4A 2EEXA 3CZGA 1CGVA 3VSVA 2XGIA 2NW0A 1LWHA 1XD1A 3ZT7A 1GZJA 1WAWA 3ARPA 1H3GA 2GJXB 4J3TA 4GZEA 1GCYA 2F2HA 3AMCA 3KL5A 3LRMA 1US3A 3GXDA 3PHAA 3LMYA 1JIBA 3ARRA 3PTMA 2OLHA 2VR5A 2V3DA 3WF0A 2A3EA 1ZU8A 4FK9A 4MDOA 5D4YA 4PMZA 3VINA 1M7XA 1EXPA 1VB9A 5JIWA 3SUVA 3WEMA 2WANA 3F5KA 1JDCA 4KMQA 2IUZA 2F7OA 1UD4A 5DT7A 2G41A 1ZJAA 1MW0A 4GINA 1FH7A 4A3YA 4BZYA 2EPOA 2HVMA 2VMFA 4JKKA 3ZT6A 1LLOA 3JUGA 1HNYA 2XGBA 4PMRA 5D9PA 4CD8A 1V0KA 2XM1A 2XSAA 3WD3A 2O9PA 4AIOA 5E0CA 3IANA 2VNCA 1H4PA 4PMQA 3VUPA 1TMQA 3AZSA 1JAKA 4NRRA 1TQSA 1VJZA 3GBDA 5KZ6A 1JGIA 1TZ7A 1ISZA 1C3FA 2EO7A 3W81A 1VAHA 2C7FA 4W5ZA 5C71A 4JFWA 7CGTA 3SCWA 3W4RA 3VDCA 4NZCA 2WCAA 5BXPA 5CJ5A 2XWDA 1KB3A 3BLBA 2J7EA 1MW2A 3WF2A 3AJ7A 3LPOA 5CLWA 1SZNA 1MYRA 3GZAA 2Z1KA 1W9VA 1HTYA 2G3JA 3WMBA 2WVVA 2X09A 4A3HA 4MTVA 3QHOA 3AFBA 2DSUA 5I5RA 3RIKA 2DGAA 4QFUA 4XZWA 5A8PA 3GNPA 5GNYA 4R27A 3VD3A 4WKHA 2FH6A 2F7QA 1Y7VA 2GDUA 3LRKA 4AD0A 5I0DA 1LG1A 5A95A 2IXUA 3CH9A 3KE0A 2FGLA 5BCAA 4W8LA 1V3JA 2ESCA 5JBEA 3QHMA 1G1YA 4WKAA 1ESWA 3LX9A 3VIFA 4BQ5A 1JYWA 4HA4A 2YIHA 3OLDA 1W2PA 3PBGA 5M5DA 4DO5A 4Z2IA 1PIFA 3AZRA 4M24A 4ATDA 1LL7A 3APGA 1GOKA 2WBGA 1HT6A 2UY5A 3VGFA 5EBAA 1VFOA 3THCA 1MXDA 2XWEA 2XFYA 4UQEA 3DDGA 1WKYA 1V6UA 1E9LA 4BA0A 1UD8A 2PC8A 5CSUA 4MNJA 3SCOA 5HDRA 1EDQA 3RM8A 4LYQA 1EH9A 1KXTA 3L4TA 1KXQA 4JFSA 3D50A 1B3WA 1Q6FA 1UZ4A 1FHDA 4W85A 1QX1A 1PX8A 2X2YA 3BCDA 3VGHA 4FLRA 3BMVA 1XSJA 4H7VA 4BS0A 4CD5A 3MS8A 4BQ2A 1M53A 2QMJA 4WK9A 1ISXA 1DWFM 2YJQA 3BAKA 1KTBA 3WDQA 4PYSA 1WNOA 4LYRA 2ZUSA 3N1AA 3A4WA 4B3LA 1TFVA 1UHVA 2CPUA 2JFEX 3CZSA 3MUAA 4DM1A 1QOXA 3GXIA 3NIYA 3AIWA 1AQMA 3U5YA 1RD6A 2A3CA 3DHPA 2YL5A 1G5AA 1E56A 1J0HA 3VGDA 3ARVA 4PCSA 5IFPA 1H09A 4AMXA 1UUQA 4MNMA 4AZ7A 1JZ8A 4BF7A 2FHCA 2CIPA 1ZBWA 1CGWA 3GXTA 4DUXA 1LWJA 1P6WA 2DH3A 1QHOA 3AXHA 1C93A 1OGBA 4EE9A 3WDIA 1K9DA 1KFWA 3PTKA 3AHYA 3VDBA 1VBUA 4IUGA 4X0NA 2VZUA 2VI0A 4HZ8A 3OZPA 2WWDA 2WCGA 2BXZA 1PJ9A 1QNRA 1E6RA 4J28A 1YQ2A 2V3EA 2WVTA 4PRWA 3OBAA 3PZIA 5E9AA 3VKKA 1C92A 4M81A 4AYGA 3BUPA 4MPKA 1VFMA 2X05A 6TAAA 3ZJ8A 3K8LA 4F9DA 2X0HA 5A8OA 1IT0A 1WO2A 3WSUA 2ZX8A 2JF6A 3FAWA 1UYQA 1JFHA 4TVDA 3WDHA 1FHLA 1KTCA 2ZUMA 1LL6A 3MSDA 3VTRA 3CUJA 4MB5A 3J7HA 3H55A 1TQUA 1OIMA 3T09A 1PAMA 5JUVA 1ITCA 1MQQA 2ZIDA 4ZENA 1ZB5A 3EMCA 3A24A 2AAAA 1W9DM 2WKGA 1C90A 3B9EA 4DWSC 2VRJA 4HP5A 5IHRA 2GJRA 1I1XA 3ALGA 1B9ZA 3F4VA 1XHGA 5F7UA 2YDQA 4AEFA 1SFSA 4NZFA 4AZBA 4FNTA 1GORA 3FHQA 1E5NA 3NYDA 4C7FA 4UCFA 1H5VA 2W4XA 3CZNA 4MAZA 1GJWA 1CECA 3CHEA 2VC9A 2E8YA 3AICA 4B3KA 4J3WA 9CGTA 1Q4NX 5FD0A 1I1WA 1V02E 4DWSB 4HPHA 2D24A 3HG4A 3CUFA 3WKZA 5HPOA 1VFFA 5DO8A 3N12A 3PZ9A 2VRQA 3SIMA 3SEPA 1E4LA 3SCSA 5LA0A 1J0KA 4NRSA 1D3CA 1HXJA 2J7FA 3VIHA 5EFFA 4AYSA 3BVTA 2YLLA 1JZ7A 2CHOA 2FYVA 3BLPX 3PTQA 1JD9A 1BTCA 2AOSA 1JAEA 4YN5A 3HU7A 1D7FA 3VU2A 3OLGA 1J01A 3VIKA 4L4PA 4W7UA 3VDHA 2F7PA 3EBVA 2VJXA 4PMOA 1VBRA 4FLSA 1VJSA 3GNRA 4TTUA 4D6FA 4J7RA 2YA2A 1OBAA 5DFAA 3BAWA 5BROA 5LYRA 4JKLA 3L4UA 3WEZA 2PWHA 2GK1B 2VX7A 4UFMA 4B16A 1W1PA 4OUEA 2X0YA 3T2QA 1XC6A 2E9BA 1QBBA 1UR0A 2CBVA 3VDAA 2PWFA 1V3LA 2ZUUA 4D6CA 1H0GA 4ACYA 1BYCA 5ECUA 2WWCA 1J12A 2D0FA 2DIJA 2VRKA 3WQWA 1QI0A 3WF4A 1PEZA 4PTWA 3VD9A 5I77A 4WSKA 4D6JA 3RMEA 5HPCA 1CXFA 4XB3A 1DWGM 1RPKA 1EQCA 3KL0A 4M56A 2VURA 4NSBA 3ARWA 3WH8A 2BY3A 4P7LA 4XV0A 3A4XA 4UFLA 3L4VA 2PBGA 3VIPA 4ZXLA 3ARXA 1EA9C 2WMKA 4J27A 4CU8A 3BAXA 3PZNA 3ZQ9A 2CHNA 3WBEA 1EO5A 4URIA 1K9EA 3L4ZA 3BMWA 3PZVA 1FFRA 1GONA 2B31A 1VRXA 4AMWA 4CN6A 2ZXAA 3A22A 1UWRA 3DYOA 2FDMA 1UWSA 4QLLA 3IJ9A 1GQIA 1HJWA 1MQRA 4U5KA 1HJSA 3CZJA 2BV9A 4HA1A 1WE5A 2EXOA 1HP5A 1H1NA 5A6KA 5HBFA 2D1ZA 1UH3A 5I3DA 1WDQA 1VENA 5CSYA 2WMIB 3CBWA 1NWSA 3WL1A 4CD6A 2QLYA 1UR4A 4Y7EA 5E6YA 3D3AA 3TTOA 5HOSA 1E72M 4E8CA 1Q6GA 1C7SA 4JIEA 3TA9A 3PZQA 2XPKA 1B90A 1L0PA 1NOWA 2UY4A 3AIBA 2WAGA 1E40A 1N82A 2FH8A 4GPNA 3WH5A 4UTFA 1JNDA 2PWEA 3WN6A 3A4AA 3GH5A 3MO4A 1W3JA 3ZIZA 4NF7A 4RE4A 1B1YA 1PZ2A 4ATLA 2ZX5A 1MXGA 2ZX6A 1JYVA 1VEOA 3BCFA 2XN0A 5A2AA 3ZJKA 4W88A 2WHJA 4HMCA 1R33A 5I23A 3M07A 1AMYA 3F5JA 4QCEA 5I24A 1BHGA 3RCNA 1EO7A 1TE1A 1M04A 4TTGA 3VMNA 2JIWA 4OBRA 2DSVA 3BSHA 1HKJA 3EDFA 3A5VA 2GFTA 1EOKA 4CN4A 4AISA 3GXMA 3FXYA 4PSRA 1TVNA 3MKKA 1J0IA 3WMCA 1JDAA 2Y4SA 1E6ZA 2CYGA 3N9KA 1UKTA 1HL8A 1UKPA 4K68A 3WEOA 1J0ZA 1MW3A 3SCUA 1DWHM 4HZ7A 1CYGA 1UH4A 1A47A 2OYKA 3GBEA 4J3SA 2CBJA 4CKQA 1QI3A 1EDGA 2BHZA 1B3YA 1W2VA 1H0IA 3B8SA 4J3UA 5FKYA 2W92A 2J8FA 2CKSA 4L4OA 1CLXA 2Z1SA 2WLZA 1JFXA 3NSNA 1KXVA 1BVNP 2V3GA 3S5YA 1WCGA 3WD2A 1W1YA 1TA3A 2XVLA 1NOUA 1KWKA 3AS2A 1CGTA 2ZUTA 7A3HA 1FP9A 3KZSA 3QR3A 3VIJA 3TTQA 4H2CA 2EADA 3BXWA 3AISA 1ZL1A 1PS3A 1R46A 2BFGA 5CPSA 2RGMA 1CXIA 1UA3A 3U7VA 1BGAA 2CKRA 5FL0A 3GH7A 2XN1A 4GO8A 4H8VA 1H49A 1XH1A 2DSZA 4M80A 3O6AA 1KGWA 2YFNA 4Z2KA 3OZOA 3GNOA 4C7DA 2E8ZA 4CVWA 5CGMA 4D1JA 3MUY1 3WUBA 2W66A 3TOPA 1V3MA 4X0VA 1E6SM 4JL2A 4B9YA 2DQXA 2XVKA 1V6YA 4EK7A 5E6ZA 1RP8A 2XSBA 3B9DA 2V38A 4BQ3A 1QI5A 3U5UA 3PZMA 4MAVA 1H41A 2TAAA 1CEOA 1HVXA 2W91A 4AXNA 2G3IA 4QLKA 3VPLA 3UCQA 1X6LA 1CDGA 4FLQA 3PZUA 3QHNA 1G94A 4U33A 1GW1A 1W3KA 2Q8XA 5AY7A 2G8ZA 3MANA 1BVZA 3U57A 3ZSTA 4ZE4A 3CZEA 3VD5A 5A6AA 1CXKA 1KBKA 1V0MA 1XH0A 3SCVA 1JXJA 2YFOA 1UR9A 1HWWA 2WPGA 2UY2A 4PMYA 3OB8A 2YL6A 4PN2A 5A6BD 5A6MA 3O2LA 1NP2A 3BAJA 2BVDA 3AOFA 4JL1A 1HKIA 3AHTA 2WC7A 2X2JA 4DUWA 3GXNA 1HJVA 1LL4A 1B3VA 3WENA 4TX6A 3CZ8A 3MV01 1VEMA 2D0HA 3AHVA 4AD2A 1LG2A 3VGGA 4TVCA 2YKKA 5FL1A 3DX2A 4FNRA 1OM0A 5D9OA 1CZ1A 2ZXQA 1OWQA 3KL3A 1QHPA 3B9AA 1R34A 1OB0A 1LQ0A 2JEQA 5IHSA 3WQ6A 4JAWA 1UWTA 3ZR6A 2X8RA 3BLKA 5AYIA 1AQ0A 4UQBA 2WBKA 1BYDA 3ARTA 2WB5A 1WP6A 4MNLA 3WQ5A 2IGTA 3GYCA 2WMGA 4AWEA 1E3XA 1E1EA 2EPLX 2GUYA 3AIEA 2XVNA 3LRLA 3LPPA 1E4NA 5ABFB 3GM8A 3WF3A 3RILA 1E6XM 4W8AA 3EJUA 3NUKA 4WSJA 2MANA 3DYPA 3DX4A 4PMDA 2ZUWA 4PTMA 3IK2A 1EGZA 3CMJA 4D71A 1QHZA 1GVYA 1NQ6A 3EMQA 2E9LA 8CGTA 1SYTA 2JEPA 4MADA 3WF1A 2PI6A 2DIEA 1KR0A 3VGBA 1E6PA 4UNIA 1E5JA 4P7RA 2EACA 4LX4A 4JCLA 1XSKA 3MSGA 2DH2A 4Z2LA 1XGZA 4GO9A 3CUGA 4D6HA 2C8NA 3TV8A 1HVQA 2ZOXA 1IV8A 2QF8A 3VIIA 5A8NA 4QCFA 1JNEA 4AD3A 1R47A 2J47A 2ZUNA 4M1RA 1B2YA 1D2KA 3CZLA 4AD1A 4IPLA 4PTVA 3T0BA 1CXHA 2ZXBA 4NXKA 4C7GA 3DX3A 2ZWZA 4UQAA 2J77A 1JF5A 4NX0A 4ZEPA 5A2BA 5JBFA 5BRQA 1K6AA 2EABA 4D6EA 3A23A 4JHOA 2G3MA 4F8XA 1NM9A 3ARUA 3CUIA 2D3NA 3RM4A 4PCTA 1UOKA 4H04A 4LPCA 2CERA 2YOCA 3K4DA 1R8LA 3WH6A 3W37A 2WC3A 8A3HA 2XFFA 4U31A 4CUCA 4ACZB 3WH7A 3W28A 1XCWA 1U2YA 1TQTA 3EJTA 4FNQA 3SCNA 4MB3A 4CU6A 3W38A 3HG3A 3W26A 1JZ4A 3ZR5A 1ZJBA 2QPSA 2J78A 3ECQA 4CCEA 5CPTA 5A8QA 3I3BA 4E2OA 1GPFA 3NDZA 2VCAA 4GIAA 2X2HA 2WVVB 3AMGA 4W87A 1XCXA 3I3DA 2OWWA 2UWFA 4QDMA 3T2PA 3AROA 1FP8A 4D6DA 2PWGA 2WW5A 3ARQA 3ZMRA 3UG3A 2WCSA 4P8XA 5GPRA 4LQ1A 2XG9A 4AD5A 2CETA 2WM0A 2DT2A 3BSGA 1TVPA 1UA7A 2YDSA 2VX4A 2J74A 4DO4A 3WQ4A 2XFRA 4PUEA 2EAEA 5ABHA 4UOQA 1HKKA 4U5IA 3RDKA 1ISYA 2D0GA 2OW6A 2J7BA 1RP9A 3AIRA 3WQVA 2WMIA 1XSIA 1WZMA 4GXPA 3W25A 1E0VA 1UWUA 3TONA 1UWIA 3WNMA 3WDJA 3SCRA 4HU0A 1KWGA 4JCMA 1OGGA 4AY1A 3BUIA 4UQCA 4CU7A 1JYXA 1F4HA 4WIWA 3W82A 4KGJA 5BXSA 3SUSA 4EAMA 2V5DA 5BXTA 2VQUA 1GQLA 1W3HA 1DEDA 2XJ7A 1GJUA 5I78A 3AHZA 3DX0A 1XV8A 4M29A 4S3KA 3VIOA 4XX6A 3N18A 3UETA 2XVGA 4UFKA 4F79A 3O9NA 1FH9A 1R86A 1KCKA 1C8QA 5IXEA 1NWRA 5FOOA 5I6SA 1EHNA 2QMKA 1HX0A 2DPEA 2QPUA 1XYZA 3WNPA 3OG2A 2V3FA 1GNXA 2E0PA 2F61A 3MUIA 1UR2A 2VQTA 5E70A 2V5CA 4DO6A 1E0XA 4HMEA 4HU8A 3KWXA 4N42A 2FE0A 1QVBA 1XH2A 1DWJM 4MB4A 5FIPA 5A69A 1UKOA 3D4YA 3IAQA 4NXSA 1A3HA 1QW9A 3LXAA 1Q6CA 2DT3A 1ZS2A 4GKLA 3NSMA 4AW7A 2WXDM 3VVGA 1HXKA 3DECA 4P8WA 2EJ1A 1FOBA 2GJXA 5DF0A 1MFUA 1J11A 4KH2A 1R75A 1G0CA 1GOWA 1MVYA 4PMNA 4W86A 3AMDA 4X9YA 4HPGA 2XIIA 2RGLA 3CPUA 3VIGA 3N04A 3EYPA 3MV11 1OGSA 1QI2A 1CGYA 3KLLA 2XM2A 2CITA 4KWUA 3SUWA 2FHFA 4JFUA 3SUUA 4J3VA 1HN1A 3N17A 4W93A 3AIQA 3EMZA 1V0LA 3BAIA 1HL9A 1E70M 3UG4A 1TG7A 4FF5A 1CTNA 2J75A 1HP4A 3PZTA 1OD8A 4QP0A 4GZIA 3BVXA 3W24A 2PWDA 3EJRA 1QNSA 1NWUA 2GVYA 4AZIA 1W9BM 1JDDA 3VOCA 1E4IA 3HG2A 2F1AA 3W29A 4F9JA 1O7DC 2QV4A 4PMVA 4AZHA 4ZE5A 5HNNA 3LXCA 3ALFA 3CUHA 3FHAA 4WLCA 3QOMA 4HOXA 3VSTA 3VMPA 2O9RA 3VM7A 1B0IA 3ARSA 4GQQA 5BXRA 4S3JA 4AZGA 2J8GA 1BYBA 3U7BA 1JZ6A 1ZBVA 4HTYA 5M3WA 4QLJA 4P7NA 2X1IA 2UY3A 2VO5A 1WZKA 3EDEA 3VX1A 3WMSA 1OSEA 3VX0A 3GDBA 1MFVA 2DT1A 3WIJA 4DM2A 3MMDA 3DHUA 3SURA 1TQWA 1CENA 4TXEA 5A2CA 1WDPA 3W0KA 4QAWA 3TP4A 4D6IA 2VCCA 4M82A 4AIEA 1XYFA 4JKMA 4P8UA 2J7HA 2WYSA 1CGUA 4IPNB 2XIBA 5HXMA 1PBGA 1ZBCA 3K46A 4IISA 1CPUA 2OSYA 1KBBA 2EPMX 1GUVA 1BGGA 1X1NA 4Q7NA 3G6LA 1KQZA 3IJ8A 2J62A 3NDYA 1KXHA 4OKDA 3VNYA 3CTTA 2E4TA 4OOZA 1BG9A 4MNKA 2C0HA 4OBSA 4R5EA 4AZCB 6A3HA 3UR7A 3DX1A 3EJSA 4FNPA 1V02A 3RPMA 4CN1A 4FMVA 1JZ3A 4UZSA 3VD4A 4U3CA 3K8MA 2PBOA 4GI8A 3CO4A 4LYPA 1UQYA 3NSXA 3CC1A 2W62A 1R87A 4PSPA 1E3ZA 3QOKA 4XUYA 2D22A 2WLYA 5EFDA 2ZX9A 1JF6A 4D1IA 2DSKA 3CHDA 3RJXA 3POHA 5ABFA 3A21A 4B9ZA 1OIFA 3WQ8A 2BVYA 3ZJ6A 3WNLA 1H11A 1J0YA 3AMLA 1BG4A 3MUZ1 2WZEA 3POCA 2VOTA 5I79A 4AZ6A 2W67A 3SCTA 2WSKA 1UKQA 1JYNA 1O7AA 5A6SA 3F5LA 3G6MA 1BYAA 5JBDA 5A1AA 4YPJA 4AC1X 1ODZA 4TOQA 5E1QA 1HJQA 3ZJ7A 1XD0A 1ISWA 5A94A 4D72A 1PPIA 1W91A 3AXIA 5A6LA 3FN9A 3KEHA 2O9OA 5D9MA 1JL8A 3HMCA 4MJ4A 4HOZA 2O92A 3VGEA 2VL4A 3UG5A 2O9TA 2Y24A 2VZTA 3K4AA 4WF7A 3WNNA 4P7OA 3ZSSA 2XUCA 3NCOA 1QBAA 1OT1A 3WY1A 4CD7A 4AMCA 1W32A 5IDIA 4Z2JA 4GQRA 2X2IA 2CCRA 1G9HA 2XHYA 3RM9A 4OGZA 4JFVA 3OGVA 3WL0A 4U2YA 4JZ5A 1V03A 1NWTA 4E4PA 1GHSA 4GI6A 4W89A 3MMWA 4KRTA 3L4WA 4H8UA 4V2XA 3PZOA 2QHAA 2BS9A 3LPFA 1J9YA 2OWXA 2BY2A 4RE2A 1V6XA 4LGXA 5CQ1A 4ACZA 2J7DA 1V6VA 2DDXA 2PF0A 3AI0A 3MMUA 1JI2A 1UD6A 3OLIA 1O6IA 1ECEA 3VO0A 3GTNA 4YHGA 5CXPA 3BH4A 4F66A 3H53A 1V3KA 1XRVA 2A3AA 1K9FA 2OSXA 1QWNA 2J25A 3WD1A 1U33A 3WNKA 1CIUA 2VR4A 1JXKA 3HN3A 1JZ2A 3A6OA 4J3XA 4WKFA 4ML4A 3PZGA 1NOFA 3CLWA 1X6NA 1BAGA 1BSIA 4CCDA 2WHKA 2F7RA 3VSUA 4UR9A 3IJ7A 2GJPA 3EDKA 1H2JA 2D73A 1WZLA 1UZ1A 3NJ3A 1S46A 6CGTA 1V3HA 1M03A 7TAAA 2JIEA 3AS1A 1JG9A 3FAXA 3WY2A 2CEQA 3II1A 1QNPA 3BC9A 3VD7A 3GXFA 4DUVA 3T0DA 3M7SA 2YBTA 3S5ZA 2Y8VA 1JZ5A 4MB1A 2WHLA 5I2UA 3FNDA 3UESA 4BCEA 1E6QM 1CXLA 4AEEA 3N15A 4DWSA 4Z2GA 5ABEA 4W7VA 1C8XA 1QW8A 2HISA 1KGXA 2WHMA 3S2CA 5GNZA 1R7AA 3M6DA 3CZKA 1UR1A 1KQYA 3WD4A 1QPKA 1TA3B 3AYRA 1E4MM 2EQDA 2J79A 2W63A 4HMDA 4MJ2A 4E8DA 4UQ9A 5TD4A 3H54A 4FLOA 4W7WA 3A3HA 2EPKX 3BVUA 2VZOA 1E71M 1UD2A 1UG6A 2ZX7A 1GQJA 3L2LA 4CGTA 1W9XA 4AIUA 2G4FA 4OZOA 1WPCA 3SCPA 2OYLA 3K1DA 3CHCA 3CHFA 4OOUA 1J0JA 5E0FA 2VUYA 3AQUA 1V08A 5A8MA 3UERA 5CGTA 5CZKA 3EJQA 1LF1A 2GK1A 2JE8A 2VX5A 1OT2A 2WMFA 4JFTA 2WMJA 2OWCA 1W3LA 3WUFA 2CESA 3AYSA 4EKJA 1W9UA 2F18A 2DEPA 3SUTA 1KCLA 3OA5A 2J7GA 5DT5A 1BF2A 3AIVA 2OSWA 4UFIA 3VMOA 1Z32X 4U3AA 4TX8A 2BNJA 1E6NA 2YL8A 4MDPA 2VT0A 5A3HA 3WDRA 4CD4A 1PIGA 1UQZA 2A3HA 1DWAM 3CIVA 2NT1A 1Q6EA 3AIUA 2ZE0A 3WNOA 4AD4A 4NZJA 2BXYA 4UOJA 1KGUA 4H8HA 4UZUA 3HJEA 3WY3A 1W1VA 2WC4A 5LA1A 1GHRA 1JI1A 1MW1A 2GSJA 3OIHA 1GOMA 4IM4A 2BY1A 3FY1A 5M03A 2NT0A 1BFNA 3EDDA 3UEQA 2YBUA 1UD5A 2VX6A 5BYWA 1E1FA 3BUDA 1J10A 3OGSA 2W5FA 3TTYA 2OW7A 1BQCA 4DWSD 5M17A 2AMGA 1LJYA 2JF7A 1PX4A 1B3XA 1CWYA 3CGTA 1AVAA 1GOQA 3WUGA 5CG0A 3DDFA 1OD0A 3PN8A 4U2ZA 4RL3A 3WDPP 4PBGA 3ZO9A 2VCBA 1WDRA 3VM5A 1SR0A 2D20A 3IGUA 2E3ZA 1Q6DA 2YDRA 3ZOAA 3CV5A 1E15A 1V6WA 2WZIA 1R7OA 4GI9A 4Q22A 2GDVA 2Y5EA 1GVIA 3VIMA 4KGLA 1BPLB 3DYMA 1CLVA 3DC0A 3WFLA 4WJXA 4M8UA 4PEEA 2F1BA 2DSWA 2VVSA 2CBUA 2IXVA 3KLKA 4W5UA 3D5HA 1WB0A 4UFHA 2YA0A 3T08A 2D2OA 1UASA 1EIBA 2YL9A 3HG5A 4EANA 3WUEA 4V28A 2WNWA 2WVSA 5ABGA 2VTFA 1BLIA 1VF8A 4GZJA 1DWIM 5CPQA 5FCZA 2BHYA 3N13A 4AZCA 1J18A 4PMXA 3THDA 4Z2HA 5AC4A 4XZBA 1KR1A 1DP0A 3D51A 1I75A 1PX3A 5AC5A 2G3NA 1L8NA 2YA1A 1V0NA 2JALA 4ZXOA 3L2MA 5CLTA 1W9PA 3OLEA 3EJPA 1UWQA 1UD3A 1M01A 1E43A 4CCCA 1B3ZA 5C8BB 2ZXDA 1VIWA 4W8BA 1EQPA 3BUBA 3SCQA 3AS0A 5EB8A 2EBNA 3WD0A 3BAYA 2WMHA 3BUQA 3WFZA 1CBGA 3W27A 1VFUA 4ATWA 5GQBA 1WZAA 1CNVA 2D23A 3K8KA 3S6TA 2WK2A 1QNOA 4W84A 4CVUA 1ODUA 1EOMA 3RO8A 1F4AA 1IZJA 1QWUA 1NARA 1MQPA 1GOIA 4OJYA 3ARYA 1HF6A 5D8WA 4TVUA 5AYBA 1HJUA 1RH9A 4HOWA 1GQKA 2W61A 1UH2A 1ITXA 1WDSA 4YHEA 1B30A 2E40A 3W6LA 2PB1A 3BVVA 1GOOA 2ZICA 3E1F1 1C8YA 5D8ZA 2FGZA 3IAPA 3FW6A 4N0RA 1EDTA 3I3EA 3AS3A 2CNCA 1US2A 3D4ZA 1E55A 1YHTA 4UFJA 5A6JA 4FNSA 3WBAA 4HA3A 2J7CA 3VILA 2VZVA 3GXPA 3QGVA 2WZHA 3ZM8A 2D3LA 4JHZA 4KRUA 3RJYA 5GNXA 1FH8A 4PMUA 2WKLA 2F8QA 5BWFA 4P7QA 3EDJA 3MU7A 1JD7A 1PZ3A 3T0AA
chains in the Genus database with same CATH superfamily
4JO1L 4RH4A 5DJZA 4X5XB 3N06B 3S4SB 1GOHA 2OMUB 1UENA 1J86A 1TCRA 5D9SA 1O5KA 1POKA 4HC1H 4HZAA 5E2WH 4MZ3A 2Z31D 4GW1A 1HDMA 4H9VA 3HPJB 4UOZA 3GB6A 2DQHH 3C2AL 4WFFD 4PB3A 1C91A 3QUMH 4HA0A 2EAWA 4CADA 1HIZA 1TZGL 4E9XA 4P2CG 1IZKA 1OINA 4U05A 4WEBL 1EBAA 3FU3A 3ZT5A 1EFXB 4UIMA 3IJ6A 1TR1A 1FFQA 4FA6A 3BQ5A 4HUCA 1SUJA 4RK8A 15C8L 4GSUA 3SDCD 2AXJA 1SR9A 4PG2A 3GS7A 3CFCH 1L8PA 1KFAH 1A7NL 3NRPA 5DMYA 5I74B 1A9BA 2E09A 1JPST 5F7WC 3OJGA 3LCFA 2X4QA 2PCEA 4D6GA 4NN6B 3DSNB 2E4FA 2ROYA 2BHFA 3X12A 4YCOA 3IXAB 5KSBA 3MRPB 1A3RL 4MHBA 2APWA 4NRZB 4GLEA 2VQ1A 3CEPA 3ARRA 1TZIB 3CAVA 1B3OA 3EO1A 1OGTA 4JN2B 1FL3A 1Y1DA 1RZ8A 2JXMB 5DLMH 3PYCA 2UZ9A 3QDMD 1RIVL 1U8QA 3UXFA 4G6FB 4P5RA 4CD8A 3P2TA 3NEXA 2QVIA 1MLBA 4GAAA 1RJLB 2EH7L 3RUGA 4J2XA 3NIDE 3VWKA 2AEWA 4X5PA 1XG4A 5XINA 2H2SD 3T8LA 1TUPA 2J1WA 3KOWA 3EKCA 3FU5A 4DTGH 3VDCA 1SZGA 1P4IL 4P2RD 2J7EA 3WF2A 4Y4FA 4HS8L 2OO0A 5KZMA 1MFCH 3NQKA 4OZ4B 1F4YL 4B5NA 1X9QA 1F6YA 3UAJC 3VWJC 2DGAA 4U3XA 5GNYA 3MBXL 3QJZA 3VD3A 1U8NA 3GRWA 2MKLC 2YSWA 4PGBA 2DQJH 4PJAA 1W2KT 2ITFA 4JN1L 3AG2B 4HJ1A 3THCA 3ETBF 1MXDA 5BV7L 4HS6A 4FQIL 4YMZA 3DI0A 3MFFA 4K9JA 3SDAA 4L37A 3V6OA 4JFYB 2PTTA 4CC4A 5EEVA 2L3BA 3HUJB 4FA3A 4GIPD 4NP4H 4F7KA 3UYRH 1RBAA 1YTDA 1ZVHA 1KRMA 2P5NA 4RGND 1LLZA 4BS0A 3VDGA 1DWFM 2JJVA 1GYLA 1A6TB 1WNOA 3AALA 1RFDL 4LQFL 3A4WA 4NOBA 5L6YH 4TPRH 5CC3A 1ZLPA 3A4JA 3MUJA 3L48A 1LMIA 3RZCA 4HIEA 2ZKWA 5I6MA 1RUAL 4P0DA 1CICB 3RL2A 4DUXA 4NIRA 4KO7A 3DMMB 4QTGA 4D0BA 4OZFG 5A2JH 1O75A 1XMWA 1NGPL 2XN9E 4DY1A 1QOPA 5K9OA 2ZRVA 3LV6A 2WNNA 2I5QA 2F5AH 3F58L 4X0NA 2VI0A 3R58A 3EXTA 2CZNA 3TJ4A 1XJBA 1J96A 2VZ1A 1KT2A 5JQHC 2VKWA 1EV2E 3VKKA 4M81A 9PCYA 3GIQA 3RLUA 3QQ3A 3RTQC 5IESL 3EO0B 3T4YA 1YUHA 4XX1E 5DRWA 1FHLA 4PJIE 1KTCA 4R88A 4XAPA 2Q8AL 3WL9A 3SRDA 4Z3HA 3CDGA 5AVTB 5HYJE 5TDOB 4HCHA 1XGRA 3TJEH 4I4WB 1DE6A 4GK8A 5LDSA 3ALGA 1G7PA 1SDYA 1S5HB 2IDUA 2YDQA 4G8TA 4AEFA 2XZCH 1F9CA 4MY9A 2X9YA 1A7PL 1X7TA 1KIUB 2XISA 4JY5H 2W4XA 3CZNA 3FEMA 1UZGA 5ENWA 3BZFB 4LLVB 2E8YA 4FEIA 4XP6H 4GXMA 5FD0A 4APQA 4DWSB 4X5WB 4EI5D 3SE8H 1ONWA 4OTXL 3NIFB 4HAGA 4NAEA 2H9GB 1YTEA 1A02N 1IEHA 1HXJA 3S8FB 4GMSH 1A6PA 4DJED 5CINH 3OQ3B 1D7FA 3B04A 1SVCP 4D94A 4JY8A 4AK1A 1NCHA 3F7JA 4XB8A 2YXXA 4DJFC 1E9OB 2YA2A 1T7LA 1CMOA 1A1NA 2BS71 4LL1A 3N2MA 3MZ2A 3QJFA 3NWRA 3N4EA 3FQNA 4WW2A 3S9YA 5DJDB 5IVXF 2NX5E 4WEVX 3CH1A 4D6CA 4ZPVB 2VFDA 3UX9B 4DNLA 4PIRF 4G80B 3QFJD 3CWGA 1R30A 4JQ1A 4JEJA 4Y19B 3WN5C 5L9DH 4F7TA 2JKNA 1E27B 3GS6A 4F2EA 3HA0A 1I1AD 1VRXA 2PETA 4CN6A 4Y2LA 1E8XA 5KINA 3N2TA 3LH2H 1H1ZA 2ACUA 4U5KA 4D0DA 3WBWA 1TCDA 2KKQA 4DKDC 1QMUA 4OZIF 5K69A 3WL1A 3O0RL 5HHOA 5K9QG 1OAKL 4LSPL 3VYPA 1HOEA 4CBZA 1PNCA 1QRNE 3TA9A 4L8SB 2Z7YA 4ERIA 3TA3B 1U3ZA 1QFEA 3IFLH 4XSMA 2HCVA 1J5DA 4NENA 1EP1A 1IVTA 4PUJA 3DIDA 1DQDL 2PTVA 1R4XA 1EPXA 2X40A 4UM8A 1CIDA 1AMYA 1ET7A 1MRDH 3RCNA 4IRSC 4YGAB 5BW6A 1EO7A 1UJ3A 3K6DA 4ANUA 1BD2E 4ODUB 5IMMB 3NACH 4QR6A 1TVNA 4I2XB 3NIFE 2Y4SA 1NBZB 5E9DD 1W8NA 5E5MB 2H1PH 5F2MA 2BOBA 2AQ2A 4QE4A 2WTRA 3B0YA 2VERN 4HHMA 3BISA 3JWNG 4J3UA 4HG4J 4RFEA 3ITVA 5EZJB 4QRPE 1JFXA 1WCGA 4QIUA 3CHPA 4PLNC 5FEWA 1TA3A 3DJ9A 4Y0GA 2KQMA 2ZUTA 1IGCL 3KZSA 5HHVH 2ILLA 4G42B 4I9WE 1NIAA 1EEXA 3NFPB 5I0YA 4YIWA 1O1HA 4Y2DA 2VLME 2F53A 4M6NH 4F0RA 2PF6A 3LTPA 2WXJA 4C7DA 3BIBX 5IG7A 4DP1X 3TOPA 4JL2A 3G6JE 5K7JA 4BQ3A 4OUUA 2EVHA 3FRPB 4Y19E 5D1XB 1KJ2A 3OKLB 3NA4A 1GJPA 3IRZA 3HHSB 4PY8J 1YQVL 5C0EA 5B7MA 1HXYB 3L7RA 3QARA 5E0QA 2JK5B 3GK0A 3MU3A 1NFIA 3EYOB 3SN1A 3WLPA 1G69A 5FFGA 3OB8A 2CZ5A 4N2YA 3F84A 5A7BA 4N1HB 3SSZA 3MZGB 4NS0A 1RAKA 3HI5H 1FVCB 3GPEA 4BKLB 3NQCA 1W5PA 4FI4A 3W11C 3KGRA 5J1AB 2QVKA 3U8GA 3C60B 4MJIB 1U8KA 5AC6A 4XAYA 1AHWA 1KN2H 1GIGL 1LQ0A 2BSDA 3DVNA 3FUFA 4KESA 4WR3A 3SIKA 3ARTA 3LD8B 3ARGC 2ALAA 4PFEA 3QLLA 4YBLB 3VXQA 4WI0B 1VZWA 3NUKA 2ZONA 1AY1L 3DYPA 2FUQA 3X11A 3CVHA 3HFML 4WGHA 5K1JA 5DY3A 1NQ6A 4A7GA 2BVOB 3F6JA 2GIXA 4BSVB 1NVMA 1XGQA 1XIWB 4WJ5A 4WRHA 3IDYB 2CZVA 5L8KB 3EO9L 4QITA 1FWTA 3ATYA 1HILB 4AG4L 2R6OA 4JY4A 3H23A 5CCZA 1B2YA 4KK5D 3M7WA 3CZLA 4W68A 3IUDA 1PCSA 4ZA0A 3UTOA 3RRXA 1PG7L 1FVPA 2GBVA 3LPWA 4C1NA 2A77H 2D3NA 5DC2A 1FCGA 4HC1L 5E2WL 1ZY9A 2UWEA 3CIWA 3CSBA 4IJ3C 1KM0A 1LTXA 5B22A 1GAFH 2V6AA 2A9DA 3GDMA 3WK3A 5D7JC 3W26A 1A5KC 1L6XA 2Q6WA 2QPSA 5CPTA 4JFDE 5FX3A 4EIUA 1J5OL 4U6VH 1CT5A 4GY1A 4GIAA 1XCXA 2QGCA 2UWFA 4PJ6A 2PWGA 1OP3H 1R3RA 3MRCB 4TNEA 1RUQH 4JKWA 4P8XA 4B5EA 1CLCA 4CGUB 4NKDB 2VX4A 3MJ9L 1T5XA 2NLJB 2RFXB 4U5IA 1ISYA 3U4BL 3RVXC 3U0PB 3HCVA 1XSIA 4PV8A 1U42A 2OA9A 1M2VB 3N1GC 3QW9A 3BUIA 1KCRL 4M62H 4GYFA 4FAAB 4HVXA 1MCSA 1OLZA 3PV7A 3TO4D 4PP1D 4TSAH 3X3FH 2DWXA 2MIZA 2I56A 3U2SA 5K2ZA 2WQXA 3VXRD 4XX6A 2DWTA 3GK8H 1EHNA 4M7JL 4ZFQA 4V1DB 5BVPL 1I9CB 3RWDA 2YD8A 1BQUA 3MQIA 3C5ZA 2R8SL 3L1EA 3L3GA 1TETH 3UWWA 2HH0L 2MPVA 1D9KB 1OAQH 4NXSA 3GPSA 1DJYA 1IEIA 4B27A 1RPXA 4H1ZA 2RTTA 2YHGA 4NZ5A 3D18A 4YL2A 4GKLA 3A67L 3HV8A 3BOVA 4KJPD 3FL7A 3QUZB 5DF0A 2BASA 2DJXA 4PBDA 4YQXL 4K7FA 1MFCL 1OGSA 4AXKA 4IL0A 1OX6A 4O51A 4TSCH 3LQMA 5LJYH 5E08L 2CHDA 2H3KA 3AIQA 3II3A 1ZHBB 1V0LA 1Q9LB 3SGJC 2AQRA 1Q9OB 1F76A 3ID7A 4QKTA 4PJEA 2FGWL 2JKRM 3W24A 2X4SB 4MWFB 1OCZB 3RP1A 3KPMA 3T2LA 2F1AA 3W29A 3DNKA 4HKXA 1IEQA 1HEHC 4JFFD 3L1FA 3ZUCA 2ZYRA 2VIRB 2BW5A 4WLCA 3VMPA 2O9RA 4Y90A 1B0GB 1B4EA 3OJDA 1DJWA 2CLVA 2PCPB 4HPOL 5F7KC 1XXDC 1IM3A 1LEKB 5ECGA 3MRGA 4HWZB 3MMDA 3MREA 3AABA 4OB5L 1QO2A 1FBAA 1SM3H 3TQVA 3GY1A 2CQVA 2XIBA 1BEYH 3CG8A 5L6YL 2MNJB 4MQTB 3F1QA 4K3DL 3NDYA 1ZFJA 4QTIH 5JO5B 4TQPA 3DX1A 1OAJA 1AH4A 2BVQB 3G1DA 2H8PA 2PDNA 3CC1A 4Q6IA 3CB8A 4KROD 4EOWL 3J2PA 5C7ZA 4D1IA 3RJXA 4E5XG 4H8WL 3E2QA 3S3BB 1IUZA 1J0YA 4YSAA 5CD3B 4XOBA 2CM5A 4G71B 4LNRA 4KHTH 3BPOB 5BS0A 3HOGA 5A6SA 3QXTA 2WXGA 1HJQA 3TXZA 3ZJ7A 4NAQA 2OL3H 2XTJB 2O9OA 4IBZA 2RKXA 3W83A 4OGXH 4UIOA 3WIHH 4UWQB 4YVPA 3BFWA 1V03A 2XXGA 1GHSA 2XZCL 2EDEA 3QQDB 1MEHA 4NZ4A 3NDZE 3QXUA 4OR1A 1UB3A 1KEGH 4XP6L 3KWVA 5FO8A 2AQ3A 3D69B 1NCAH 4NNXA 2J43A 4U0RB 1LUCB 3SE8L 4IS6A 1LQ2A 2DDXA 4GAGL 2GLKA 5ETUB 4Z3FA 1A1MA 3P9MB 5TTRA 1X4XA 4V11A 5EN3A 4J1UA 2P0OA 2V2XA 5CINL 5ICYA 2R69A 4JTQA 3IGSA 4RGOL 1BAWA 3B4UA 4X60A 2VDIA 3QIUC 4KVCL 4MCYB 3ROLA 2YZ8A 3S0CA 1BBJA 3RNKA 1H2JA 2WQUA 1I1FA 3BGJA 1UZ1A 4WHTA 1AACA 3M1CA 2PGEA 3FAXA 1X5FA 5DLCA 4LE8A 1ZALA 4N1CA 5JXAL 3GXFA 1XAUA 1F4WH 2F8VA 4BCYA 4DVRL 5HDOA 5GS2D 3P6LA 2EYRA 3ZZSA 2JF1A 4HBQA 2VW4A 5ABEA 4LNCA 2H32A 5I8OH 1DJGA 1KGCE 3WLNA 4YHPA 3M6DA 3ORJA 3KDNA 3P84A 5KW9H 4UQ9A 3H54A 4YNYB 4F7EA 1C9SA 3I9AA 5DEGB 5L9DL 1CCWB 2VXQH 4KK6D 3TDFA 2X42A 2AQOA 3KBEA 3BVUA 2J66A 3BARA 4BJHA 3KLAB 1FRGH 4CGTA 3LLXA 4GXWA 2WJ5A 5BZZA 4KKAC 3LH2L 4OOUA 3UABA 3AQUA 1RBOB 5KVDH 1N0LB 3KWTA 2GK1A 1H3TA 2VC2B 5EBMB 1ED3A 3AREC 1QKZH 5GRJH 4KOBA 4QDPA 2BIPA 1BQHA 2ZZ2A 4L3EE 4KEVA 1VGKA 1ETZB 1XBRA 3CDYA 4V1XA 2ASHA 2H3XC 4FXGC 3UU0A 1Z32X 3M45A 3W02A 3LZOA 2YL8A 2VLKD 1F58H 3FQXB 3OKDB 3UYPA 2IKIA 5I6PA 5ACZB 5CC7A 1WFUA 5IUSA 2WUCH 1ULVA 2CKBL 1HAUA 5EU6D 2J9XA 3QH2A 3R94A 4NJ9H 1AZNA 4BK5C 5EU7C 2ZC8A 3A4FA 1SFJA 3RWHB 3BH8A 4FULA 3P3YA 4KV5E 4U1LA 5FEXA 5KOMC 3RZWA 3ZO9A 2PDCA 3BV7A 1NA8A 4PWIA 2E3ZA 3EWBX 4Y4HC 5HHVL 5IFJB 4L4LA 4OKVB 1LP9A 1BM3H 4KGLA 1DO5A 3Q43A 4ZODA 2IXVA 3LIZH 4PJGB 3ECUA 1UASA 1CLYH 3UXLA 2H4EA 3VNMA 1DWIM 3QFEA 5CPQA 2TRYA 4AJVA 1JHTB 3BPLC 3ARBD 5F9OH 1OFRA 3RF9A 1P7QD 1S7WA 3EOAA 4E8GA 1OAUL 1QBLH 1KGJA 4V2BA 5A6IA 2FT6A 2OODA 4A6GA 1YNLH 5L8LB 4MY1A 4WFEE 1QW7A 3X1BA 1BFTA 7ODCA 4ATWA 4GFTB 5BVJB 2J12B 3QV9A 1GKEA 1KCUH 3EYQC 5HYIA 3FCGA 3QWRD 2FQIA 3FOMA 1ZXKA 4I8YA 4DOHE 1I2QA 1HJUA 1WDSA 3KG5A 4PJFA 3V7AG 1C8YA 2VDKH 1A5FL 3TKFA 1UWGH 1H3VA 1J5HA 4X4XA 1LMKA 1D6EB 3HR5A 3SE3C 1UADC 4IFKA 3QGVA 2WZHA 5GGSB 2VDPH 1AO7D 1JPGA 3T0AA 1RBLA 2NPLX 3K1KC 5GGRB 1YC8A 3L7FB 1YNTB 3RPDA 1AZRA 1GW6A 3MCKA 3P9WB 2FIKB 4B9IA 3GHSA 4P8VA 4NZUL 4G7YL 1FHUA 4KO5A 1IGFL 4DZ8A 4OIFA 2X0WA 4NI3A 3FDWA 2XNAB 4ZB0A 4H41A 3W0WD 5I6KA 4A6YA 3QFWA 2OX4A 3TVMC 2VZSA 4FD0A 4FQJL 2OTDA 5HUOA 5CAYB 4YYCA 1V51A 2WCPA 1H6TA 5EN2A 1R85A 1MCKA 1WBYA 4IF2A 1AKJA 3CK0H 3I6LE 1TZOA 4F92B 3SBFA 5I15H 3I9PA 1N2RA 1G01A 2X6VA 5FDWA 5FF4A 3GC3A 4JO2H 2Y07H 3KXFD 2EPNA 1HKMA 4MASA 1GAFL 3NZUA 2K9UA 5AVSB 2WIIA 1HSBA 4ZUTA 2QLVB 3ZKXB 4WFHD 5I76B 3LMYA 4Y2WA 1VP5A 1JXDA 5AC7A 4M6VA 5AL8A 2N0KA 1JV5A 4S2SB 4G8GB 2DMHA 2XPYA 5I1HH 3QEQB 5GIRA 3HI1B 1K2DA 3W7EA 1NGYA 2BOGX 1WBZB 3N55A 4PREA 5E0CA 1FC2D 2NX1A 3IANA 4FTVE 3IDNA 1GSKA 2ATAA 1JGIA 3W87A 5CWSB 2NXYD 1RJYB 4TVSa 4OI7A 2ZCLL 4WWOA 2QHRL 2DFAA 2DWDA 5DQ9A 2FWOA 1ECQA 3TNNB 5HMFA 2XPGB 4APXB 3KCJA 4A3HA 4DEWA 1TPH1 1XC4A 1RHHB 1UACH 3N9RA 1IGSA 2F7QA 2GDUA 4DFIA 3RRAA 4I0PC 2UBPC 2QR0A 3CV7A 3IYLW 3N4FA 1JYWA 3UJTH 4X8XA 3PFMA 1TETL 3MLXH 1HHIA 1FORL 3HC3H 1OAQL 3QIWC 4XKYB 5F72S 3IEBA 2W9DL 2CHWA 4I3RH 1TJ1A 3QCTH 1ZT1B 1E9LA 3PQYB 1GTEA 4H00A 3B5TA 1VBGA 2DJ4A 4JO1H 1M57B 4JFSA 5GS0C 2L7EA 4W85A 2ZXEB 1PXGA 4XMTA 1PX8A 4LPUA 1VQTA 2EDLA 5JHBA 1TJXA 4PYHA 4H7VA 5HI5D 3LTSA 3C2AH 4ILDA 2XH0A 4GKSA 1E6OL 1VYPX 4IMKC 1TZGH 2VAAB 4RBPH 3FTUA 4WEBH 4TULL 3AIWA 3X1GA 5F7DB 1G5AA 3KPSD 4JFHD 2B5IB 1V7NL 5IFPA 15C8H 2Y5TA 3O2DH 1P6WA 1A4KB 5HK4A 2C3VA 3DUUB 1AL8A 1I2NA 1OGBA 4XNDA 4HYRA 3L17A 1W6TA 3B6SA 1G6RL 3AM8C 4BEIA 1A3RH 4FL4C 3QTGA 3P4MA 4F9DA 3ZE1B 1AP2A 4XTDA 3LRGA 4TVDA 4H20H 3NPZB 4EXPX 4N2IA 1N19A 1YEDA 4P23A 2YC1A 3LGGA 3H55A 2VB5A 2XU2A 2W9MA 3NZRA 1RIVH 3GF8A 4ZQMA 4FQXC 4HH9B 1DFBL 1KV7A 4C60A 3A24A 3O6YX 3VE9A 1IFGA 3SD2A 5IHRA 1I1XA 4X9SA 1VKXA 3EH3B 2EH7H 2ZG3A 3FO9A 1AZVA 1M68A 5CILL 2PDYA 2DP3A 4K3EL 3N44F 2VC9A 3URNA 4AQZA 4RPPA 2ADIA 3CFKA 3DJRA 1JBJA 4HPHA 3HG4A 4GH1A 4E0RB 4I9XA 4LNVA 3PQYE 4HS8H 3BJ91 5B38B 3SJ3A 4Y89A 2WXIA 1JZ7A 1F4YH 2V33A 4OGXL 3L95A 5M2FX 4CNSA 4L4PA 3QQ4A 2ED9A 3MV7E 3MBXH 4V15A 1WFNA 5B8CC 7XIMA 5K4ZA 3UR5A 3KJ6L 5HGHA 5FEBA 4Y9CA 2EUWA 4JN1H 3QK0A 2X0YA 3H8AA 4OHQA 4LEOB 2K7QA 5SWSE 4PJ5D 3WTUA 1P5UA 2XZAL 5BV7H 1N4XL 2XWJA 4FQIH 1PEZA 1TQCC 3EAKA 4D6JA 3DFTA 3U4AA 1CXFA 4X6CE 3N4AA 1KGIA 3O6LL 1LZOA 1U1JA 3ARWA 3RJQB 3H9SD 5IR1A 4HUUA 2F9RA 4Z7OB 3WD5H 1KBPA 5CMAB 4IKIA 4KTDL 1KYOJ 3WNJA 1V05A 1RFDH 4LQFH 4IIBA 4LSQL 3STZA 2A1YA 5KYYB 3RL1B 5AHFA 2Y6ZA 1VSCA 3CZJA 2HUEA 3Q05A 1F4WL 1TO5A 1SHMA 4ZMZA 1T0PB 5CSYA 2WMIB 1RUAH 4LKXA 4LS1A 1NPNA 4IKKA 4BFEA 1NGPH 1ND0A 1BZ7B 1KKOA 1HHHB 1CFQB 2GBTA 3F58H 4KX8A 3GH5A 4GIRA 4F3FB 3ZIZA 3MQTA 1P0DA 4UU9A 4MX7A 2LLNA 2ADJA 3ZJKA 5KYUA 3WI9A 4QCEA 3B34A 4YE4L 5IESH 3Q9QA 3O05A 1E2ZA 4Y5XA 3A5VA 3SO5A 1EOKA 1FYTB 5KVDL 1CF8L 1TSHA 1BAFL 5I1DA 4DH2A 4XZUA 3QV6A 2NQ5A 2Q8AH 2WYIA 4MG4A 4U6XB 5JHLA 3LM3A 3MBWB 1GC1L 4ZS6C 4JRFA 2IJ0C 5GRJL 2CBJA 2Z8VC 4NQVA 2BHZA 1G4MA 2OXGA 3WLBB 4HNUA 3GC2A 3FC8A 3C9NB 1A7PH 3OHMB 1PUDA 4LUJA 4W9TA 1KFJA 1AAJA 3UROR 1P1ZB 4O57A 2FX8L 1S5NA 1TWSA 2C9VA 5MKGB 2VDQH 4UQ3B 4OTXH 2F8OA 2J8UF 1FFNB 2HWGA 4NJ9L 3O6AA 3W1ZA 3THAA 1ROCA 4UTUA 1F97A 3OVGA 1FWEC 1S9XA 5HGDB 2A74A 4QRTA 2ONEA 1XZ0B 4MNQA 2W9LA 3C8KA 3IFOA 1OX4A 4WGXA 2W91A 4B3ZA 5JHAA 3N3EA 1A80A 4QNPF 2HQAA 3SJVA 4KVNL 3EGDA 4GSRA 5GS1B 5EC1A 1LRTA 1EAQA 3VD5A 3X1NA 4GP4B 4PN2A 4XNUH 2QJMA 1LXMA 4XCNA 5D1QE 1EXUA 2P24B 3OJVC 3GXNA 4NZDA 3AHVA 3NOEA 5IW6A 2Y5QA 1HH6A 2EKSA 3N40P 5HYFA 1I4FA 3MPCA 4LT7A 2PE4A 1I7TA 1BWVA 1VFAB 1IE4A 2UYLB 3PGDB 1T6VN 5IJKA 3NPXA 4W6WB 2OKOA 3OQRA 3EPNA 3HB3B 3IEAA 3GM8A 3RWJA 2PDJA 3D3VA 1BFSA 2NW2B 5FYKD 4AYFB 3DX4A 2JVUA 2NOYA 1OAKH 4LSPH 5BJTA 1EANA 3LH9A 1Y6MR 2XBTA 8CGTA 5AHNA 1DVQA 4D8PA 1SO6A 2PI6A 2DIEA 3PP7A 4XO6A 3AQZA 5HWJA 4UNIA 5DRZB 1Q9KA 2JCCF 2VUOA 1MI5A 1FLTX 1XIBA 5D2LA 4C6NA 1QR1A 2AI0L 4H7CA 3QUGA 1DQDH 1LRNA 2X4NB 1XIDA 4PUKA 1NCOA 4WEMB 1YSOA 1U8OA 3HC0A 5KVGL 3D25A 5IY5B 2EABA 4PGZA 4LCYA 1PG7X 3AUVA 4FXSA 2X9WA 5IB3A 1XIFA 5DQDL 2I7OA 5F6IC 5DS2A 3AXLB 2H1XA 1ITUA 4IYKA 1OADA 4UMGA 2VDGA 3EJTA 3MBEB 2EKCA 1W8EA 2DW7A 1CDCA 3ECQA 3N3MA 4CW1A 1FVDB 3EIFA 3NA8A 4NRYB 1IGCH 1DTNA 2Y1ZA 1UXWB 2L5HA 3GVVA 1FHVA 4LQ1A 3UMTA 1YYLL 4X22A 3JVFC 3GUFA 3CK0L 1KOAA 3SN6N 1I53A 2XFRA 1JWMA 1J8SA 3BLIA 1G67A 5JPMA 1S7RB 3UZJA 4F9LA 4IP7A 1XGDA 3RJDA 1LDCA 1NFDE 5ANHA 1Q65A 2AKRA 4XVOA 1HHGA 1JN6B 4REQA 1YQVH 1F4HA 3HTWA 4KKBC 3X17A 4JKPL 4ELMA 3LS9A 4XVUD 3MJ7A 2XJ7A 1IEXA 3FFSA 3AHZA 3EA2A 3DX0A 4LHJB 4DUOA 4POZC 1MJ8L 4KKXA 4MA3B 2E9IA 3F5WB 2DQDL 3VFNB 5I6SA 4E5TA 2YUXA 2XTLA 1IBYA 3KJ4C 4HUWB 1PKQE 4MFEA 1HHJB 3UBHA 4JR9H 1GIGH 2F74A 3LKSA 3AT0A 4AIZA 2UZYA 3TU9A 2YXVA 1CFTA 1UT2A 4ODHL 4N6QA 1OGAA 2B59A 2GCYB 3DG3A 1G0CA 3A4DA 4X7DC 3IS4A 2DBLL 2G5UA 1AY1H 4YFEA 3MHGA 3X3GL 3GO1L 2JGQA 3HFMH 3ZMNA 3GC4A 1F4XL 1ZSXA 5K9JH 3RU6A 2I9UA 2GT9A 2HTKC 2ETWA 4IXXA 4ZO7A 3EO9H 4NT6A 3VRJB 2I9TB 1URIA 3CDFA 2Y25A 4GZIA 2BJML 5D33A 1J88A 4GH3A 5BMWA 2OEKA 2FLIA 2BOFX 4JDEB 3VQLA 5C0CB 4AG4H 1YLVA 3MLXL 4G7SB 3IRDA 1VFSA 1M9WA 4I3RL 3QCTL 3DFPA 2HFFB 5ITFA 3EFOB 2D31A 3FJLA 2KT6A 4GQQA 1A50A 5A6TC 5BXRA 1PG7H 3BW2A 4AGLA 3QPQD 5JW4R 2BOEX 4XRCB 3L6FB 3PAVA 3M5ZA 3S2MA 3WMSA 5D2VA 1EZSA 4GZ7A 2MNRA 1JV2B 3WJLC 1QWKA 4NQDD 4GKNB 5A43C 5JYLA 4F2UA 4W9CC 3TZNA 3VOFA 5HXMA 1DUZB 1O5DT 4KY2A 4EN3D 1PKMA 2JNZA 3HQOA 1J5OH 1YEFL 2E4TA 4LCVA 1WRFA 4OBSA 4AZCB 3ZHDA 4Y2OA 3UAJA 2K0RA 5JXED 4FMVA 3ITOA 3AC0A 3O2DL 3W72A 2WQPA 3B9KB 4XVDA 4IDLA 2WLYA 3MJ9H 3DI1A 3L3JB 3W57A 4G9FA 4GSDL 5BOPA 3U4BH 1P48A 1ZGLP 1QFWM 2V69A 2UY6A 4H26B 2DYSB 4N4PA 2WZEA 2NR6D 3O4LB 1L4IA 1GGCL 2FTYA 4XE5B 4CC0A 2O5ZL 5T1KB 3VFSA 4Y16C 1KCRH 4OFYA 2ED6A 1JF1B 4OCRL 4H20L 2VABB 5D7HA 5JOFB 4IBVA 3JV6A 3NQDA 4WF7A 7PAZA 3ZTCC 1OT1A 4A22A 3QJUB 4OCYL 1OHLA 4AGNA 4L4TE 4M7JH 5BVPH 4AKPA 1JRHH 4HS3A 3WL0A 4JZ5A 1M1XB 2R8SH 5KSVB 2HH0H 2W6RA 5DJZB 4DAGL 3O6FC 3VI4B 1J9YA 1TCRB 3QYNA 5C0CE 1RQBA 5EF2A 1E4KA 1HDMB 4Z1DA 3A67H 32C2A 1F02I 3SYOA 1VERA 3W73A 4CADB 3BH4A 3ESOA 5TPWL 3H53A 2HTMA 4YQXH 3BGMB 4IQHA 5F9DC 3CT7A 3KFTA 4UIMB 1JXKA 3EA3A 1QFPA 5E08H 3FYIB 2EIDA 3D2UA 2XIDA 3C8HA 2WHKA 1IQWL 4RNHA 3SCMB 3RTQA 1JWSA 4XNMA 2FGWH 3FU9A 5IJVA 4PMFA 5LAXA 3MJGX 3WY2A 1X98A 2Q7YA 2GVJA 1QEWA 1LNUA 1UYWL 4OM0L 1Q6QA 4Q4KA 2X4QB 2I07B 2ZP8A 2AC0A 2E46A 4AE0A 1XF2A 1KCVL 4TV5A 5DHDA 1AANA 1JZ5A 4X99A 5E9NA 5I2UA 4WEEA 4Z7NB 3BUTA 3GE7A 1GKQA 3K0WA 4HPOH 3GJFA 1CFSA 1PTAA 3KMDA 2Y5JA 2HLAA 4RV3A 2VQ1B 2WWMD 1A65A 1ZRUA 2EIJB 3EO1B 4E8DA 3WD5L 4BFGA 1OGTB 4YTSA 4Y9GA 4ORIA 5FK9A 4OB5H 3HHRB 3TYCA 3LSBA 1UG6A 3O4LE 2P5ED 3FQWA 4PYGA 1B2WL 4HGMA 4OZOA 3QZMA 2IH1A 4K3DH 2VUYA 4ZMYA 3O6CA 4WDIB 1X8CA 2CCLA 4AVIA 2JIXD 3V4BA 3F2BA 4BK9A 4Q9BA 2XLLA 3O6DA 5LIXX 1NGXB 3P4NA 4LUYA 4K71B 1NC4A 3KVMA 2QPEB 1L7TL 3GDCA 1F6AA 2RIKA 4EOWH 4X9GA 3SY6A 2OCZA 1KBLA 3TN0B 1KCLA 1NKOA 1P1MA 4H8WH 4NRXA 3RDJA 3EGJA 2FB3A 2L7JA 4EAEA 3GX9A 2WV3A 2IDCA 3T04D 2YK1H 2VT0A 1ZD6A 2YD3A 1O66A 1BX2A 3EFFB 3SGDH 4NZJA 3OQ8A 1U8NB 4EIBA 3HTLX 3K2UL 4R7OA 2GSJA 4JX4A 2VDOL 1BFVL 2BY1A 3EDDA 4QEEA 2Z7KA 4PB4A 3WN5A 2WQVA 4DYEA 4HS6B 4WU5B 3MFFB 3SDAB 4EF3A 4L37B 5CG0A 1ML1A 4DGWC 2BIHA 4N6RA 1IFHL 3IGUA 3HE6C 1TSRA 3B1UA 4G5AA 4HN8A 2PR4L 3QCVL 1V6WA 5FA4A 5HQEA 4NUQA 4DZHA 1OC6A 1IGML 3WEXB 1BPLB 1KBVA 4GAGH 2VDQL 2KZBA 1QU4A 1DXIA 4UFHA 3HVDA 2YL9A 4UOW0 3RZCB 4HIEB 5FM5O 3HUJE 4RGOH 3DUSA 3THDA 5D2YA 5BZWB 4E9WA 2H9AA 3L2NA 4CMMB 4KVCH 3NOYA 2G3NA 3RL2B 1V0NA 4IIGA 5EO0A 3OX8A 1UD3A 3VH8G 4YVNA 3SCQA 5JXAH 4DVRH 1XI3A 2WK2A 4RA0C 1QNOA 4XNUL 4QI3A 1ZUAX 3LN4A 12E8H 2E9GA 4QEHA 5K1VA 2ZICA 4JIIX 3PWVA 1NFPA 1S7TB 4LYKA 1C5DA 3FW6A 2Y7MA 1XBDA 3WL9B 3CDGB 2NYYC 2XXMB 4KBXA 1JCKA 4G1MB 4DERA 2PZNA 1XGRB 3PL6C 4JHZA 5GNXA 2WKLA 1OX5A 5BWFA 2C1IA 4FXRA 2Y1HA 2R27A 3L4XA 2BOLA 4HIIA 3HVNA 2W60A 4M7LL 5ENWB 1IKNA 4F2FA 2GTZA 2ZJSL 1HJXA 2MHAB 3L12A 4UTHA 6TIMA 4ONGL 4XCYA 3MI6A 1W5QA 3W1QA 2JJUA 1L9SA 1TQVA 4NJIA 4FA8A 4NAEB 3PB0A 2TODA 2B7DT 4ONOA 5B4MD 3LRHA 2CO6B 4AVKA 3MRMB 5C86A 1K1DA 1SW0A 3ZX1A 1EDHA 1MWOA 4Y1AA 2CKBH 2A3BA 4HZ6A 1ZV2A 1OM9A 5JIPA 1AXIB 4AGMA 3PXJA 3VACA 4R90H 1JPEA 3FQNB 1DHKA 1CXEA 4ZUWB 4WW2B 2XYLA 2FHBA 4YEEA 1ZLSL 5KSAD 4KUCD 5L7XL 5IHBA 2G2NA 1CGVA 2EVFA 3ARGA 2N56A 3ZT7A 1OFDA 3ZRCC 1IGYB 1J9RA 4JREC 3IJQA 3HS0C 4IICA 1F42A 1YDPA 4LCRA 4HUXA 5AVRB 3QQ0A 3WEMA 4HJIA 4NNYA 2BGSA 2G41A 3S35H 4F7TB 3CSGA 1PYMA 2DM4A 2IBZY 4LO9A 2A6DA 1IXQA 1IXNA 4PD4J 4R9XA 5GZND 5GS3A 1G7IA 4BRVA 4AIOA 5HHOB 1TZ7A 3ZWTA 3GHRA 4E2VA 1JPKA 3TQKA 1QPPA 4YTUA 2DI9A 1WDWA 2N0MA 4A2EA 2D7MA 1OAUH 1T3FB 4X7FC 5FA3A 5CJ5A 3IDGB 5I1IL 3GBLA 5LNVA 1ZA6B 1SZNA 1MYRA 3GZAA 1AHKA 4NENB 4MTVA 1AJZA 1O94A 1WF5A 5LG6A 4UM8B 4JRXA 2H1LM 2OXHB 4JOMA 1IIGA 3ELFA 1UJ3B 5D7JA 4WKHA 2E5EA 1UWXK 1L6YA 1S3HA 1FJ1A 5E1IA 1TWIA 1A5FH 4WKAA 2YD9A 1YPZA 3LX9A 5L0QB 5E6ID 4JR9L 1LL7A 4ABQA 1IEBA 2BOBB 3DDGA 3SKMA 3MC5A 2WTRB 3BFOA 4WENB 1KFKA 3MDWA 1DEEA 3UBFA 2VM8A 2NV9A 4RFEB 4A2MA 4AV4A 4I7WA 3KLHC 1KXQA 3D87B 3W5MA 2LW3A 1IWAA 3TMLA 5KMYA 4I2XE 3ERXA 3WFHA 4BFJA 3V1PA 4O2FA 3BMVA 1JRCA 4CD5A 2NQHA 5K9JL 4NZUH 5KSUA 4G7YH 1PHWA 1IGFH 4FOJA 4IEFA 4KXDA 5DHVB 1FG9C 4Y2DB 2F53B 3NCCB 1N6UA 5B3JE 1LOQA 1AQMA 3DUHA 5IG7B 2A3CA 4FQJH 1T5KA 1U41A 4XCCL 1WBXB 4HX1B 2A4CA 4QHPA 2V67A 2FEEL 3EGSB 4Z7VA 3PTKA 2DTML 3STLB 4QPEA 3I7SA 1NFIB 4E4FA 5AHLA 4L1LA 4Z3TA 1U1HA 5I00A 3JZ7A 4A35A 3NCEB 3QI9D 1IBDA 5D1XE 3FH5A 4RDBA 4NIKB 4FF7A 3NFSL 3VTRA 3TPUA 2ITCA 2YD0A 1AHWB 3IJHB 4LSDA 2QF7A 2PABA 3SGJA 2Y36L 5LZLA 4YMPA 3FUKA 2JLPA 1F18A 3VXQB 3GYRA 1DVYA 1GORA 4Y5YC 3K5XA 4A7UA 3WLQA 3EBHA 1H5VA 3ABRA 5M95B 4FR6A 4MKVA 2HPMA 4K3JL 4MJIE 2X4TA 4WGWB 1WJ3A 3M0HA 1EZ2A 5DO8A 2ZCLH 1R9XA 2QHRH 1UWXH 3JT0A 1E4LA 2CPCA 1I7RB 1QPQA 4OLUL 1XLIA 3SIZA 3QYMA 5F6HI 1J8KA 2VWSA 3PTQA 4XD6A 5I6XB 3VNLA 4WO4B 4PRHD 4DIXA 5B39B 3FNKA 3VDHA 4IJBA 3V35A 4X4ME 4QRRA 2FO4B 1UB5A 1JRHL 2XACC 4H9MA 3W7IA 4G70B 5AD0A 2WLMA 3QORA 1FORH 2UWEB 4XN5A 2W9DH 3T7VA 4ACYA 5DFWH 3VFTA 1J12A 1Z5LA 2DKUA 4OGYL 2V82A 1NC2D 1MVUB 3ARDD 5GJPA 4ZMQA 3GSQA 1DWGM 1T83C 5D09A 3DGBA 3BQ6A 4GIYA 5AW2B 5CGQA 3ZLFA 3LBOA 3BMWA 1E6OH 3L9RB 8RUCA 4ZFOA 4RDWA 1LWIA 3DYOA 3R79A 4J40A 1A3ZA 4C83A 4HK3N 1T5XB 4TULH 2BV9A 4UXDA 4LARL 1WE5A 3ELQA 2BLFA 2OV0A 2ENYA 3HCVB 1SFHA 4CD6A 1V7NH 5LGYA 2XX0A 4PV8B 4C1LA 5E6YA 3MCMA 3TTOA 2OG9A 4ZMVA 3GAYA 4FXTA 4FXJA 1C7SA 2EDHA 1QFHA 4JGUA 3ZKNC 3G5EA 9XIAA 5AUMA 1AR1D 4GPNA 4JG1L 3P3TA 2KLSA 2CUHA 1B88A 1IGJA 1G6RH 4UNLA 4JE0A 3N19B 3O3EA 2ZX6A 3PY9A 3U2SB 1A2YA 4V33A 4YTQA 4YU1A 2CLRA 5BUPA 4R7DB 2LLGA 1NELA 1YBQA 4PZVA 3U3HA 3RWDB 3B3IB 3TCLA 3TBBA 3MKKA 5EEUA 5MEQA 4MJ6A 1Q9WB 2FR4B 5CEZD 2CZFA 2F8IA 3FT0A 1IAKA 1DVFC 5T1LD 3H3PL 2NUTB 5AW8B 3ATBA 1JTPA 1DFBH 3G3DA 2QPFA 1W2VA 1RHCA 1U58A 3CDZA 4JTHA 4V1DE 4B90A 3T6CA 2IPUK 4H1LG 5CILH 4K7FB 4K3EH 1YEGL 2YK1L 5D1ZB 4EVNA 4FPSA 1ZL1A 3Q6GL 5CPSA 2PPFA 4OUIA 2WW8A 2YWYA 3MA7A 1P7HL 3QVAA 3V5CA 4B4FA 1R5VB 1OFOA 2DSZA 2ZOKA 1XW8A 3HZYA 3KPMB 4X0VA 1TTGA 1UOZA 3WO4B 2R2HB 2XSBA 2MTAA 4A39A 4J8RA 4BE5A 1CEOA 2MCAA 4QLKA 2YAOA 4YPGA 2VGBA 2R0KL 3CX2A 3KJ6H 3ZE0B 5CD5D 5DVMA 4S3BA 1IM3B 3CXHJ 2CNZA 1BM7A 1QTWA 3PAOA 3MRGB 2XZAH 3MREB 3D08A 3AREA 1N4XH 4N9DA 1YYCA 2VEGA 4B50A 1AXSB 5I66A 4PFMA 1CZ8L 3BW9A 4R2GC 1LL4A 3HKZA 3O6LH 3ZE2F 3IMBA 3HE7C 4FQPA 1TTQA 4FXGA 2ARJQ 3DX2A 4HZLA 1CZ1A 5F7EL 4XC1L 5FKPA 4KTDH 4M5YL 3IN0A 1AQ0A 5IV2A 2JELL 2WTOA 2H8PB 4ECLA 1V27A 1OPGL 2IFFL 4LSQH 4Q6IB 1TQBB 3SI9A 1NBQA 1C1EH 3LPPA 3QQNA 3RILA 4I5BA 3EJUA 3OKKA 4BK5A 2MANA 3HPAA 1PVHA 5HNTA 2ZUQB 4LNRB 3OKMA 1F05A 3F7PC 3TXAA 12E8L 1LEIA 1RUML 1OK6A 1E90A 3F12A 5F97E 4C56D 1M7DA 2OO6A 5HSFA 5BV7C 4D6HA 2EIMB 4NDMA 1INQB 1SYVB 2YLHA 4UT9A 3INOA 4XD4A 2VUKA 1H15A 4ZT1A 5IWLC 4QJ5B 2ZXBA 2ZWZA 4G7VH 1JF5A 4YE4H 3WLRA 1DBKL 5EU3A 4OFQA 4QYAA 1CF8H 1U3JA 3I65A 3RNQA 1BAFH 4RV8A 3PUCA 3W9DB 3FQYA 1UOKA 3FMGL 4H04A 1GYMA 1GC1H 2XTJE 2YOCA 2Y61A 3UXKA 5B1BB 1TV3A 1KM1A 4MQ7A 4D0CA 4PW4A 3V5KA 3WUZA 4XWOC 1DYZA 3OVQA 1Z6JT 3O45A 1F3TA 1BQSA 2GFBB 3QUYA 4J1UB 2CIKB 1R3SA 1Z7JA 5ICYB 1GVFA 3CAFA 4IQLA 4MWAA 3G24A 1F73A 4D6DA 1LLWA 3GFZA 2FX8H 1N5AA 3ARQA 3QA3A 3OWEA 5BOJA 3EXSA 5C7HA 4NQEA 1PZ1A 4DNHA 2Y6SC 3RNKB 5I1LA 2YDSA 3DFHA 2R9RA 2J57A 4HEME 4IPPA 3FCUB 4R90L 4LAOA 2ZRWA 3WO3B 4JQ2A 3B5GA 3SE3A 2EYRB 3RGBA 2VN4A 2IIJA 4NC1E 5SV3A 3ZDXB 2H32B 4B9FA 4KVNH 3F3HA 4AHQA 2XV2A 4JDTL 4ZJ9A 1OY3B 3S96A 4F7EB 4YSRA 3WFCH 1I3GL 1XV8A 4W9HC 3S35L 2CLMA 3O9NA 2QXWA 5A8GA 4XXCA 1HX0A 2DPEA 1F2XK 2WY3B 3MV8A 3OG2A 2UXFA 2V3FA 1MCLA 2F61A 2EYTA 5E70A 2PXYD 5FIPA 5HVGB 5CUSL 1N59A 3L5XH 4TNGA 3RJOA 1BQHB 5IW1B 3B83A 3ZLHA 1FOBA 5EB9A 1VGKB 3ZDYF 2GQ3A 2PO6C 4DF2A 3UYPB 2P76A 1DO6A 4EPBC 5D5MA 5JHDA 2WB7A 2NUWA 2QDDA 5IROD 3JS3A 4D7PA 3PSWA 4QHNA 4OLEA 3EJRA 4Q8VA 2GVYA 1PLAA 1U6AL 3W56A 2AI0H 2Y7SA 4H9TA 2K6ZA 1E8WA 4ZE5A 3W1TA 3BH8B 4BELD 1UZ8B 5AL0A 2ZAIA 5KVGH 1NEZA 2RFGA 2VLRA 3DJZA 2UY3A 3RX4A 2W80C 2C16A 2EDTA 5DQDH 2E5BA 2DT1A 3QAZC 6XIMA 3RVTD 1FWNA 1U92A 5D2WA 4J4PC 1V7AA 3N2OA 1ZBCA 2FT8A 1SO5A 4LANA 2J71A 2XQBL 2EDJA 2EPMX 1ILSA 3B7TA 4MS8D 2RAMA 2EPHA 1UROA 3JXAA 3QV7A 3I4EA 4MNKA 1ADQL 4FE9A 2XQYK 2ZT9C 5JOEA 3WTSA 5F1IA 3VUAA 2WYHA 1YYLH 1O5QA 4M5ZL 2BOCA 2ZDRA 3CO4A 1N8ZB 3GB7A 4I0PA 4DBDA 1IGTB 1ZT4A 2B3RA 2YQ2A 4K3HA 5EU9A 4PJGE 3C2RA 4ZOCA 4JGDA 3BP7A 3H26A 2PTDA 3SQLA 1FWRA 2VLJB 5FYLL 3QIWA 4KKQA 1F5WA 4LSVL 5H6HA 5AKSA 4JZNB 1E2WA 3FOMB 4XPHL 5FGBC 5E1QA 5G2WA 3IFPB 2G60L 4K3GA 4PJFB 4JKPH 1U3NA 4IRJD 4MJJA 3LZ5A 2GJ6D 1ERNA 1Z5HA 1MLCA 4R26L 1E5UI 3T0WA 4X4XB 3HR5B 1J87A 1MJ8H 2XUCA 2F5BL 2YPIA 4IFKB 1VFBA 2DQDH 4IMKA 5BXFB 1F45A 2YPLB 1Q38A 1ZTXH 2NNCA 2OZ0A 2PODA 3K74B 5HI3C 5EC2B 3RLSA 1GGBL 1IIKA 4KDTC 5CLYA 1VPXA 2GPTA 3DEQA 4C47A 2YGNA 1VFTA 4NILA 4ODHH 3ATFA 4X2PA 1MG2C 3RDTD 4LESA 2WZPA 1XRVA 2DBLH 4G8EA 4C6DA 3X3GH 4G1NA 3NSDA 3GO1H 5FUCE 4P2QD 3AM8A 1IO4C 1F4XH 4K55A 3MLTB 2RAGA 5EN2B 3BZEA 1JCMP 2FVKA 3VG9B 1AKJB 4W6XB 2D73A 2BJMH 6CGTA 4HHLA 4QT5B 1JG9A 3FQTA 3UBGA 2WSYA 1N2RB 3QIBD 3QUMA 4ETYA 1LT7A 4XNZB 2PP8A 1B0RB 4FQXA 3V79C 2OX1A 1DYSA 1X1ZA 4POUB 2FZ9A 2WIIB 3N15A 3QZBA 4HV8B 1LM1A 2ZZ1A 3QZWB 2QEJA 3DKLA 2HFEB 1HW6A 3GU9A 1F7BA 4RMBA 5F7AA 2VLJE 1UD2A 3W9EB 3FYEB 1KSRA 2VDLL 2NY0B 1WA2X 4S1SL 2G5BA 3QZNA 1YEFH 4XCEA 4EZMA 2VX5A 4PJBA 1AZBA 4G8GE 3UNTA 5B8CA 4XISA 3QEQE 1PNDA 2MFNA 4DEPC 4NUWA 2BNRD 2Z1WA 4TVPD 4PJ9B 4Z76A 3KPRA 4GSDH 4KY1L 2XZZA 2EEAA 3CV6A 2YPLE 2DWDB 1GPWA 2FAUA 5DQ9B 2FWOB 2PDIA 4TX8A 2CGYA 5CIPB 1GGCH 1O1ZA 2O5ZH 3COTA 2QJHA 2W0FA 1DWAM 8XIAA 3KGSA 4IHOB 4JB9L 4OCRH 2QR0B 3VFVA 5HYSB 2XYBA 1JK9A 3VRLF 1P2CA 2VITB 3EHBD 5TE6L 3EJCA 4MMXC 3VNKA 3W7KA 1AZZC 2W5FA 4OCYH 4WXYA 3VXSD 3MA8A 4IBTA 1PX4A 1W8OA 1CWYA 2JSFA 1PYWB 3R1ZA 1KCWA 4MMZC 3PDOA 1UGNA 1L9OA 2TSAA 1TKWA 3EWXA 1PBYA 4E41D 3G0XA 4DAGH 3CV5A 3T6ZA 4WFGE 1WUZA 2QUUA 1EZVY 1ZENA 3DX5A 1OSYA 4QROA 2APTA 4G11A 1TPVA 5TPWH 5DHXB 2WKOF 3D5HA 5F1KC 4ZQKA 1RU9H 3GD1C 1ACZA 2VTFA 4QOKD 4GIEA 1VF8A 3G9AB 5KANG 2DZAA 2Y0FA 4XZBA 2J5WA 1XLLA 1V8EA 4KRPC 2Y5TB 5BRZA 1IQWH 3EZ4A 1H5BC 1OE3A 4ZXOA 4YYFA 2C3VB 1DBTA 4LHUA 3EJPA 4UIKL 2DYRB 1UYWH 4OM0H 3HLKA 1Z5YD 2HKHH 1FZMB 3ARFD 3QJSB 3B6SB 5LQBL 1OCCB 1KCVH 4GQBA 1LO5B 3FA4A 2WQWA 1O9ZA 1P84J 1MRQA 1WD8A 4OJYA 4YVUA 3T1FA 2OMTA 4KI1A 3W2UA 1HF6A 1FSKB 3P4MB 5AYBA 5G55A 2DLGA 3BXNA 3HMWH 1AP2B 2KL6A 3IAPA 1MUWA 3IBEA 3T65A 1YEDB 4P23B 2YC1B 4GW5A 4J12A 1WV2A 2EINB 3VILA 1B2WH 3QNYB 5DWPA 1DCLA 2R0ZL 4GJ1A 3EDJA 1C1EL 1VKXB 3E0FA 5IEHA 3ZE1E 5C0NC 1Q0EA 1AGCA 3MHFA 2ADIB 3CFKB 1OK8A 1L7TH 4G1KA 5C0DA 4HT1L 1NLBL 2PA6A 2WNZA 2ALWA 2NXZD 2RH0A 4V27A 3GBMH 1T03H 1GH7A 2ATKB 1OFBA 3OGRA 5F3BA 3NN8A 3R43A 4RQQA 3NCJL 3L95B 3RB7A 3QQ4B 4IIEA 3TNMA 3UJEA 1QSFB 4G7VL 5DEZA 1N8OE 3SDDB 5FECB 2VVNA 4UQDA 2IAMA 3QAQA 4UTTA 2VDNL 4NZ8A 1YJDL 3K2UH 1FDJA 4JFEA 4YSCA 4GFXA 2VDOH 1BFVH 4U28A 2C3WA 1YX1A 1LOSA 1C7TA 1EX0A 1XGTA 1NFBA 1P5UB 3TIDA 2XWJB 2KX9A 4JHMA 1XD1A 4FCHA 5C08D 2R9HC 1YXDA 1XH3B 4GFSA 2CUAA 4FFVD 2IALA 4GG6F 2QAFA 3M4HA 4JQIL 2C34A 4LCWA 1IFHH 1BIIA 5IR1B 3WF0A 3L3HA 2PR4H 3QCVH 2HT4C 3EF4A 3CEUA 1GWJA 4L61A 5M7QA 2HRGA 1IGMH 3BIAX 1UM6L 5DT7A 2CLPA 3UNDA 4H8WC 3N42F 3VZYA 3FO2A 1CCZA 5AVVB 2XGBA 3OF6D 2DQEL 1V0KA 3STZB 3VXOA 5J11C 1TU2B 1H4PA 1R3KA 5A2KH 4Z7OE 6PCYA 4WQOA 2GGIA 2V68A 1A21A 3RGVC 5GZOC 4OWGA 2IPWA 3L5HA 2OQYA 3E0VA 1ND0B 2XWDA 1KB3A 3LPOA 4HKZA 1XYLA 3M7OA 5CLWA 1LTDA 3BLOA 4GXUN 4EWND 5IHZA 4PJ8A 2N1KA 3SR7A 3WFCL 1HZKA 4S3AA 2I7SA 2ADJB 5CPOA 1EGJL 3KPNA 5KVFE 1NUFA 5GJSL 4NSKB 2XY1A 3A6CL 3EOLA 3NIGF 3CH9A 3B43A 4QXGH 2FGLA 1G1YA 3CFDA 3OLDA 5CCKH 3PBGA 4LPYA 2B15A 3WLOA 4E3TA 4A7SA 1FZOA 4FQ1L 3L5XL 1MCIA 2BPBA 3X13A 4UQEA 2GEEA 3UACA 2OXGB 5C7XL 3DC8A 2QFPA 1V7YA 1QSFE 4HZMA 2NXIA 2BCKA 2J3SA 1FYTE 1B3WA 4M7LH 4PJ7F 4P2OA 2ZJSH 1XMEB 2ZE3A 4G8FA 3MS8A 4WK9A 2PURA 3LU2A 4ONGH 4PHZA 3GT6A 1CDYA 3BPNC 3ERPA 2V17L 5FKAA 3PWJA 1RD6A 2ENSA 2WZ0A 4HWUA 4RGMB 3HG1B 4AMXA 2JB5L 1NGWA 3OSKA 3GUGA 4MNQB 3EWCA 1Q72L 2NY6B 2CO1A 5H8UA 4K8EA 5EFIB 3SJVB 1C93A 2JQMA 2YD7A 2LTQC 2NZ9D 1Y0EA 4Y9PA 4YLBA 2VZUA 3MPGA 5LLIC 1ZLSH 2BXZA 2D7PA 2G97A 5L7XH 3T4WA 4PRWA 1HOCB 2Q7NA 1Y5XA 2J1KA 1QZ1A 4XCNB 4FKHA 2ACSA 3P5ZA 4AWUA 3UL4A 4IG2B 4IHBA 3ENLA 3MO1A 5IW6B 2EKSB 2ZUMA 1LL6A 3K3QA 1T4KA 1VBHA 3FDKA 3R7MA 2B20A 4QHLB 3T09A 1U3HA 4ODSL 5FR3A 5EZPA 1K4HA 1VGEH 4Z7QB 1EO8L 3EADA 3VXMA 5IB2A 3UT0A 3MMEA 3MP4A 2NUPA 3WX7A 3WKYA 4FNTA 3RWJB 4LVNB 3D3VB 4Y5VC 2G3XA 3PBYA 4HWNA 4UBPC 2EIZA 1DVUA 4OCWL 3ZRFC 3UA4A 3OYXA 2P46B 4HJWA 3WLLA 3QDJD 1Q9KB 4P5TC 5I1IH 4FR1A 3SIMA 1A3QA 2VELA 3SCSA 5LA0A 5BQ7B 1DJHA 1IM9D 1D2PA 5D2LB 3BT2L 1JD9A 3QZOA 1QR1B 1J01A 4PBVC 2E6YA 2OEJA 5DYOA 1RHFA 4PMOA 3VK5A 1VJSA 4F7PB 1U8OB 4EO5A 4M6UA 1XYMA 3D25B 1ZTXL 1OF8A 4LCYB 4KI5E 2C7UB 3H70A 3U9IA 2BC4A 3LS5L 1UR0A 2CBVA 3ROOA 3WIAA 3RPKA 3K2GA 3KVDD 1GS8A 4WUIA 4EN2A 2IWFA 3U2JA 1QO5A 4WGVB 4NAFB 3FS9A 2MH4A 1CE1L 3NEHA 3AGWA 2PDPA 2O30A 3L4VA 1SXBA 3MRNB 4ZNCD 5LGJA 1NMCB 2DOCA 1G7HB 2ZAGA 5C6TH 4DKEL 1FWIC 2FATL 4AMWA 4M51A 5GGQL 3PWPD 1E5YA 2J8OA 3RLHA 1JWMB 2FB4L 2VMCA 4CQ9A 1XLAA 1JGUH 1QWGA 2D1ZA 5HVWA 2V2TB 5JPMB 4YDLC 4XCCH 4GNKB 1UR4A 5FJUA 2PDGA 3OL2A 3V2AR 1KPVB 3PC0A 1EJVC 5EZLA 4NP7A 5D30A 2PGRA 4Z7QE 5DZNA 3ABMB 2DTMH 3IVSA 2PU1A 5C0JA 1NBCA 1KLGA 2HJLA 4ELMB 4UDUA 5I18L 4QRBA 4N2AA 2VUNA 3M07A 4YBHA 3FF7A 4TLTA 5LN4A 3LKPB 3BSHA 1LBMA 4NP9A 3WJJC 4Z3IA 4WGKA 1I2RA 3IWVA 5MHSD 4AFYA 3NFSH 1HL8A 1UKPA 3VWJA 2F74B 2EICA 1UH4A 2TSYA 2OYKA 5TF1L 3GBEA 4J3SA 2UZYB 4EUPB 4KNQA 2YD2A 1CFTB 1XLKA 2Y36H 1QACA 4JPQA 1OGAB 2W92A 5T3XD 2B59B 4BQBA 5FUZL 5ADPL 4K3JH 4ZYKA 3TYGL 1KWKA 5E1AA 2PDXA 5D32A 2X7VA 2R24A 2EADA 3O63A 4F57L 1U91A 1R46A 3MV9B 3TSDA