5CXPA

X-ray crystallographic protein structure of the glycoside hydrolase family 30 subfamily 8 xylanase, xyn30a, from clostridium acetobutylicum
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
387
structure length
387
Chain Sequence
b'SNDATINVAAKHQTIRGFGASSAWCGALSDTCMDTLYKNAGLDILRVRIAPNEGWNRGDYRAWADELSNAKKVRARGGIVFATPWTPPASMKTNNTTTGANKGSLKPSSYAAYAAYLKTFVKYMSDNGAPLYALSLQNEPDWAPDYDACTWTAQQFHDFLKQYGASLSSTIKIIMPESLGFNPAMSDPTLNDPTTAQYVSIIGGHLYGSPIRDYPLARNKGKDIWMTEHYLEGNDPGTCVKLAKEIHDCMTIGNMNAYVYWWISGDQNGLYNTRTNETYKKTYVMGQFSKFIGNGYSRVDATNSPQSNVYVSAYTGNNKVVIVAINQGTYPVNQSFNVQNSTVSNVSSWVSSGTLNMAKTNSNISAANGRFNASLPAQSVTTFVADA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible xylan degradation enzyme (Glycosyl hydrolase family
publication title Crystal structure of a GH30 xylanase
rcsb
source organism Clostridium acetobutylicum (strain atcc 824 / dsm 792 / jcm 1419 / lmg 5710 / vk
molecule tags Hydrolase
total genus 143
structure length 387
sequence length 387
ec nomenclature
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02055 Glyco_hydro_30 Glycosyl hydrolase family 30 TIM-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5cxpA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cxpA02
2OWCA 4N0RA 3L4ZA 3TOPA 1HP5A 1UZ1A 2PWHA 1US2A 2CHNA 3KWXA 5HPCA 2DH2A 4X9YA 3GH4A 1QHPA 1QWUA 5DEZA 4ZFMA 4U3CA 1QI3A 2D24A 4P7QA 1JZ2A 4JFVA 5FIPA 2EABA 4TOQA 4U31A 3WDRA 4FK9A 2ALWA 3VM7A 2BS9A 5A6MA 1UWQA 4W86A 4HZ6A 4TVDA 4UQCA 4AIUA 3W28A 1D7FA 1G5AA 2Y24A 1Q6FA 1I1XA 1GOQA 2YBTA 1KB3A 2BV9A 4UZUA 3GNOA 1VRXA 4W8AA 3EJPA 3EJTA 3AMGA 3WMBA 3MI6A 2VI0A 5M17A 4P8UA 3WELA 4B3KA 4MNJA 4HPHA 1PEZA 4E4PA 2VX4A 8CGTA 3VVGA 2DDXA 1W2PA 2WC4A 2EO7A 3S2CA 1RP8A 1HTYA 1JNDA 1X1NA 3CC1A 3GXIA 4LYPA 1VEPA 4TTUA 2PF0A 1KWKA 1HIZA 4JFTA 5CPSA 2JE8A 1C91A 2VVNA 5ABHA 1JYNA 5E6ZA 3AXIA 2IGTA 2J7CA 2VNCA 5CPQA 2XUCA 5I77A 1XH1A 2IUZA 4H04A 4KRTA 1NWTA 4AWEA 1IT0A 1MXDA 3U7BA 2Z1KA 3KLLA 2Z1SA 3VGFA 3M07A 1OGSA 1ISYA 5I6SA 2A3AA 1PIGA 1R8LA 3AIEA 2WC7A 5KEZA 3WDQA 1WCGA 3UR8A 1UG6A 2BXZA 3K46A 1BQCA 1ZBWA 2VZUA 3WENA 3BLPX 1ISVA 3VIFA 3TTQA 3ZJKA 4FNTA 1BYDA 1WE5A 4HA3A 2ZX8A 1W9VA 1TVNA 2DEPA 2VR5A 1IV8A 2RGMA 2WVTA 3WY4A 5DF0A 3U7VA 2D73A 1HN1A 4ATWA 4AMXA 1H49A 2V3DA 2CITA 4HP5A 4ZE4A 1W9UA 2QLYA 1E1FA 3O6AA 1OSEA 2J62A 4GI6A 1XC6A 1B3VA 2VZVA 5GPRA 5E70A 2EPLX 2VX5A 3ARUA 4GINA 2C7FA 1GVIA 3PZVA 1TCMA 1E1EA 4D6DA 2GJXB 1KQZA 2XWDA 2YA2A 4UFLA 1E55A 1HKJA 4LYRA 3SCWA 1GUVA 4JHZA 1WO2A 2J7GA 2E4TA 2WANA 1TQWA 1JFXA 9CGTA 3N15A 4AZIA 1UZ4A 1LQ0A 2W92A 5EBAA 1C8XA 3AMCA 5CSUA 2OW6A 3GXNA 3EDEA 3MS8A 4EAMA 1C8QA 1NOFA 3D52A 3CZNA 3LX9A 1CLVA 3TV8A 1QNRA 4URIA 3ZJ6A 4FNPA 3GH7A 3VIHA 2C8NA 1E70M 3ZT6A 4HOXA 4AEEA 2V3GA 1UA3A 3N12A 4FMVA 4CU7A 1CXEA 3BAJA 1UWSA 1WNOA 3N9KA 4XZBA 1HF6A 4NRRA 1VEOA 3QGVA 1E0WA 1B30A 2FH8A 4PMVA 5GNYA 2XSAA 3AICA 4Z2JA 2PWGA 4WKHA 1NP0A 1XHGA 4JIEA 4JHOA 4NXKA 2XVNA 3FW6A 1XGZA 3VM5A 1Q6CA 1C8YA 2ZUMA 1EGZA 1BVZA 3AHTA 2J47A 4ZE5A 3SCSA 4E8DA 3PZQA 3A4WA 3MO4A 4HZ8A 3CUGA 1OM0A 3AROA 1M03A 4NZCA 5DMYA 3SCTA 1M53A 3WIJA 2X8RA 4M81A 4H2CA 1KTCA 4CD8A 1HJUA 1DTUA 4TTGA 3VMOA 3WMCA 4AZGA 3WF1A 4OBSA 4XV0A 2GK1A 3WY2A 5E0FA 3AIBA 1AMYA 1UUQA 3I3BA 3T0AA 1MXGA 2ZUUA 5I24A 4D6IA 1QBAA 5IDIA 3VSUA 4HMCA 3VOCA 3IAQA 4J3WA 1MW1A 1UR2A 2GJRA 2EBNA 2E9BA 2DSKA 1HKMA 2D2OA 2F61A 2DQXA 3ARWA 3AXHA 1GVYA 1E40A 1JYVA 1UWRA 4X0VA 2DSWA 3AMLA 4JL2A 5M5DA 4HPGA 2WCSA 1K9TA 1GQJA 2GK1B 1QHOA 3WD2A 4PYSA 2WMGA 1EA9C 3ZQ9A 1PZ3A 3CZSA 2XM2A 4HU8A 1MWOA 3VINA 4C7GA 3VMNA 1JF5A 3LPPA 1E0VA 3MV01 2IXVA 1TVPA 4NXSA 3OLIA 3WQ8A 2XFYA 5IFTA 4P7NA 1E72M 1UD2A 5DT7A 5HDRA 2WC3A 3CMGA 2EADA 2WZEA 5LA0A 1HP4A 1HXKA 3EJQA 2QMJA 1EOMA 2W5FA 1FP8A 1EH9A 4FNQA 2QMKA 1EDTA 2BNJA 4J3SA 4DWSC 1WB0A 3MKKA 1GOMA 7TAAA 4NZFA 5DFAA 1R33A 4E8CA 1QI2A 1XRVA 4GZIA 3AHZA 1BPLB 3BUQA 2G3NA 3BVWA 4TVCA 3AXXA 1V02E 3CHFA 4WSJA 1QPKA 3AIVA 1R47A 2VL4A 3WDJA 4PMOA 1KWGA 3GXFA 3F5LA 2F7QA 1C90A 1XH0A 2ZIDA 4FNUA 1JYXA 1EDGA 4LPCA 4DM2A 3WL1A 2J79A 2WZIA 3OLDA 3W37A 2OSXA 3MANA 3N13A 4KMQA 4MAZA 1QW8A 2GDVA 1NQ6A 3M46A 2YDQA 1VAHA 1PX3A 4P8WA 4J3VA 2WMKA 3SCQA 3EJSA 4J27A 1KXTA 1JDDA 4FNSA 1TUXA 5FKYA 2J7BA 3WUFA 2WM0A 4PMUA 3LXAA 2XIIA 2QPUA 3T08A 2DGAA 1PX4A 1JZ7A 4NZJA 3UG3A 1G01A 1DWIM 2B31A 5CZKA 3AFBA 2GFTA 4WSKA 5CLTA 3PTMA 4CKQA 4UOQA 1XYZA 3EDJA 4S3KA 1SMDA 3BCFA 2VT0A 3VKKA 5I5RA 3CMJA 1HL9A 1DHKA 1E15A 5C8BB 3MU7A 2YA0A 4W5ZA 4ZEPA 2ZX7A 1PBGA 4U3AA 1JAEA 2DIJA 1QBBA 2JALA 3VGEA 3PZOA 3BAKA 2VC9A 4F8XA 3A21A 4MNMA 1OD8A 4DM1A 1K6AA 5BROA 3CLWA 1W9BM 3F5JA 2EPKX 3JUGA 3IJ9A 2A3HA 3WFZA 2XYLA 2WKLA 3LMYA 2EAEA 3II1A 4P7LA 5JBDA 2BY1A 3WDIA 1BTCA 3ARTA 4D6GA 3WY3A 1AQMA 1CXIA 3MUAA 4GZEA 4P8VA 5I79A 1R85A 4PMYA 3NSNA 2GJPA 1GJWA 3ALGA 1CENA 3T2PA 1W1YA 4ACYA 3EMCA 2VZTA 3NDYA 2TAAA 3GZAA 3BAWA 4LQ1A 1EIBA 3CZGA 1YQ2A 3S5ZA 5AC4A 3U5UA 1LWJA 4TX8A 1E0XA 1VJZA 1WKYA 3MMUA 3L4XA 1LF1A 3PTQA 2G8ZA 4JZ5A 4MADA 3DYMA 1UKTA 2OLHA 2WMIB 3BGAA 1G1YA 1W2VA 4QP0A 3OGVA 4CCDA 4AZ7A 2ZXQA 3SCUA 2UY2A 4NX0A 4W7VA 1OBAA 1X6NA 1E4IA 3VX1A 2XSBA 5JIWA 1EQPA 2DT0A 1D2KA 1F4AA 1VF8A 3SCNA 3SIMA 3BVVA 4PMRA 1OGGA 1W3LA 3NJ3A 3QOMA 3AZSA 1PZ2A 3WF4A 1XSJA 2W62A 1GQIA 3VIJA 3ZT5A 3NSXA 4PTMA 3PZMA 3DX4A 1UD3A 1RD6A 4NSBA 1UHVA 1CXLA 2JEQA 1KR0A 1GOWA 1R7OA 3PZUA 3ARZA 3L4YA 4U2YA 1JF6A 3BC9A 1L8NA 4JCMA 3WMSA 1US3A 3EMQA 1VFUA 4UTFA 4HA4A 1E4LA 4U33A 2UY4A 5A94A 2DSUA 3LPOA 2HISA 1GORA 1HKKA 2WCGA 2YA1A 1MFUA 1XD1A 1JZ6A 3GXMA 2RGLA 1QI5A 5A2AA 1NOUA 1OB0A 4W5UA 1CECA 2PC8A 1CGTA 2DH3A 4AZ5A 3DYPA 1UKOA 1LWHA 3EDKA 3W81A 1FFRA 3CPUA 4X0NA 1R46A 3RDKA 3DDFA 4DWSB 1VFFA 1OIMA 3VPLA 2BXYA 3CO4A 3WDHA 1PX8A 2VRJA 3RM4A 4UQEA 2CBUA 1SFSA 3T0DA 1BHGA 1JZ4A 3AS2A 4AMCA 2YL9A 3VNYA 1C7SA 3VIKA 3HJEA 4OOZA 4AZBA 2WVVB 3ECQA 2D3NA 3AQUA 2ZXBA 5A2BA 1BFNA 2DSZA 2V38A 4M29A 3N11A 3ARXA 1HJVA 3QHNA 2DPEA 1HT6A 1VFMA 1RH9A 3VD9A 1HNYA 2VRKA 4F9DA 4UFIA 3L4WA 2F8QA 4ATLA 4XB3A 2NT1A 3TP4A 3AMKA 1NOWA 2W61A 2W67A 3OGSA 4MNLA 1E3XA 1J12A 1Y7VA 1GQLA 5EMYA 3KZSA 5ABFB 1CWYA 1UA7A 2WNWA 3ZR5A 1GNXA 1QI0A 4GQRA 2ZICA 1IZJA 3IGUA 1H0IA 3SUWA 5KZ6A 4P7OA 3U57A 5M03A 1LLOA 1A3HA 1F4HA 1E6NA 1UKPA 5A6BA 1JIBA 1B3ZA 3IK2A 5CPTA 4MB5A 1KBKA 2QF8A 1TQVA 2F7OA 3BLKA 3W24A 5C70A 3VD4A 4KRUA 4MTVA 1W3HA 2D0FA 1QNSA 2ZWYA 4UQDA 3CUHA 1QW9A 3SCVA 2OSWA 3CHCA 3THCA 1E6XM 1FH9A 5A3HA 4W7UA 1ZJBA 1ISWA 2VTFA 3D5HA 3F4VA 3VD3A 2GJXA 1UH2A 1B9ZA 3MV11 2UY3A 5CG0A 4MDOA 4EANA 1QNOA 2V3EA 5AYBA 1IZKA 2J7HA 3VILA 3D51A 3GNRA 3O9NA 5IHSA 3CZLA 4PTXA 1VBRA 1C7TA 2J25A 5A8NA 2NSXA 3WBEA 4H8UA 1A47A 1KGWA 1PPIA 3UG5A 7CGTA 1CPUA 7A3HA 3GYCA 1KCKA 4QCFA 4KWUA 4M82A 1WDQA 2JIWA 1J0HA 2VCCA 4KGLA 5A6LA 1N82A 2D22A 4GO8A 1B90A 1NWSA 4W8LA 3L4UA 4LYQA 1BYAA 5AC5A 3O2LA 5BXSA 3AS1A 4PUEA 1UWUA 3VMPA 2HVMA 1B0IA 1UQYA 2FHBA 1HJQA 4AIOA 2VVSA 1CGXA 2X05A 2YOCA 2DT2A 2J78A 4FLOA 1G9HA 2WHMA 4AZHA 1GOOA 3WH8A 3WD0A 4TXEA 4C7FA 4H8VA 3QOKA 3G6MA 1UKSA 1B1YA 4R5EA 3RPMA 4UFHA 1MVYA 3BUBA 4CCEA 2D3LA 1QNQA 2QV4A 2OSYA 2VR4A 1LG1A 4RE4A 2DSVA 2J4GA 4IPLA 1UR0A 4EKJA 3S5YA 4BQ5A 4M8UA 1R87A 2OWWA 3GDBA 3OZOA 2UWFA 4B16A 3ALFA 1JI2A 1V6XA 2W4XA 2Y5EA 3IAPA 3NUKA 4P7RA 3WNPA 4GPNA 4L4PA 4F66A 3A22A 3VNZA 1MQPA 3DYOA 1Q6EA 1WDPA 4D6CA 2WBGA 4A3YA 3K8KA 3OG2A 3DDGA 1HX0A 2WHJA 3WH5A 5D9MA 1FP9A 4AYGA 1W32A 1HVQA 3PZ9A 5DT5A 3ARQA 2GVYA 5D4YA 3LRMA 2OWXA 1FFQA 1KR1A 1DP0A 1ZL1A 3K8LA 3WFLA 1CXFA 5CGTA 3A4XA 4Z2GA 4CUCA 3DHUA 4WLCA 3N18A 1D3CA 1GOIA 4W7WA 2OYMA 4DO5A 2JEPA 3MSGA 4M24A 4EK7A 3UG4A 2YJQA 1ESWA 4IPNB 4Z2KA 2O9TA 2WKGA 1PS3A 1GHRA 5A6SA 1BSIA 1MFVA 2J77A 4YHGA 1OT2A 3KEHA 1CZ1A 1V3HA 2JF6A 3WD4A 1B2YA 1H3GA 1HVXA 3IJ8A 1WDSA 1W1TA 4CCCA 4JKLA 5CLWA 2X2YA 4PMZA 4W88A 4V2XA 4UOZA 4DUXA 1BYBA 2J7FA 5BYWA 2G3JA 1WP6A 1XV8A 3E1F1 3OIHA 5E9AA 2VUYA 1CXHA 3B9DA 6TAAA 3BSGA 4FLSA 4UQAA 5JBFA 4BQ4A 1QNPA 1QHZA 2E9MA 1Z32X 3VIIA 2XHYA 2VURA 3EYPA 4AZCA 1P6WA 3B8SA 4MPKA 3VTRA 4PSRA 5LA1A 1V3JA 3L4VA 4H7VA 3VU2A 2YDRA 3WUBA 1H41A 1E71M 3K1DA 2QHAA 4IM4A 1KQYA 2CXGA 5F7UA 1ZB5A 3N1AA 1J0IA 2XFRA 3VIPA 1Q4NX 4AD3A 1WPCA 2YIHA 1XSIA 2ZXDA 4E2OA 3CH9A 4D72A 4AMWA 4AD4A 4AZCB 4HTYA 1W9PA 4Q22A 1WZLA 4WKAA 3VUPA 3VO0A 2XGIA 3D4ZA 2PBGA 4CVUA 1NARA 3F5KA 3LRLA 1E6SM 1K9FA 1OINA 4UZSA 1FOBA 1FA2A 3AHXA 1W3JA 2BHUA 1KXQA 1MW3A 4TX6A 5FL0A 4S3JA 1V3MA 5CQ1A 1JI1A 2XVPA 3WUGA 1TE1A 3VIMA 5JIPA 5JUVA 2FE0A 4TUFA 3FAWA 4PRWA 1EXPA 5A8QA 1HKIA 1WDRA 2CBIA 1YHTA 2DT3A 3VDHA 3WNMA 4CU8A 1E3ZA 3EJRA 5D9OA 3SUSA 1CLXA 3W25A 3HG4A 4HMEA 2CETA 2XG9A 4WJXA 3APGA 3LPFA 4GI9A 3LPGA 1DWHM 2X2IA 1KTBA 3ZR6A 3W4RA 2EJ1A 5LYRA 4JCLA 1V02A 1UR8A 2FDMA 1ECEA 3VGGA 4R27A 2WMHA 3T2OA 3WDPP 3GM8A 3ARYA 2OYLA 4J3UA 3TTOA 2GUYA 4PBGA 2XVGA 3VDAA 1KGXA 1JZ5A 3WKZA 5HXMA 3OGRA 4BS0A 3HZ3A 3THDA 3SCPA 3WD1A 2F1AA 3FN9A 5GNZA 4CVWA 2CIPA 4NRSA 4BA0A 1QOXA 4M80A 1XYFA 1BLIA 2MANA 1W9XA 2IXUA 2E8ZA 2VZOA 4YHEA 4ACZA 2CPUA 1UD5A 4FF5A 4W85A 1GONA 3FXYA 1QI4A 2WHLA 3M7SA 3KE0A 3W0KA 3A47A 2BY3A 1CTNA 1RP9A 2ZUVA 3WF3A 1JL8A 1NM9A 1OIFA 5CSYA 4AYSA 1DEDA 4QLLA 1FHDA 1T0OA 1JFHA 3AIWA 4YPJA 1PJ9A 4H8HA 1JAKA 2ZXAA 4WIWA 4OZOA 3OZPA 4WF7A 4ACZB 1V6UA 2WZHA 3AOFA 2FGLA 1KXVA 4Z2LA 4TVUA 2D1ZA 2WMIA 4W87A 2GDUA 4YN5A 4PCTA 4AZ6A 3NDZA 1KBBA 2YL5A 1BYCA 1NP2A 4WKFA 1UWIA 4QLKA 2ZOXA 3BH4A 1V3IA 1DWGM 2W66A 5HPOA 1J10A 3EJUA 3RJXA 3GNPA 3WH7A 3WEZA 3A3HA 2WCAA 1H5VA 3AHVA 5CJ5A 2XVLA 1V6YA 2XIBA 4P8XA 1ZBVA 3W26A 1VENA 1ODUA 4U2ZA 2VO5A 3AISA 1AVAA 4HMDA 3WSUA 4PMXA 3CUIA 4A4AA 1G0CA 3SUUA 2W91A 5ABGA 5I0DA 5FCZA 3BUIA 4GO9A 2QPSA 2FHFA 3BXWA 3RIKA 1I1WA 3WQ5A 4BF7A 3W6LA 3ZJ8A 1OWQA 2OW7A 4UCFA 4W89A 3NYDA 1EHAA 1SYTA 4UQBA 3K4AA 4DUWA 4AW7A 3VGHA 2VCBA 4AXNA 1GCYA 5IFPA 3OLGA 3RM8A 2YLAA 3PZTA 4D1IA 4J28A 3UESA 4AEFA 2WPGA 1V03A 4B15A 1TMQA 1MW0A 1E4NA 3D3AA 4HOWA 3UETA 1J18A 1VEMA 3RM9A 1U33A 3CZ8A 5AYIA 1J11A 2E8YA 3OBAA 2VCAA 3CBWA 5BXRA 2WWDA 5A8PA 5FD0A 2YKKA 4BZYA 3CTTA 4PMQA 4DWSA 3KLKA 3VGBA 1E73M 2WAGA 5E6YA 1Q6DA 2PWEA 1DWFM 5TD4A 3W53A 4U5KA 4J3XA 4B9YA 1DWAM 2EPMX 2XVKA 1HXJA 1WAWA 3ZT7A 3UR7A 3D50A 3AI0A 1GJUA 2ZUWA 1K9DA 2WVVA 3IJ7A 2XN1A 1J0YA 6CGTA 1LL6A 2E0PA 2J8FA 4ATDA 3SUTA 3AJ7A 2PI6A 5I3DA 2CCRA 3QHOA 2JFEX 2ZE0A 1Q6GA 2JIEA 5D8WA 3WEMA 4IISA 2XJ7A 5E1QA 3MUY1 1CXKA 2WVSA 4LXFA 2AOSA 3L2LA 1H2JA 4F9JA 4CN6A 3PZNA 1FHLA 1W1VA 3AYSA 3I3DA 2V3FA 1QX1A 1E5JA 5ABFA 3LRKA 1BF2A 2PBOA 1PAMA 5ABEA 1XSKA 3DX2A 2XGBA 1TFVA 3WBAA 3AIRA 2O9RA 3W27A 4UFMA 5A2CA 3OLEA 3EBVA 1BVNP 4MJ2A 1JZ8A 2FH6A 4QCEA 1LJYA 4AC1X 1BG9A 4FNRA 1BGGA 2PWFA 3VDCA 4OKDA 3RILA 3UCQA 1J0ZA 2CNCA 1QVBA 3PZIA 3ZM8A 3HN3A 2BHZA 3K8MA 1UD6A 1V3KA 2CKSA 2X2JA 1E9LA 2VX7A 3IANA 2J74A 1UR1A 2VOTA 3W38A 5C71A 4W8BA 2F2HA 3VIOA 3WEOA 1O7AA 2CKRA 1L0PA 2CBJA 5I2UA 1BAGA 3DHPA 4M56A 1V0KA 3PN8A 2ZUNA 5IHRA 4MB4A 3BMVA 3BMWA 4AIEA 5AY7A 5CGMA 2A3BA 1MQRA 3AZRA 2J8GA 3I3EA 1B31A 3CIVA 5A6KA 3SURA 3T0BA 3WD3A 1UD8A 5A69A 2J75A 2FYVA 4UFKA 2E9LA 1W1PA 4OJYA 1VFOA 1E6PA 3OB8A 2A3CA 3VSVA 1PIFA 4DO4A 3MUZ1 5EB8A 1W3KA 3ZO9A 3BSHA 1EOKA 2Y2WA 1CDGA 1KCLA 1B3YA 1V0LA 3BAIA 4J7RA 1SR0A 2Y4SA 2CERA 3CZEA 4PN2A 3VIGA 4CD5A 1ZBKA 4JKMA 3NSMA 4QAWA 4V28A 3WNKA 1H11A 3VD7A 5A6AA 4D6FA 4Q7NA 3WNNA 3WH6A 4C7DA 1BG4A 1EHNA 2BY2A 2VQUA 4B3LA 4B9ZA 1TQTA 2EPNA 2D0GA 5GNXA 1E56A 1V0MA 3AMDA 3FAXA 5DO8A 2VZSA 2WXDM 1UOKA 4WK9A 2FGZA 1CBGA 3AZTA 1V6WA 2G3IA 1WZAA 2GSJA 4BCEA 3AIQA 3DC0A 5CXPA 2YDSA 1JDAA 1MYRA 2CESA 2WYSA 5BCAA 3CHEA 3CZKA 4JFUA 3HG3A 3H54A 5HNNA 5BRPA 4H41A 3AIUA 1TR1A 2VJXA 2WWCA 2FHCA 4OBRA 3S6TA 2WK2A 2EACA 3KL0A 3WQ6A 1W91A 2ZUTA 2G41A 3KL3A 1FH8A 3WL0A 3A6OA 2WW5A 1TA3A 3WQWA 2DIEA 4FLQA 1B3XA 2YBUA 1J0KA 1OT1A 1SZNA 4HZ7A 4IUGA 1JD9A 1MW2A 2AAAA 1XCXA 3HG5A 1ITCA 3W29A 1JD7A 4L4OA 4CD4A 1UKQA 3WQ4A 3VDBA 4ZENA 1CIUA 5A8OA 1HWWA 1NH6A 2WMFA 4M1RA 5BXPA 1SMAA 4QDMA 1C93A 1V0NA 3NCOA 4UOJA 2BVTA 1H4PA 4JKKA 2Q8XA 2CBVA 4UQ9A 2E3ZA 1TA3B 3ZMRA 1UASA 3TTSA 4PMNA 4ML4A 1AQHA 2PB1A 1XD0A 4GI8A 3CZJA 2F1BA 4MB1A 1XH2A 4DUVA 2WSKA 3DX3A 4PEEA 1JDCA 4D1JA 5ECUA 2ZUSA 3VX0A 3TTYA 1X6LA 3PBGA 2C0HA 1R34A 4GZJA 3T09A 4ZXOA 4XX6A 4QLJA 3WH9A 2WSPA 4CD6A 3ZJ7A 4JFSA 2O9OA 1M01A 3ARSA 1NWUA 5GQBA 3ZSTA 3G6LA 5D8ZA 5E09A 2W63A 3A5VA 3L4TA 3L2MA 5FL1A 4Y7EA 3VD5A 3CV5A 1R75A 4CU6A 1TQSA 1JG9A 2BY0A 3A23A 3LXCA 3SCOA 1U2YA 3SUVA 5BWFA 1K9EA 3HU7A 1JXKA 3ZSSA 2X0YA 1ITXA 2EXOA 3AS0A 1CYGA 4N42A 3WN6A 2WB5A 3NIYA 2XWEA 1CNVA 2A3EA 4A3HA 2ZWZA 3WNOA 2WHKA 2AMGA 1E5NA 3DX0A 1JXJA 3FHQA 3M6DA 1CEOA 3WUEA 1UR9A 3GH5A 3RMEA 3BLBA 3GBEA 4UNIA 4CGTA 2J7DA 4HU0A 1OGBA 3GXDA 2ZX6A 4MDPA 4J3TA 1VBUA 3LXBA 1V08A 3DX1A 3EMZA 3EDFA 4CN1A 1QWNA 4OGZA 5JBEA 2F7PA 5EFDA 2VQTA 1E6ZA 2V5DA 1LL4A 3RJYA 4PSPA 2XN0A 2Y8VA 1WZKA 2G4FA 3WNLA 2WVUA 3BCDA 3POHA 3OA5A 4LX4A 3PTKA 2EQDA 1GQKA 1GOKA 1E6QM 4PUDA 3SCRA 6A3HA 4RL3A 5M3WA 3QR3A 1VJSA 1HJSA 1UWTA 2F7RA 2BVYA 4ZXLA 2BHYA 4CN4A 2VX6A 3A24A 3KL5A 3CUFA 5A6JA 1ISZA 2UY5A 1UH3A 1GPFA 1DWJM 2XTKA 2BVDA 4MNKA 4W84A 1J0JA 1ZU8A 1ISXA 4F79A 4W93A 3ZIZA 3AHYA 1MQQA 2EEXA 4HOZA 3DECA 4AY1A 1GW1A 4D6HA 5FOOA 1R7AA 1JGIA 2VMFA 4D6JA 1NWRA 1TG7A 4D71A 3H53A 1GHSA 4KH2A 1OCQA 3POCA 4Z2HA 1V3LA 4AD0A 1E4MM 4RE2A 3EDDA 3N04A 2G3MA 5BXTA 1G94A 1JYWA 4UFJA 4AD1A 1EO5A 1EO7A 3GTNA 1FH7A 3PHAA 1O6IA 3CGTA 2X1IA 1O7DC 4D6EA 2F18A 1ZBCA 4AISA 1CGUA 4DWSD 1KXHA 5HBFA 3PZGA 1CGVA 3TA9A 1GZJA 3J7HA 3AYRA 8A3HA 2VRQA 1HL8A 1OD0A 3FHAA 1TZ7A 2WBKA 4XUYA 2D20A 3GXTA 2O92A 4XZWA 3W82A 5LA2A 3RO8A 4NI3A 3UEQA 2OYKA 2WMJA 4LGXA 3MSDA 4U5IA 1VB9A 3A4AA 2J7EA 4GXPA 4K68A 5A8MA 3FNDA 2O9PA 1VIWA 3FY1A 2CHOA 1EQCA 1LL7A 4MB3A 1J9YA 3CHDA 1UR4A 5EFFA 4BQ3A 2PWDA 3GBDA 5D9NA 2X2HA 3H55A 4GIAA 2WLZA 1UYQA 3BVTA 3BAYA 3MMDA 4Z2IA 2V5CA 3U5YA 1E6RA 3ARRA 3BVXA 1TQUA 4V27A 1W9DM 1JZ3A 2X09A 2XM1A 4OOUA 5D9PA 1CGWA 3WY1A 3VGDA 2CEQA 1M7XA 3BVUA 2XN2A 1I75A 1BGAA 5A95A 4OUEA 1V6VA 2YFOA 1UH4A 1C3FA 3QHMA 1B3WA 1H1NA 2D23A 1R86A 4PTWA 5HOSA 4PMDA 1CGYA 2ZX9A 4MAVA 3CUJA 3K4DA 3D4YA 1ODZA 2E40A 5BRQA 2DT1A 3MMWA 5A1AA 3WQVA 3N17A 1KFWA 2CYGA 2ZX5A 4QFUA 1WZMA 3GXPA 1S46A 5E0CA 1JNEA 1HJWA 3W6MA 4AD5A 3BUPA 2JF7A 3HG2A 3B9EA 1EDQA 2NT0A 3AS3A 3BAXA 3ZOAA 5IXEA 1UQZA 4PTVA 3HMCA 5A6BD 4NF7A 5I23A 3BUDA 4JL1A 1KGUA 4OIFA 1C92A 4GQQA 3ARVA 3T2QA 1U30A 4EE9A 4HA1A 3SEPA 2ESCA 2YFNA 2YL6A 4UR9A 4KGJA 2XFFA 2D0HA 1UD4A 1E43A 1RPKA 4GKLA 3MUIA 2YL8A 3TONA 1HJXA 1AQ0A 4BQ2A 4MJ4A 1H09A 4JFWA 3WF2A 2X0HA 4DO6A 1J01A 1ZJAA 2BFGA 1ZS2A 2WLYA 2EPOA 3B9AA 4RE3A 3ARPA 4AD2A 1M04A 4JAWA 4PCSA 2XPKA 2Y8KA 1H0GA 4FLRA 3UERA 4CD7A 5I78A 2NW0A 3RCNA 1XCWA 3WF0A 1LG2A 3VSTA 2YLLA
chains in the Genus database with same CATH superfamily
2OWCA 1QPRA 3RVUC 3B0YA 5EOCL 3QQDA 5CJQH 4NQDE 4WGHA 3TWCH 3KWXA 5C6WH 4JFVA 4IMLB 3WDRA 3FU6A 4OM1H 1AS7A 1W6LA 1BZOA 2NWRA 1YMHA 5J89A 2Y61A 4KUZH 1MAJA 3VCRA 3P0WA 3QQDB 1GOQA 3OEXA 3MLUL 1XEUA 5CBJA 2YUWA 3UADA 4P8UA 4ZX4A 3JUZA 5EOQH 1XF5A 1J5SA 3L3OC 1GIGH 4L23A 4GJIA 5CAYB 3NFUA 4G7EB 4U7SA 1S9XB 1I9CB 3TFXA 3KUMA 3R4DA 4YMZA 4GQZA 5I6OA 1ZQ5A 3CQIA 1QNZH 1VP5A 1NL0L 4XXCC 4HHAA 4H04A 3WIIL 1VFSA 4AWEA 2AKRB 4Z0XB 4MZ8A 4G7SB 4N90E 4S1RH 3QJOA 2HBXA 4JDYA 1AG6A 5JLZA 3DG6A 5IV2B 5F6IC 4HK3N 3DRQB 4I4WA 2R9HD 1IFHH 5GJMA 4Z7WE 5T5NF 3TYFB 5AVXB 4X7TB 3BJLA 3QO1B 3R8QA 5I15L 1E1FA 2IPTH 4R8WL 1W72H 1R5VA 1J6PA 3UWZA 1FZKB 3MLVL 2HS8A 1E1EA 2FPVA 3N44B 2EEBA 1KCRL 1E55A 5BRZE 2I9EA 3D18B 4KZDH 3NPXA 5AVVB 3AMCA 2W9DL 3HG0A 3MREA 5MEPA 4O13A 1BF5A 4RVBA 4PJ8A 4MQSB 3T6VA 1EXBA 1F90L 1J8HD 4FMVA 4CU7A 4PLNC 3W70A 3P2DA 1CDJA 4BCYA 1TSRA 1I9EA 4P46C 1K5NA 3MREB 4FP1A 1A7OH 4WKHA 1XHGA 4H00A 4PJ8B 1EJVC 4LARL 2J47A 3BSZA 4ZE5A 2D2GA 4E8DA 4L5FE 4LUJA 3QJHB 3OWRA 2HZHA 4JRYD 4FQ1H 4M5ZL 1RR2A 2V5RA 4NNCA 1NBQA 2GUOB 4I5RA 4ORMA 2MPAH 3WMCA 4YHML 4DGUA 3V4UH 2DM3A 2B7QA 2FTWA 4JJ5A 1UUQA 5AFAA 3I50L 3IAQA 3DLQR 1MW1A 2RHEA 3IJYA 2QAFA 3DAQA 5TTRA 3FDGA 5IW6A 3TW7A 4LRNH 4JJ5B 3EOTH 3S2MA 3BEWB 1NGXB 1FAIH 2XM2A 3FPXA 2B59B 2KQMA 1K7XA 4Z3GA 3EOLA 1ORQA 4JGDA 4LEBA 1CL7L 4EKXA 1EH9A 4JPVH 1X9LA 3GBML 2VW4A 4O02B 1NC4B 5HMSA 1UTDA 7TAAA 2EVFA 1SMOA 2ZTJA 1ORQB 5EUOA 4E8CA 3CHPA 4GE8A 1SFTA 2FT8A 2OMXB 1AOZA 3PPCA 3A4FA 1FCGA 3QNZA 1WIOA 3MPGA 3FXGA 2P3EA 3ZHKA 4L0YA 4LPCA 3NACL 3PJLA 4P2QA 1ZLUK 3TCSA 1UZ6E 3GB6A 3GLCA 5T1KA 3WQGA 2I5IA 1FHNA 4N0YL 4OGXH 4TO8A 4XP5H 1JNNH 3HZMB 3RDTD 3RFZC 4GW4B 4I0PA 5F7AA 4HNUA 3P2TA 4FNSA 1S7UB 1TUXA 3BPCB 1EFZA 1AR1D 4LCYA 1RQEA 3RCYA 3VD1A 1ZGLM 4C5ZA 2ZKWA 5C08E 5T1KB 2CJTA 4OZGA 1NFBA 5T5NG 4YCOA 2C13A 4PPTA 3RIAK 4YR6A 4HX1A 5D1QD 1IM9D 1SMDA 4GIOA 4LCYB 5C8BB 4FIRA 1K6QH 1AAJA 4CJ1A 1YDOA 2CA4A 3BAKA 1MCDA 4RCAA 3APCA 1WBHA 1AY1L 3CLWA 4BSJA 3WFBL 2J13A 1E6JL 4NUGL 2OR9H 3MOAL 2YUXA 3QPXH 2A6JA 3K81A 4PMYA 4YWIA 2VDNH 1O9WA 1CENA 2HJLB 3G04A 2TSBA 2HTMA 4WUUD 5C8JB 2JCCB 3S5ZA 1KPUA 1E67A 5T3ZH 5KINA 3SDAA 4KMTL 1CFTA 2OLHA 4ADIA 1E4WH 1IRAY 1W2VA 3T81A 3DVNA 3N1FC 3VFSA 3DI0A 4J2MA 2XSBA 4CQ9A 4GJJA 2KPWA 2DM2A 4M02A 1I7TB 2VQ1A 3SCNA 3SIMA 1ZGLA 3PWPE 3LCHA 4C6JA 4WY7L 5SWUA 1KNOA 3PFQA 2OGJA 1WWWX 3SGGA 4O9HH 2F9RA 4DN1A 1R7OA 1GOWA 1SN0A 2APXA 4U2YA 2C71A 2VQ1B 4P2AA 2O6EA 1E4LA 1AGFA 1KNOB 2Y7SA 4LGPB 4MWAC 3SRDA 2DDQH 4R88A 3H42L 3IKCA 2P0OA 3NQ8A 3FXIC 5E2JA 5A2AA 3ZLHA 5SWZE 2PC8A 2FD6L 5JYLA 1K8DB 3S2NA 2WSDA 1A5KC 1LBLA 1AGFB 3GVRA 1SW7A 3WJYA 2IC2A 2Z31B 4LSUH 5E95B 2ZYFA 5AENA 1PYMA 3BZEA 4LASL 1XL4A 2I16A 3HJEA 2I5QA 3ECQA 1UACH 3AQUA 4LUSA 2FT7A 2GY7B 3RWJB 2ROYA 4O53A 4KK5C 4BI6A 5F4WA 1VSCA 1G9NH 1W72B 4P2OC 5IEHB 5T5FL 5EPDA 3IGAA 1E4XH 2W61A 2ZKHL 4X6FB 3BN9C 3ITCA 3MXVL 2WNWA 5IWLC 5I8OL 1GAFL 1N59B 3DG3A 3F2LA 1IZJA 4MA1C 4C1NA 3KGRA 5IROC 4G8GA 1P0SE 4JR5A 1XBRA 3KVLA 2OELA 1Z9NA 1DLHA 1TQVA 5I1LB 4MTMA 4IOFD 1LM8V 3EHBD 1S2WA 2ZOWA 3QDHA 5JO5B 3UZVA 1ISWA 1MDAA 1B9ZA 3MV11 4UT6A 5AZEH 1TTCA 1QNOA 2YD8A 1TWWA 4HT3A 2XBZA 3AWGA 1RSYA 1YY9C 2BVPB 4FQJH 4OIIH 1N55A 3MC0A 2YJLA 2VCCA 3KJ6H 3EH5B 3KR3L 5L2JA 3GI9H 4RXFA 3GKZA 3PDDA 4YE0A 2HVMA 1MUWA 5AL8A 4DZIA 3F12A 2X6VA 3MXWL 1J1OL 3IVSA 4IRZH 4ZS6C 1YKWA 2ZVRA 4R7VA 4CCEA 2X4OB 1NIDA 2OSYA 3UAJA 1K1DA 3RVTC 1UR0A 4AZ8A 3S5YA 1R87A 3IJSB 3W1PA 1DBJL 4RA3A 3F12B 1WDPA 2ENJA 5FB8B 4OD2A 3EKCA 4RQQB 2G9HA 1T0NA 3GLAA 2CHDA 1HVQA 3VOGA 4H26A 1S38A 1F6FB 1M7DB 1YDNA 1FFQA 1KM6A 4AZ8B 1Y8BA 4M61A 3GIZL 1JTOA 4Q4RA 4RR4A 4U1IA 3INUH 4OD2B 4Y5YC 3MSGA 1T0NB 3DNKA 4PQXA 1RL1A 2BVWA 3LM3A 2JLPA 1CE1H 5IHWA 4OV5A 4ENZA 1DBAH 3KEHA 2Z00A 1J8HE 3WD4A 3V0VA 1ONWA 4JFFD 2Z0IA 2BSEA 4Q32A 4UOZA 4U1IB 2DU2A 2P80D 3E1F1 3B9DA 4D0BA 1KSRA 4YWSA 2NDFA 2EAWA 3AB0C 2B7PA 2FTPA 5CSZA 3PSWA 2ZPKL 1KFGA 3QM3A 5A8GA 2IW0A 4JRYE 1E71M 2K4WA 4TSCL 2WXOA 4DB7A 2VABA 3PJWA 3P61A 3S3SA 1XSIA 1FTXA 3EWBX 2Z93B 1W9PA 4K71B 5D1ZC 2X4QA 4PGCB 4Z7OF 3HHSA 1SOKA 5CSZB 3KM2A 5BV7C 4GUPB 4H88H 3MRNA 2VABB 3HLAB 3JV4B 1I7UA 3A3WA 2HK0A 2MCPL 1MCOL 4ZPVB 2AJVH 5E8NA 2INEA 1E9QB 5GGQH 2RGSA 1FY6A 1XYCA 3G18A 3TPKA 2Q3OA 2YMXH 4KDTA 2YYUA 4Y9MA 5KSWA 5DRWB 1M7UA 4L3CA 1OWRM 2X2GA 2PYFB 5DXXA 4OFPA 1NEZA 4UIMA 5MI0C 2VDNB 1BWKA 5KBMA 5L6YL 1AJ2A 2PS2A 5FV2A 1GTHA 3LIUA 2WXRA 3AXMA 3RWEA 1KGXA 1FBIH 2ZOKB 3OYZA 2KKQA 1F8TL 4L3CB 3WD1A 1P2CA 3FN9A 1NEZB 3NFPB 2WINB 4ZRGA 4QHLB 4KKAC 1M4KA 1YQVH 5LBVA 4HPXA 3FJNA 5KSVB 2HPMA 3MODH 4HIJA 2WWMC 3RWEB 3H21A 1K4CA 1KN4L 2X4TB 3KE0A 1GCFA 4WU7B 5IVOA 4N0CC 3UTTB 4AYSA 4RPQA 4PJ9A 4TR9A 4GLEA 4WIWA 3HRZB 1KXVA 2K3TA 3QA3A 1NUDA 2GKIA 1NF0A 4GW5A 2I32A 1UWIA 4GUHA 3KBHE 5DUJA 3A12A 2DZSA 3OKYA 1P4LA 5JIQA 3MCKA 5FECB 2DTSA 5CJ5A 5J6GB 3VNMA 5IKCA 1I3GL 2A9NH 5HAOA 1MJ7L 2ED6A 2R2BA 1YECL 1YEFH 5SX4H 4DYJA 5D5MB 4DN3L 5EO0B 3WN5B 3MCKB 5C6TH 3GE7A 4DQOL 3MR9B 1HFBA 3TYUA 1V03A 1EK3A 3G8RA 4HQQH 3KW7A 3APDA 4MA3A 5BW7C 4MYXA 7REQB 3S5LB 3VWJB 5D2LF 1DWFM 4FQQB 3L08A 3QCVH 1XF2B 5KVDH 2YD2A 1A0CA 1Z3GH 4ZXBB 1MJUH 1EP2A 4MA3B 2LU3A 1C5BL 1NAL1 1REIA 5JQ6H 1DJSA 1U3ZA 1ZIBA 3VRIB 1IKNA 2QQKH 2K6WA 1ZTXL 2A4AA 3EYFA 2JB5L 4R5TA 1MRDH 2TYSA 3W7DA 4B5SA 1KG0A 4HFUL 3T4YA 4AGQA 1AD0B 2IBZX 4JQVA 5AUMA 1PAMA 2APVA 2B1AL 4R4FL 3MDWA 1D3HA 2XUWA 2QCMA 1GZGA 3TJ4A 4FNRA 1MVUA 4D8PB 4JPWH 4GHRA 1SXZA 2OR7A 4ZMGA 5AUMB 2JI3A 1UGKA 1XISA 3SOTA 3WBYA 2ALAA 5EHFA 3TWAA 3CSFA 1RU9H 2BVOB 4BKNA 4PJIE 4GFTB 1LQSR 1YPZE 5BWAA 5C07E 4LHUG 3BPWA 1MVUB 2ZUYA 4MB4A 5AY7A 2R2HB 4YHYB 4KZCA 5A6KA 3DMMB 4GRWF 2J75A 4DKDC 3P84A 3D05A 2NY3D 1JZDC 4WEBL 2DZBA 2E6AA 4L64A 1NGWA 3M5ZA 4KBPA 2Y4SA 2UWEB 4K5NA 5AAWA 3MQTA 4CD5A 4M62L 1SO4A 1Q1JH 3IS1X 3VA8A 2E3VA 2RKXA 1QA9A 4D9PA 4HK6A 2V5SA 5EV7A 1RZKC 1WA1X 1NGWB 3GSWA 5GNXA 3DFTA 3KVMA 1UCWA 3BQ5A 3SDXF 5C0EB 1QEXA 4NZ3A 2FGZA 3HA0A 2GSJA 1PLAA 1WZ1L 3MKCA 3MLRL 5C09D 3L5IA 1YNYA 4G7YH 3QQ9D 1X5IA 1AKJA 3T4AA 1GYNA 3CHXA 4GKNB 4Y4KB 5B3JE 1TR1A 3WFHA 3HZKA 3S6TA 1G87A 1XBZA 1A5UA 3NP4A 4Q4EA 5E2TL 2F53A 1WS7A 3JS3A 2YBUA 1RXLA 5DI8B 5F2MA 2WPBA 3EOBA 1EYEA 1K7EA 1JD7A 3JQOB 2BNUA 1MZYA 3JWNC 4DNMA 3HZKB 2XN9A 1QCWA 1YJDH 1J9CT 3WBWA 3K5XA 4WWNA 1UASA 3AG2B 4PGZA 1A7NL 4AYBA 1QLEL 3GIPA 4NUJA 1F6LL 4GZJA 4I3SH 4ZXOA 2WSPA 1D7DA 2XN9B 4FQLL 3ZKSD 1GT8A 2Q7NA 5GQBA 3ZSTA 2W6RA 5I5IA 1ETA1 2KPNA 2IO5A 2NY0B 2ZG2A 2W63A 3BJTA 2NY7L 1YEHL 2KZ1B 2X89D 5EPMA 4NAFB 5AG8A 3LQMA 4DP2X 3W7MA 2PP1A 3X11A 4FCHA 3SCOA 4NUJB 3UABA 2GVGA 3EO0A 3AQDA 4WI5A 1TNNA 4HV8B 4TRPH 4X4YA 3HJZA 4I3RH 3H4FA 4I87A 1DDHB 1IFRA 1DV7A 2FVLA 5ICXB 1A8JH 1U8OA 4YOKA 4JM2C 3HB3B 1YTEA 4N9OB 4Y9PA 3BLBA 4B91A 4Q8WA 1PEWA 3EO1B 3JU2A 3VABA 5AZ0A 1X5AA 4XO6A 1X5XA 3V79C 5BUAA 1O60A 1L3WA 1ZP4A 3ARBC 1T22A 3EYUH 1UBSA 1O1ZA 4NKCA 1D9KC 3PTKA 4DZAA 5EYWA 5D7JD 4ZUWA 1GMIA 3HCVB 1OAQH 2BERA 2C18A 4JTHA 2AJ3A 4AL8L 1C5CH 4S3EA 1LP9E 3H7VA 1F58H 3OL2A 3PAOA 3GZ3A 3A24A 4I18B 2UY5A 1S39A 4AEHL 4N1CA 2XTKA 3QUYB 3FU7A 3IN2A 5F7MC 5KJ4A 3BLDA 4FXRA 4E68A 3WTTA 1URZA 4UMBA 3BKJL 4ONOA 2AJ3B 1D7BA 1TSIA 2IPJA 4NG3A 2D03L 3M5XA 5CKAA 5IBUG 3T3PE 1GJIA 5F71A 3DCPA 2HYMA 2G3MA 3RRXA 4A67A 4XKYA 5LAPA 3CMOL 3L3JA 3K4WA 1EO7A 1QAPA 2FKPA 3MRKA 4BYHA 4D6EA 5L0QC 3IB4A 2VEIA 5ICYB 5J4MA 3LI1A 3PWUA 3M64A 1ZV2A 4LVBA 5GGRB 5T1DL 3RUGA 7FABL 1Q0YL 3GXTA 2ZDRA 4HSHA 2Q6WB 4GLRH 3VOFA 4U1SA 4LGXA 2Q9OA 3E0FA 3MRKB 5H4ZA 1I4FA 3UZWA 4O19A 4BY3A 3VDGA 3NA9L 5HVHC 4KJQD 3T3ME 2DEXX 3P30L 4KK8C 2ISVA 2QHLA 3DX6B 4UR7A 1I4FB 3VGDA 3BVUA 3GW3A 1YDYA 4NBZB 5A95A 1S6NA 1ANUA 1ICPA 3ARGA 4BQ8A 4PAZA 2P46B 5LIYX 3WE6B 4Y1AB 2C3HA 1F6YA 2GVJA 3HA1A 4G9DB 2BSDA 3MMWA 4YHNA 2DKMA 4HFWA 2ZRVA 1JNEA 2GEQA 3S3PA 2Q3ZA 1EDQA 4LSDA 4QHMB 4R2GB 4EJ1C 5FJUA 4HA1A 1JXDA 2H47C 5FACA 4I5UA 2YL6A 5DR5L 2NW2A 4Z1BA 5AB9A 4F0HA 5DHYB 2CO7A 2YL8A 3GKWL 4B2DA 1I9JL 4K94H 2XWJA 2NUXA 4JFWA 1VZGA 3CC5A 4JGJA 3APYA 1E9IA 5CZVH 1ZNNA 1TZOA 1JUFB 2BSTB 1CBVH 3IDUA 4HAKA 3VFCA 3E2VA 2VIRA 3PNRB 2FWSA 1QOKA 5BMFH 1QHPA 4A7SA 4YO0B 1DIEA 2DY2A 4KO7A 1Q9KA 2YD6A 2GPZA 4UYQA 1JCMP 2BS9A 2VXUH 3O6DA 4E41D 2WKOF 2HA1A 5GJPA 4XMWA 1D7FA 1U22A 5FUCE 3HN8A 4S1SL 4KNSA 3REVB 2E7FA 3SJ3A 4AQLA 2E27L 1TKKA 5DVNA 4B3KA 1PEZA 2JQXA 2B4CL 4LIQH 1G9EA 3MFFA 1IQDB 3ERPA 3MUUA 4UUJA 3BI9X 2PF0A 1HIZA 4A21A 5C0GB 4Q7DA 5L88H 2KX9A 1IAKB 3URQA 5JPNB 3MFFB 4R26H 5D72L 5CR1A 4UUJB 4J8RB 1OGSA 1K7FA 5A3IC 1W0MA 1E28A 1EP1A 3K46A 3GQYA 3BWUC 5I1AB 4UTWA 5DF0A 1GKOA 5DHMC 4AMXA 1IL1B 1MCLA 1O75A 4FXTA 1MI3A 4PJAA 4R3SB 2DIKA 4JRXD 2ZCHH 3IF1A 3EB2A 1Y5XA 4TMPA 1OSZA 3SCWA 1GUVA 4M7LT 2HX7A 1H9VA 3Q1SH 3OR6A 4XVEA 2BNQD 4YDLC 5EO9A 1N8OE 3GXNA 5T3XE 1MVFA 1ICTA 1EJOH 2PXYC 2IH9A 3KM8A 3ZT6A 4MKMA 3MA9H 1BZEA 4QS6A 3S5SA 5A2LH 1L6PA 4BWLC 1GVFA 3B6SA 5JMOC 4PMVA 3EFDL 1NPUA 3I75A 1NMAL 1TZ8A 2YEVB 2ZUMA 3OZKA 5C0AB 3SJVA 2WY3B 1QK2A 2YYTA 2VERA 4ZFOB 1GOXA 5C09E 3DUSA 5L4JA 3I3BA 4NZ8A 2JKXA 4NPJA 2FCBA 2BRQA 3IXTB 5L4MA 3NPVA 2E9BA 1EUTA 32C2A 5EZIH 4FHAA 3AXHA 1WWBX 3T07A 1AQ8A 4JL2A 1V10A 3NPSB 4ZD3H 4LLUA 1QYGH 5DQDH 3L1GA 3L4CA 1LTXA 1IC7H 4LHUD 1AJZA 32C2B 3TBVB 2RBLA 4O51B 5LNSA 1R19A 1O6TA 4O1FA 4GS7B 4JG5A 1YBQA 4MGGA 1IGIH 1EDTA 2ATSA 2Y7EA 4BDVA 4N2GA 3DURB 1PZ1A 4QHUB 4FQHA 4KKCC 5ITFA 4U6HB 2WGXA 3FSUA 3BGMA 1IX2A 4S10A 4ZMTA 5K69A 5DXWA 3RN6A 5IOPA 4JIRA 3RPIB 4PB9H 1XH0A 5BVPH 5FGSA 3L3HA 2PLCA 3GS0A 4G8EB 5ANME 4LMQE 5DLML 2AVFA 5CBEB 3BGMB 5TDNA 1REQA 1FV1A 1R1CA 2WLNA 2ESVD 1FFPA 4UNUA 1ZV5A 5IOPB 2YXOA 3SCQA 3EJSA 1TQBC 3O6MH 1KXTA 3KWUA 3FQYA 4Z78A 2DLGA 4NI6A 4W9KC 5G2WA 3VKAA 2VDQH 3T08A 1JZ7A 1N68A 3K2KA 3S9ZA 3R43A 1HI6B 1NM4A 4UDUB 3LZ3A 5GS2D 1XB6A 1XYZA 1KXTB 1C9DA 4S3KA 5DVLA 4M6MH 4Z78B 3A9BA 2IBGA 3VKKA 4OFYD 1CF8H 3MU7A 2CDGB 4ZEPA 3EJCA 1XFPA 1G5GA 3O3EB 2DAVA 3U46B 4MNMA 1XH3A 3N41F 4KWWA 2ZAGA 1WYJA 2BY1A 5CFAA 3KNBA 4Q8TA 3PXLA 4JTSA 4ZTYA 2PDHA 5D33A 3NDYA 1SUXA 4AIXA 1N6QH 3B1UA 3P5YA 1LWJA 3UXKA 2VDRH 5H91A 4LHQB 3VYOA 1WKYA 3MMUA 1YY8B 3O3AA 3WG6A 2O56A 1UKTA 4PRAA 3IVKA 5CZJA 1SXNA 2UY2A 3ITLA 5F9DC 4DJEA 2INZA 4YCPA 4OLXL 4RMRA 4U1GB 3M88A 4XN2A 1J96A 3QJAA 2A4EA 4PRAB 3R6IA 4B95C 2AEQH 5BMXA 4IIEA 3LKNB 2JEQA 3WO4B 3MRRA 4MJID 3QIWC 3V1HA 3MWCA 4KDWA 3NA8A 1SOSA 2EDYA 4UV4H 3PQYD 2DYPD 1TWZA 3NZHH 3IS0X 1NQKA 2CWNA 3DERA 1IGMH 1QMUA 4ZSUA 4UMGA 1CECA 1R9XA 5MENA 3ZKQD 4AWJC 3MBWB 4DO7A 2WWKO 1ZRQA 2ZRWA 3UPAA 1R46A 2E9GA 4OB5H 3HPFA 3AT0A 1VHPA 2RDWA 4GXVH 1MHPH 3RM4A 3BARA 5GSRB 2X4SB 1XLJA 4YXHH 3HFFA 5MENB 1UOVA 5B1JC 4NZUH 2VH5L 3FOLA 5DRXA 2BSBA 3OBEA 4Z3IA 2YPVH 4MCYB 4XD4A 3V0HA 3OMNB 4GIPD 1QWHA 5DJ0B 3SY6A 2E28A 3HB9A 1RH9A 3V6OA 5HJBA 4YHZH 2J73A 4PGBA 3S6DA 4MJMA 5HA7A 2WUBH 3HTLX 1HL4A 5EBWA 1CGSH 1LYQA 4QLWA 2IGLA 2E6JA 2VC2L 2OXGA 3N34A 2Z91A 2HDJA 2F7OA 4NZDA 3OQEA 3EZ4A 4ODVL 1FO0A 4GUGA 3VXSB 4E41E 3TU9A 2K0RA 3RX9A 3BICA 5KS9A 1X98A 4WK2B 4Q0XL 4PBEA 2WOQA 1G6CA 3R0MA 4TVSa 2XWTB 1PLGH 3UT0A 3D51A 3GNRA 4PTXA 4Q9QH 3KCLA 3HS0A 4YWGL 2R0WL 2J25A 3G6JA 2PPDA 1CE6A 1PPIA 4KTDH 5LKYA 1IFGA 3S1WA 3SQRA 2IADB 4JD4A 1W0VA 5JXED 2B3IA 1FKWA 4DI9A 1AR2A 1KUMA 4AJYV 4HJSA 4QO1B 3DX8A 3NEEA 3F7LA 2HWGA 3EH3B 1W0VB 3DBXB 2WHMA 4AHOA 4OLWL 3QQ3B 1DBBH 4BZ2L 4UFHA 1JULA 2DQJL 4RE4A 4UTAL 4GX8A 3NSFA 2V6HA 4M8UA 4M6QA 3CBJB 4M7LL 3Q8FA 1UT1A 3H1ZA 3M0XA 5EU3B 1C1EL 4KH9A 4JRXE 3TXZA 2FT6A 2WV8A 1FP9A 1OEPA 4Y9GA 4RZBA 2YXXA 2BNRD 4N6QA 2TSYA 4CUCA 3C6LD 3TFKD 1QZNA 4P5MA 2OYMA 2BNQE 3WLKX 1BDYA 4EK7A 3B3BA 1J5TA 4IPNB 4ETQA 1IARB 1A7QL 1UZGA 1KM0A 1BWLA 1BCIA 5I1JH 4KI5F 3UACA 2VLRD 4UWQB 1N0XL 1MY5A 3MLSL 5I1KH 3BE7A 4UTUA 4ANXA 2NQ9A 3HQOA 4K8RC 1BYBA 4R7NA 3V10A 5F2LA 2GBAA 2D2HA 4JTCA 3GTIA 4AH2B 2WXKA 2AK4B 2VSMB 1QHZA 3QZWG 1HIMH 4IGBC 5D04C 3ULUF 2OJZL 3NSJA 3FH8A 4H7VA 4HIEB 1XGPA 3TH4T 4XRCA 1XICA 2VDQB 1UJPA 4TOYL 4AVJA 4XKMA 5IESH 3URNA 4Z7OE 3Q6FA 3SKJL 5GSVA 3W9DA 3F01A 3VG9C 3C2RA 1I1CA 3UCCA 2AXHA 5L8LB 5LIUX 4DZ5A 1V3MA 2Z8VC 1JI1A 3BSZH 3EBIA 3TPUB 1GJPA 5GISL 4A2GA 3FAWA 4XD6A 2IPUG 5GSVB 3LQAC 5KITA 3VUSA 2PF8A 2PP3A 1SJEA 3LPGA 3RKDD 1I3RB 3S36H 1MRFH 1FUNA 2UYLA 5ID1B 2DOCA 5IB5B 3UBXA 1KENL 4DTGH 1A5FH 3EADA 3ARYA 1R3IH 4KNTA 4YVNA 1VCGA 4X5WB 4HIBA 4Z5RA 3UR2A 2ED7A 2VDRB 4J2XA 1SBSH 1UJTA 4HPJA 1QFWL 3MMEA 1CK0L 7TIMA 3DGBA 1T4KA 5LXVA 3PFMA 4NRSA 3RNQA 4OI9A 1A14H 3VI3F 1XR9A 2IXUA 2E8ZA 4YDMA 3QFJD 1PDZA 4H9ZA 1H5BB 5AVWB 5HYIA 4JFDE 1IU1A 2VGBA 4UT9A 1SSDA 3MMEB 4YXKL 3BP7A 4KZEL 1FWEC 4JPSA 3RNQB 2ESVE 4I5XA 4OZOA 3AU1B 2WZHA 3AOFA 1OG6A 4U1KB 3U0PB 3QPEA 3PJSB 5ID0A 3QDJA 4LE8A 1NKGA 3IIZA 1EZSA 5IIEB 4C6NA 2UZYA 3GS7A 3JYBA 3BP7B 2IVFC 4GT7A 2R8SL 1V6YA 1CG9A 4ELMA 1BD0A 4QM1A 1D5MA 3QDJB 1UUSA 1ORSB 1IAOA 3SUUA 2W91A 1ID5I 1H60A 4IIQC 3OVPA 2FHFA 1X39A 4OI7A 3HI5L 4F57L 5F1NA 3E96A 2H8PA 3FSWA 1CG9B 1U8PB 1P4IL 3NBNA 1SYTA 4PLJD 2WLJA 4DAGH 5HYFA 1GTEA 4CDGC 1D5MB 3RM8A 1VADB 3ZZSA 4CNNA 1IAOB 1RHHA 4O0QA 4F9PA 4IF2A 1CLKA 2XWBA 1EBHA 5IM7A 4XBGA 2CMRH 3E12A 2E9WA 4XTDA 1Q72L 5D2LE 1J05B 3KLKA 1L6XA 2YD3A 2MKWA 2OO0A 3AAZA 1S7SA 3MV8A 4OZIF 2WVVA 1TPWA 2XN1A 5LHFA 3Q0HA 1WUZA 2VB5A 2PI6A 3LH9A 4XZNX 2CCRA 2WP3O 5I1CH 4XBMA 4HKJA 3C61A 1KLYA 2ZG3A 4J6RH 1CXKA 5I6KA 1B6UA 2M83A 1RZQA 3ARDD 3PZNA 5DJAA 5ABFA 5D4IA 4UNTA 3MRQA 4MQTB 3PPGA 4BF5A 2O9RA 4HKJB 4KF1A 4MJIE 3WFDL 1IEXA 1LO3H 2AEWA 4M1CD 5KZMA 5DJAB 2WUCL 3GKAA 1HHJA 4LSRH 3PQYE 3IANA 3AABA 3BLFA 1UJQA 1YMHB 4XPHL 4C6CA 2B81A 3FTZA 2ZUNA 3S8WA 1NCBH 3O2DL 2IH3A 3ASWA 4LMQI 3TWCL 2EIJB 4KETA 4GRWE 2WSQA 1XF5B 2LLEA 2EIZA 1YAZA 5DA0B 1ZEAL 1A5OC 1N7KA 3KPSD 1UQSA 4Q8QA 4PFEA 5C0BA 1X7FA 1CICD 4KUZL 3Q2DA 2DMBA 1NJ9A 4ZODA 3FTWA 4ALAH 4JN2A 5I1HL 4PN2A 4KK6C 2EIZB 4HHAB 1BVWA 3SBQA 3DIPA 4LU5H 1UQSB 2D31A 3JVFC 2F19H 5JLZB 3UZZA 5F7KC 4I4WB 2F8XC 3LSBA 3SDXE 2PPCA 3CNYA 1WKEA 4N9CA 1JRHL 4FFWD 4PP1C 3CEPA 3LB6D 1X7IA 3K5RA 5G2HA 1RULH 1BFSA 1PG7H 1R5VB 4WGXA 5GJSL 1XSOA 4XNUH 1DVXA 2FHCA 3SCMD 2WJ7A 3QXWA 3KL0A 1B4RA 4Y2NA 3HNSL 4S3BA 3X1BA 3CHRA 5MEPB 4L4OA 1M42A 3M0ZA 4Q97A 3D5OF 3NM3A 2BVTA 5C2UB 5H2ZA 2E3ZA 4A63A 3TTSA 4A7UA 1N2VA 3PU7A 3NZGA 3BVJA 4UT6H 1K5NB 4MB1A 5JXAL 2NQ5A 5E8PA 1FIEA 4ZOEA 1W37A 4OW6A 1H6UA 4OCWH 1JPSH 1NBZA 3PHSA 1XLGA 2QR0A 1YG9A 1BOYA 3REWA 3K5SA 2HRGA 1XLBA 5KZCD 1TQSA 3I9GH 4PUBH 2XICA 3E74A 3AS0A 1L6SA 1A7OL 3SY0A 1R17A 2YEZA 5ADPH 5CPLA 1BM7A 3ANUA 4WO0A 2BNRE 3ESOA 3QO0A 3SDDD 3IJYB 4X5LA 4FQ1L 3NOIA 5IW6B 2J7DA 5CSSA 1QBMH 2Y2YA 3EDFA 5J1SC 4B60A 2R1PA 2VLRE 4NZ1A 2P43B 5J13B 3QO0B 4RGOL 5EEUA 2GIXA 3SGDH 1K3UA 1UM5L 3HS9A 3U6RA 4LX4A 4HUWA 1VS1A 4NKDA 4C4BA 1U5VA 1BJ8A 1FGVH 4JTUA 4EWND 1FYTD 3VAVA 4LRNL 4N2OA 3EOTL 2XINA 5EUOB 3V0WH 2XY2A 2APTA 4W93A 3H24A 4HCDA 3QNZB 2NQZA 4Y16C 1YEIH 4WO4A 5I8EA 4Q6YA 1JGIA 4PW4A 3OVQA 4NQCA 4P2QB 2FZDA 1J1PL 5EC1A 4C6DA 2VDOL 1DQQA 4B5EA 4H8QA 4I0PB 4BK9A 1EWHA 1CGUA 4P5TC 5DZNA 4MVAA 3AYRA 2VRQA 2VC5A 3VOIA 2D20A 4OZGB 1DQQB 1J9QA 4YR6B 1IKFH 4HX1B 1FVEA 4HWUA 3WMPA 3CFQA 4MB3A 4OGXL 3MCNA 4YEEA 2E7CA 3GBDA 3UJJH 4FJYA 2Q09A 1UYQA 5LN4A 3V5HA 1A6VH 3R0KA 3LN4A 4H44C 5D9PA 4A7GA 2INFA 3CSYA 4KESA 2DBLH 2J12B 4QNEA 4A3RA 3QHMA 4KKLD 3D6GA 3KDNA 4LS0A 2A6JB 5DZ9A 3HQ1A 2FVNA 1HCVA 3EJZD 4MAVA 3G04B 4E9LA 3L7RA 2NY1C 1K6QL 5HHNA 3SGJA 4G9FE 3N2JA 2NUYA 5FGCB 1KPUB 5EZOL 1TVHA 5CEXA 4FJZA 3O16A 3QIUA 3VTTA 3SDAB 5CMAA 1YXCA 3GU2A 1CFTB 2CBPA 4UMSA 3W5NA 3DVNB 3K6OA 3VFSB 3FSAA 5H6HA 5HHNB 2F5BH 4HIPA 4FNLL 2VDNL 4YBLC 4ZAKC 1AQ0A 1ZGLB 4OBTA 1UW9A 4FULA 1MOEA 2HK1A 3VXRA 1RI8A 4XVUC 1MFAL 4XAYA 5CMAB 1XCWA 3DKLA 5K9JH 1E4WL 4KJPC 5K93A 4PJFA 3OD3A 1NSNH 5LQBL 2C3ZA 5DD1H 3AGWA 4DQAA 2ZOLA 2QVMA 1XINA 1O7DE 4LPTA 3IKCB 4TVDA 4ZX3A 3QPYA 4UT7H 4A7QA 2YAOA 3MO1A 2VN6A 1WDAA 3LMJH 1TJPA 3AMGA 4MMZA 4UZGA 4E4PA 4I77H 5HJ3A 3MBED 1XGTA 4BUGA 3VFPA 1RZGA 3S35X 3BZEB 3BOLA 1T1XA 1AGCA 3EYSH 2DDQL 3HFMH 4LUSB 1DE5A 3JZEA 3SE4C 4F5CE 2NXIA 4IOTA 1JYNA 4MMZB 5E6ZA 3LN5A 4PCPA 4LBAA 3W5MA 5DWUL 1TFPA 1EA0A 2QLVB 2RHGA 3VFPB 1HSAA 3IGAB 4KRLB 4RDQF 5ETUA 2R2EA 1EGJL 1ISYA 4LSUL 1ZBWA 4LCCC 1GG1A 4EDWL 3LN5B 4N8UA 4AOFA 4C1NB 2CDFA 5CGYC 5J8LA 4G8GB 2EDEA 1DLHB 1JDFA 3LNGA 1KBWA 1U8MA 5B4MD 1FL6A 2V3DA 4FD0A 1O4UA 5DO2D 1G9NL 4L9ZA 4FZEH 1G69A 5GPRA 3WNJA 1AG1O 2AQOA 4BFRA 3UZVB 3Q05A 1F2QA 4WWKC 4RW3A 3RF9A 1FL6B 4NERA 1UZ4A 1HXYA 2AMUA 3QHFH 4ZOBA 1NOFA 4MRCA 3LX9A 4KI5D 4URIA 2R8WA 2H8ZA 3KPSE 2C8NA 3OHXA 4NU7A 5L2JB 1TZAA 1RPXA 2F5AL 1FNEA 3SM0A 3SRKA 3IIVA 2UZ9A 5JZ7D 1E0WA 4OIBA 2X10A 2AJYH 5GS0C 4NXKA 4OFVA 3ULUD 2A38A 4OIIL 3OHXB 4UC5A 4ABQA 1NLBH 4OD1H 4GXMA 3MGAA 3M16A 2AC0A 3PZQA 1I31A 3AROA 1M03A 4ZTEA 2IMMA 4A39A 1RA0A 3LNFA 3O0RH 5FYKD 1SVDA 1KDIA 2P26A 2QFRA 1Z7AA 2X8RA 2EG6A 1AZVA 3ZKNC 2YXWA 1P6AB 4ELKA 5F0LB 3T0AA 2G9HB 2W38A 1YEYA 2YD4A 3VOCA 2BRRH 4H26B 4PRHA 3N9GL 4M61B 1XFBA 4IRZL 1CW2A 2ADGA 3KXFA 3BDXA 3OAUH 2HRLA 3CZSA 3D25A 4AUBA 1JCKA 5GRUH 1A5LC 3DESA 3S37X 3NZRA 1LP6A 5C0NC 4PC8A 4OV5B 4P7NA 2FJFA 1GH7A 5IP4A 4PRHB 2YGQA 5I1EH 2OKMA 3V0VB 3EUUA 1N6VA 3SJNA 3KXFB 3RCMA 2VP8A 3D25B 1WB0A 3U6XA 4D0BB 4FYRA 2VR7A 2ZYIA 5ILTL 4V11A 5JA9A 3INUL 4FPSA 3G5WA 4QIUA 4NN7C 3WOVA 3R06A 4P2YA 2VC6A 1RIUH 1CE1L 2CO1A 2JJTC 4O10A 3VGAC 3FCUB 4TQEH 3WL1A 3TJIA 2WZIA 1R3TA 1HH6A 2X4QB 3HHSB 2FECL 4MAZA 4RX0A 3R06B 5ALBH 2BIQA 3IPEA 4GEIA 3MRNB 3ZDYB 3QXVA 1I7UB 4RDQG 5F7HA 3FC8A 2GSGA 3VW3L 2B0MA 5E8NB 2E1DA 4QISA 5FF2A 3F7PC 3TT1L 4Q4MA 4NJJA 2CO3A 1KELH 4OGYL 3BW3A 4AGOA 2E7BA 3CDGA 4P9MH 2VDPB 4WKXA 3WI9A 3VB8A 4UIMB 1EX1A 4H88L 3N19B 1RK5A 4HS8H 4Q4PA 4XPAH 3TZVA 3KH3A 4ZK8A 1VPXA 3ATBA 2XQBH 3PL6D 2VC9A 3L3DA 5GGQL 3GBNH 1OD8A 2L3BA 3C8KA 4YSPA 2YMXL 1P2CB 4MDJA 3RRAA 1WIUA 2BLFA 4I1PA 3LMYA 3LOTA 3CIQA 4HS6A 5EEXA 4GBUA 4HIJB 2AAVA 2GJPA 1K4CB 3DIVA 1JZEA 3HE6D 1C29A 2NQCA 5JUEH 2W0PA 1KCZA 2XSXA 1FBIL 4YK4C 2VSCA 4TM9A 4MQ7A 4PJ9B 1J6OA 4KRPC 2ZXEB 1RSFA 4LCIH 3QA3B 1SW0A 2H3NA 1GA2A 5D1QE 2ZZ6A 4N28A 4GW5B 5EULV 3MODL 2FX7H 3PC0A 4W6XB 2PYED 1P4LB 3O2WH 2G37A 5IBXA 3X3GH 1ZLSL 2Q7AA 4B96A 3W88A 5IKCB 4Z7VA 1WWAX 2R2BB 4OCSH 3VIJA 2EDWA 4IK6A 1T96A 3PZMA 1IC4H 1UD3A 4NWTH 4H3DA 2FR4A 3OG3A 4HLZG 4N1HB 3PZUA 4M7ZB 2OPCA 3L4YA 2OG9A 3BC9A 5I73C 2OMNA 4XTRC 4WUUE 2UY4A 2OTPA 3KYAA 1KGYE 2G5BA 3BTNA 4NJ9L 4XE0A 3GX9A 1JZ6A 2A9NL 2FR4B 5EA0L 4LNCA 3RHWF 3BPOC 4NC1C 4W4QA 1OYBA 3V2AR 4O28A 4ONFH 1CVRA 1SOQA 1CFQA 3X1EA 4RRPA 3WDHA 1JTTA 2ATPA 1RMFH 4O8AA 3HAEA 4GAJH 3GRIA 3U0TA 3T0DA 4X4MA 1C5DA 4JZJA 1C9WA 1Q66A 3VVVA 1N5AA 1FHVA 1FWWA 3STZA 1X1OA 3QVAA 2DYRB 4HQQL 3FUDA 1A0QH 4FXGA 4TSBH 5HHOA 2EDBA 1TJHL 3U0TB 1ZGDA 4JZJB 1E4KC 3EYFB 1BZQK 4NQDA 1KG0B 3T4YB 3I85A 1GNXA 4CNTA 2EO1A 1Z3GL 3IGUA 4JS3A 5JHLL 1MJUL 3S34L 4HUVA 1W2KT 5A6BA 3R10A 4ODSH 4KCUA 3L9BA 2HN7A 2QQKL 5D7SH 2IPGA 1MRDL 4XNDA 3CXDH 2J21A 3R58A 4M1GH 5A3HA 4HLEA 2YZ8A 2QHRH 4HUVB 2ADYA 4V15A 2EICA 2UXVA 4PVMA 5CJBA 4YDVA 3TEYA 4TQ8A 5FC9A 4NAMA 1VBRA 1U0QA 4YLQT 3S3BB 3GKFA 1IXPA 3AY4C 4TLKA 1H61A 2VKXA 5H37A 4RMVA 4YDVB 3Q06A 4J5VA 1RU9L 4ML9A 2K7QA 1SU5A 4WFHD 1OCOB 5CEWA 4Z7WA 4AIOA 1XGUA 2X9YA 2W79A 3RPBA 1FWJC 4C7FA 1QA9B 3G1YA 1QR1A 4MNGE 1HZKA 4XPFL 3GSWB 2WQSA 1MVYA 4S1DD 4L8BA 4JCWA 2OWWA 4OCYH 1VZIA 1LYXA 5FYKU 4OV6F 4JKWA 3A22A 1FE8H 3SSZA 3DDGA 2WHJA 3HE7D 1AKJB 3T4AB 1Q1JL 5D4YA 4L61A 3WFHB 4L8BB 1EO8H 4N2DA 4JNXA 1CXFA 4XP1L 4A8IA 3DHUA 2F53B 4X9IA 1GR7A 1D3CA 4LLMA 2AGJL 3EOBB 3QJSB 4Z2KA 1AXSA 2BNUB 2O9TA 4KI5E 1GHRA 1AC6A 1JRBA 3CSBA 4R4BA 4G7YL 4LDLB 3UWUA 1HVXA 3CX5K 1Q6QA 2HSAA 1NBCA 3JZYA 1FGNH 4O17A 5JW3H 3RAOA 5DJDA 5U7SA 4FLSA 4WVRA 4I9JA 3T2NH 2E9MA 1SZRA 5EL1A 1EERB 3BAEH 4B9IA 3ULUE 2DW6A 4R4BB 3N06B 1N64L 1E0UA 3VU2A 2WO5A 3NIDF 5F7UA 1Q4NX 5EPMB 1Y65A 3DRTA 2NY2D 4D72A 4RDBA 3X11B 4AD4A 1XZ0A 3HKFA 4HTYA 1X8FA 4LFYA 3EO0B 4CNIA 1W17A 3EW3B 3OB0H 1SJCA 5DJCA 4X4YB 3ASOB 1XBDA 1E6SM 5I00A 3T71A 1RD5A 2HV5A 4I3SL 1U8OB 4RGND 4JFFE 5I19H 2E46A 5JIPA 3TYZA 2A3LA 3BGFB 4I88A 3GQFA 4CNIB 3TROA 1AFVH 5DJCB 3VI4F 5GZNA 3RI5F 4HMEA 1ZVHA 1ZUAX 1KTBA 2N7AA 1BEXA 4TRPL 3DV4A 3T78A 5LYRA 1T22B 4P3WA 2OXNA 2FDMA 3GZKA 2W94A 5KTEL 4ZUWB 2GUYA 4L9XA 4MQXC 1PTDA 4Y7OC 5IFJA 2HQAA 3LLDA 1CZ8H 2OMYA 1DORA 1KGJA 3SCPA 4DK6A 5D96C 2B5IC 2NX5A 3VI3E 4ZFOL 1QOXA 2MANA 3ALXA 3LD8B 3FU7B 4U3SA 2Y7OA 2BIOA 4YS4A 4Q58C 1PL9A 2A9AA 3UG8A 4ZNEE 5FM5O 4TV6A 1DANT 1ZT7A 4K9EH 4DJFC 3L65A 2HRHA 1OAQL 3NTCL 1BX2A 3WJMA 2MRYA 3CE1A 1PJ9A 2YKLH 3EX4A 4OY9A 5C08A 1EEQA 4XKYB 3TR2A 4DPPA 1ITUA 4GSXA 5BS0D 3HMXL 3L3JB 2IFFL 3WIFA 1PDYA 3TO4C 1P53A 3RZCC 1H8OA 3ZS4A 3BH4A 1XF3A 1JQVA 2A99A 4NOBA 3PAUA 3PWUB 3Q2VA 3RUGB 1O5QA 4QXIA 3U6XS 3GTHA 1LORA 4U1SB 2QUUA 5HSFA 4G6AC 1XF3B 2QPSA 1IGWA 2DWYA 2DIBA 3TFBA 2G0WA 1NVMA 2IQTA 1F8MA 1OK0A 3E5BA 2NRDA 1T21A 3K4AA 2R24A 4CILA 3MHFA 1J18A 1J4EA 3Q37A 3B2VH 1E5YA 3ARGB 3JWDH 1T21B 2UUDK 2ZUXA 4YHNB 2F9BT 4HFWB 5IR1A 2CHWA 4HUXA 5BZDA 1GJUA 3PWPA 4KROB 1K9DA 1K3IA 3IJ7A 5IJKA 1L0QA 3VNLA 1NCAH 3MNMA 3AJ7A 2ANUA 2NW2B 3ATEA 3U9UA 1EHKB 2PYEE 3B7TA 2CO7B 1EXHA 4HUXB 3D46A 2A1WL 2XJ7A 3BJSA 2XWJB 5BZDB 1BTMA 4MJHA 3CC5B 5C92A 2LU5A 1WBJA 4ISVA 1JK8A 3LRKA 4W9HC 1SZEA 4GGBA 2XGBA 4GY0A 3VFRA 3U9UB 3P0YH 4EI5C 4BQ6A 1JXFA 4UFMA 2VIRB 2XH7A 3VE9A 2LQRA 3RPTA 5SWZA 5IUSA 3RX5A 1KFEA 4HJ0C 3RILA 3PZIA 1Q9KB 4KKZA 2Y88A 4K94L 3GF8A 4U7KA 3X1GA 1A5SA 1JSYA 4U0QB 1VDGA 2Y7NA 5CZVL 2OJPA 4GWEA 1FLTX 4DF2A 2OV0A 1XYAA 1FNAA 3BMWA 2E76C 5FAGA 4QGYA 3PIQA 5D7KD 2Y9RT 2ZYHA 4U1HA 2K9UA 4R9HA 2J8HA 1W1PA 3OB8A 3OA3A 3OG4B 2DD8H 5HD8C 4GG8A 3GEFA 4F7EA 1W8EA 5AKSA 4QCIA 1P7BA 2RJMA 4I7ZC 1E42A 2LU4A 3OKKA 1NPJA 1EXUA 1JZFA 1YO4A 4V28A 2ORBH 5A6AA 2GYSA 3GRWA 4LIQL 1E28B 1BG4A 3GFUA 4B3LA 4QCIB 1NUGA 1EJSC 1MPAH 4DAFA 3CHQA 5L88L 4LBRA 2R0ZH 2X7VA 1RJRA 1QUNA 3BPLC 3L1EA 4R26L 4PJAB 1Q7ZA 5BRPA 2ZZ7A 2D7QA 3ML8A 3IF1B 3O9WC 4OBRA 2HMIC 1IB5A 1LTDA 1OSZB 1FH8A 2HJFA 3DJTA 3WQWA 1DN2A 2YOAA 3OR6B 1MW2A 5EO9B 2C3VA 1IEWA 4PJGF 1GPWA 1MZZA 3TEXA 1T2XA 1EGVA 1FO0H 2ZCGA 3ULVC 3IEAA 43C9A 5TQ2H 1RJYA 3ZE0F 2KZWA 5K9CA 3ZMRA 3PF3A 4WFHE 3IE4A 3B6SB 1Y1UA 4I0CC 2C3VB 1IGJA 5M2FX 4AHQA 5SWQA 3I75B 1Q3NA 1XYBA 3QORA 4IP5A 1PAZA 2HBVA 1EJOL 4JFPA 4J8QA 1X5HA 3D3FA 5J6SA 3SJVB 1Z1WA 2EXYD 3MA9L 4HUNB 1VKXA 2OZ0A 4OCXL 1UB5A 1BZ8A 2WGNB 4TVPH 3L17A 2AL1A 3H70A 3DUSB 2X0YA 3WN6A 1RAMA 1ONEA 3WD5L 1BJ1H 1D6EA 4H2HA 3D2UA 3LZNA 1J8HA 3HC4H 4NHCL 1AD4A 3QUXC 1FLRH 3UYRH 3GXDA 4LLUB 1V08A 3EMZA 2Y1VA 1JDEA 1GYLA 4PSPA 1AH1A 3WNLA 3TSMA 3D2UB 3POHA 3ZHLA 4DP9X 1G7VA 2EQDA 1YBQB 1GOKA 4JRYA 4BDVB 4ZQKA 3S1UA 1VJSA 5E08H 1DJQA 4Z7UF 2F7RA 2DQHH 2X12A 5E1AA 4A66A 4FQHB 4YBQC 5ITFB 4ODUA 2PDXA 2OCZA 4K37A 1UWXK 5DQDL 3VKBA 2KS0A 4GFXA 4I0KA 4ACTA 2OA9A 3QZMA 1A2YA 3CSTA 1O5RA 2VN7A 1GW1A 4QYAA 3L3HB 3IRSA 4LP8A 3P4MA 3HGSA 3DU0A 5TDNB 1REQB 1S5MA 1FV1B 3T0CA 3O05A 1RUAH 1FFPB 4ZUVA 5D70L 1ZANL 4O2EA 4JNZA 1A2YB 3QIBA 4YUEL 1YX1A 4MXVF 4YE4H 4PB9L 4MAYC 1AA1B 3LYRA 3B06A 2FZ9A 4X6DF 3H2OA 2P7TA 3H8AA 1XI3A 3ZTCC 2JKSA 1J9YA 3LHWA 4Z7AA 5CUSH 1W0WA 4WGVB 2PD5A 3I68A 4EP8C 3BVTA 2X53A 3GO1H 3ARRA 4L29A 2R1MA 5LNUA 4XC3H 2VDQL 1XH3B 1ZGLP 2P7TB 3IMRA 2X40A 4Y4FA 4NFDA 2FTAA 3MRDA 3PM6A 3KNBB 1R86A 4PMDA 1CGYA 2EDMA 1ZMYA 4L29B 1CF8L 1XXXA 1A53A 3WS6C 2E40A 1E9PA 2L8AA 1AZ1A 4L6OA 4AD5A 3BUPA 2JF7A 3HG2A 3HPLA 1UQZA 5BS0E 3O3AB 3RLSA 1RFDH 3IVKB 2F7IA 5EDXA 2ESCA 3ZIMA 1YNKH 4Q8UA 2ZP8A 5HI4C 1J1XH 3M0LA 4BQ2A 3HPLB 3CVIL 3G9AB 1ETJA 4P9HH 4RE3A 5DD0L 4UT9H 1N6QL 3BD4A 1LG2A 2QELA 3W2MA 4R7DA 1RIVH 3WUWG 3UJSA 4Z7NF 1IKOP 3TN3A 3MRRB 1QWUA 2JKLA 4MS6A 2WYTA 2WXPA 4RLIA 2EABA 4U31A 4M93C 1AIZA 3W83A 4HZ6A 2FQGA 4JIQA 4IIDA 3ZUCA 3DX7A 1M3UA 4M51A 4FFZH 3JTTA 2VI0A 5M17A 2ICSA 3RVVD 3OQ8A 5C0QA 2ICEA 4WY0F 5IB1A 4UTJA 3I7QA 1ZPTA 3PGFL 4FJ6A 1O7SA 2IMNA 3G5XA 3EEZA 1VEPA 3FOLB 4TTUA 5CPSA 5DRXB 4UV4L 2JE8A 3NZHL 5F1OB 3CBKB 3WKML 1G4MA 1AODA 2C34A 2VNCA 4DUOA 4E5XG 3R0DA 2ICEB 5E2UH 1WA3A 3RVWD 1XH1A 2IUZA 4PGBB 4LRIA 5B8CC 3GGWA 1MHPL 5T1JA 1PIGA 3RVUD 5EBWB 1C08A 3PNWA 3W23A 3CYJA 3X1FA 5J11C 4DZ8A 1LOLA 4NZUL 4CNSA 3P3BA 2Y06H 2QR6A 2OXGB 2YPVL 2Z91B 5KVFE 4G70B 4PJIA 1YPZA 3N2TA 5C07A 1FO0B 5F89A 5GRJL 2AF2A 4JY4A 5KS9B 1CGSL 4KT2A 3EOUA 4ZPTA 2J7LA 1SVZA 5D7IF 5FEPA 2E7HA 3RL1A 1KKOA 1F02I 3DI2B 3OXRA 4X83A 4DJDA 1PVNA 1IAIM 3ZYZA 4TS6A 5D7KE 3HS0B 3PAZA 3OV6A 3G6JB 1CE6B 4S1QL 2VW6A 4F9LC 3LCGA 4Y4HC 4X3ZA 3W56A 3FQXA 3AYTA 3VNJA 4G1NA 2OZNA 1DUZA 3RL1B 3DX8B 1XLDA 4MFDA 1PLGL 4ZOCA 4P2RD 2IBZY 5E7BA 4Q9QL 2N59A 1RVKA 3MBDA 3C60D 2IGFH 1T20A 4NZ5A 1CTOA 4L4LA 3CUGA 2EH8H 4EOUA 1FFOA 3IMTA 5CR8A 3WY2A 4YDNA 2JJSA 3VSUA 3UXLA 1DBBL 2D2OA 2I07A 4LB8A 2GPTA 4GQ9H 4KNUA 2ZA1A 3MRBA 1QHOA 3WD2A 4P5MB 3ZQ9A 1NPNA 4ETQB 3RP1A 2I1OA 4XB7A 3T6CA 4IRJC 4QHKJ 2I07B 4Z8FH 3KDPB 4YSSA 3DFYA 4MD5A 5J5RA 1EOMA 2W5FA 4R7NB 5CJXC 4GJTB 3QCTL 4J3SA 3CHVA 4DWSC 2PN5A 4NC0B 4YFEA 3K71A 1SY6A 3OB0K 3GMNA 4NZFA 5DFAA 4WHBA 1YEWA 1J8VA 3AXXA 2FUTA 2RMNA 4WSJA 4HZAA 1XGPB 2P50A 5D30A 4LSSH 5I1JL 4ZOAA 4ZSOE 3QCUH 4XRCB 2PP7A 4G6FB 3JV6A 1E5BA 1JPMA 2ZIDA 4FNUA 5I1KL 3TN5A 3O6KH 3R11A 2YS4A 1NCOA 2VLKD 1OCNA 3Q6FB 4N0UE 4XXWA 2COVD 3W9DB 1HIML 4RNJA 3LRSA 3BD5A 2ATKA 4J3VA 3JV6B 3H9YA 4AW4A 2GVEA 4LJ3A 2J7BA 4FABL 3DVIA 3WUFA 3ZVIA 4JQXA 4RAHA 2V17L 2XIIA 1PLBA 5IESL 3H22A 1S5TA 1LP9A 2CUIA 4BRVA 4MMXC 1EAJA 1SJEB 5DDHA 3CMJA 2UYLB 4TSAH 4JYEA 2YA0A 5ACMA 3UBXB 5JVLA 4PV1C 4I6KA 1TJRA 1R24A 4GRMA 4Z5RB 1LQ2A 1E4HA 4KXCA 1R9ZA 1OARL 3HTWA 3SE9H 1ZD6A 3CAKA 2EPKX 1TKWA 1T4KB 3TBCA 5KWYC 4IKJA 2XYLA 3FU3A 2MFNA 1XR9B 2C3WA 3S36L 3NQVA 5I79A 3SW6A 3CWHA 1MRFL 2NLYA 5CEZL 1DOSA 4DTGL 1TPFA 3SBWA 1K03A 3P2BA 4LQ1A 1TKWB 1SBSL 4JM2F 3T0VA 2VO8A 5G1TA 2R1LA 4MADA 4AXKA 3DIDA 5IQ9A 4O02L 3H6AA 2XFWA 2EIDA 5ID0B 1G4PA 2GZXA 1A14L 3B9KC 3SCUA 1E4IA 2GQHA 4R0LC 4IRSC 2UZYB 5KAQF 3QC3A 4Y5VA 3EOSA 1W3LA 2NY4D 4NN5C 3WO3B 4GKZA 4ELMB 4HJWA 5I6PA 5D1XC 2VEGA 5F1NB 2H8PB 3ZDZF 1SJAA 4GKZB 3GC4A 4JIIX 5DVOA 4ZMXA 3N3TA 4NRXA 3N3EA 2HISA 2A7RA 3GDTA 1RHHB 2JI1A 4ONGH 2Z1VA 2ZYRA 1OB0A 3L67A 2XWBB 2CLOA 4RKAA 3TZFA 5IM7B 4XBGB 3AG3B 2HP4A 2R1XA 2J20A 5J8OA 1JBJA 2MOGA 3TAKA 4FX6M 1PX8A 1U4FA 3AAZB 1SFSA 4RZKA 4HBCL 1S7SB 2QDEA 4DAGL 3MV8B 1HUVA 4HMNA 3WO8A 4H7ZA 2NXZD 3HKZA 1XTMA 4HHMA 2WVVB 2CLRA 5H94A 4XR8C 3ARXA 4HIXH 5D03A 1VFMA 3MRIA 2W27A 1XXFC 1D8WA 3VD9A 2Z25A 1HKVA 1QR4A 2W67A 4CVXA 3Q4DA 2XIMA 1AZ2A 4GACA 4QITA 5ABFB 1GXEA 1S5WA 3R18A 3MRQB 2L04A 1NCUA 1EBPA 1Q13A 1DBML 1KLUA 1RHCA 5CH9A 3UROR 3QZEA 4ERAA 5DZAA 3L3KA 3EWZA 2FB4H 4J6RL 3U9WA 5CJQL 1HHJB 3LKSA 2PPGA 1WYIA 4OM1L 4QNPF 3L0KA 1T03H 3TXVA 4HAGA 1IZKA 4TNWF 2DVTA 1RLDA 1P6FA