5CXPA

X-ray crystallographic protein structure of the glycoside hydrolase family 30 subfamily 8 xylanase, xyn30a, from clostridium acetobutylicum
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
387
structure length
387
Chain Sequence
SNDATINVAAKHQTIRGFGASSAWCGALSDTCMDTLYKNAGLDILRVRIAPNEGWNRGDYRAWADELSNAKKVRARGGIVFATPWTPPASMKTNNTTTGANKGSLKPSSYAAYAAYLKTFVKYMSDNGAPLYALSLQNEPDWAPDYDACTWTAQQFHDFLKQYGASLSSTIKIIMPESLGFNPAMSDPTLNDPTTAQYVSIIGGHLYGSPIRDYPLARNKGKDIWMTEHYLEGNDPGTCVKLAKEIHDCMTIGNMNAYVYWWISGDQNGLYNTRTNETYKKTYVMGQFSKFIGNGYSRVDATNSPQSNVYVSAYTGNNKVVIVAINQGTYPVNQSFNVQNSTVSNVSSWVSSGTLNMAKTNSNISAANGRFNASLPAQSVTTFVADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible xylan degradation enzyme (Glycosyl hydrolase family
publication title Crystal structure of a GH30 xylanase
rcsb
source organism Clostridium acetobutylicum (strain atcc 824 / dsm 792 / jcm 1419 / lmg 5710 / vk
molecule tags Hydrolase
total genus 143
structure length 387
sequence length 387
ec nomenclature
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02055 Glyco_hydro_30 Glycosyl hydrolase family 30 TIM-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5cxpA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cxpA02
4CGTA 1E6XM 5AYIA 3MI6A 4AEFA 1ITCA 4Q22A 3FHQA 3PZVA 5BROA 2DH3A 1VAHA 4ATDA 2NW0A 3ALFA 4BA0A 5E0CA 5HBFA 2J75A 4QDMA 1GQLA 4HZ6A 4GI8A 1PPIA 1XH1A 2JALA 2WLYA 1W9XA 4QCFA 3AS3A 4IPNB 3WNKA 3ZIZA 2Z1SA 1KTCA 1PZ3A 2YKKA 4BZYA 1QBBA 5CLWA 1DHKA 1EDQA 1O7DC 4MNJA 3MUZ1 3AMCA 2G3NA 1H5VA 3ARSA 5ABFB 1TMQA 5BXSA 3UR7A 5JIWA 2DT0A 3CZGA 3L4TA 2EABA 3AS1A 3SIMA 1HVQA 5C71A 5FOOA 5GNXA 3EYPA 4JZ5A 1D2KA 5D9MA 2XIIA 4CVUA 2J25A 5E09A 2PWFA 5CZKA 1E4NA 4QFUA 4M82A 1K6AA 1B9ZA 5A8NA 4QCEA 3GBDA 4J3TA 2CBUA 3BXWA 4QAWA 4A3YA 2Z1KA 4IISA 2YLLA 4ZE5A 3W6LA 3AHTA 2OLHA 3WD2A 4AZ6A 4UOQA 2PC8A 1NQ6A 1QWUA 1VB9A 4HOWA 1R7OA 1IT0A 2V5CA 3N17A 1QNPA 2FYVA 2W63A 3ARQA 1NM9A 1EQCA 1GJWA 1E4IA 3EDEA 1EH9A 3ZO9A 1E71M 1QW8A 3A4XA 3WMSA 2X09A 2BHZA 3BC9A 4MAZA 3O6AA 1HKIA 2WANA 2ZUTA 2VX4A 3WIJA 1XSIA 2DIEA 3L2LA 3W28A 4EE9A 4OUEA 1HT6A 3VDHA 1XSKA 2AAAA 1J9YA 2EQDA 2PWDA 1MQQA 2V38A 3WDJA 3D4ZA 1WZKA 4H2CA 1OD0A 4PTVA 1V02A 2XHYA 3NCOA 4D1JA 1UA7A 4UFIA 5LA1A 3H53A 3AMDA 1Y7VA 3DDGA 1LF1A 3OZPA 2WNWA 3WD0A 2BXYA 2ZE0A 3DX2A 2VOTA 1N82A 2FE0A 2CEQA 1UH4A 1C8XA 4EKJA 2NSXA 1W1PA 5A6BA 5DT5A 3K4AA 1K9EA 3VVGA 3GNRA 1OIFA 4JFTA 1MQPA 2J7FA 2GJXA 3BLPX 3BMWA 1PIGA 3VTRA 3QOKA 2EADA 4J3UA 1B31A 1CYGA 5A8OA 1WAWA 3NDYA 3VX0A 4OBRA 2VMFA 4AMWA 2OWXA 2DPEA 1EO5A 1CEOA 2WMIA 3AZSA 3W4RA 2W91A 5BXPA 1RP8A 4AZGA 3FHAA 5CQ1A 4W8LA 2VZSA 1G94A 4AZIA 3CMJA 2V3DA 4CKQA 1W1VA 4D6HA 5BXRA 1C90A 5C70A 3UESA 1CGTA 2ZX7A 3RDKA 1CXLA 3UCQA 1NWTA 4P8VA 5CPQA 5HPCA 1BVNP 4A3HA 4LPCA 1HF6A 1KXVA 3AXXA 4JKMA 3S2CA 3TTSA 2YBTA 4V2XA 4CU6A 4OIFA 1QI5A 1BYDA 3FY1A 3VGHA 1H41A 1MW0A 2EACA 2EEXA 3IJ9A 2WVTA 4N0RA 3SUSA 7A3HA 2ZWZA 1JXKA 3HN3A 3GM8A 3IAPA 1M04A 1D3CA 2ZXDA 4Z2KA 1ISWA 1XH2A 1ZBKA 1W9VA 2VUYA 1EOMA 1H0GA 1QBAA 1QNRA 3CUIA 5DO8A 3A6OA 2W92A 1MXGA 4CVWA 1HP4A 3NUKA 3ZJ8A 2D24A 1JZ3A 2XSAA 1BYCA 3WBAA 1G01A 4TX6A 1J0KA 4D6CA 2OSYA 2WVSA 3ZJKA 1WO2A 2EPKX 3AMLA 3WQ6A 2WMFA 1VFFA 3TTYA 1VFUA 2XUCA 3AS2A 4WKAA 5I79A 2W67A 3AHYA 4GQRA 4F9DA 1XCXA 4NI3A 2BHUA 3VSUA 1JI2A 1E5NA 2X0HA 5A3HA 1H49A 3SCVA 5FL0A 2WMHA 3T0AA 1W9PA 2C8NA 4CU7A 3SCUA 4MDPA 5TD4A 2O9PA 4M29A 2D2OA 3WDRA 2D73A 1T0OA 4WJXA 2DSKA 1MFVA 1E70M 2XN1A 4LGXA 4XUYA 2YJQA 2WCGA 2JFEX 1ZJBA 3OLGA 3ALGA 1I1XA 3QGVA 4CD8A 4GQQA 3WY3A 3ZR6A 1EOKA 2ZWYA 3PTQA 3WN6A 1KR1A 4M56A 4J7RA 1X6NA 4WSJA 4KGLA 2JIWA 3HZ3A 2VCAA 5GPRA 3GXFA 3RJXA 1UH2A 5EBAA 1V6VA 3A21A 4PBGA 2BHYA 4PCTA 4GO8A 3AYRA 3N12A 4PUDA 3WNLA 4IM4A 3WH6A 1J0HA 3AMGA 3PZIA 3VGDA 3ZOAA 2PBGA 2DT3A 2BY3A 3AJ7A 1OM0A 1E0XA 1P6WA 2TAAA 4PMVA 3VIKA 3OG2A 3D51A 1W1TA 2UY2A 3VGFA 2ZUSA 1G1YA 4JL2A 3MMDA 3SEPA 3VMPA 2J47A 5E6YA 3UG5A 3WY2A 3EMQA 3N9KA 3VO0A 1QNQA 4DUWA 4HA4A 1LL6A 5D8WA 1JL8A 3TA9A 4CN6A 2NT1A 3AZRA 3L2MA 3KLKA 1GOWA 2DGAA 1HX0A 3FW6A 2VNCA 1JF5A 3VNYA 3AISA 1WE5A 1MYRA 1VIWA 3F4VA 4JL1A 3CHFA 1R87A 1PX3A 1HJSA 1DEDA 1RP9A 5E6ZA 4KRTA 2QF8A 1JFHA 1NOFA 3KL3A 4EK7A 1UZ1A 1GOOA 3ZMRA 2WZEA 1MQRA 3RO8A 2VL4A 4XZBA 3BAWA 2XSBA 1DWJM 4URIA 1V6UA 3LMYA 2WCAA 4JKKA 4PMDA 3ZSSA 1H11A 5BCAA 4YHGA 4BS0A 2VCBA 1W3KA 2FGLA 4HOZA 3DX4A 1FOBA 4WLCA 3DX1A 2YDQA 5FD0A 4Y7EA 1JAEA 3A24A 1UKTA 3LX9A 4BQ5A 1QHOA 1J18A 3MUIA 5CGTA 4PEEA 3EMCA 1UWIA 3GXDA 1UD6A 3G6MA 3U5YA 1FH9A 4DUXA 2D23A 1VEMA 1W2PA 1I75A 1PBGA 4AEEA 3LPPA 1OWQA 2BXZA 1EDGA 2Y8VA 2X8RA 3BGAA 3QR3A 3MU7A 4TUFA 1CDGA 2VZOA 2WK2A 2GJPA 1NWSA 2CYGA 1R46A 5D8ZA 3SUWA 3CZKA 4ZE4A 1U2YA 3DHUA 1UR9A 4D6EA 2A3CA 3WMBA 2OW6A 1J0JA 3RILA 2J7HA 4JFSA 1OB0A 2Y2WA 1Q6GA 1C8QA 3BAYA 3ARYA 1CPUA 3BUIA 1WDSA 2XTKA 1XC6A 4HMCA 3WH7A 1UZ4A 1E6ZA 5A94A 3ARWA 1K9TA 2Y4SA 3WDPP 1UASA 2WBGA 4L4PA 4TXEA 4DWSD 3WF0A 4QP0A 4OKDA 3S5YA 2GUYA 2GJRA 3BSGA 1E4MM 1VBRA 3SCPA 3BCDA 2A3EA 3GNOA 3WQ5A 4JKLA 1QHPA 3G6LA 1MXDA 1XYFA 2UY5A 1UWSA 5I0DA 4TTUA 1F4AA 3B9AA 3A47A 4AMCA 1CECA 3VIOA 4CD5A 4AZHA 3VDAA 2BFGA 2A3AA 1HP5A 2C7FA 1HKKA 1NARA 3VD5A 3GH5A 1R7AA 1CXIA 2DSWA 3WEMA 1DWFM 2CBJA 1HJUA 1TZ7A 4WF7A 3QOMA 2DT1A 2F1AA 1KGXA 2ZXAA 3BUPA 3E1F1 1JYNA 4J3WA 4AW7A 1J10A 4P8UA 3EBVA 4X9YA 3MSGA 6A3HA 1YHTA 4CD4A 1Q6FA 3K1DA 4Z2GA 1V3HA 4FNRA 3U7BA 3RM4A 2DSVA 4W84A 3VX1A 4GZEA 1JD9A 3WL0A 4W8AA 5JBFA 1NP2A 3SCSA 1R85A 4E2OA 2WHKA 1TVPA 3S5ZA 3AICA 3BVWA 1E1FA 3BVXA 5DEZA 4JHZA 4JCLA 2E0PA 3WNOA 5A2AA 3MS8A 1OGSA 3BUQA 2CBIA 1I1WA 4TVCA 1TG7A 3AROA 3VD4A 4J3XA 2PWHA 3IJ8A 2CHOA 1DWAM 5GNYA 1US2A 4MDOA 5CSUA 2NT0A 1C93A 3A4AA 1KQZA 4AD4A 4XB3A 5I24A 5IFTA 4JCMA 1QHZA 1OT1A 1C3FA 2V3EA 3EDJA 3NIYA 4J3VA 3VIMA 3D5HA 1J0IA 2BVDA 4AZ5A 4RE3A 3BAIA 2DSZA 4PRWA 4U33A 3VU2A 3OIHA 1HL9A 2E8YA 5LA0A 1UR2A 2QPSA 4WKFA 1UA3A 2X2JA 2OSWA 1UR8A 4D6IA 2XGBA 1H3GA 4P7OA 1B2YA 1HTYA 3CZSA 3NSMA 3FN9A 4IUGA 4GO9A 2GSJA 1BQCA 2AMGA 4ACZB 3WQWA 4AD3A 4HA3A 2WMJA 1M03A 1FFRA 4C7GA 1VBUA 3W29A 3WF2A 3WNMA 2RGMA 4CU8A 1HKJA 1JZ4A 3VKKA 4BQ2A 5BXTA 1EA9C 1GOQA 3MUY1 1FA2A 3BVTA 2O92A 3CHDA 3H55A 2UY3A 4MJ2A 1ESWA 2FH8A 1FHDA 4FMVA 2QHAA 3AOFA 1CNVA 1UQYA 2ZUMA 2VRQA 5A95A 1JG9A 2WMKA 1UD3A 4KWUA 2OSXA 3K8LA 4DO6A 1KTBA 2IXUA 4IPLA 1UKSA 2CERA 2OYMA 4ATWA 1JZ5A 1QOXA 2E8ZA 2WZHA 3PN8A 2J7EA 4AZ7A 1HL8A 3ARTA 2WHJA 2F18A 4UCFA 2VJXA 2WVUA 1PX8A 1LWJA 4DWSA 1B3ZA 4D6JA 1QNSA 3UEQA 5M17A 3F5JA 2D0FA 1QI3A 3OGVA 1W3HA 4MB3A 3MSDA 4FNUA 5JBEA 3UETA 1C7SA 5BRQA 3ARPA 1CENA 2WB5A 2XYLA 4H8VA 3ZR5A 1H4PA 4YPJA 3RCNA 2WC4A 1ISVA 1UYQA 2PWGA 2J7DA 3D52A 1XHGA 2JEQA 3ZJ7A 1WZLA 3PTKA 5A1AA 1G9HA 1A3HA 3GXPA 2G41A 4OOZA 4LYRA 2Q8XA 4AZBA 3GXIA 1GUVA 2XJ7A 2ZUNA 4XV0A 1VJZA 1WDPA 3EJPA 3VDBA 2DH2A 4PUEA 1WNOA 4JFVA 1US3A 3VD7A 2CXGA 4ACYA 1TQUA 4U31A 1ZJAA 1GPFA 4UQ9A 2WXDM 3H54A 1BYAA 5CLTA 2XM1A 1V0NA 2DSUA 2WYSA 4D6DA 1K9DA 3MUAA 2ZUUA 3D50A 2GDVA 1W9DM 3GTNA 2EPLX 2ZX6A 4C7FA 2FH6A 3VIFA 3ARZA 1WPCA 4Z2IA 1W32A 4PMYA 4LYPA 1GQKA 4LX4A 2VC9A 2VQUA 3W81A 4P7RA 2J4GA 1R86A 3SCNA 2XM2A 1HNYA 4W93A 1UWUA 3VM7A 2XFFA 3N15A 1W91A 3OLEA 1BGAA 5A8PA 3KEHA 3S6TA 3THCA 2VVSA 4AD0A 1VJSA 4B3KA 4FF5A 3CUJA 3D4YA 4GZIA 1UOKA 4MNKA 1Q6DA 2DT2A 4A4AA 2W4XA 4PMQA 5I23A 1TUXA 5HXMA 1WDQA 2J77A 2CHNA 2ZX5A 3GXNA 2YL5A 1UWRA 4AD2A 4HPHA 1ITXA 1HXKA 5E9AA 1G0CA 5A69A 3CUGA 4FLRA 5KEZA 3BLKA 4W7VA 2EBNA 2GJXB 1TQSA 4KMQA 2XIBA 2VZVA 1JNEA 2ZICA 4NF7A 3WENA 1CWYA 1SMAA 1OBAA 4H41A 4M1RA 1V3MA 3BAJA 5E0FA 3OA5A 4NSBA 1ZBVA 2Y24A 1GZJA 3W25A 4S3JA 4HZ7A 5HDRA 4JFWA 1JDDA 3B9EA 5CPTA 2X05A 5I78A 2VO5A 3LRKA 2WMIB 1CGWA 4AY1A 4WK9A 3WUEA 1XSJA 1J0ZA 1JAKA 1KCKA 1JZ6A 4DM2A 3WH9A 4LQ1A 1EHAA 1JYWA 1B0IA 1CGXA 3RMEA 4C7DA 5LYRA 1V0KA 3AFBA 5IDIA 1JI1A 1B3WA 1CZ1A 1V0MA 2X2YA 3DHPA 3CHEA 4H04A 4KGJA 5A6LA 1TR1A 1AQ0A 2D0HA 1J11A 1BYBA 1KWGA 1Z32X 4M81A 3LXAA 4AIEA 3PZTA 4BQ3A 1FH7A 2CPUA 3AS0A 2FHCA 4YHEA 1E9LA 3T0BA 4B9YA 3CHCA 4PMUA 2ZIDA 4W88A 4MNMA 2B31A 1BTCA 1G5AA 1ZL1A 4P8WA 4RL3A 1BG9A 2JEPA 1R75A 1QW9A 3HJEA 1HKMA 2QLYA 4PMOA 3W53A 1OSEA 1E0VA 2ZXQA 4ZFMA 2VR5A 4HMDA 2EJ1A 3OGSA 3EJTA 1KBKA 3PZQA 4UTFA 1V0LA 4CUCA 3WD3A 2D20A 2YLAA 4MNLA 3WEZA 1WZMA 1QI2A 3EDFA 1TA3A 4AZCA 4UR9A 4FLOA 5M5DA 3VIGA 3AIEA 3WELA 4GKLA 1J0YA 4PSRA 4K68A 3AXHA 3RJYA 2HVMA 1ZS2A 1QX1A 2CESA 3O9NA 2HISA 2YFNA 4PMXA 5JUVA 4L4OA 3AYSA 2F7RA 4LXFA 3KZSA 2X2IA 4U2ZA 4M8UA 4CD7A 2V5DA 3UG3A 1GW1A 1KFWA 1NH6A 1B1YA 3EJRA 5D9PA 3RPMA 2WSPA 3FAXA 3VSVA 4M80A 1UH3A 3CZNA 1FP8A 3W82A 2FHBA 3ARXA 1E1EA 5DF0A 5CPSA 1UD2A 3SUTA 4HP5A 3LRMA 1QWNA 3CIVA 4UFJA 1JDAA 2UWFA 3WH8A 1RH9A 4X0NA 4CN1A 2AOSA 1E3XA 1CXFA 2WLZA 4R27A 4NZCA 5I2UA 3CUFA 1IZKA 1KQYA 3RIKA 2D1ZA 2VURA 1JZ8A 1ISXA 1O6IA 4UQAA 2VX7A 1JYXA 1TA3B 1ODUA 2GK1A 4HU0A 4P8XA 2RGLA 3GXMA 1KGUA 4WIWA 3VD9A 4UOJA 4UNIA 1HVXA 3KL0A 4RE2A 5ABGA 4P7NA 3VILA 1E6PA 2D3NA 2V3GA 2WWCA 5E70A 5A6MA 4Q7NA 4JFUA 2QV4A 2CCRA 1CBGA 4XX6A 4CCEA 1LG2A 1E40A 1MW1A 3VIHA 1E43A 1CXKA 3W27A 1EHNA 4FLQA 2YIHA 2XWDA 4DUVA 5A8QA 1O7AA 4PMNA 1Q6CA 3W26A 3LXBA 2VX5A 1OT2A 2QMJA 3KE0A 1TVNA 1NP0A 2WCSA 4FNPA 4M24A 4D1IA 5DFAA 2UY4A 3CTTA 2IUZA 3CZ8A 1PS3A 4W7WA 1E4LA 3PZUA 2OWWA 4U3AA 3NYDA 2PB1A 2YDSA 4GINA 2E3ZA 3L4YA 2XN2A 2WVVA 5AY7A 3VIJA 3K8KA 5A6KA 3M46A 3DECA 3CUHA 4H7VA 3L4ZA 1L8NA 3L4WA 3WD4A 4EANA 5AC4A 5CGMA 3WQVA 3VINA 1KCLA 4YN5A 1E55A 3BSHA 2YA2A 3WNNA 1CGUA 1HN1A 4CD6A 2WWDA 3SCRA 3VDCA 1M53A 3B8SA 3BMVA 3PZNA 1E73M 3WKZA 5HPOA 1B30A 4UQDA 3MV11 2CKRA 3HG4A 3VM5A 3CZEA 3BAKA 5FL1A 4PMZA 3N11A 3BUDA 3WQ4A 2GVYA 5HOSA 3UERA 1HJWA 3SUUA 3EDKA 3BVUA 3LPFA 3WBEA 1ZB5A 4F9JA 3A5VA 3TTQA 5BYWA 4H8UA 3TOPA 3WH5A 3II1A 2GDUA 3IJ7A 1E3ZA 3CZLA 1NOUA 3VGEA 2XVKA 1JGIA 4KH2A 4FNTA 1R34A 1E15A 3GNPA 8A3HA 4U5KA 3AI0A 1NOWA 1EIBA 1FH8A 4MTVA 1V3JA 5A2BA 4P7LA 2VI0A 2E40A 2PBOA 2BNJA 3W6MA 5CG0A 3IAQA 5EFFA 1VEPA 3T08A 4TVUA 4W5UA 1UG6A 2WW5A 3CO4A 2JIEA 3A23A 5ABEA 1UR0A 4AIUA 3THDA 1H09A 2YBUA 2J7GA 2W62A 5AC5A 5ABFA 2CIPA 3ARRA 1OIMA 3OZOA 5FCZA 2F2HA 3EJUA 3WEOA 1E0WA 1V6XA 1MW3A 4NZFA 1LWHA 3L4VA 1QI4A 6TAAA 2FDMA 4XZWA 2BV9A 2G3MA 4U3CA 1CIUA 3JUGA 2DEPA 4Z2LA 1EXPA 3AHZA 3W38A 1ISZA 4AISA 4JAWA 2X2HA 3CZJA 3DYOA 4CN4A 4J3SA 3DYPA 2CKSA 3I3DA 3MMWA 1V03A 2BY0A 3VD3A 1M7XA 4DO4A 1UHVA 4GXPA 1AMYA 1JF6A 3U57A 1IV8A 1R8LA 4MB4A 3IGUA 1E6SM 4HPGA 1GQIA 4PYSA 3EDDA 3DX3A 2X1IA 2JF6A 1GOKA 4GI6A 3K4DA 2A3BA 3NDZA 5FKYA 3KWXA 1UUQA 4N42A 4ZENA 2W61A 1JZ2A 3NSXA 1UD4A 5M03A 4E8CA 2YFOA 4F79A 2ZUWA 1V3KA 1PZ2A 1KGWA 1S46A 3ZJ6A 2XG9A 5I77A 3POCA 3B9DA 1NWRA 2WKLA 4HOXA 1TQVA 2W66A 4PTXA 1KXQA 1AQMA 1MWOA 7TAAA 4UFMA 3SUVA 4PSPA 1J12A 3OBAA 3ECQA 1BSIA 1JD7A 1EO7A 1EDTA 1V08A 2CBVA 1GJUA 3CH9A 2F7PA 4UZSA 2EPMX 2FGZA 5HNNA 3TV8A 5D4YA 1XD0A 1E6RA 1MFUA 1QI0A 2GFTA 2YA1A 3U7VA 3AQUA 4J28A 3AXIA 3M6DA 1OCQA 1V02E 3AHXA 4B15A 2E9MA 5JBDA 3RM9A 1AVAA 2OWCA 4HTYA 2XVPA 1C92A 1F4HA 3MO4A 2F7OA 1JNDA 3OB8A 1ISYA 3VIPA 1V6YA 3N1AA 3WUBA 4UFLA 2WBKA 3VUPA 1W1YA 3WF1A 3GH7A 5DMYA 3T2QA 3APGA 3L4XA 1HJVA 3GZAA 2J62A 1JXJA 3ZT7A 1B3XA 2EXOA 4R5EA 1BAGA 2G8ZA 2X0YA 1A47A 1KBBA 4D6GA 1TFVA 5FIPA 5CJ5A 3WL1A 1XYZA 4AYGA 3AIQA 2D22A 3VMNA 4NXKA 1DP0A 5KZ6A 3DX0A 1TQTA 3ZT5A 3KLLA 2WMGA 1H1NA 2EPOA 3HG5A 4MADA 1JZ7A 1KB3A 7CGTA 1VF8A 4GZJA 4HMEA 5BRPA 3OGRA 2IXVA 1D7FA 4D71A 4ZXLA 3M7SA 1E5JA 4DWSB 1CXHA 3BH4A 1B3VA 5CSYA 1FFQA 4AMXA 1B3YA 2C0HA 3ARUA 1TE1A 2OYLA 3RM8A 2J7CA 2D3LA 2IGTA 1GORA 4BCEA 1QVBA 3IK2A 1HJQA 4ATLA 2WHMA 3CPUA 3BUBA 3TONA 3WY1A 5EB8A 4UQCA 3WY4A 1PX4A 1ECEA 4NX0A 2J8FA 4KRUA 2OYKA 3J7HA 3ZT6A 5C8BB 1CGYA 1OINA 1SFSA 2VRJA 3WDHA 1HWWA 2BVTA 3DC0A 5EMYA 3LPGA 3T0DA 4PMRA 4WKHA 3AMKA 1W9UA 2ZOXA 3ZM8A 1LG1A 1PJ9A 3DDFA 3EJSA 1QPKA 3GYCA 5D9NA 1NWUA 1UWQA 1V3LA 4AYSA 1Q6EA 4GPNA 2VZUA 1K9FA 3CMGA 1SMDA 2F1BA 3BAXA 2BY1A 2QPUA 4Z2JA 1MVYA 1VFOA 1W2VA 3CV5A 3MMUA 1DTUA 1GHRA 2W5FA 3OLIA 4JHOA 5F7UA 2BY2A 2F61A 4PN2A 5IXEA 1VFMA 4UFKA 2BVYA 1OD8A 2XVLA 2CITA 2OW7A 3FNDA 2E9BA 1GONA 3VPLA 5A6SA 6CGTA 4JIEA 2WAGA 1SZNA 2CETA 1GVIA 1EQPA 2D0GA 4OJYA 3AIWA 3O2LA 3CGTA 1UKPA 4P7QA 4HU8A 1TQWA 3GBEA 1IZJA 3PZMA 4MB5A 4AC1X 3AZTA 2YL8A 5A2CA 4NZJA 2O9OA 3BVVA 1R47A 1GVYA 4GI9A 5EFDA 4RE4A 3F5KA 1FP9A 5I3DA 1UD8A 3WD1A 2VT0A 3HU7A 1CGVA 3L4UA 4W87A 2J78A 1JYVA 4TX8A 3IANA 4UOZA 2XGIA 1U33A 4AXNA 2DDXA 1WDRA 4W89A 4FNSA 5A8MA 1YQ2A 4BF7A 2DQXA 3LXCA 2ALWA 4DM1A 4U5IA 1RPKA 3WF3A 3WUGA 3N18A 2V3FA 1GQJA 1BHGA 2WHLA 2G4FA 4CCDA 3OLDA 3MV01 5IHSA 3ZQ9A 3QHOA 3CC1A 3K46A 3PBGA 4S3KA 1L0PA 3KL5A 2VZTA 1XGZA 5ABHA 2E4TA 3PZOA 2J7BA 5GQBA 1UR4A 2EAEA 3TTOA 4LYQA 3HG3A 1BGGA 4NRRA 2JE8A 1H0IA 1BFNA 1JIBA 3VGGA 5AYBA 1LL7A 1DWHM 4U2YA 1OGGA 1PIFA 2YL6A 3AIVA 4F66A 4B9ZA 1OGBA 5I5RA 1KXHA 3T2PA 3PZ9A 1B90A 3VOCA 1XCWA 3WF4A 3TP4A 3WQ8A 2VR4A 1BVZA 1CLXA 3T09A 1TCMA 1VRXA 1U30A 3PTMA 4PTMA 4TVDA 3UR8A 2QMKA 5JIPA 1XD1A 2YOCA 1SR0A 2O9TA 3F5LA 3QHMA 4UFHA 5LA2A 2VRKA 5BWFA 4QLLA 2EO7A 3QHNA 1WZAA 4OOUA 2XN0A 4UQBA 5D9OA 3SCOA 1WP6A 3U5UA 4NXSA 3VNZA 1MW2A 1UQZA 2ZXBA 1LJYA 1UD5A 3CLWA 3ZSTA 4Z2HA 3GH4A 1W9BM 4OZOA 3EJQA 3W0KA 2CNCA 1XRVA 4AZCB 3WDIA 3WSUA 1BF2A 2Y5EA 2WPGA 1H2JA 4QLJA 4UQEA 3BCFA 4NRSA 1R33A 1C91A 3K8MA 1GCYA 4MPKA 1C8YA 1SYTA 1W3LA 3LRLA 4AIOA 3DYMA 4W7UA 3GDBA 2ZX9A 3SCTA 2WM0A 4D72A 3M07A 1E56A 4J27A 1BPLB 3NJ3A 4UZUA 1VEOA 1PAMA 4FLSA 1AQHA 2G3JA 3I3BA 4PCSA 5I6SA 4V27A 1JFXA 1GOIA 2WC7A 4PTWA 2XFRA 2EPNA 2VQTA 3PZGA 2Y8KA 2WC3A 3POHA 3AIBA 3WUFA 5ECUA 1W3JA 1VENA 2XPKA 1KXTA 1LL4A 4ZXOA 3HMCA 5E1QA 5M3WA 4AD5A 4B16A 1DWIM 4F8XA 2F7QA 3A22A 1WKYA 1BLIA 3ARVA 1GNXA 1QNOA 3VSTA 1UKOA 1ZU8A 1CTNA 4GIAA 4B3LA 2ESCA 2PF0A 3AIRA 1ZBCA 1FHLA 4AD1A 3WFLA 2GK1B 2WSKA 3WMCA 2BS9A 4MJ4A 1LQ0A 2ZX8A 3T2OA 3N13A 2XVNA 3MKKA 4TOQA 8CGTA 4FNQA 2XVGA 1HXJA 3VGBA 2PI6A 1GHSA 5GNZA 3VIIA 1ODZA 3PHAA 2VCCA 4V28A 3FAWA 4ZEPA 2WZIA 2A3HA 3CBWA 3AIUA 3WDQA 1BG4A 4HA1A 4D6FA 1HIZA 1E6QM 2YDRA 1X6LA 4W86A 9CGTA 4X0VA 1WB0A 2XFYA 1XV8A 2MANA 2XWEA 3SCWA 1UKQA 2VX6A 3BLBA 1DWGM 4OBSA 4W5ZA 3A4WA 3GXTA 5A6JA 4HZ8A 3NSNA 1E72M 3SCQA 1V6WA 3SURA 3WFZA 1V3IA 4WSKA 2JF7A 1GOMA 1PEZA 1X1NA 4W85A 2J8GA 5A6BD 1LLOA 1UR1A 1CLVA 2FHFA 1EGZA 1KR0A 4E4PA 5A6AA 4E8DA 3D3AA 4ACZA 1CXEA 2VTFA 4MAVA 3HG2A 2J74A 2O9RA 2WVVB 2YL9A 3A3HA 3AHVA 1KWKA 1Q4NX 4QLKA 2E9LA 5CXPA 4TTGA 4ML4A 2VVNA 3EMZA 4DWSC 2PWEA 1ZBWA 3W24A 4FK9A 3MANA 2F8QA 5IHRA 1E6NA 2J79A 4BQ4A 4DO5A 2G3IA 1RD6A 4AWEA 4EAMA 3LPOA 1JDCA 1J01A 1WCGA 4OGZA 3FXYA 2YA0A 3UG4A 2ZUVA 1UWTA 4W8BA 1XH0A 3WNPA 5DT7A 3W37A 1HJXA 5IFPA 2DIJA 2WKGA 4H8HA 3I3EA 1C7TA 4MB1A 3VMOA 4CCCA 3N04A 1M01A
chains in the Genus database with same CATH superfamily
2PO6C 4S1RL 4Q9QH 3U0HA 2PZNA 1JMZA 3IV8A 2BIOA 2QAPA 1R0MA 4NCDA 2FQDA 3WFEH 1GQLA 4DP1X 2VO8A 3VFNA 2FLIA 4HJSA 1GTFA 3WNKA 2I16A 4KNSA 3CDFA 4PRAB 4TRPH 2PFHA 2VR7A 1I2PA 4FP8H 3KYOA 1PUDA 4JX4A 3GMRB 5I76B 4KO9A 3Q48A 5C9JB 4BI7A 1B9ZA 2FLMA 3BPOC 1X96A 3CEPA 3V4BA 4ZE5A 3N1MC 5TTRA 1RK0A 2JTDA 4AEIH 2V5CA 3FYYA 2QVMA 3SGKC 3JZEA 1D3HA 4H83A 1YE4A 3QPXH 1A02N 3V0FA 2XN9B 2ORBL 2DIEA 4EE9A 1BFOA 4G6KH 3VDHA 1S5WA 2BO0A 2V38A 3CFEA 4UNKA 3CVHH 3WO4C 1Q9KA 4LUJA 1OD0A 3V6OE 5LA1A 2DQTH 3JV6A 3DX2A 3W1PA 5D7LD 1KJ2L 4LLQA 2W07B 4JFPB 1TTGA 4JQVC 2F5BL 3VVGA 1ZT1A 4OQTH 1PIGA 4J3UA 4FA8A 3M0XA 3PE9A 3P3YA 2X1UA 1ETB1 3NDYA 4AUYA 1SO3A 5EUOE 25C8H 4H40A 2H7WA 4L1HA 1OCBA 5E9DB 1AKJA 3ETTA 4N0UB 4UIMB 3SM0A 3C2YA 1CDBA 4P8VA 1BVNP 3GTIA 1HF6A 1JVOA 3RVVC 2NY1B 5I1GH 4EE2A 1QI5A 4U1LA 3CV1A 2BRRL 3URBA 1I9EA 3SUSA 4RMTA 5EU6B 5LGHH 1GKEA 3ES6B 5IHUL 3UP8A 2BVEA 4U1MA 2ZVRA 1KIPA 4IRJA 4F33B 3QWRD 3WBAA 4MJIB 2ATMA 2KZKA 3CHRA 2EPKX 4GSXA 1YXCA 2WZ5A 4FOMA 1QW7A 1L9OA 3CXDH 5E8PB 1BV8A 3AS2A 2W67A 2CM5A 5H4ZA 3VSUA 1Y1UA 3GMQA 2PPEA 1G4RA 4RAVA 5C0EA 3DJZA 5REQA 4PRBA 3LV3A 5TD4A 3LKNA 3CFTA 2QADC 3X3GH 1SDAB 2AP2A 1J96A 2JFEX 2HTMA 3NQIA 5CKAA 4RFNB 3HHSA 5KYXA 2UZYA 3NURA 1PNDA 5IHLB 5DCDA 1T6VN 4HUNB 1ET8A 4L4VB 2ENQA 3OXSA 3P0VL 1SN0A 3UG8A 4L23A 4KXAA 3K2UL 3Q4DA 3W1UA 3G1DA 3OR6B 3VIKA 3VFPA 1M5WA 3RB7A 4XO3A 1L0YA 1R5IA 3OJGA 3VMPA 4CQCA 1I9RL 3VO0A 1QNQA 2FGWL 2Y8UA 2NXZD 5DJXA 3VH8B 3CFKB 2I7OA 4DQOH 4RQQA 4O4YH 2B4CC 1XUUA 1HJSA 2UY6A 1XQ4A 2DQEL 4OLWL 1BZ7A 5K9OA 3NH7H 4ZZKA 3W1AA 1DVFB 5C9XA 4CDHA 3K5SA 3WIAA 1U1JA 4IXHA 4M3PA 4X6CA 1D5BB 3NCJH 1FWEC 5DJAB 3ZSSA 3ZVIA 4Y1AB 1GC1C 3EHBD 4QRUB 5HJ3B 1K8IA 4QOKB 3OG3A 2IBZY 3KOWA 1J93A 4GS7C 4HT1L 2NY7L 4MVBD 4NC2B 2ODOA 1EO8L 2FX7L 1LLWA 3F7YB 3P74A 3OB0H 3OWEA 3DUSB 1ZHKA 1E9OB 3W3BA 1LEIB 3MU7A 1KYFA 2WZPA 3ARFB 1RPQA 3LY6A 3O6CA 4Y4HD 5EMLA 4P5RA 4TLSA 4JGDA 1RJLA 1Y6KR 1LO5B 3F04A 4Y16D 2DU2A 2IPKB 4TV3A 3MRBA 1BM3H 3D5OF 3FB8B 5JIQA 3ECBB 5D7SH 4EDWL 2R1MA 1KACB 1W80A 2QQNH 4PRTA 4XN1A 1VBRA 3GNOA 3RL1B 3HHMA 3UTQA 1F4AA 4CD5A 4Z1CA 5L9DL 3DJ9A 3O6FB 1A5FL 1HKKA 3KHOA 4KZDL 4JD4A 2PYEA 3CAQA 2GCYA 1NCHA 1A4LA 2DSWA 5KSBA 2DJLA 2P5EA 4R2GD 3MV8D 3BUPA 1W8SA 4J3WA 4PCNA 4OF8A 4JANB 4PJ9A 3UBXB 1RZKH 3PWNB 1JUBA 1ZVSB 4OU3A 3UYCA 4KWOA 3T07A 5C0CA 4XB7A 2AQ3A 4Z7OB 5JBFA 4TMCA 1T6WA 3HAEG 4JHZA 4JR9L 4EPEC 4JMNA 1RJPA 3R79A 1FCCA 1ZGLP 5HR7A 3I6KB 4MNQD 4LARH 2ZWNA 4FTDA 1HHKA 1PV8A 3FEQA 4XN2A 1ONQB 1CFTA 4TSCH 4JJOA 2JBMA 3LEXA 3ROOA 2V37A 1C93A 4Z7QF 5J5EA 2IDCA 1QSVA 4AZ5A 3FQUA 3MLVH 3TJHC 2HZGA 5ICXB 4NFCA 3R0NA 2ZNXA 3H23A 1DUYB 4KVPA 4UANA 2GYIA 3EYSH 5KSUA 2GSJA 1CFSA 3UTPD 1T1XA 3L1EA 5EZLA 5J3HC 2ID5A 3UMTA 2OTUB 4CU8A 3GSNB 4US5D 3WLNA 4MSSA 5IBTH 4AX7A 2Q8BH 4NBZB 4W9JC 5A7BA 4HJ1A 4TSBL 3KW8A 3V5HA 3W1RA 1IBBA 4L8BA 1ZHLA 3K8LA 3WJXA 1E9QB 1FVCB 4QS5A 1JZ5A 3PR2A 4HSNA 1OF6A 4AZ7A 3FCTB 2ZOOA 3SKMA 3T55A 5M17A 4YHLH 3HE6A 4XT1C 5FDYA 4FMFA 4FNUA 3T4WA 4X5RA 3PL6A 1CENA 4INFA 3DVIA 3UJTL 1ZJIA 3NSJA 1RSCA 5CR8A 4AW4A 2IFGA 3DPDA 5IJCC 3MUXA 4PJBA 3CBJB 3FT9A 4LLYB 1M7UA 3U3HA 3ZE1E 4I90A 1O5DT 3VA2C 1A6ZB 3MA8A 4PJIE 5TAOA 4HS6B 2VXTH 2ZUUA 3HG1D 4L2LA 2ZTBA 3SDOA 3DK0A 4I0CC 1KN2H 3W81A 3E0WA 3E2HC 2IBGA 3VM7A 2VC5A 4XO5A 1MREL 2YPLB 1KYAA 1OOWA 3IUHA 3A0OA 1IEIA 4N4QA 2J44A 1WDQA 3N41F 1NJJA 3WV0A 4OLYH 1VRDA 3KNBB 5KVEH 4ADTA 1SW3A 1YEHH 2A6KA 4JS7A 1F41A 3CT7A 2NY4B 2O6DA 4J4PD 4NF7A 3BAJA 2A1WH 2OL3A 2R2CA 3W1QA 2Q87A 3CSGA 4HJTA 5SV3A 3HOGA 1JHKH 1XF0A 3D18B 4ZUUB 1XSJA 1F6FB 1T22B 2D3VA 2X2GA 4JNXA 4XODA 2CJSA 4KI5F 4OGXL 1MLBB 1HE7A 1E0TA 5KYWA 1B3WA 4ONFH 4YSTA 2WP3T 5SX5K 2BSTA 4OIIH 5FKPB 4WV1B 3QPYA 3L3OC 3RBSA 2K4WA 4BQ3A 1ZA6B 2ATSA 4MZ3A 3MBXL 5HQLA 1J5SA 3DU0A 5D03A 5TH2B 2C3GA 2HTKC 4LB8A 3ZZSA 3W7MA 4ZFFA 1QTSA 4KKPA 3MOAL 3HJEA 2WZ0A 3AITA 3MPCA 4GG9A 1P4BL 5CINH 3ULVE 4PMOA 2DBJA 3IJIA 5C0JB 4KJPD 4OZHF 3OGSA 2R0KH 3VI4A 3SDDB 2EPHA 3EDFA 2GIMA 1OP3K 4GH1A 1SYVA 5F3BB 1E28A 5DD1H 4AHOA 2EE6A 4GW5B 5AW4B 2ZWSA 3D34A 2D2JA 3MW7A 1V8HA 4Z0JA 3L7EA 4LXFA 1MCIA 1HW6A 2BC4B 3U7AA 1I3GH 2Q3AA 1PZ5A 4TNVF 2ITCA 4N24A 4LUSB 2NV1A 3CASA 2IDSA 3LHVA 1XZWA 3IV3A 3IJQA 1E1EA 3PJNA 4J2PA 1QUPA 4P57A 4E41E 1YDPA 2BW4A 3CIVA 4LOUC 2A7PA 5TQ2H 2PGRA 4N85A 3VFOA 1HNFA 1IZKA 3OL2A 1QATA 3RIKA 1K5NA 1UZGA 4MAYD 1MFNA 3QA3A 4LLMB 1TJGL 5JA8B 2E4FA 4HS3A 2DORA 3I2CH 3LKQB 4MQSB 3E38A 2NY3B 1X8FA 3V0HA 4HSQA 1QBMH 4XP9H 1L9TA 3CK5A 4KQNA 3NQFA 1XTMA 3NQ6A 3OVRA 2FJHA 4GUIA 4FF7A 4NJGA 1E40A 2YPKB 5DD3L 2GABA 3MP3A 3LZ5A 1RZGA 1TCRA 2XH2A 2ENJA 4WU7B 4K2SA 4D1IA 3J07A 3CTTA 1EWHA 3RVUD 4W7WA 5HYQB 3GSXA 4U3AA 4F8NA 3WEXA 3GSQB 2WVVA 2RDUA 3ZTNH 1PKLA 5L0QB 1YEEL 3GU9A 4XNZC 4H1LG 2ITDA 3HMXH 1U3HA 5DYOB 1N0XL 3V0DA 1H5YA 2BPBA 4JTGA 3GNNA 1KPUB 1T20B 5I73C 3H6AA 1OC7A 1RY7B 2Z7KA 4TUUA 5KYYB 1E9PB 4YHMH 5HOSA 4W9HC 2ZP9A 5E23A 3WBEA 1UBPC 1CQKA 1S7VA 3I9IA 3H6OA 1A66A 1YN6B 1TV2A 1XP3A 4XKYB 4FFWC 2B1HH 5AVZB 5BOOA 4PJ8D 4LSTH 4U6HA 1NOWA 1EIBA 2DWDA 4X7TB 2P24A 2VJ8A 4W9IC 3KHJA 3FCUB 2DWTA 2BP8B 1U0QA 1HH9A 3T8XA 2WW5A 3CO4A 2VM8A 1YBQA 2C3WA 4NO5B 1IEHA 1B0WA 1P2CA 1X7IA 4A3UA 4JN8A 1NGWB 2FJGB 2VC2H 3PXJA 5FAGA 4ZSOE 2PPAA 3P80A 3W38A 3QHZH 5AVYB 4PC8A 4J3SA 2PXYC 2VXUL 3MMWA 4V1DE 5FW6A 2A77H 3PC0A 5FK9B 3U57A 3V0IA 1MFMA 5D5MB 4EXBA 4KDTA 1GOXA 2WO4A 2VFHA 4I13B 2ICWA 1KBLA 4WTQA 1CZ8L 3W1ZA 2HKFL 3DX8B 4A7TA 2E9GA 1WAAA 3GPEA 4X6EA 1TU2A 1IGJB 3QSKB 4XMKH 4M6OH 4JYDA 1D8CA 3GZPA 4HOXA 3F7RA 2DL2A 4AWUA 4Z5RB 4IRZL 5GGTA 4NO0D 4UM8B 1JD7A 1U1UA 5DS8B 4DPQA 4KHXL 1UWXK 1U8JA 1J8HE 5BS0D 3OPZH 3BW2A 1HIML 5HHPA 4G9DB 2NMSA 2Q5BA 4Y5VB 1FL6A 3QCUL 4NG3A 2EDMA 1JCKA 4UTWA 3N9GL 3PNWB 4N6EA 2QFRA 4IBTA 1ETA1 4K7PX 1YEDA 3S47A 5F93C 4ZAKA 1BD2A 2J62A 3K91A 1AH4A 3C5ZC 3WLKX 1DUZA 1XIWC 4YUEH 4N8VG 2X38A 1LT8A 1JGLL 1RZ8B 2O7SA 1IFHH 3ZT5A 1KB5A 5D71L 4GZJA 4HMEA 4IGMA 2VDMB 1P0KA 1WUFA 4W9DC 1Q0XH 4MFDA 1TRIA 3P0YL 5IJVB 5IMMB 2FJSA 3QQ4B 3W2KA 1QSZA 2P5NA 2GHWB 2LOEA 1NDMA 2HFGL 2NX3A 4UDUA 4F9LA 2WHMA 1PX4A 2XG5A 4QRBA 1ECEA 2V9UA 5I0VA 4NX0A 3JVAA 4ZXBA 4M43H 4GHRA 3MODH 1CGYA 1OINA 1NPNA 5C1MB 1L0XA 4YXGA 3TL5A 3ZE2E 2VM3A 3TYGL 5F7DA 5L2JA 4HG4J 5IEKA 1U93A 3UTSE 1PWLA 3TJLA 2WXQA 1JOIA 2ZFAA 4E38A 4HIEB 3QUKB 4WFGE 3LDBC 3G24A 2W5FA 3KLHD 4R4NC 4JICA 5F7UA 5IXEA 5BNXD 3DZ1A 4MRBA 1V5XA 1KCWA 1FBAA 5B22A 3IVUA 2F53A 1G7IA 2OS7A 2CD0A 5EBMA 4PJFE 3ORJA 3US9A 4CQBA 4CBZA 2JB6B 1BAFL 5HDQL 4DK6A 3RYMA 4TX8A 1AHKA 3OYXA 4PA8A 3CMFA 1RPKA 2VFGA 1HSAB 1WXJA 3WJMA 2WZTA 3JT0A 5D7JA 1JGMA 1SY6H 2DEYX 2VZ1A 2BDQA 4LF2A 2XZ9A 3RKPA 4HCDA 1T21B 2QQLL 3UDWC 1NC4D 3NQCA 3ELQA 3N4AA 5EEUA 1NDGA 4AMKL 1AYOA 4U2YA 3RURA 4F2TA 3STGA 3IDGA 3IJYB 3PPEA 3PZ9A 1B90A 4Y9PA 3JTSA 1EB3A 2XIOA 4XNUL 4M4RB 2R2HA 4DZ8A 4OOUA 3KHDA 1NF7A 3Q6GL 1ORSB 2HKHL 1J9TA 1SJHA 1T4KA 3ZWTA 4QHPA 4P2QA 3MLXL 4X7SL 1UEMA 3LRLA 1VFBB 4BDVA 5DC4B 3GDBA 4XNMA 2ZX9A 4POZD 1NF0A 3NJ3A 4WVXA 4N5EC 5C07E 3EGXA 2VEGA 1P1VA 4GG6E 3SGGA 2EPNA 1KTLB 2ARJA 4LSSH 5KYUA 2C3VB 5SX4H 1LP9A 3RAOA 5FYKE 4RW5A 2W81C 2B4CL 3TR2A 2QCHA 4CNNA 3M86A 2FAUA 3D3VE 3RDTC 2ESCA 3O9WA 2GK1B 4D3CH 2BS9A 2VM9A 3MJGX 2ZX8A 3GIZH 3PGDB 4MZRA 4OB5L 2YCIX 4TOQA 4IBQA 3TVMC 5HWNA 5GNZA 1TX0A 3VG9C 3PHAA 5E7FA 3VNIA 3Q3GA 4ZEPA 2W6RA 1X1OA 5DQDL 5HHXH 1QSFB 3PGFH 2X9WA 4NKOA 5GRWA 2MANA 1BZOA 1R3KA 1U8QA 3U6WA 3NSNA 1E72M 2H26A 5AHNA 5F2MA 3L48A 1F3DH 3K2IA 3S1UA 5F96L 5CIPB 2NNFA 3MVTA 3P73B 2Z1PA 5EIIA 2VTFA 3REWA 3QFGA 4QIRA 3V0TA 1FPTL 1YSOA 3CNKA 1DKWA 2J9ZA 3PY9A 2CO1A 5I26A 3HPSA 3I50H 1AKJD 3MV7A 5BV7H 1ZTMA 4OT1H 3WGVB 4FTVE 1P5BA 5BRBA 1WCGA 2ICES 1Z2KA 4CL7A 1XH0A 5DT7A 2ESVE 1E6JH 2DIJA 5I8CB 1R2RA 4CCCA 3N04A 1OPGH 4Y7OC 3SN4A 3OJMB 3TZVC 1M01A 1TTQA 4ANKA 1Y6MR 4LS0A 4J3OH 4LPYA 2NW0A 4AYEC 5EG6C 5GS1B 3QFJE 4S0TD 4HZ6A 4X98B 3GWQA 2OQJA 4GMSL 4IRJD 1X3DA 4BKSC 4LV9A 4M0XA 3CVCA 2EYRA 1O7DC 1J1PH 1FDYA 3L5XL 5SWZB 1RZJH 1NUDA 3N3MA 2VDQB 2EABA 1JPHA 4MDRA 1AZRA 2UWEB 2J25A 2XH7A 2X4UA 3PU7A 3L9EA 3CC5A 8TIMA 4X2UA 4UOQA 3L9CA 5F6IC 2K6WA 1A9EB 3GGWA 4KROB 1OK4A 5DK2B 2KC0A 4H6QA 5IT2H 2W0PA 2XXMB 5CAKA 5DFTA 3FRPB 4QRSA 5KS9A 1P9MC 5H37A 3NJMA 2L8AA 2AITA 3WDJA 3VXPA 4JQIL 3D4ZA 3W7GA 1T83C 1XF2B 3FQTB 3PWJA 4AQ1C 1UA7A 4UFIA 1GSMA 4MA3B 3WD0A 1TJIH 4XRCB 1NIBA 2RCSH 1IR1A 4JO2L 2QVKA 2X4RB 3VWJB 4PV8B 5BW6A 3ATBA 4MA1B 4QSHA 3GNRA 5IK3A 3BZFB 2NPLX 4WW1A 3LHPH 3C0QA 3FX4A 4HHGA 2PTXA 4N9EA 4NNYA 5G1YA 2LVCA 4XAPA 4Q4IA 5IBXA 1C08A 2PLCA 4PGDB 5FGRA 3CHVA 3KXFA 3DV6A 5FGCE 3A6BH 5ID0B 4L4LA 1Q8MA 1WOBA 5EULV 2AK4E 2GVEA 3ZVHA 1H41A 4XNXH 1OPOA 3USBA 4U4MA 1I8MB 2CK2A 4XD3A 5FHBH 1M04A 3N19B 4M1CC 2Q6ZA 4IJ3B 4N3TA 3CV7A 1QNRA 3NEHA 3FMGH 2WZPD 8RUCA 1GYAA 2A21A 2HVNA 4YGVB 2ZKHL 4L37B 4XPGH 2Z31A 3GT6A 3SQOH 4X9IA 1JHTB 2OSYA 3GJFA 2W94A 5K59E 3DJTA 3MRMB 4JY9A 3SW6A 4PP1C 2INEA 5I79A 1UOVA 3II3A 3MBWA 4IXXA 3BQUB 2FK9A 4N8CL 2BNQE 4N2YA 1DJSA 1K6WA 4WZHA 3IJDA 1NCTA 3B40A 4WJXA 1T40A 1W0YT 4XUYA 4K3GA 4FAMA 2PYED 3EUUA 1ZJBA 3B8DA 1IQWL 3TYZA 3V0SA 2UVEA 4CD8A 3O3BA 1N59A 2P5ED 4QHKI 1H6TA 5E2UL 4M56A 4J7RA 2JIWA 4HS8L 4PJ9D 2BP5M 4MD4A 2V2DA 4B5VA 2JCCF 2YD8A 1FAIH 1KCVH 1JPFA 4H9ZA 1CLYL 5C0CD 4I88A 1W1TA 2CSPA 4YIWA 2IPUG 4UOW0 1F61A 1W5OA 3UBPC 4DUWA 1QLEH 1IE4A 1KPVA 4HU3A 3C0JA 5IG7A 1ECYA 3EO1B 4OAWA 3TO4C 2DGAA 3S3GA 1HX0A 2HVJB 4S38A 4X0KA 2R82A 1XCTA 2JKAA 1I1CA 4G2DA 4TF4A 1JFHA 1II4E 5I19H 2OXNA 1MQRA 3WKQA 5MF5A 5F9WB 2PDJA 1EAPB 3DAQA 2NLIA 4XO6A 1GS7A 5AZEH 1TJXA 2XNAB 1Z3NA 2VCBA 3LCFA 1W3KA 5B1AB 1A6VL 2QGBA 3V7AE 5FD0A 1BBDL 2R56H 4H0HB 1BG1A 3M5ZA 1WWWX 3H1ZA 3UWEA 4GJ1A 1T3FA 3QTGA 4M6QA 4N2AA 2F8VA 5XIAA 1I75A 5E99H 3RY6A 1LM8V 1R19A 1TF4A 1CVRA 1KM1A 5D8ZA 1RUMH 2YMXH 2VWSA 4UTCA 5E2TH 1F0LA 3ROLA 4D6EA 2EECA 4PJGF 3TBSA 5F9JA 1TTFA 4FQQB 4IU3B 3DHJA 1ITUA 3GU1A 4U1GC 8XIMA 2DM4A 1OE1A 5CJXC 5J1AB 1G6VK 3WF0A 1RHHB 3HE6D 4BQCA 5I8EA 3QULA 1ZSHA 3PL6D 2IJ0C 5F9OH 3RL2A 4MMZA 1IC4H 5LQBH 3WL9A 3FTGA 3NIGF 2NYYD 4BCYA 4FF9A 3KBJA 5H6HA 1NGYB 2DJXA 3BLEA 1HXYA 4AW7A 1J10A 1I0DA 3P81A 1PDKB 2HA1A 4PJ7B 4G5ZL 4MYWB 4GZ7A 4AK2A 1AD4A 3VXSB 1F6KA 3WE1A 4IIDA 5I3KA 1QXLA 2XT1B 5F0MB 1NP2A 1DJWA 4OLVH 5TGBB 3W0WB 3UXIA 4AVOA 4L9XA 1KPRA 3LVEA 1N55A 4KIRA 3TCLB 5CEYA 4P05A 4TO8A 1TYJA 4MDOA 2DUAA 5DC0A 2CCWA 1PTZA 5K9JH 4RR4A 1Z0NA 2BVWA 3CDZB 2V3EA 3QNXA 1SXNA 3H3PH 1OB1B 3BAIA 2QV5A 2MTPA 4U33A 1K6QH 1UR2A 2R4SH 2WWOA 3EWCA 2X2JA 2DQDL 3W56A 1LBLA 4R97B 3D48R 1F58H 4IUGA 1KFAL 4EXAA 1DJNA 2DW7A 5I82A 2J6VA 1T04B 1IXQA 3K6SA 2DQFB 1VBUA 2CIIB 3JSSA 3SDXA 4KK6D 2XQYG 4FP1A 2VSMB 4K07A 4M93B 4NUMA 3GRIA 4GYBA 1EA9C 1A64A 4YJZL 4HB7A 5BOJA 3K2MC 5KZEA 1QCWA 4JZJB 3X1FA 1P7QA 2OX1A 4KWVA 1KJ3H 5BOEA 4PGEA 5F1SA 1J05B 3IDIB 2FIKA 1TELA 3JUZA 2VGBA 3V0WH 3V0AC 3OG4B 2RALA 4EBQH 1IIKA 5BU9A 1LWJA 4QKTA 2NW3B 2DF3A 1MZYA 4NP9A 5AW0B 4BUQA 3E74A 1Q5MA 35C8H 4LPTA 3HOJA 1AK5A 4ZW8A 4NUGL 1IVLA 2RQ8A 1EF3A 1C7SA 4FQJL 1YVLA 5D96B 3AUVA 3MRFA 1XX9C 4H8PA 1KENL 3H0TB 4WY0B 1IC1A 3NOYA 2CWNA 3P54A 1BVKA 5C09B 3T4YA 4ZVJA 3M1BB 3UNDA 2DDQH 4LYRA 2FD6H 2R14A 1SO4A 5KVEE 4R7WA 2GEEA 2NWSA 1NUGA 1BYAA 3C6LA 3H7BA 4LDCA 4MRCA 1XJBA 4IHOA 3RPKA 1XGYH 4DJFC 4W9LC 1FNEB 4LX4A 4R83A 4RNRB 2XQBL 2R39A 2B08A 1G4SA 2FO1A 1A14H 1P5UC 1AGCA 4XP4H 2E68A 3IAGC 4LOEA 4MKSA 4KI5C 4HNCA 3E0FA 4LF1A 1WTGT 2E46A 4OLUL 2TRHA 1S3KH 2YL5A 5JXQA 5DXWA 1X5JA 4IS6B 2WXMA 2PDKA 3VC5A 2R23A 3BLKA 1QT1A 3NA4A 2GJXB 4LAJH 3K3QA 1V3MA 3RWDB 2IEPA 1GZJA 4YVUA 4QXGL 1WC7B 2HG5A 4JG0L 3S37L 2GSIA 5T1KA 1RVFH 2JJTA 3L3HA 2PU1A 2AL2A 3QEUB 4YLBA 4LL9A 1RIVL 3HB3D 3AFBA 1JI1A 3Q45A 1DORA 3O4LD 3JWNG 1YNTB 3SE9H 4ANXA 4WHDA 3RLVA 2X1WL 2ADAA 1Z32X 4FR6A 1L0QA 2NV2A 3OZ9H 1ZKAA 1VP5A 3ENEA 3TU9A 1U3HD 2G75A 3N55A 4C1NB 4BCZA 1WBYA 2XDHA 2ZCKL 3FUNA 4QTIH 1DL7H 4MJJA 4OUUB 1I1YB 3WIFA 4HCHA 1BFVL 2EJ1A 1H6EA 2YRBA 1RZIA 4ZX5A 4ELMB 2Q76A 4WUUB 3Q8FA 3WELA 3JTTA 1JNNL 4G56A 1JTTA 3RJYA 1ZS2A 1ZT4B 2CIKB 3HB9A 4MNHA 4LWWA 4WSHA 4G6FD 1O5KA 4AC7C 1AGEA 3MRQB 5I3JA 3SPVA 4R3SB 1GTNA 2G2RB 5FIEA 2XFWA 2ADGA 1RA5A 4H88L 2DQCL 3F84A 4I0KA 4K9EH 4UTMA 4RW3A 4YDVA 3O6KH 2X6BA 4HK0A 4GAJH 2ZCHH 4M5SA 5AVHA 2EXWD 4S39A 1JYXA 1PG7W 1EJOL 5JIHA 4AUJA 3BKML 3T78A 5DHEA 4C47A 4F3FA 2OCJA 1T0NB 4QRPB 2QCFA 3N2BA 5DMKA 1NCJA 3V1PA 5KYNA 3K1KC 4NQDE 2R1XB 4UM9B 5C3TA 1YEJL 5CP3A 1RIHH 4LAQH 2OP4H 5TDPB 5FJOA 2F7FA 3I02B 4JRYE 3VIHA 2NX1A 2CZNA 3TQVA 1K4DB 1EHNA 2EZ0C 1O7AA 4MIMA 3V4PL 4Q6YA 5FAAA 1XX1A 1ZHBB 3GIVB 3GIYA 3M45A 3IEBA 3Q2DA 1GPOH 4WEBL 1WWCA 3O0RH 2CQVA 4EPKA 5SV4A 4R0LA 3PZUA 3DH7A 3KPSA 2YDSA 3KUMA 5HNTA 1KG0B 3IDJA 4A22A 3GRBA 1NBZB 2D31B 4IDJL 1NMBL 3S2MA 3QORA 3GI8H 4PTUB 1CICC 4G8IA 1QR1A 1ADQA 4ZAKD 1BD2D 3HG0A 3PAZA 2QPXA 3BAKA 3Q9QA 3LNFA 1D7KA 1FH2A 3QEHA 1YKWA 4ODSL 4GYKA 3RGVB 3KRUA 4C6IA 3LNPA 3APYA 3MRKA 3JW7A 2P42B 2BWGA 4NFDA 2OJEB 4NQSB 8A3HA 4DFIA 3PGCB 3O15A 1ACXA 5ANMA 5DD6A 3PPCA 2QJNA 3WMLA 4TN9A 5BOFA 3T08A 1B54A 1XR9B 3A23A 5ABEA 2RHEA 3ARGB 1MFAL 4ZXBD 2J7GA 4JO3L 4OT7A 3D1MC 1FVDB 4G1MB 3MDWA 5ALCH 6TAAA 4XZWA 1DYZA 1GKQA 1NDTA 2DEPA 1TSRA 2BWQA 2NY1C 4J2MA 1ALDA 3H9ZA 5C08E 5F44A 4LCWE 3MKGA 5B39B 1KLFB 2W79A 3FU6A 2ASHA 3EDDA 3DFPA 2W5PA 1G7PB 4H26B 5GGVY 4QEEA 5MERB 3WU1A 3KPRE 4Q8NA 4X5LA 2F53D 2H2PC 4XZ9A 1WYIA 4PTXA 3EZ4A 4YXHL 4UFMA 3NR0A 3PABB 4C83A 4YQXL 2IPTH 2F7PA 3BKCH 1SM9A 1EL3A 3FN0L 2BNRA 3M0LA 3AXIA 3N2MA 1GQNA 4LLVB 5D2LA 3ISWA 5CLZA 1OX4A 1PVHA 4DHLA 1TPC1 5I1CH 5D7JD 1MRDH 4IJRA 4RFNC 2E6PA 2XINA 3RVTC 3OQEA 1FRGL 3REVA 3FTVA 1DBKH 3BFWA 4R5EA 4JTSA 1WTLA 2IS7A 3QDMB 3TC3A 3U8GA 2ZRXA 2A74C 3QYQA 1INEL 3BZDA 4RRPA 4JUSA 1JBJA 5D2NA 3SBRA 1D7FA 5I6XC 2M26A 4E2BA 5ABZA 4IIHA 2ROYA 2CALA 3FYEB 5L4MA 3RM8A 4TUOB 1QPNA 2IGTA 3BQ5A 5CP7B 1H15A 4G2AA 2H90A 4NNXB 2KZ1B 3BV7A 4DP4X 4A2MA 3BL3A 4F0HA 2J8FA 3B2VL 3QMTA 5D7EA 3MKCA 3ZT6A 2EXTA 4IBYA 3RQ3A 4U1JA 1HWWA 1CT8B 3SJVB 5EMYA 1PFCA 4L6OA 4P2QD 5GJSH 4PMRA 1KLUB 5JPMA 2ZOXA 3EJSA 2WLNA 3OKOA 5D9NA 4UT6H 4K8RL 2J8UB 1TETL 4P4KA 4TUJA 5C0RL 4M5YH 2QPUA 5T5NG 3OXRA 1GVSA 3BDKA 5JOFA 4PIBA 1TPH1 1LUCA 1NSJA 3MGOA 4IDLA 1UWGH 3MO1A 2PEVA 2GKIA 2WYHA 4HIXH 2IAMC 5KSAC 2DZPA 2XOTA 2HJFB 4LASL 3F7KA 1IZJA 3B7YA 4MJ6B 3O9WD 1FH5H 3OQRA 4XBGB 2GK0A 4YSUA 3NVDA 1PLBA 2GC7C 3F4NA 3RWGB 4PJEA 4Q7BA 3C5JB 2V5MA 2FWLB 1KKRA 4FNSA 5AUMA 1OK0A 1RLBA 3T6VA 1XXFC 3O6FC 1NPJA 4JUTA 2H3KA 2FPVA 4R4FH 4UR7A 4I18A 4DZHA 1SFJA 4WEMB 2XWTA 3TX4A 3PS7A 4KY2A 3QHOA 1U8OB 3HZMB 2IDTA 4OM1H 4AENA 3PBGA 4EN3B 3EGDB 2OMXB 5AOIA 1UR4A 1SJCA 4RNFA 4B5ZA 4A2SA 2OXGB 2HLFD 3U1SH 3NQ7A 1H7NA 4PJDE 1C16A 1VGKA 4KVCH 3S48A 5D6DA 5FESA 1GYCA 1KXHA 2GJ6B 4U1IA 4PWEA 3VTMA 4RRPM 3O0FA 3MV7D 1YY9D 3VJ6A 3UR8A 1A22B 5JIPA 1EV2E 4IKIA 3F5LA 4OJFH 3QNYB 4PJ7F 3O2VH 4Y8DC 2XGZA 4Z2HA 2Z1WA 3AWEA 3FB7A 3NZ8A 1OAXL 1V6TA 2CHZA 2J88L 1XS2A 5INDA 1OAZL 2GGEA 2NX5A 3VFWB 1EJVC 2FZDA 3VRLF 5E08H 3SCTA 4D72A 4ENEC 2X40A 4D0CB 4FG6C 4R34A 1W8NA 4PS4H 5E8DL 3D8MA 2XFRA 1MUWA 1GHFL 3PG8A 2UZXA 3E2SA 4UUJB 4A39A 2WLLA 1YQVH 1L5GB 1F6LL 4X6DA 4AM0A 2EDWA 3HMCA 3BIKB 3O2DA 1QRNE 5E1QA 4I1PA 3ARVA 1FWFC 3IDNB 2Q6WA 2QKIB 5A16A 1OWRM 2MHAB 2G3FA 4DZAA 4UV7L 3BISA 3GR4A 4CSZA 1H8OA 3QQ3B 1Z9AA 5IVXA 4IGNA 4BH8A 1C1EL 4NJHA 2X53A 3GKWL 3CT2A 5DRWB 1N64L 2QSVA 3ULSB 5FF6B 1WCBB 1PEZA 2Y25A 1BKHA 4O8RA 3DO4A 3WLLA 3UC2A 5ITBH 1GR7A 1MH5A 1I7RA 2AXWA 4AKPA 4FG2A 4MAVA 4Q58C 2ZP0T 4K15A 3C5XA 4KS0A 3E0IA 3SAZA 3EJJX 1CDUA 2ACQA 1NANI 1M7DA 4HHLA 5DUPH 2PP9A 1WEJL 4MD0B 1FNGB 1EJWC 3KXFD 1JZHA 5HYJE 1GL4B 3WUWG 1UP2A 3D39A 1I1AA 2J8OA 1ACYL 1FWTA 3NSDA 4Y1SA 5HDLA 4ZS7L 9RUBA 3WN5B 3UCRA 3WXWH 3TC6A 1SYSA 3S4SB 4OM0H 5DQ9A 5E0CA 2O5YL 1X9RA 1X5MA 1P7BA 1PPIA 4L8CB 2Z31D 1KTCA 1QVOA 2ZOKA 5CLWA 1PU0A 4IRSB 4JFFA 4EI5A 1NELA 2GOKA 3DPBA 3PSWA 1JCLA 2BIHA 2JKEA 4YDIL 1MFCL 1YDYA 3G18A 4MJZA 3INOA 2A5UA 2J66A 4I89A 3KM1A 4BFRA 4WV1C 4KXCA 3W9ZA 3W6LA 2WQAA 1K02A 1NQ6A 4RDZA 2AQRA 1ZLPA 4EOWH 1T03H 3RHWK 3EWUA 4RH4A 3WMSA 4ZUTA 3VYNA 1T1YA 1ASPA 2DLGA 1O95A 3PAUA 4FHBD 5TNVA 4FABH 1OF8A 2G60H 4PVLA 4MWAE 4DKFL 2R2EB 4FXKC 1MCNA 1YNTF 3GTTA 2AQVA 5GS0H 3X11B 3G0UA 2BXYA 4IF2A 2VXQL 2VQ4A 2Y63A 4QCIA 1F3XA 5H35A 3NO5A 5I5JA 3WLWD 4YXKL 3CLFL 4JFTA 2ZRWA 5I1KH 4PREA 1U5VA 5AFAA 2EADA 4QHRA 1VADB 3NCWA 1B31A 4EI0A 2AJ3B 3TPKA 1CEOA 3NK3A 4AZIA 1IM9A 4L3CB 2P5WE 4EPBC 4PB9L 1DN0A 3VI3E 3W02A 4K3JH 3KLAB 1F8TH 3IS4A 3DRTA 5LGJB 4WD0A 4REQA 1XGRB 1S7UA 1UXWA 3H2AA 2NY3C 3IF1A 1D3CA 1W0VB 2VGIA 4Z2KA 2Y1AA 3MACH 4NT6B 4G43B 3TXVA 5JTWA 3C60A 4UILH 2CRMA 3QEGH 3OTTA 2PA6A 2D24A 4EX4A 5DFWH 2BX5A 3VXTB 4ZUVA 2CLIA 1A7BA 3DMMB 2MKWA 4BKLA 3G77A 3QHFH 3H85A 3HC0A 4WSGA 3F85A 3R12A 2PPDA 1N19A 2WZMA 3H3BC 3NPXA 5E8OA 2BHUA 5TE6H 2GUOA 4Q9BA 3T3PB 3VQ2C 1H49A 4PLJC 4OU1A 3KLDA 4MQ7B 3SCUA 1TVLA 4UF7C 4JTRA 1AY1L 3MV9E 2H6PB 3CQQA 4PJ5B 2CMRH 4UMGA 4OZGB 5IQMA 4NNCA 3E3QE 1AXSB 4HEPA 1E7UA 1EF2A 3SPJA 3KS0J 1X6NA 4ICXA 2VCAA 2Z0IA 3HAEH 1UH2A 3MRRB 4PCTA 1B4JL 3RIFF 2QUMA 1WAPA 3L6FB 2DT3A 3AJ7A 3MXVH 4GP4B 3G6JE 1AS8A 5F3HB 5AW7B 5MEOA 4L05A 2J47A 3QY8A 4MMXC 3H7RA 1XCQB 1UZ6F 1L7TL 4XAYA 1FZOA 2AGKA 1SJBA 5B38G 1S8DA 3KLKA 5AG8A 3S96B 2AC0A 2VLKA 2D7OA 3LNDA 5L2KA 3KVKA 1J87A 2YAFA 2Q3OA 4I3SL 5L6UA 2OMYA 1KGJA 2WZEA 4NWUH 1F3EA 4I4WB 4G59C 1FLTX 3VVVA 2V5TA 4GKZA 1WKDA 1KBJA 2Z28A 1KTRL 4RJEA 3DX4A 4LT9A 4ZPVA 3IJSA 3A24A 2P8CA 5E5RB 4KDWA 2IANA 2COQA 5JW5B 4QGYA 5AVNA 2ZOTA 1R5VB 4RFEA 1OWQA 4GUQA 4WI2A 4NZ1A 4F40A 3NRPA 3GFXA 4P3DA 1P7QD 2R24A 3CO8A 4YEEA 1UR9A 2NQHA 4W9TA 3HRZC 2EDNA 1J0JA 4ASTA 3G6DL 4LO9A 2VW4A 4Z7NB 2DUXA 2P5PA 2OO6A 1I9JL 2CCVA 3DGGA 3ISRA 4JN2B 4XNBA 3H8AA 3DGBA 3RTLA 1EXHA 3M88A 4JKLA 2NQCA 4JFEB 1OFPA 4CADA 4GLRI 4HHAB 4UBDD 3UPRB 3B9AA 2ADJB 2FEEL 5A3ID 4HHPA 3V2AR 3FQXA 1CXIA 3A64A 1OCCB 1A4JB 2CBJA 2ZA1A 4QRRA 2EYSA 2XTJE 3NVTA 4YZFE 1MJJB 4OCYL 3MLZL 4LSQH 1SBSL 2RFXA 2HT2D 1A6WL 2BB0A 1SRDA 2MNJB 1QOPA 3OZMA 1UB5A 1MRFL 4OE7A 3QDJA 3C6LD 1GA2A 3WOVA 3TO2A 3BWAA 1GZQB 1E1FA 4QQ3A 5DS2A 5DVNA 2MNUA 1ORQA 3FJ6A 1M57B 4IM8A 2PWHA 4XE5B 2G50A 3GIQA 5ESAA 1CLCA 5I24A 2APFA 3MREB 4PLKD 1YTDA 2BVDA 3WFCH 4PG2C 2WIIA 5A2FA 4Y88A 3BKJH 1RZQA 1QP1A 3EJYD 1P4CA 5TF1L 3J2PA 1H3GA 2WTRB 4ACZB 4DJDA 1E6OH 3WUZA 1PQZB 4HA3A 5KN5A 3WCZA 3OODA 1UA6L 4JM2A 2G5UA 2YQ2A 2UY7A 3BLIA 1LDCA 1INQA 2Y6ZA 3NAAH 3EO9H 5T1KD 3WTXA 1QQDA 2C26A 4ZTPH 2FH8A 3KFTA 2Z93B 1AJZA 4GSDH 2QHAA 5FJPA 1T66C 3G5VB 2FVMA 5DRXB 4ACPA 1DDHB 5DY2A 1DXIA 3ITTA 5T3XD 1OFRA 1QMLA 1RMFH 2Y5TA 4XC3L 4HJ0C 2OPCA 1IGCL 4IRZA 4K37A 3MHGA 2IWEA 1FFPA 4GFTB 1UCBH 5BRQA 2E6FA 1R5WA 4AIXA 1UB6B 2J7DA 4KRZA 4XBEL 2DLFH 1RI8A 1G9HA 4FFVD 1JXFA 1OZUA 4KEUA 1F4YL 4WTZA 4NAMA 3F00A 4NUWA 2PO6A 2WB7A 1AE6L 2I9LB 4ZJ9A 1N67A 4P9HL 1BZQK 1GPFA 2XX1A 3UTTA 2VYOA 5EOQH 4PGJA 4DP2X 4NHUA 4NKDA 2YRLA 1MPAH 1QPXA 2AQSA 2L3BA 4ZMTA 2Y2TA 1FG9C 3LOWA 3SCNA 4RMBA 5CHNB 3O45B 4CEUC 3I75B 2EF9A 3MMEB 1PKQE 2VVSA 2WQWA 4OD3H 3RVXD 4LEQA 3G5EA 2QJGA 2PR4L 5I23A 1CFVL 3MUGA 4RLDA 5HXMA 4ORZC 3X13B 4L1SA 4F8QA 1FDLH 1BQ5A 4KHTH 3SGKA 1EFQA 3VXNA 3PPGA 4BE6A 3GC4A 2EBNA 2AQQA 1NBQA 4U1NB 1TTCA 2ZD0A 4M1RA 4M6MH 4N2OA 5C2XA 4Z1YA 1CDYA 4BWUA 5HDRA 1WT5C 4NRZB 3F6JA 5KINA 4NHCL 1X5LA 4NOFA 2V2CA 4O4WA 3MZNA 5I1EH 1Q9LA 5CAHA 3QIBB 3FU0A 2QGYA 5DUBA 4Z8FL 1V0MA 3KPSD 3QZWB 4D9LL 4OLZL 1TR1A 3LKSA 1IAOB 4JQVA 4QRQB 3UZEC 4RZCA 3NJLA 4Z0BL 3HURA 2OGJA 3QORD 2EDLA 1HHHA 4HJJL 1G5AA 3RAJL 1BG9A 3U9UA 1M7IB 4HMDA 3SO3B 1CF1A 4CUCA 3GSVA 1QI2A 2FVLA 2X1QA 3UXFA 1AA1B 3CB3A 2YSSA 2F6KA 1O75A 5K33A 3CHXA 4ICCX 1A53A 4C6PA 3BQVA 4UTAA 1RJCA 3CPLA 3OKEB 2AXFA 4GEIA 4Z1PA 2WSPA 5DMJB 5D7KD 2YWYA 4PGBA 4JM4H 5JORB 3LN4A 1MHPH 4HP5A 1PHWA 3TBVA 3GMNA 2Z2BA 1KIUA 5D1QA 2VDGA 2A6DB 1R3TA 4OZFA 3W75A 2X9XA 3ZN6A 2TPSA 1VFAB 4Z7OF 2ZONA 3XIMA 1FYHB 1I4FA 5L7XH 5GS1C 4UIKH 1PAZA 3EX3A 5AVTB 2K9UA 2BASA 4IIBA 4DZ5A 2WWCA 5F7EH 4JEJA 1CGSL 2VWTA 3ID7A 4FYSA 2YIHA 5A8QA 3LQGA 2DZUA 3STEA 4QHMB 3W11D 1NP0A 2WCSA 4FNPA 2UY4A 2PMQA 2BNRD 5LVEA 4XVUD 3QFDB 4N28A 2AW2A 5CJNA 3G22A 6XIAA 3B3BA 3KBMA 3D0VB 3ZKXC 2E7MA 1NMAL 4G9FE 3BH9A 1XIHA 3CFDB 5AC4A 1SU5A 1Q7ZA 1BGXL 4KNQA 2PW1B 5E6UB 4X4XB 2Z1VA 2MTAA 5EA0L 1MCKA 2QCLA 3MGAA 3X17A 4Y90A 2BERA 1M53A 4HXAL 4W70A 1K8YA 4AYFB 3MLSH 2G0LA 4A2GA 4L9YA 1LEGA 2WWKO 4TNWF 3DI1A 3TTQA 1MEHA 5CUSH 1CL7H 1AQDA 3IJ7A 4DBSA 4MA1C 4MWFB 5DCBA 1G4TA 3H26A 3BO8A 2F15A 3R18A 1D5ZA 4XZIA 3SE8H 3GUTA 3W6MA 2CBTA 2UZIL 4W5UA 4KK5C 5FDWB 2VABA 5FM5O 4AG4H 3ZGIA 3BWUF 3BXNA 2JI1A 5D4QA 3B5HA 4P5MA 1GKPA 4GUCA 1NCCL 1A0DA 3P9LA 4AHPA 2X4SA 4PH6A 3T0EB 4YSQA 4CNUA 3RWCB 4P4KD 4Q4OA 1SEBB 3F7VA 2OJPA 1JF6A 4UAHA 1X5ZA 1E6SM 1EEYB 2VFFA 2G4GA 4C60A 4IJ3C 1MRCL 5IMKB 1S78C 5EF1A 5FKYA 2CLOA 1UUQA 1XMWA 1JZ2A 3QJFB 1OTTC 4E8CA 4X9SA 3EOEA 3B9DA 2C9PA 3F6IA 4QITA 2ALDA 1AG0A 3SUVA 1BSIA 3QZPA 5F8QC 3OF6A 2CBVA 1V08A 2EH7H 5DMGD 1SLVA 1BWMA 5I71B 3BDYH 1Y5VA 3C3UA 4HUVA 1V02E 1B3IA 1G9NH 2BSSA 1HCVA 4G8EA 3LIZL 1B4LA 1TPUA 3V4VB 1WZ1H 4OJEH 2YZ1A 4KQ3L 4PJAA 5J9PA 3GH7A 4JO4H 3T4AB 3RI5K 4J3BA 4Z95H 1KCSL 1RJRA 3FO9A 1WUEA 3AU0A 2FYYA 4LBSA 2K7PA 4TVPD 4K8RC 3EH2A 3WL1A 1YMMA 4IOFD 1USQA 3MUHL 1KDIA 1B6DA 2TRYA 3SGZA 1U95A 4MJMA 2J1ZA 4P2VA 3LZFL 2ZYSA 4H8WL 1O1ZA 3NFNA 3W5MA 4BCEA 4MZ2A 1XZ0A 3IK2A 4Z7VA 1HJQA 3F62A 4KWSA 2R7EB 5AVXB 4PCYA 3CPUA 4WWNA 4J6RL 3MTXA 4LSUH 1O6SA 3QQ9D 3P93A 1BJ1J 4R7JA 2DEXX 4WI9A 1OANA 4EF3A 3E8UL 3AMKA 2NX5D 3ZM8A 3VZXA 3TOYA 5I75C 3IXAA 1CDCA 4S3GA 1B4RA 3JZ7A 2QYGA 4O2EA 1A7OL 4GAGH 3QO1B 4TTDC 2Z27A 4UINL 2OW7A 1NINA 1JK9A 2YQBA 1SZNA 2NW2A 1QSEE 4DVBA 1Z44A 1U9KA 1BQHB 4KTYA 1IKFH 3N0AA 3P77B 4NZJA 2EVGA 4G3YL 1UD8A 3STLB 1SVZA 4GAFB 3GSRB 1JCYA 5DHVB 3EO0A 5EUOB 1U33A 1BPVA 4ODHL 6XIMA 4O0QA 4M1DL 3WUGA 3V9FA 3GW0A 4QSFA 5HI4D 4GG8B 3TCSA 3CFBA 3ILQD 2BS71 3KL5A 4G6MH 4MYXA 4OF3A 1AJ0A 2V69A 3OAYK 4JQ1A 1VBGA 3VXGA 3E6FA 1QK0A 3BANA 3FQRB 4JDTH 1NTDA 2WOYA 4S3BA 2OMAA 3MTWA 3PWPB 5JNYB 2NY6B 1YIXA 3AIVA 4R33A 3MRPA 2L7EA 4JNYA 5LHEA 4AJVA 4F7KA 4G7YL 3BP4B 2R1PA 3T09A 2KAUC 5MP6H 2VKZG 4TVDA 4FIQA 3QR1A 2QMKA 5DGQA 1E4XH 5E2WH 1EDHA 4AE1A 3D39D 1VGAA 2JCCA 4YBQD 2R69H 3FS2A 4NB7A 1K7XA 1JJUA 1X9LA 2FATL 1F6YA 4UWQB 2ZKXA 1I1AD 3T1FB 4ZG1A 4MYAA 1B0GB 5DCCA 3WDIA 3QXUA 1H3TA 4JXCA 3L3OA 2GTZB 2YB1A 3I6RA 4YYCA 2PLJA 3ZHFA 1IIIA 1JN6B 3F7JA 5BZDA 2WLIA 4LQFH 4KTGA 2WXPA 4FLSA 1MKFA 3CFJB 3IMTA 1IT8A 4MUPA 4JFFD 4EI5D 5ERWB 2ZAHA 5C6MA 1J5OL 4QO1B 3TFBA 1PZAA 1IUZA 4MMWA 1HEZB 4B5NA 1EZ2A 3CSYA 4KRPB 4LUYA 2ENPA 2JKJA 1OAJA 1XGQA 4GC3A 3A22A 1BLIA 5CZVL 4HXBH 4HBCH 1SEQL 4N90D 1ZBCA 1I8UA 5D5MF 3W3OA 4OGYL 3B0YA 3VB8A 3TA4D 2MOVA 3VUSA 6FABL 3W2DL 4NSKB 5JR1H 1NBVH 1GMEA 4WQ6A 2HX8A 1TQCC 3RRQA 3FB5B 2FFCA 1E6QM 3O06A 4W9CC 4NKIH 3EWYA 2QIWA 4CMHB 3HZYB 3QCTL 1V3IA 1AG1O 1YW1A 3TC9A 2E27H 4NI8A 5F1KC 2FHFA 3TYUA 2C4FU 3P4OB 1CC3A 3C3NA 4KFZC 3MJ7A 4DESA 3C6EA 3UGVA 1DQLL 2ZP8A 2GIXA 1IM9D 3IN0A 4Q14A 4OGZA 2WBJC 2XFXA 3WNPA 4JTDA 4S3FA 4IMDA 2CNYA 3GHBH 4Q6JA 5E1GA 2VKWA 3W7CA 2X9YA 1U8IA 3THUA 3AU6A 4LEFA 4NM8H 4JNMA 2GY5A 3C60D 3ABQA 3HQNA 2KZWA 5FO8B 1R2SA 2YK1H 4O18A 4CVXB 4HW6A 4L1WA 4XHJD 4NOBA 2E9IA 4C6QA 3NWRA 3GNXA 1PYMA 4PODA 2VDML 4RK8A 5MEQB 1H5VA 3DN5A 5BXSA 5B8CC 4DTGL 4A55A 5T3ZD 1HVQA 5FOOA 2J56A 2YUVA 4LMQI 1Y07A 1TCDA 4LANA 2X4OA 3IMSA 4F7EB 3WD2A 3B4NA 1XYCA 1Q7QA 3RRXA 1LEKB 3APMA 5CD5D 3ARQA 2PTTB 1E0UA 1NM9A 1GJWA 4BYHA 1E4IA 1NAKH 1P5VB 3A4XA 2XWBA 2Y36L 4AJWA 3RY5A 3X3FL 3W28A 3ITLA 2AAAA 4PRIE 1FTXA 4C59B 1RUQH 5SWSB 5FLVA 2DKSA 1HHGB 1VRSA 1SPQA 5E24E 3NCOA 2PF8A 4D1JA 2P8PB 2YJLA 5J6HA 4X50A 2PXYA 4KCUA 3DDGA 4FQXC 3IM1A 4S1SH 2YMTA 3VXRB 2OMUB 3V9CA 3EYQC 3H21A 1UH4A 2R1YA 1P48A 2MIZA 4YVVA 3T6ZA 3VXMB 1W1PA 3LYEA 1S7XB 5ALBH 3OKYA 2VLKD 1S7RA 1A5SA 3EXLA 4NZTH 4OCXL 1OIFA 1RJZA 3QZMA 5L2KD 3MX0A 4HIHB 3BMWA 3Q37A 3OJDB 4LALA 4OF7A 3PTDA 1FG2B 1OADA 4P99A 2AJUH 2WZ6A 4LAKA 1BXAA 1KBPA 4HAFA 4YH6A 4JFQA 2VZSA 2Y72A 4P07A 3M17A 4CKQA 2C13A 1OARH 4N6RA 1TTJA 3UESA 1I85C 1NJ9B 4P2YA 4MA8H 4A3HA 5TK4A 4B60A 4GFSA 1ED3A 2VLRA 4JG5A 2YBTA 4YDJA 4V2XA 1JHLL 2P8LB 4R90L 1DBBL 4PS3A 2UVFA 2IAND 3MWCA 4NGHH 1SM3H 4Q32A 1DIEA 3IU3A 4H13C 2VUYA 1COBA 2DWEA 4OFCA 4QM1A 4OCWL 3DWTA 2NTFB 2CZVA 2R6OA 3TCEA 4CVWA 1OC6A 4YBLB 1JZ3A 5HVHC 3IXTA 4GMEA 4BFIA 2P8MA 3ZE1B 3C5ZA 2EIZB 4P4RB 1MCRA 3H42L 4EUPB 1OM3H 3HBPA 4KW2A 3KPOA 3HQOA 3LEVL 4PJIB 1W72H 2WXGA 3JWOH 4WKAA 4GKOA 3TAKA 4NI3A 3NP3A 1G9EA 2WMHA 3BZ4B 3QZAA 4FJYA 1G87A 3KWTA 4MXVE 2EHHA 4ZDHB 3GSUB 4XVSH 4KTEL 4QRRD 3QW4B 3HZ3A 5EU4B 3A21A 4PBGA 4AC2A 1X4YA 2X6MA 1N10A 2CA3A 3FO1A 2OEMA 1J0HA 3MA9H 5JXAH 1OM0A 1CE6A 4Y4KC 4HK3J 1D6EA 4IP7A 3QDJD 3RGVC 1P69B 4P2RA 2JELH 3JV4A 5BMFL 3DX7A 4JPKL 1LWIA 3QDGE 3H4XA 1J9QA 1YYLH 4L8DB 1A6PA 1AGBA 3G8EA 4UB0H 3IRCA 1JF5A 5D30A 3ATDA 1IL1B 4KTDL 3KL3A 4NDMB 4AZ8A 3JBG7 1V4YA 4NLHA 1ZANH 5FF4A 2EDXA 1BQKA 3NSFA 1TQXA 1BLNB 2EKSB 2EYTA 3QUMH 1U4FA 1MJ7H 4WLCA 3DX1A 1S2VA 2YDQA 4DJDD 3VCNA 4OGAD 1JAEA 3B7RL 3MO7A 1RK6A 2GVJA 4JM2D 4YSDA 3FKKA 2EJAA 4FQLL 1BX2A 4OHQA 3EWXA 4XP6H 2V9QA 2Y8VA 3STZB 4UT7H 2VW7A 3IVKB 4JAMB 1MAML 4LCCB 2DY2A 4HJUA 4ZE4A 2F68X 2GSMB 3KHQA 3MCG1 3UDWA 5BQ7A 2A3CA 3B9OA 4GUGA 5T5FH 3KPNB 5A2LH 1AIFB 3WK2A 5A94A 2YEZA 3SRKA 3PWVA 4PJHB 3FQYA 5ICZB 2CK0H 4XMVA 3CFCL 3F05A 3V4PA 2O1AA 3G6LA 2UY5A 3PFUA 2NQ9A 5I0DA 3NCFB 3GHRA 4NZUH 3MLUH 4O10A 2WNGA 1EFXB 5FUOH 3RVWD 8XIAA 4PMFA 2DI7A 1HQTA 2A83A 4ABUA 4WY7H 5LBSH 1E2ZA 3V6ZA 5L6YH 1QOKA 2UWEF 4HQVA 2PO6D 5JPNB 4MLJA 4K38A 4DETA 2C6QA 1RBLA 3S9DB 4FNRA 2ALRA 2NY5H 3UTTD 5HK4A 1OKEA 3QNZB 2VDQL 4O57A 2XJLA 1TFPA 5EYWA 1OLZA 1NQKA 1I53A 3G04A 5DJ8B 2VDRH 1D3GA 1Q0EA 3MRLA 1YMHB 5A40E 5IIEA 4LL4A 1BAWA 4TOYH 5GNYA 4N25A 5CSUA 4MMYB 3C6SA 2O5NA 4W6WB 4AD4A 7FABH 4GMTL 4YHOH 1C3FA 5HDOA 2QQQA 4X63A 4X9GA 1M2VB 4E5TA 5TPWH 3RDTA 1DO6A 1F18A 3HPFA 1OYCA 3HZVB 2OQHA 5E4OA 1F7BA 1EGVA 3WK3A 4LCUB 3MCOA 3TVMA 1PZBA 3KPTA 3E5BA 1KC5L 3JWNH 3VKKA 4QQUA 4NPYB 2APWA 2HBVA 1AXTL 1JUEA 5IFJB 2YAEA 4P9HC 3C5QA 1PY9A 3H6JA 3PDOA 3DVNA 4OLXL 3F03K 3QH3A 3HC3L 2AMUA 1USZA 2VD9A 1NBCA 1LNUA 1TZHB 2VJXA 2MPAH 1BMGA 1WFTA 4B9JA 3NACH 3OB0K 2OA9A 4MB3A 4UXDA 5D7IE 3MSDA 3FKUS 4ZSOB 3NCYS 1L9MA 3L12A 3WAJA 4I3RL 1A0QL 2ROXA 4BFKA 1HILB 4JTTA 3P30H 2HRPL 4V1DB 5A2IH 4EN3C 2JXMA 3RVVD 2YZRA 2QSCH 4F8TA 3NSCA 3NJJA 3TZVA 1BJ8A 1WNOA 2VISB 1GT8A 2F6UA 3VZZA 1QFWH 3P3BA 1KF9B 5T9BG 2X41A 3SB0A 2DSUA 5D55A 4D8PB 5KW9H 4ODXB 3UJIL 4V11A 1JWSA 4DPCX 3OM3B 2WB1A 1KLZA 3OQ8A 4UTIA 4LVDA 3TBYB 4L4TE 4JGNA 3TBBA 4MX7A 4YL9A 1UWUA 5D1QD 1BGAA 4Y2NA 2VE6B 1KJ2A 1DVFC 1IC7H