5CXZA

Syk catalytic domain complexed with naphthyridine inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
275
structure length
269
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVTDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Orally bioavailable Syk inhibitors with activity in a rat PK/PD model.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
total genus 93
structure length 269
sequence length 275
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cxzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cxzA01
3BYMA 2V22A 2WTKC 5E8ZA 4AOIA 4KIKB 1LP4A 4FX3A 4B7TA 5TKDA 5KMIA 4UWYA 4OTRA 3DKFA 3R1YA 5HBEA 4IX4A 2BAJA 3FY2A 4NJ3A 2WU7A 5HCXA 4LYNA 1VJYA 3BQRA 1P14A 3F3TA 2J90A 2PVLA 4U5JA 5JT2A 4RA5A 1CM8A 2W7XA 3LCDA 5I9UA 2C5VA 3W8QA 4DGNA 5JMSA 4CZYB 3DV3A 4BWKA 2YM6A 3UIMA 1G5SA 3GC8A 4L00A 1JSTA 2J5FA 5TO8A 4TWOA 3A61A 5C01A 2IZSA 2HCKA 3AXWA 3IGGA 4G3CA 4TN6A 4EWHA 1KE9A 4LV8A 5EM5A 1XH8A 2HY81 3OEFX 2XBAA 3FJQE 3D83A 3OWKA 2KULA 1MP8A 4LGGA 4MH7A 3AD4A 4KIQA 3VBQA 5HI2A 2Z7SA 3QKLA 5E1EA 4M0YA 4H3PA 3RZFA 4O84A 4MVFA 2ZJWA 4FG8A 3ORIA 4O0XA 2B52A 5DR6A 4CKRA 3PY0A 4Y5QA 1W82A 3MJ1A 4DHFA 3NNXA 2GTMA 1U59A 3AT2A 5G6VA 1BLXA 2C5YA 3UQFA 3UPXA 4YSMA 3I7CA 3SG8A 4HGTA 5EQPA 4YTFA 5HNIX 1NY3A 3PXZA 3F61A 2I1MA 4JI9A 3EYGA 2X8DA 2OJIA 3B2WA 3OTUA 4J1RA 4MXOA 4RC2A 4YC3A 4IX5A 4AN2A 4DH1A 3PDTA 1JVPP 2O5KA 3CJGA 3TXOA 4XOZA 1JKSA 2ZB1A 3UYTA 4YTCA 1PXIA 3GENA 3EFWA 1OUKA 2G2HA 2XF0A 2C30A 3QQUA 4FV6A 4GV1A 4HZRA 4ZOGA 3CSVA 4KIKA 5T6KA 3L9LA 4IADA 5HG5A 3VS3A 4UZHA 5FXQA 5CEQA 2QI8A 1H1WA 2V5QA 5AP0A 4CQEA 4FGRA 2YIWA 2J0IA 1H0VA 4LUEA 4UV0A 4GFMA 3V5JA 2UZWE 2X7OA 4XJ0A 2P2HA 3KF4A 3DTCA 4CZTA 5LARA 3TZ8A 1H1RA 2PY3A 3AGLA 1LUFA 3PSBA 3HMMA 4I4FA 4ANNA 4GJ3A 4CFNA 1F5QA 1JWHA 4U79A 4RRVA 2O65A 4C61A 4YSJA 4PWNA 5IQCA 2NRUA 2OGVA 2PVHA 1URCA 4G3EA 3T3UA 5CAPA 1KE5A 1V0BA 3IW7A 1YXXA 4FVQA 4JXFA 3H4JA 4N0SA 2W4KA 3M42A 3MFRA 3NCZA 5GZ8A 4G2FA 2RFEA 3IO7A 2Z02A 2WTJA 2P3GX 4WSYA 5BPYA 2F2CB 3PXFA 4BI1A 2CGUA 3C4FA 2C47A 2VWYA 3A62A 4Q9SA 4ZSLA 1PKDA 2W9ZB 4I41A 2XH5A 3OOGA 5CF5A 2F57A 3ITZA 3VW6A 1UU3A 2PUUA 4IWPA 4U6RA 3DBEA 2ZOQA 3OCBA 4KA3A 1S9IA 3QZGA 3OT8A 3V5LA 3NNWA 1KE6A 5L6WL 1KUTA 3LCOA 4XG7A 5HQ0A 3OCGA 4CXAA 2OXYA 4M67A 1OMWA 2PULA 4W9WA 3LCTA 4JX7A 4K11A 5BX0A 3R7OA 4I0TA 4M84A 3EQFA 3DTWA 3QFVA 2YEXA 5CXHA 5LCJA 4M69A 4I24A 1W7HA 3KL8A 3NYVA 3RINA 4L6QA 3VJOA 2H9VA 1YVJA 3C4ZA 3PLSA 5K4IA 3GT8A 3ZCLA 5EW3A 4F9YA 1A9UA 4BC6A 1UU9A 2YABA 5CVFA 4G34A 1GJOA 2ETKA 4FTIA 5EK7A 3UOHA 3CQWA 5JZJA 4IIRA 4X2KA 3KULA 5BYLA 3GOKA 4AWIA 1X8BA 3QTWA 4RX8A 5I9VA 4ACMA 5HG7A 5HTIA 5I5ZA 4EH4A 1H07A 2Q0BA 3A99A 4RA4A 5I9WA 4D0XA 3HGKA 4GL9A 4GU6A 4R5SA 5HX6A 4OUCA 1PW2A 3F2NA 4MF0A 2X2LA 3AG9A 4QTAA 3A7IA 3S00A 4YJOA 4C57A 3AQVA 3ZXZA 4B4LA 2DUVA 3DU8A 5EHLA 4IBMA 2UW5A 2G2IA 3OBGA 2Q0NA 4FG7A 5E92A 1R3CA 5M4UA 4H05A 3UZRA 1OL7A 4FI1A 4S31A 3WYXA 5K4JA 5L4QA 3UOLA 3NIEA 3PWDA 4Y85A 3UE4A 3V5PA 4K0YA 3UZPA 5IQEA 4FOCA 5TOZA 5AUUA 2ZYBA 4LL0A 4CNHA 4IZAA 4DGGA 4YHFA 1FGKA 1QPJA 1YXSA 4EHEA 3Q52A 4M12A 1OZ1A 3QBNA 4BF2A 3KCFA 3IG7A 4FV4A 4C2VA 4RX9A 4RJ5A 3VJNA 1OVEA 5J9LA 4KS8A 4FODA 3MY5A 2XBJA 4GCJA 3ZLWA 4QNYA 3KXZA 2B9JA 2W1IA 3EKKA 1GAGA 4JRNA 4L8MA 1GIJA 4U80A 3F2RA 3KRXA 3R9RA 1F3MC 3OXIA 3VC4A 1R1WA 5I0BA 2G01A 3GQIA 2R3MA 1FVRA 3RHKA 4JBVA 5IQFA 2YCFA 3ZRLA 4QMMA 4ZLYA 3G33A 2GHLA 3PTGA 4FSTA 2GMXA 4TWNA 5ITAA 2R7IA 3UPZA 4PDSA 4PUZA 3K5VA 4EOMA 1ERKA 5D9HA 3FHRA 5CI7A 1DI8A 1H26A 2RGPA 5KNJA 4YZDA 3HVCA 3ORPA 2R2PA 3DDQA 5LMKA 5IA5A 4R1VA 4R3PA 4QTDA 3PVGA 2IW9A 5K5XA 3H9RA 5B2KA 5E9EA 4MEDA 3LJ1A 4DINA 4F7JA 4XV9A 3O7LB 5DT4A 3DKGA 4WRGA 2PVKA 2X7GA 4GT3A 4NSTA 5EDPA 4ZY5A 3RZBA 2JITA 2XK7A 5EQEA 1PF8A 5AIRA 1OBDA 2WMWA 3FI8A 2C1AA 2C6EA 4O0TA 3RTPA 3KEXA 3RAKA 1REJA 1UKHA 1WAKA 5E8WA 3RKBA 2W05A 5CZHA 4LGHA 4E73A 4MAOA 4G3DA 4TYJA 3R0TA 3AC5A 4EL9A 4EYMA 3RAWA 3BBTB 2PE2A 4QMXA 3DXQA 3HUCA 5DNRA 2B9HA 4ZZMA 4WA9A 3D7ZA 2ZV8A 4CLJA 3CS9A 2OH4A 2YDJA 3HNGA 4YBKA 4F9BA 3GB2A 3R01A 4RVTA 4DG0E 4DH3A 3GCUA 3V8SA 3Q04A 2C5OA 4XCUA 3DK3A 1XQZA 3HMNA 4O0VA 5EDQA 3ZONA 4CFVA 4F0IA 3TUCA 4HPTE 3KXHA 2ETRA 5AA8A 2OXDA 4B0GA 5M4IA 4NWMA 3DJ6A 1PMNA 3SLSA 4YR8A 3KQ7A 2XA4A 3GGFA 1WBVA 4E6AA 5EHYA 4C4JA 3FWQA 1YHSA 1SMHA 2UVXA 2B55A 2RFNA 3G9NA 3COMA 3HV4A 3QCYA 3R00A 4BTFA 4EOJA 4BBFA 5FEQA 3L9NA 5J5SA 3TG1A 4BDEA 3DB8A 5IDPA 2PSQA 2PK9A 2JFMA 4P5QA 4O2PA 5HX8A 1UVRA 3BHVA 3M11A 3QXPA 4D2SA 3AC8A 3K3JA 3DK7A 2KTYA 3FSKA 4OBQA 1M7NA 4LOQA 2ZDUA 4BCOA 3O96A 2QKWB 5AP1A 1SVEA 1PMVA 4M13A 3MY0A 3QRKA 3AD5A 5J7BA 4PP9A 4ANLA 4BCGA 4E5AX 2FO0A 4IJ9A 4YHTA 1XO2B 3PA5A 2BHHA 4JJRA 3VBWA 4HVSA 4XP2A 2IZUA 3CGOA 5L2WA 1ZLTA 3VHEA 4QP1A 3U54A 3CLYA 4IH8A 3KXGA 3MJ2A 3WIKA 4CFUA 4FIEA 1Z9XA 4NTTA 5BMMA 3FMJA 3VQHA 3DDPA 1RJBA 2YM8A 2XNOA 4LM5A 4G6OA 4EK4A 3WI6A 5TR6A 3HAMA 3OZ6A 3I0OA 4DEEA 2ZM1A 3ZC6A 1BYGA 2B7AA 4AZTA 4ZTMA 4BDCA 2OJ9A 3R04A 4QP7A 3KKVA 3RM7A 1H28A 4J7BA 4J71A 3DFAA 1U5RA 2DS1A 4IX3A 5AP4A 3COIA 1YOJA 3S3IA 5L3AA 1SYKA 4FV3A 2JIVA 3ET7A 3PY3A 4UWBA 4F63A 3C5IA 3C5UA 1GZ8A 5HTCA 4RMZA 4FTLA 3G0EA 3BX5A 4X7QA 3IW8A 4I92A 4JG8A 4JQEA 3RMFA 4ANBA 4CYIA 2X9FA 2WTDA 1DI9A 2CLXA 5E8YA 5HU3A 4QQ5A 3CXWA 2C5NA 3PP0A 5G1XA 1H24A 4ITIA 3AMBA 3BYOA 2RIOA 4M97A 5IQBA 1W98A 4IDVA 3GC7A 2C69A 4QYGA 2C6DA 1E1VA 4R6VA 2CKPA 4XLIA 4NCTC 2XNGA 4ITJA 3BGZA 4YO6A 5HTBA 2PVMA 5AP2A 4DFXE 5LCKA 3C1XA 3OROA 3UP2A 1XBCA 4J52A 4AAAA 2OLCA 5KBRA 2R3OA 2VWBA 4CRSA 2IG7A 3F82A 5L2QA 1OKYA 4FUXA 3HMIA 2C3IB 4R7IA 1OIYA 3WOWA 3GEQA 2GSFA 3FL4A 4FSUA 1VR2A 4FKVA 2FGIA 1GZOA 3IW5A 4YUQA 4JQ7A 5DG5A 2BKZA 4FKSA 1IR3A 4GKHA 4RWLA 3BGPA 4X2JA 5AM7A 3TV7A 4MHAA 3UNZA 4ERKA 1M2RA 4DTBA 4RPVA 2QCSA 2WELA 3FZTA 4IX6A 4AFJA 3UOKA 5IEVA 3UO6A 4X6RA 5HKMA 2OJFE 4QMLA 2UVZA 1H27A 2J51A 3Q32A 4GKIA 4FKIA 5DR9A 2XCKA 3MH2A 3UNJA 2FUMA 4OR5A 1WVWA 4ZTHA 3HRFA 3QCXA 5EHOA 3HUBA 5E1SA 3RI1A 5EQYA 4V0GA 4GYIA 4E4NA 2F9GA 3BE9A 5H9BA 4F64A 3UVQA 1UNLA 3IGOA 4GMYA 4KIPA 3V5TA 4BBEA 4FC0A 4O6EA 4CLIA 1K3AA 2J50A 3QC4A 1Q99A 1Z5MA 3EHAA 3TI1A 3QD4A 1I09A 4IHPA 4U0IA 4DGMA 5M56A 3O8TA 3VBVA 2J9MA 3F7ZA 3Q4TA 5DE2A 3SW4A 3W2CA 3ATSA 2DQ7X 3V51A 4F08A 3H10A 3U6HA 3R6XA 3QX4A 3F5GA 5J95A 5JFXA 2WMXA 4QMZA 2C3KA 5L8LA 4J97A 2XNEA 3UJGA 4YJTA 3NUPA 2PUPA 2Z60A 5TE0A 3PWYA 4YJSA 3WILA 4NKAA 4DEIA 4DCAA 4NM0A 5FXRA 5JQ8A 3PE1A 5DR2A 1Z57A 5AUYA 3D5VA 4YZNA 3ALNA 4GK3A 3LXLA 2PVNA 3PXKA 4L45A 4OGRA 5HE0A 4BCJA 3T9TA 1FQ1B 3QQFA 3BU5A 4UMQA 4BDAA 1JKKA 2VO6A 4E5WA 4ZSAA 5JGBA 2Y0AA 4ORKA 5LOHA 3UIBA 4MBJA 2VRXA 2CMWA 1PRYA 1AGWA 3W33A 1ZRZA 4AF3A 4AG8A 4WRSA 3UVPA 5BUJA 3UOJA 3SG9A 3W2QA 1PYEA 2XNMA 5IUIA 2VX3A 2YZAA 4FKOA 5IA1A 2JD5A 2W99B 2ESMA 3BPRA 4FK3A 4BDKA 2YHVA 2C6TA 3BLQA 2RL5A 4YJNA 5A4LA 4D2TA 5A46A 3W10A 5IEXA 2VWXA 3TT0A 4USDA 5KE0A 3UG2A 2WIPA 3C50A 2OJJA 4XV1A 4KKEA 3FZPA 3MB7A 3HEGA 2R0UA 4JDHA 2WFYA 5EI6A 4E26A 2CHLA 4D9UA 4F65A 2YJSA 2I0YA 2HY0A 1IA9A 4NM5A 2XKCA 1BKXA 1XH4A 4OBOA 3OUNB 5HVYA 4ASEA 4ZLOA 5BYYA 5CEKA 2Q83A 5M09A 3OD6X 4TZRA 2DYLA 5AP5A 2XK3A 3LFCA 3R9NA 5CANA 3A7JA 3PJ8A 4JX3A 2VAGA 4PPBA 3VWAA 3WARA 3ATTA 3SV0A 3O17A 2BALA 5BVEA 1G3NA 3MV5A 3SXFA 3FY0A 2O3PA 4ENXA 2J6MA 2WQNA 4FZAB 5D7VA 4NK9A 3IK3A 4I23A 2WTCA 3TTJA 4EUTA 3DQWA 1PYXA 2B4SB 1Y91A 3WF6A 4ARKA 4TWCA 4E93A 2GQRA 4ZXTA 3OT3A 2OIBA 4MNEB 4FTQA 4EOIA 4CD0A 4LMUA 1J3HA 4J8NA 4ZTLA 1WBPA 3A7HA 5D41A 4F9WA 4CFMA 1A48A 1PXKA 1P4OA 3B8RA 4KWPA 3RPSA 1ZOHA 3C0IA 4W4YA 2OG8A 3HMOA 2Y6MA 4NIFB 3ZRKA 4UZDA 3PFQA 5CI6A 3LFAA 4FKGA 4YJVA 3LQ5A 3P0MA 5EM7A 5ETFA 3KMWA 3IKAA 4IM3A 3FUPA 4D2RA 3Q3BA 2CDZA 4FT5A 2OU7A 4KUJA 5FGKA 2F7EE 5AADA 3L8XA 3ZBXA 3ANQA 5ANEA 4LRJA 2RG6A 3AD6A 4Q9ZA 5FEDA 5CLPA 4FV8A 4F09A 5HBHA 4AGUA 1ZMUA 2PVYA 1PXNA 2XIKA 3FZ1A 3KA0A 4NT4A 5IU2A 2VX1A 3WE4A 1V0PA 4L68A 2ITVA 5HCZA 3EZRA 3E8NA 3PA3A 3GU8A 3VW8A 3GVUA 3BHYA 3UVRA 2HAKA 5J1WA 4C2WA 4Z9LA 4HPUE 3JR1A 4CCBA 1YXVA 3KF7A 3N4UA 4WHZA 3OW4A 3KK8A 1KV1A 5AAEA 4HZSA 3IW6A 4CEGA 5C8NA 3SQQA 2PU8A 2R64A 2ITYA 4CSVA 4UXLA 4A4LA 4ZZNA 4G6LA 4DFNA 4M8TA 3QGYA 4K2RA 3PJ1A 4NFNA 1XBAA 1YDRE 4FT3A 4O38A 4M0ZA 4YP8A 2J5EA 2LGCA 5IEYA 3RHXA 2VWIA 2IVUA 5CQUA 3L1SA 4TYGA 1H01A 2Y7JA 3VBTA 4BYIA 4A9SA 1K2PA 1OPLA 5IUHA 3QYWA 4I3ZA 4FF8A 5J5TA 3KN5A 4HCTA 3QZIA 4DEGA 4BDFA 4EJ7A 2XIRA 3ZLYA 2XK4A 4CGAA 4C4FA 1TVOA 3ORTA 4QMNA 5AMNA 2PUIA 5DHJA 2VTIA 2R5TA 4FEUA 2WMUA 2J0KA 2A27A 4JAIA 4FEWA 5CSVA 4ZMEA 5CNNA 3F2AA 4IEBA 3I6WA 3EQBA 4KBKA 3UC3A 3RALA 3HKOA 5H8BA 4ANOA 2JBOA 1Q8UA 3FLNC 4HGLA 1ZWSA 3D9VA 3PVBA 2CKEA 1PY5A 2QODA 3Q4UA 4P90A 2AUHA 4E3CA 3Q6WA 4QPSA 4EKLA 3F5UA 1ZOEA 2BZKB 4RIXB 1J7LA 4PMMA 3OWPA 2X0GA 1ND4A 2CN5A 4KS7A 3TWJA 2I0VA 3ODYX 4GIHA 4D58A 5CEMA 2Y8OA 4X6QC 2C4GA 2JAMA 3BRBA 3HA6A 3LFSA 3QTZA 5C1QB 3MFTA 4FZDB 4KBAA 4X3JA 5A3XA 4AQCA 4BI0A 1IAHA 3RK9A 4AXAA 3QD2B 4DLIA 2V7OA 3TZ7A 2GS2A 4DH5A 4C7TA 3ANRA 3NS9A 4NW5A 3CCNA 4DTKA 2WQOA 1Q8YA 4A4OA 2JIIA 3IONA 3FPQA 5LVOA 3W8LA 3NVMB 4IB1A 4HGSA 5CAOA 3U6IA 1SZMA 4FNZA 4XX9A 5DBXA 4ZAUA 3CE3A 3EQPA 3LAUA 1MQ4A 3CD8A 3OCSA 2OH0E 2OSCA 4HYUA 3R8PA 3DBDA 3UGCA 4ACHA 3SW7A 4CQGA 3SA0A 2OIQA 3IW4A 2YCSA 4U8ZA 4EOOA 3D5WA 2CN8A 1O6KA 4AE6A 3NYXA 5LVPA 1UA2A 4Q2AA 2VUWA 1UWJA 3F3UA 5BVDA 1YHWA 4PMPA 4AA5A 1WBSA 2OIDA 3QRJA 1OI9A 5M57A 4D4YA 4YC8A 3OMVA 4IDTA 4RLLA 5ANOA 4EEVA 5I9XA 2HZ0A 3P1AA 2WOUA 3BIZA 3KFAA 1BI8A 4IMYA 5BNJA 5HZNA 3R7YA 4DC2A 4K18A 2XB7A 3DBCA 3HV6A 5AP3A 4CG8A 4X3FA 4RFZA 2BCJA 3TZ9A 3DT1A 4UMRA 3NUYA 4O2ZA 4ACDA 1BUHA 3FQEA 4FZ6A 3FYKX 4CFFA 5CTPA 3I5ZA 2W1HA 3OS3A 5HESA 1Q62A 3TCPA 1Y57A 4BCQA 5CU0A 4CCUA 1OL2A 3C4EA 4QP4A 2XKFA 3ACKA 3VS5A 4RWKA 3VQUA 3DPKA 4BTKA 3ZDIA 5L6PA 4IB3A 4IC8A 4RZWA 5CENA 3TZMA 2CNQA 3W16A 4L9IA 4PTGA 1DS5A 1ZARA 5AUVA 4HCUA 5LJJA 3E7OA 2WB8A 2YERA 4OTIA 4BKZA 4D1ZA 2QONA 4F6UA 5JH6A 5JN2A 4GUBA 5AV3A 4FZ7A 4OW8A 3CQEA 3ODZX 4BDJA 4O96A 2ITXA 2OWBA 3QA8A 2R3JA 2QNJA 3CPBA 3PG1A 1FPUA 3BHHA 2VGOA 2C3LA 2NO3A 3EQDA 2BTSA 4F0GA 3HYHA 1APME 3AC2A 1P5EA 2JDVA 1SNXA 2F49A 5HE3A 4A06A 4OTHA 4PMSA 1YDSE 2AYPA 4EC9A 1U54A 4HYIA 3QWJA 4USEA 1SM2A 3TV6A 3N4TA 4FV1A 1YQJA 3DK6A 3BHUA 4EWQA 4O0YA 5IQAA 2F2UA 3DGKA 3W32A 3WIGA 4JVGA 2OZOA 4FNXA 3R7IA 4AW0A 1GY3A 2VWUA 3MPMA 1ZXEA 5L8KA 4EK5A 3Q2JA 3F3WA 1E9HA 3ZFYA 3QX2A 2VWZA 3BBWA 4USFA 1Q3WA 2VTAA 5J1VA 5BUIA 5HVJA 2QD9A 4O27B 3WBLA 4ASDA 4XG2A 4PL5A 4KSQA 4JDKA 1F0QA 1QL6A 3FXWA 4GT5A 3JYAA 3R1NA 1M2PA 3QKKA 4FSWA 5K5NA 4TRLA 1Q8WA 1SNUA 4RFMA 1OKWA 1NVSA 1Y6BA 3ID6C 3RK7A 4D2PA 4QMVA 3R83A 4QYFA 1MRUA 5CU2A 5IH6A 5EW8A 2ZV2A 4PMTA 4ALVA 4ZIMA 4BIBA 3ETAA 4D5HA 4D4SA 4EQUA 3PVWA 4ID7A 2FSLX 2QO2A 1NVRA 5AUTA 3G0FA 3MTFA 3QYZA 3O2MA 4PF4A 1W84A 5BVNA 3JVRA 4W9XA 5IUGA 5DEWA 3AC4A 3VS2A 2BIKB 1HCLA 4ZY4A 2I0HA 3OFMA 3FMKA 5ETCA 4FEVA 4MWHA 2QKRA 3NGAA 4UYAA 4CV9A 3C0GA 4XLVA 5CEOA 1GNGA 3AMYA 5DA3A 3ZM4A 3WZJA 4DEDA 3JY9A 4ASZA 2X4ZA 3C7QA 4I6HA 4AFEA 4FTTA 4QYEA 3QC9A 4S32A 1TKIA 3I5NA 4II5A 3PUPA 3W18A 1KOAA 4FKRA 4QQCA 4BRXA 5M51A 4O6LA 3ZU7A 3QL8A 4PTEA 3AT3A 4A7CA 4EHZA 3HDNA 1ZY4A 3GP0A 4HOKA 4ZTSA 3V8TA 4FSQA 5F20A 3DY7A 3ZM9A 3WF7A 1KE8A 3DJ5A 2BFYA 4PNIA 5LMKC 1ZYSA 3TIYA 4L43A 5KO1A 1IRKA 4JBQA 3V5QA 5KHWA 4NCTA 3VS1A 2HZ4A 1H4LA 2UW8A 2HK5A 1Y6AA 3PRFA 2QR8A 5M06A 4XG6A 5CU3A 1OL5A 4G3GA 4ERWA 4BI2A 3RPRA 4BZOA 3VUHA 3ZZEA 4NTSA 3OEZA 4B99A 2BZIB 3VO3A 4XV2A 1VEBA 2BFXA 3D7TB 3DNDA 3LM0A 1YXUA 3R21A 4BKYA 4U44A 2XNBA 5IQHA 2W5AA 2A2AA 2WU6A 5I3OA 5HLWA 5KZ0A 4L46A 1OIQA 3QTXA 2WMRA 5M08A 2O0UA 4ANMA 2ZM3A 3I79A 3A7GA 3NVKI 3IQ7A 2W9FB 4JG6A 4V0GB 4ZK5A 3SOAA 4BCFA 4FTCA 4FGBA 4YJPA 5EYKA 3R8VA 4RX5A 4QPAA 3LLAA 2OF4A 3R8ZA 2C6LA 2YISA 2GNGA 4KABA 2Y4IC 5ANGA 4ZSGA 4D4RA 4F7SA 2RKUA 3O7LD 5AFVA 3EB0A 4R3CA 3VRYA 1KV2A 3OWLA 2GQSA 3VUKA 2O8YA 3MH1A 2W1CA 2F4JA 3NPCA 3CPCA 3DAJA 4ONAA 4U7ZA 5EFQA 2R4BA 3LKMA 1H25A 2UW7A 5C8KA 4O1PA 4ACGA 2JEDA 1KE7A 2Z8CA 4DFLA 2GDOA 4BGHA 2YZLA 4H39A 4A9RA 2FYSA 4OAUC 3OHTA 1PXPA 1W83A 4E4XA 2UUEA 5HD4A 2VO3A 2UZLA 3H9OA 2OZAA 3RP9A 1BX6A 4IACA 4D28A 2WHBA 5CWZA 5DMZA 2OKRA 2YAKA 3R1SA 2XNPA 1VYWA 3LFBA 4YZ9A 2XK8A 3VUDA 4FVPA 3TNHA 1W0XC 2QOOA 4TTHB 3I60A 4CVAA 5FP6A 2ETMA 3TNWA 5CT0A 4R7BA 4P5ZA 4MXXA 2E9UA 4QYYA 3BGQA 3SOCA 4Z55A 3R28A 1EH4A 2XK6A 5KMJA 2JGZA 4RIOA 1FGIA 3F3VA 3DAEA 3UG1A 3OG7A 2EXEA 4GK2A 1SVGA 4AS0A 4IZYA 5BVWA 4LGDA 3EKNA 3JS2A 5EYDA 3B8QA 1CDKA 4N70A 4AU8A 3GXLA 3VRZA 4XV3A 3LIJA 5IDNA 4FSMA 1H08A 3PIYA 3I7BA 4WUNA 4APCA 4ZSJA 4C37A 4AN9A 4ASXA 4GVAA 2VTQA 3VF8A 4LUDA 3OBJA 2YM4A 2PE0A 3HRCA 3WF5A 4WOVA 3T9IA 4A07A 4L42A 4QYHA 5HG9A 2HZNA 4NM7A 1LEZA 1NT2A 3FZOA 5KHXA 2BROA 5CVHA 2QOLA 2JKKA 4QRCA 3LQ3A 3HZTA 2J0JA 4P4CA 4WO5A 3A4OX 4ZEGA 2BRGA 3GC0A 3F69A 5DI1A 4JR7A 5D12A 3LMGA 4IC7A 2UZEA 3BWFA 5T68A 3LM5A 3W2SA 2XMYA 4XP3A 2P33A 3ZFXA 4WNPA 5M07A 2BRBA 2ONLA 4L53A 5AR4A 1PXOA 2IVVA 5KZIA 4F9AA 2YN8A 4FSYA 4O7YA 4JIAA 4F4PA 1CTPE 4FA2A 2R3QA 4I4EA 3MWUA 3ENMA 2ZV9A 1QMZA 4OAVB 4MXYA 2BRMA 3NCGA 3NYNA 5AR2A 5AV1A 1YDTE 3RPYA 4Y73A 5ETIA 3QAME 3BYUA 4KRDA 3COHA 3OUKA 3NR9A 3NDMA 4AZEA 3WZEA 2WMVA 3P23A 4B8LA 4F6WA 4X3FC 4C59A 4YGAA 4E4LA 3G6GA 3SX9A 4DT9A 2OFUA 1O6LA 2CGWA 2FSOX 2C0TA 2WEVA 3DBQA 4IAYA 4BDHA 2XUUA 5D1JA 2B54A 5A54A 5IF1A 3S0OA 5FTOA 4JG7A 4CTCA 3UC4A 2VD5A 4EI4A 2JDOA 2PWLA 3A60A 2UW0A 4MNEA 4WT6A 3NSZA 4DH7A 5IMXA 4F1OA 5A4QA 5CF4A 4GUEA 5EH0A 2C6OA 4IE9A 1XH9A 4M14A 2FB8A 1ZMWA 4CFXA 3PXRA 5E8UA 2WMBA 2IZRA 4BCPA 4QMWA 3VUTA 4IVDA 3THBA 3ULZA 3Q5ZA 4UXQA 4BIDA 1Y8GA 4I6FA 3FDNA 3NIZA 4NJDA 5AUWA 1KWPA 1FMKA 4MQ1A 4D2VA 1O6YA 3QQKA 1JQHA 2HWOA 2R3LA 2X6EA 3PZHA 4UALA 5L2SA 4PL3A 2JKOA 4DA5A 2OZAB 5E8VA 4QP6A 5FG8A 4YJQA 5JRSA 3GFWA 4X0MA 3QQJA 3LXKA 2H34A 4W4XA 3DXNA 5DOSA 4E6DA 2QG5A 3FQHA 5AR3A 2BDFA 3ZDUA 4IXPA 1Q8TA 3PYYA 3CKXA 4TPTA 5CS6A 3F5XA 3COKA 3ZUUA 5FDPA 2ZMCA 4LI5A 3FKOA 4W4VA 2GHGA 5FEEA 1QPCA 5AJQA 1UU7A 2CNUA 4RVKA 5FP5A 4BWPA 2BZJA 5CU6A 2IN6A 4MCVA 2R3GA 2QHNA 4KIOA 4DFYA 3KREA 4O7RA 3D0EA 2VTOA 3LFFA 4JQ8A 4AUAA 2WIHA 3RGFA 3HAVA 3S4QA 1JOWB 4FR4A 4UWCA 2PZPA 4QMSA 3GU6A 4TXCA 3D2KA 2I7QA 4I94A 4EH2A 5B2LA 4FT0A 5ACKA 2VWWA 3ZEWA 2XNNA 2A1AB 4I20A 3RVGA 4MYGA 3U8WA 2WD1A 3LFDA 4FV7A 3L9MA 3R2BA 4UX9A 3GCVA 3R7GA 2C5XA 2J0MB 4FE2A 4DGOA 3W2OA 5BMSA 2IWIA 4UMTA 3ROYA 4EOKA 5LMBA 4PPCA 4FL1A 4RWJA 5F4NA 2UZUE 3Q6UA 4IAFA 1PXLA 1JPAA 4FBXA 4DAWA 4GT4A 4J95A 3F66A 3EZVA 4N6YA 2PTKA 2C6MA 1K9AA 2HW6A 2GCDA 1FMOE 2Y4PA 2IPXA 1J1BA 3UQGA 1CKIA 4CYJA 2H96A 3Q60A 4BKJA 5A4TA 4R3RA 3B2TA 3N51A 3VAPA 4D55A 2PMLX 4BL1A 2Z7LA 2VTLA 4AGDA 4KKHA 2HXLA 4J53A 3FZSA 3FLZA 4JBOA 3PPJA 4QMYA 5HIDA 5T3QA 4EJNA 5C9CA 1WBOA 2QURA 4IQ6A 3U4WA 4F1TA 2W1DA 1PHKA 3A8XA 1GZKA 4QMOA 5CY3A 4EH7A 5B0XA 3PLAE 1Q8ZA 3E3BX 5JK3A 3Q4ZA 3WZKA 3QF9A 2FH9A 2QU5A 3D5UA 4I5CA 3O0GA 4GFGA 4AZVA 4IAIA 1TQMA 1WVYA 4GK4A 4ZSEA 3R8LA 3SC1A 3ORMA 4AT4A 3AGMA 1WVXA 1O9UA 3V6SA 2V62A 3ZUVA 3UIXA 5DPVA 4FTRA 3ZRMA 2I40A 3CR0A 4O0WA 4ZJJA 3I4BA 4WUAA 3C9WA 4I21A 2G15A 2LAVA 1ZZ2A 1OKZA 5DLSA 2OXXA 4RIXA 4GYGA 3IDPA 2BRNA 2WGJA 5EOLA 3ZFMA 2E9OA 2PL0A 3C13A 5H8GA 4EH3A 5CF8A 4BCIA 1U46A 4LG4A 5DIAA 5HNGA 4YU2A 2NPQA 2W1FA 1RE8A 2A4LA 4WNKA 5C4KA 4BWXA 4U45A 2UZBA 2YM3A 3JVSA 3CP9A 4ACCA 3BEAA 5FLFA 4HVDA 2H8HA 2W96B 4ZS0A 1OPKA 4GW8A 2XVDA 3ORNA 3R02A 5AV2A 3O71A 3TUDA 2YFXA 1B6CB 4ZS4A 2EB3A 4K9YA 2REIA 2VTJA 5GJDA 3EQCA 3SHEA 5HCYA 3U51A 3O50A 1VYZA 2YM7A 4IZ5A 4RJ4A 2HXQA 1BL6A 3E64A 4QMPA 3QALE 4W4WA 2B9IA 1RW8A 3ORZA 4YZMA 1QPEA 3TKIA 2OICA 3ZEPA 4RGJA 3QWKA 3R9DA 4HW7A 2QVSE 3FPMA 3BYSA 4FTUA 1GOLA 1FBNA 3AMAA 3E8CA 5GIPE 2YDIA 5ANKA 4X2FA 3ZO4A 3JXWA 2EXMA 4AA4A 4AACA 2C1BA 3MIYA 4H58A 4HVGA 3VUGA 3O8PA 3RM6A 1FVVA 3RPOA 3PP1A 5CT7A 3UODA 2EVAA 3T8OA 4BGGA 5FD2A 5I3RA 2YWVA 4Q5HA 4O21A 1XHAA 3GUBA 4PV0A 3KRWA 3SXSA 3LFNA 2OK1A 2WMAA 3QCQA 4TYIA 2NNWB 2OBJA 3RWQA 2CCHA 4Z7HA 4C8BA 3QRIA 3PA4A 1I44A 3PSCA 4Y95A 2YCRA 4BCKA 4E4MA 1U5QA 2ZM4A 4E5BA 3TACA 3MYGA 5GZAA 4XBRA 3DLSA 3TN8A 1YOMA 2YCQA 3BEGA 2R3IA 3QTUA 2ZVAA 2ZMDA 3EL7A 4TL0A 2GS6A 4FKPA 2OW3A 3C4WA 4IWOA 3CY2A 3A2CA 3EQHA 4FNWA 5TF9A 4BFMA 4CMUA 3PE2A 4S30A 5J9YA 2VV9A 3MY1A 4TNBA 4YBJA 4CG9A 2R3FA 3HRBA 3QUDA 5D11A 3W1FA 2W17A 5JEBA 4O7WA 4NL0A 3CGFA 5AP6A 5C27A 2B0QA 1Q5KA 3WZUA 5H3QA 3FI4A 4WBOA 3MB6A 4C35A 3QA0A 4FKWA 3TNPC 2EXCX 3ACJA 4IVCA 3Q2MA 3AOXA 5I4NA 1R0PA 4QMUA 3FMMA 1HOWA 5DT3A 4IANA 4YJRA 4QP8A 5FM3A 3VN9A 3DQXA 2X7FA 3PVUA 4XRLA 5AV0A 4C02A 3IDCA 4EZ3A 2P4IA 3C51A 2BAQA 3A4PA 4FTMA 2ZV7A 2X81A 4FYOA 1GZNA 2WMTA 2Y6OA 5M4FA 2J4ZA 2RSVA 3PZEA 4NZWB 1XH6A 1ATPE 4O0SA 5K3YA 2ITOA 3MVLA 4XH6A 1OKVA 4I5PA 4E6CA 3U55A 2J7TA 2JDRA 3II5A 2X1NA 4QP3A 5ANJA 5L6OA 2XIZA 3VS4A 4U81A 3TJCA 4MQ2A 2XJ1A 3DZOA 1JLUE 2XKEA 3E63A 3CBLA 3MVMA 3R9HA 3KXNA 1UWHA 3NUSA 4QQTA 5JQ5A 5IQIA 3IECA 2XZSA 4A9UA 4FVRA 3IOPA 4R8QA 4R1YA 3PJ2A 3HMPA 5L8JA 1H0WA 1BL7A 2W0JA 3O8UA 4WNMA 1V0OA 4RIYB 3NAXA 4V01A 4G3FA 4FIGA 2BDWA 2PE1A 1IG1A 2XRWA 5LXMA 1G8SA 1GIIA 4O83A 3WF9A 4FTKA 3GNIB 4K77A 2WQEA 4HYHA 3NUAA 3VS0A 1WBTA 3P4KA 4G5PA 5BQ0A 1Q24A 3LE6A 2R3KA 4U3YA 2BILB 4IB0A 1U4DA 5KKRC 3KVWA 4PDPA 4L3LA 3P5KA 4RJ7A 3TL8A 3MFUA 3GCSA 4EH9A 4Z3VA 2QOFA 1FINA 4UY9A 4Y5HA 4WD5A 3MFSA 2WMSA 4DITA 3FI3A 5FUTA 5TT7A 2JBPA 4BDDA 3R22A 2F7ZE 4IWQA 3VVHA 2JIUA 3I81A 4V05A 4EH5A 4KNBA 3U9NA 4AA0A 5FTQA 5AM6A 2QLQA 5EI2A 3BU3A 3KCKA 3KB7A 3CY3A 4FIIA 3P7BA 4Q5EA 2WPAA 4DT8A 3TDWA 3QTIA 4J8MA 4IZ7A 2CNVA 2YAAA 2PHKA 1MUOA 2Z2WA 3T3VA 2QOBA 2I6LA 4Y8DA 3CTJA 4EH6A 4MTAA 1XH7A 2YA9A 1LEWA 3OTVA 4DBNA 4NYEA 2ITTA 1M2QA 2O63A 4UEUA 1PXJA 5E91A 1ZYCA 3LLTA 4FTNA 4HJOA 5CAQA 3MTLA 1NW1A 1RDQE 3SRVB 5CVGA 3M2WA 3OCTA 4BHZA 4ZJIA 3SKCA 3Q96A 3VIDA 3QD3A 4NIFA 4FTJA 1DAYA 2X8IA 2ITNA 1T45A 4U3ZA 3POOA 4LMNA 3PXQA 2ZDTA 3CJFA 2B9FA 2BVAA 2X8EA 4HGEA 3FLYA 4C34A 1URWA 5KMLA 1FOTA 1J7IA 4TT7A 5ANIA 4EBWA 3QD0A 2OFVA 4FV5A 1WFCA 3V3VA 4AP7A 2E2BA 4MK0A 2WXVA 3S2PA 5E7RA 4F0FA 4ZTRA 4I0SA 5D10A 1OGUA 4ANSA 4CFWA 4OT6A 4XEYA 2NP8A 5BYZA 4G9CA 2QLUA 4JS8A 2CKOA 5LMAA 4DFUA 2C6IA 3EQRA 5HO7A 4D1SA 3LMHA 2RFSA 4AGWA 3E5AA 3NAYA 5HO6A 1S9JA 3HX4A 4FV9A 5KBQA 3GU7A 2YLFA 4G1WA 4KSPA 4OTQA 4CKIA 5CU4A 4CMOA 5JFVA 3BYVA 4WSQA 4J96A 4MXCA 3G9LX 2W1GA 4I6BA 2CKQA 1PMEA 3ZO3A 4DLJA 3BE2A 3P08A 3PY1A 4GFOA 2WKMA 3AC3A 3LJ2A 3NWWA 3ULIA 4V04A 3KXXA 2YM5A 3Q9XA 2OJGA 2W06A 3PIZA 4KD1A 4U43A 5F1ZA 4BDGA 1XKKA 3ZS5A 3R2YA 4BCMA 2XM9A 3QLFA 3Q9YA 2YLEA 2SRCA 2R9SA 3GOPA 2ERKA 1PJKA 4GRBA 4DEAA 5GINE 3EWHA 4H36A 5LVMA 3EJ1A 4BTMA 5IA4A 2ZAZA 4FK6A 4R78A 3EFKA 3H30A 4DEBA 1STCE 4JRVA 3QRUA 3RPVA 3MI9A 4PX6A 4IFGA 4NEUA 3BWJA 4DTAA 2VTHA 4D0WA 4O82A 3HV3A 4GJ2A 4S34A 5CSHA 3ZBFA 4DG2E 4EC8A 3OY1A 2BDJA 5AX9A 3Q53A 5HIEA 4ZMFA 3F3ZA 4JL9A 4E6QA 4FV0A 3TTIA 5HE1A 3PPKA 3OP5A 2CGVA 3MW1A 4EORA 5KUPA 1WMKA 5B7VA 3BU6A 4FL3A 4YZCA 5DH3A 3U87A 4EKKA 5HEZA 4GVJA 4K1BA 5A6OA 1M14A 2PPQA 3Q4CA 1PKGA 5DEYA 3D5XA 4PY1A 1ZYJA 1YKRA 3KXMA 3HV5A 5CX9A 4EZ5A 2QG7A 5CEPA 4O7TA 3LXPA 3PPZA 4NKSA 4UYNA 3HL7A 4NUSA 1XWSA 1R0EA 1W8CA 4CMTA 3EIDA 3KK9A 3R30A 3Q9WA 5IPJA 5E4HA 3SXRA 1NA7A 2XJ0A 4L3PA 2JDSA 2XEYA 3JY0A 3R7VA 3SRVA 5HE2A 5K9IA 3VF9A 5KMNA 4ENYA 4YHJA 4L01A 3DB6A 3PSDA 3DJ7A 4FSRA 4XNEA 4BZNA 3VBYA 5F94A 3SD0A 3UYSA 2VTPA 2BZHB 2JLDA 2Y9QA 3I6UA 5IQGA 3FQSA 3OC1A 3NNUA 5DRBA 3TNIA 5FXSA 5LQFA 4MXAA 3ZLSA 4L67A 3LXNA 3NNVA 4RLKA 3KVXA 2BAKA 5EKOA 3UTOA 3FI2A 4C4GA 2YJRA 2QOCA 3L8SA 5C4LA 2UW4A 3DOGA 5EYCA 4OTWA 1M17A 2HELA 2X2KA 3GFEA 4G6NA 4A9YA 4AT5A 3ROCA 1CKJA 4WKQA 1OECA 1Q4LA 3KMUA 4IWDA 4IVAA 4QP2A 4EZ7A 3AC1A 3NUXA 3UO4A 3FMLA 4RWIA 4OTPA 5DWRA 3QUPA 4RBLA 4YMJA 3LFEA 4FL2A 5AV4A 5J9ZA 1OB3A 2XM8A 1UV5A 5AR8A 4RJ6A 3EFJA 3DBFA 3HP5A 4D5KA 3OXTA 2XRUA 4EYJA 4CV8A 4O86A 1SVHA 4J99A 1YWVA 3DS6A 2UV2A 2QOHA 3H3CA 5FM2A 4AZWA 4C3PA 3E7VA 3PIXA 5DT0A 3TNQB 4ANQA 4D2WA 4F1MA 4AE9A 2PMIA 5JRQA 2UZVA 4BCHA 5B2MA 3DXPA 4BR3A 3C0HA 3HV7A 3WYYA 1DAWA 1MRYA 4RSSA 2XYUA 4XUFA 1WBWA 4ITHA 3WE8A 3U6JA 2CLQA 3QTRA 2E9VA 3RAHA 3TUBA 4FEXA 4H1MA 3UNKA 3V5WA 3NUNA 4TKSA 4BBMA 5CALA 2BKKA 3BLRA 2XK9A 1R39A 4L44A 4E7WA 4CTBA 2VN9A 3QZFA 3LPBA 3RAIA 4YLKA 4C33A 1YI3A 3FXXA 1H8FA 4QP9A 3CQUA 5HIBA 5FDXA 4G16A 5CXZA 2VGPA 2CGXA 1WZYA 3M1SA 3E93A 4TW9A 2NRYA 4B9DA 4YO4A 5IZFA 3U4UA 4CT2A 5A4CA 2GPHA 3FKLA 4GG5A 3VUMA 5A6NA 5KX8A 4XG8A 2X2MA 1ZMVA 4MF1A 2ERZE 2VTNA 4YC6A 4C0TA 4MD9E 3ZTXA 4DH8A 4X2NA 4FV2A 1DM2A 4OTDA 3ZO2A 3A7FA 3DAKA 1XR1A 5CSXA 2HW7A 4GU9A 5EM6A 3R7UA 3ZC5A 2BTRA 1HCKA 4TYEA 1YWNA 3BHTA 2J0LA 5C03A 1UKIA 1ZYDA 3EN6A 3K5UA 1P4FA 4R7HA 3CD3A 5DFPA 3HLLA 1H1SA 5CSWA 3ALOA 3FKNA 2UZOA 3FLWA 3QHWA 3TKHA 4DCEA 4RC3A 5M55A 4W8DA 2G9XA 4KINA 4FKQA 3G15A 3NX8A 5HO8A 2JKMA 3ZXTA 3KRLA 3U9CA 2P0CA 4H3QA 2A19B 1KOBA 1M7QA 4DF3A 4B6LA 1AD5A 5J79A 4RJ8A 1Q3DA 5LVLA 1OPJA 1OL1A 1QPDA 2OI4X 3E8EA 4E1ZA 2XS0A 1PXMA 3FLQA 4J98A 4BN1A 3P7AA 4UMPA 3G2FA 5DGZA 4EH8A 4WIHA 3WZDA 2I0EA 4XOYA 1WBNA 2GNFA 2ONLC 5DN3A 5DVRA 4ZTQA 4XYFA 2JDTA 2VX0A 4QTCA 4DFZE 2HIWA 2XCHA 2VO7A 2YIXA 3EN5A 4AOJA 5EI8A 4L3JA 4YTIA 4UBAA 4NFMA 3QQLA 5I9YA 4HNIA 3W55A 2BUJA 4BVUA 3KC3A 4O91A 1NXKA 2UZNA 1YW2A 3OF0A 4I0RA 2E9PA 5IA0A 1RQQA 1YI4A 3KRRA 3OW3A 2O64A 4PTCA 4QO9A 3RNIA 3NW7A 4E20A 5KMOA 3UIUA 4N57A 4MX9A 2IJMA 3ORXA 1KSWA 3FC1X 3KULB 4AW1A 4YJUA 3CKWA 3CC6A 3FMEA 3LCKA 5JSMA 2GS7A 4G5JA 4QQJA 3R9OA 4ALUA 5EM8A 1U54B 2PVFA 4I1ZA 2GFCA 3E3PA 4X2GA 4GS6A 4O7LA 2VTMA 5HG8A 4NM3A 2W4JA 2C0OA 2PVRA 2VU3A 4JBPA 4QMTA 3G51A 3QU0A 5JGDA 3H9FA 3OVVA 4AW5A 4S33A 4WBBB 2QQ7A 3NYOA 4JAJA 4L52A 3ORLA 4Y72A 1YI6A 3JUHA 4IJPA 3GBZA 4O0UA 5K0KA 3QTQA 4BIEA 4EOSA 2R7BA 4M3QA 2V0DA 4IAAA 3FEGA 4FIJA 3EFLA 4MBIA 5GNKA 3EOCA 3KN6A 4MBLA 2Z7RA 4XMOA 5EDRA 2ITZA 2RFDA 3BCEA 4YPDA 1XJDA 3V01A 1H00A 4P2KA 2QC6A 2WTIA 3LFQA 4PL4A 4QPMA 4MXZA 4P7EA 4RQVA 1OM1A 4IAZA 4PQNA 3HP2A 3R1QA 1OUYA 1BMKA 4ZJVA 2P55A 3RJCA 2XJ2A 4QTBA 3VNTA 3DKCA 1J7UA 3ZOSA 4XHKB 4RC4A 1PMUA 3R71A 3KY2A 2IO6A 5AA9A 3EH9A 4I6QA 2UVYA 4LL5A 4MNFA 5GJFA 2BR1A 4YTHA 2ITQA 4R5YA 3L8PA 4TYHA 2YIYA 4LV5A 3N4VA 4U42A 2QO9A 3NLBA 4AZFA 2PYWA 5HVKA 4RJ3A 5FWKK 2HWPA 1TQPA 3QCSA 3D2IA 1OL6A 5IA3A 3ZO1A 4AOTA 1B38A 2GNJA 2UW6A 4GIIA 3S95A 3NMUF 3BV2A 2WAJA 4UMUA 2EUFB 3QQGA 2O2UA 4YNEA 3TV4A 4AX8A 3FC2A 3EQIA 2IW8A 5LWNA 2CSNA 4O81A 5ETAA 4JT3A 2QU6A 4I5MA 4RIWB 4C58A 4EHGA 5HORA 4OT5A 2CCIA 2QOKA 5CQWA 2R3NA 3VS7A 4GSBA 3DLZA 4TY1A 1ZY5A 3Q5IA 5E8TA 4A9TA 3NRMA 3DCVA 3PJ3A 5I9ZA 4FIHA 5IH4A 3LHJA 2JFLA 3C4CA 4B8MA 3UBDA 3MVHA 3UQCA 5HLPA 4M68A 4MD8E 1L8TA 4F7NA 3NEWA 3ZSIA 5JFSA 2FSMX 3E92A 3MSSA 3CTHA 3IPHA 3OY3A 3SAYA 2XEZA 2P2IA 4APPA 5K0XA 2WTKB 2YIRA 4JDIA 3F5PA 4JIKA 2H6DA 3DKOA 1ZZLA 1CMKE 4HVIA 2XYNA 4WG5A 3BQCA 5AUXA 3G5DA 2FA2A 3R63A 3ZSHA 5AEPA 5IISA 3G90X 5J87A 4EHVA 5DYJA 3FYJX 3V8WA 4RZVA 4DYMA 4WG4A 5AIKA 2C6KA 5CEIA 3RBWA 5CAUA 2W1ZA 4FMQA 5IG1A 3IOKA 1JSVA 2VNWA 2W1EA 2WQMA 4Y83A 4RVLA 2IVTA 3RNYA 1Q97A 1UNHA 5IA2A 3DA6A 3RCJA 2X4FA 5AWMA 3QZHA 5KMMA 1JKTA 3MH0A 3MPAA 4GEOA 5A4EA 1IA8A 3DNEA 4MWIA 1TQIA 4ZLZA 3TKUA 4ZZOA 5C8MA 4EOLA 3UO5A 4U97A 1E1XA 4W8EA 5CASA 5IQDA 4PP7A 4FOBA 1JKLA 3QHRA 2JC6A 2UW9A 2X9EA 3F6XA 4U41A 4K8AA 5IKWA 4L7SA 4RFYA 3JPVA 2CJMA 3BI6A 4LRMA 3R73A 4O7SA 4DG3E 5HOAA 4I5HA 3GU5A 3P7CA 1YXTA 4BGQA 3R7EA 5GZ9A 4IW0A 3REPA 2X39A 4R77A 1WCCA 3ZLXA 2B1PA 5IMEA 2HYYA 3P9JA 5FQDC 3EL8A 3TM0A 3EN7A 3PXYA 5BVKA 2F7XE 4QTEA 5EYMA 4EBVA 2IVSA 3NW5A 4U9AA 5FRIA 4RT7A 5GIOE 3QUEA 3MIAA 3E8DA 4IM2A 4M69B 1T46A 3D4QA 4FKLA 3V04A 2B53A 5E8SA 5KMKA 4NH1A 4PPAA 4RIYA 4HVHA 4LQMA 1V1KA 4XRJA 4QOXA 3D14A 4C4HA 5EKNA 4K6ZA 4G17A 3E87A 3POZA 4U40A 2R3RA 2GNIA 5KKRB 4RG0A 4EUUA 1OIRA 1VZOA 3I1AA 1GIHA 3IS5A 5M4CA 4H1JA 2DWBA 4FTAA 4FICA 4IFCA 5F9EA 1IAJA 4FSNA 4DN5A 1JBPE 2C0IA 2UZDA 2R3HA 2WNTA 4FNYA 4JDJA 2PMOX 4JOAA 4XBUA 2QOQA 2BHEA 2HOGA 3NW6A 3ELJA 1REKA 3UZTA 3P78A 3C4XA 4C4IA 2YACA 3FSFA 3GQLA 2E9NA 4RIWA 5BUEA 5L2IA 2EWAA 3GCQA 4DE4A 4EONA 5E8XA 2WEIA 5GHVA 5HBJA 3AT4A 5AR5A 3MVJA 4D9TA 3A8WA 4YLLA 1BI7A 4X21A 4BDBA 3MA6A 4AN3A 2RG5A 2G2FA 2UZTA 3QLGA 4IVBA 2C68A 2WO6A 3OWJA 5EW9A 3VS6A 1OBGA 3GU4A 4C38A 1OITA 3VUIA 3LCSA 4WG3A 4C3RA 5JGAA 1Q41A 1IEPA 5AUZA 1XH5A 3QTSA 4BTJA 2ITWA 2GU8A 2WQBA 4BYJA 4MKCA 3RCDA 5J8IA 3EN4A 4FKUA 4G31A 3W2PA 2AC3A 4S2ZA 3LZBA 4AZSA 2ZB0A 4GH2A 4UB7A 3FXZA 4PDYA 2Z7QA 5L2TA 4HCVA 1MRVA 3MA3A 5JFWA 3P86A 3BKBA 2PZ5A 3NUUA 4YPSA 2C3JA 5HICA 5GJGA 3CIKA 3Q9ZA 3D7TA 4AW2A 3PRIA 2GNLA 4JLCA 4LOPA 3O23A 4DFBA 3BLHA 4XG4A 4E8AA 1R78A 3LOKA 4BCNA 5A9UA 2JAVA 4OBPA 2XP2A 4BY9E 1Y8YA 3KU2A 3L8VA 2W4OA 3MH3A 3TJDA 5AR7A 4A4XA 2EU9A 5BVFA 1FVTA 2ACXA 3FHIA 5CNOA 4O7NA 3ZUTA 5AAGA 2BMCA 3NZ0A 5HHWA 2VNYA 3VBXA 2R3PA 4RX7A 2V55A 3DFCB 3N9XA 1L3RE 3DZQA 5ACBC 3FV8A 3RK5A 1QCFA 3UMWA 4FG9A 3F9NA 3LQ8A 4D4VA 3FMDA 3UP7A 3W2RA 4QNAA 3O51A 2WOTA 3KMMA 4KBCA 5ICPA 4RVMA 5FBNC 4M7IA 4ALWA 3GCPA 4EOPA 5AX3A 2FVDA 2GHMA 2EB2A 2X6DA 2ITUA 5CSPA 4CKJA 4TWPA 4XG9A 3MPTA 3MESA 3MN3A 5JZNA 4PRJA 3EMGA 3E62A 4GG7A 5HD7A 2G1TA 2IW6A 3MS9A 4X3FB 2PVJA 3LMIA 3KRJA 4F70A 1J91A 3GI3A 1ZOGA 3OXZA 4FIFA 3LJ0A 4OTGA 1MQBA 2W5BA 4PNKA 2QO7A 2XIXA 1XBBA 2GNHA 4EOQA 2J2IB 2OO8X 3K3IA 3PG3A 4LRKA 2VZ6A 5HGIA 3HA8A 4TYHB 1NVQA 4JR3A 4AT3A 4Z16A 5H8EA 5LVNA 3WF8A 2V7AA 2XKDA 2YDKA 3V6RA 1OIUA 3D15A 3LW0A 4M15A 4XS2A 5C26A 3CTQA 5M44A 4FKTA 2A0CX 3MBLA 3VULA 4JNWA 4C4EA 4FSZA 5IH5A 2YWPA 2PZRA 3BV3A 3OOMA 5ANDA 2GQGA 5HNBA 5CF6A 5CZIA 3UDBA 3RWPA 3ZYAA 2WTVA 3D94A 4FT9A 4I93A 4F6SA 5LWMA 3EQGA 4MD7E 3CEKA 4F9CA 1J1CA 4YLJA 3HECA 3HDMA 2UW3A 1YRPA 1JSUA 1CKPA 4OLIA 5AP7A 5EG3A 1A06A 4BZDA 3QQHA 2PUNA 4EK8A 1IASA 4C3FA 4D1XA 4NU1A 3ZMMA 4QD6A 3F7WA 4TNDA 2PZYA 4FT7A 2VTRA 4CZUA 4BICA 2W5HA 4YNOA 4EQMA 3QGWA 4FKJA 4Y46A 5M53A 2BIYA 2GTNA 5KCVA 4QT1A 4FTOA 3TIZA 2PZIA 2QR7A 3KGAA 4KKGA 4RQKA 3SVVA 2VTSA 3ENHA 4NW6A 1ZYLA 3F88A 1JNKA 4FZFB 4ZP5A 4EK3A 4O7VA 1YOLA 5DRDA 1YHVA 2CPKE 4K33A 3ZHPC 1UU8A 3K2LA 4XP0A 2VWVA 5J7HA 4LOOA 1AQ1A 4N4SA 1B39A 3FE3A 4N6ZA 5HLNA 4G9RA 4YURA 1G8AA 2WTWA 2YIQA 2FSTX 2XIYA 1H1QA 5D7AA 3BZ3A 1JAMA 3LVPA 3EYHA 3QXOA 4OTFA 3ZSGA 1H1PA 4UN0C 5A14A 4M66A 5CYIA 4KB8A 4XG3A 5FBOA 2JKQA 3FLSA 4DBXA 2PMNX 4IM0A 4Z7GA 4PDOA 3L9PA 3P79A 3G6HA 4KAOA 5E90A 5JKGA 4O7ZA 3FAAA 4O1OA 4DGLC 4EQCA 3S1HA 3I0QA 2IZTA 2R0IA 2HZIA 3VHKA 2QOIA 3E88A 3SDJA 3MGYA 3TEIA 4EK6A 3PJCA 4QMQA 4O0RA 2OF2A 1LR4A 2Y4IB 3UMXA 4FEQA 2VTTA 3FMNA 3H0ZA 2VO0A 3ORKA 2BPMA 3TDVA 4FUYA 3R8MA 4DEHA 1P2AA 3MDYA 4ZY6A 4C36A 2AC5A 5F95A 5H2UA 2HENA 4CRLA 1CSNA 4F99A 2WMQA 4C62A 4L7FA 4IB5A 3GC9A 3FZRA 4FYNA 3ZH8A 5BVOA 4CT1A 3BELA 4BDIA 3ZZWA 3R8UA 4LFIA 2RF9A 3K54A 1M52A 3EN9A 3QRTA 2QHMA 2ITPA 2GFSA 3FMHA 4WNOA 4AGCA 4ZTNA 4IAKA 5FTGA 3SGCA 4H3BA 1YWRA 3FL5A 4KRCA 2WZJA 3FBVA 5EOBA 4BB4A 1Q61A 4BHNA 5CAVA 3ERKA 4F7LA 1ZAOA 1UNGA 4HYSA 5AAFA 3IDBA 4HNFA 3QKMA 1LPUA 4O22A 5HU9A 2BRHA 4I22A 3H0YA 2YITA 4YZBA
chains in the Genus database with same CATH superfamily
3BYMA 2V22A 2WTKC 5E8ZA 4AOIA 4KIKB 1LP4A 4FX3A 4B7TA 5TKDA 5KMIA 4UWYA 4OTRA 3DKFA 3R1YA 5HBEA 4IX4A 2BAJA 3FY2A 4NJ3A 2WU7A 5HCXA 4LYNA 1VJYA 3BQRA 1P14A 3F3TA 2J90A 2PVLA 4U5JA 5JT2A 4RA5A 1CM8A 2W7XA 3LCDA 5I9UA 2C5VA 3W8QA 4DGNA 5JMSA 4CZYB 3DV3A 4BWKA 2YM6A 3UIMA 1G5SA 3GC8A 4L00A 1JSTA 2J5FA 5TO8A 4TWOA 3A61A 5C01A 2IZSA 2HCKA 3AXWA 3IGGA 4G3CA 4TN6A 4EWHA 1KE9A 4LV8A 5EM5A 1XH8A 2HY81 3OEFX 2XBAA 3FJQE 3D83A 3OWKA 2KULA 1MP8A 4LGGA 4MH7A 3AD4A 4KIQA 3VBQA 5HI2A 2Z7SA 3QKLA 5E1EA 4M0YA 4H3PA 3RZFA 4O84A 4MVFA 2ZJWA 4FG8A 3ORIA 4O0XA 2B52A 5DR6A 4CKRA 3PY0A 4Y5QA 1W82A 3MJ1A 4DHFA 3NNXA 2GTMA 1U59A 3AT2A 5G6VA 1BLXA 2C5YA 3UQFA 3UPXA 4YSMA 3I7CA 3SG8A 4HGTA 5EQPA 4YTFA 5HNIX 1NY3A 3PXZA 3F61A 2I1MA 4JI9A 3EYGA 2X8DA 2OJIA 3B2WA 3OTUA 4J1RA 4MXOA 4RC2A 4YC3A 4IX5A 4AN2A 4DH1A 3PDTA 1JVPP 2O5KA 3CJGA 3TXOA 4XOZA 1JKSA 2ZB1A 3UYTA 4YTCA 1PXIA 3GENA 3EFWA 1OUKA 2G2HA 2XF0A 2C30A 3QQUA 4FV6A 4GV1A 4HZRA 4ZOGA 3CSVA 4KIKA 5T6KA 3L9LA 4IADA 5HG5A 3VS3A 4UZHA 5FXQA 5CEQA 2QI8A 1H1WA 2V5QA 5AP0A 4CQEA 4FGRA 2YIWA 2XALA 2J0IA 1H0VA 4LUEA 4UV0A 2XARA 4GFMA 3V5JA 2UZWE 2X7OA 4XJ0A 2P2HA 3KF4A 3DTCA 4CZTA 5LARA 3TZ8A 1H1RA 2PY3A 3NFFB 3AGLA 1LUFA 3PSBA 3HMMA 3TYKA 4I4FA 4ANNA 4GJ3A 4CFNA 1F5QA 1JWHA 4U79A 4RRVA 2O65A 4C61A 4YSJA 4PWNA 5IQCA 2NRUA 2OGVA 2PVHA 1URCA 4G3EA 3T3UA 5CAPA 1KE5A 1V0BA 3IW7A 1YXXA 4FVQA 4JXFA 3H4JA 4N0SA 2W4KA 3M42A 3MFRA 3NCZA 5GZ8A 4JMQA 4G2FA 2RFEA 3IO7A 2Z02A 2WTJA 2P3GX 4WSYA 5BPYA 2F2CB 3PXFA 4BI1A 2CGUA 3C4FA 2C47A 2VWYA 3A62A 4Q9SA 4ZSLA 1PKDA 2W9ZB 4I41A 2XH5A 3OOGA 5CF5A 2F57A 3ITZA 3VW6A 1UU3A 2PUUA 4IWPA 4U6RA 3DBEA 2ZOQA 3OCBA 4KA3A 1S9IA 3QZGA 3OT8A 3V5LA 3NNWA 1KE6A 5L6WL 1KUTA 3LCOA 4XG7A 5HQ0A 3OCGA 4CXAA 2OXYA 4M67A 1OMWA 2PULA 4W9WA 3LCTA 4JX7A 4K11A 5BX0A 3R7OA 4I0TA 4M84A 3EQFA 3DTWA 3QFVA 2YEXA 5CXHA 5LCJA 4M69A 4I24A 1W7HA 3KL8A 3NYVA 3RINA 4L6QA 3VJOA 2H9VA 1YVJA 3C4ZA 3PLSA 5K4IA 3GT8A 3ZCLA 5EW3A 4F9YA 1A9UA 4BC6A 1UU9A 2YABA 5CVFA 4G34A 1GJOA 2ETKA 4FTIA 5EK7A 3UOHA 3CQWA 5JZJA 4IIRA 4X2KA 3KULA 5BYLA 3GOKA 4AWIA 1X8BA 3QTWA 4RX8A 5I9VA 4ACMA 5HG7A 5HTIA 5I5ZA 4EH4A 1H07A 2Q0BA 3A99A 4RA4A 5I9WA 4D0XA 3HGKA 4GL9A 4GU6A 4R5SA 5HX6A 4OUCA 1PW2A 3F2NA 4MF0A 2X2LA 3AG9A 4QTAA 3A7IA 3S00A 4YJOA 4C57A 3AQVA 3ZXZA 4B4LA 2DUVA 3DU8A 5EHLA 4IBMA 2UW5A 2G2IA 3OBGA 2Q0NA 4FG7A 5E92A 1R3CA 5M4UA 4H05A 3UZRA 1OL7A 4FI1A 4S31A 3WYXA 5K4JA 5L4QA 3UOLA 3NIEA 3PWDA 4Y85A 3UE4A 3V5PA 4K0YA 3UZPA 5IQEA 4FOCA 5TOZA 5AUUA 2ZYBA 4LL0A 4CNHA 4IZAA 4DGGA 4YHFA 1FGKA 1QPJA 1YXSA 4EHEA 3Q52A 4M12A 1OZ1A 3QBNA 2IEWA 3KCFA 3IG7A 4FV4A 4BF2A 4C2VA 4RX9A 4RJ5A 3VJNA 1OVEA 5J9LA 4KS8A 4FODA 3MY5A 2XBJA 4GCJA 3ZLWA 4QNYA 3KXZA 2B9JA 2W1IA 3EKKA 1GAGA 4JRNA 4L8MA 1GIJA 4U80A 3F2RA 3KRXA 3R9RA 1F3MC 3OXIA 3VC4A 1R1WA 5I0BA 2G01A 3GQIA 2R3MA 1FVRA 3RHKA 4JBVA 5IQFA 2YCFA 3ZRLA 4QMMA 4ZLYA 3G33A 2GHLA 3PTGA 4FSTA 2GMXA 4TWNA 5ITAA 2R7IA 3UPZA 4PDSA 4PUZA 3K5VA 4EOMA 1ERKA 5D9HA 3FHRA 5CI7A 1DI8A 1H26A 2RGPA 5KNJA 4YZDA 3HVCA 3ORPA 2R2PA 3DDQA 5LMKA 5IA5A 4R1VA 4R3PA 4QTDA 3PVGA 2IW9A 5K5XA 3H9RA 5B2KA 5E9EA 4MEDA 3LJ1A 4DINA 4F7JA 4XV9A 3O7LB 5DT4A 4AXFA 3DKGA 4WRGA 2PVKA 2X7GA 4GT3A 4NSTA 5EDPA 4ZY5A 4AQKA 3RZBA 2JITA 2XK7A 5EQEA 1PF8A 5AIRA 1OBDA 2WMWA 3FI8A 2C1AA 2C6EA 4O0TA 3RTPA 3KEXA 3RAKA 1REJA 1UKHA 1WAKA 5E8WA 3RKBA 2W05A 5CZHA 4LGHA 4E73A 4MAOA 4G3DA 2XANA 3PUFC 4TYJA 3R0TA 3AC5A 4EL9A 4EYMA 3RAWA 3BBTB 2PE2A 4QMXA 3DXQA 3HUCA 5DNRA 2B9HA 4ZZMA 4WA9A 3D7ZA 2ZV8A 4CLJA 3CS9A 2OH4A 2YDJA 3HNGA 4YBKA 4F9BA 3GB2A 3R01A 4RVTA 4DG0E 4DH3A 3GCUA 3V8SA 3Q04A 2C5OA 4XCUA 3DK3A 1XQZA 3HMNA 4O0VA 5EDQA 3ZONA 4CFVA 4F0IA 3TUCA 4HPTE 3KXHA 2ETRA 5AA8A 2OXDA 4B0GA 5M4IA 4NWMA 3DJ6A 1PMNA 3SLSA 4YR8A 3KQ7A 2XA4A 3GGFA 1WBVA 4E6AA 5EHYA 4C4JA 3FWQA 1YHSA 1SMHA 2UVXA 2B55A 2RFNA 3G9NA 3COMA 3HV4A 3QCYA 3R00A 4BTFA 4EOJA 4BBFA 5FEQA 3L9NA 5J5SA 3TG1A 1G8JA 4BDEA 3DB8A 5IDPA 2PSQA 2PK9A 2JFMA 4P5QA 4O2PA 5HX8A 1UVRA 3BHVA 3M11A 3QXPA 4D2SA 3AC8A 3K3JA 3DK7A 2KTYA 3FSKA 4OBQA 1M7NA 4LOQA 2ZDUA 4BCOA 1VLRA 3O96A 2QKWB 5AP1A 1SVEA 1PMVA 4M13A 3MY0A 3QRKA 3AD5A 5J7BA 3AKLA 4PP9A 4ANLA 4BCGA 4E5AX 2FO0A 4IJ9A 4YHTA 1XO2B 3PA5A 2BHHA 4JJRA 3VBWA 4HVSA 4XP2A 2IZUA 3CGOA 5L2WA 1ZLTA 3VHEA 4QP1A 3U54A 3CLYA 4IH8A 3KXGA 3MJ2A 3WIKA 4CFUA 4FIEA 1Z9XA 4NTTA 5BMMA 3FMJA 3VQHA 3DDPA 1RJBA 4BJJA 2YM8A 2XNOA 4LM5A 4G6OA 4LDTA 4EK4A 3WI6A 5TR6A 3HAMA 3OZ6A 3I0OA 4DEEA 2ZM1A 3ZC6A 1BYGA 2B7AA 4AZTA 4ZTMA 4QDEA 1W2CA 4BDCA 2OJ9A 3R04A 4QP7A 3KKVA 3RM7A 1H28A 4J7BA 4J71A 3DFAA 1U5RA 2DS1A 4IX3A 5AP4A 3COIA 1YOJA 3S3IA 5L3AA 1SYKA 4FV3A 2JIVA 3ET7A 3PY3A 4UWBA 4F63A 3C5IA 3C5UA 1GZ8A 5HTCA 4RMZA 4FTLA 3G0EA 3BX5A 4X7QA 3IW8A 4I92A 4JG8A 4JQEA 3RMFA 4ANBA 4CYIA 2X9FA 2WTDA 1DI9A 2CLXA 5E8YA 5HU3A 4QQ5A 3CXWA 2C5NA 3PP0A 5G1XA 1H24A 4ITIA 3AMBA 3BYOA 2RIOA 4M97A 5IQBA 1W98A 4IDVA 3GC7A 2C69A 4QYGA 2C6DA 1E1VA 4R6VA 2CKPA 4XLIA 4NCTC 2XNGA 4ITJA 3BGZA 4YO6A 5HTBA 2PVMA 5AP2A 4DFXE 5LCKA 3C1XA 3OROA 3UP2A 1XBCA 4J52A 4AAAA 2OLCA 5KBRA 2R3OA 2VWBA 4CRSA 2IG7A 3F82A 5L2QA 1OKYA 4FUXA 3HMIA 2C3IB 4R7IA 1OIYA 3WOWA 3GEQA 2GSFA 3FL4A 4FSUA 1VR2A 4FKVA 2FGIA 1GZOA 3IW5A 4YUQA 4JQ7A 5DG5A 2BKZA 4FKSA 1IR3A 4GKHA 4RWLA 3BGPA 4X2JA 5AM7A 3TV7A 4MHAA 3UNZA 4ERKA 1M2RA 4DTBA 4RPVA 2QCSA 2WELA 3FZTA 4IX6A 4AFJA 3UOKA 5IEVA 3UO6A 4X6RA 5HKMA 2OJFE 4QMLA 2UVZA 1H27A 2J51A 3Q32A 4GKIA 4FKIA 5DR9A 2XCKA 3MH2A 3UNJA 2FUMA 4OR5A 1WVWA 4ZTHA 3HRFA 3QCXA 5EHOA 3HUBA 5E1SA 3RI1A 5EQYA 4AXEA 4V0GA 4GYIA 4E4NA 2F9GA 3BE9A 2X0QA 5H9BA 4F64A 3UVQA 1UNLA 3IGOA 4GMYA 4KIPA 3V5TA 4BBEA 4FC0A 4O6EA 4CLIA 1K3AA 2J50A 3QC4A 1Q99A 1Z5MA 3EHAA 3TI1A 3QD4A 1I09A 4IHPA 4U0IA 4DGMA 5M56A 3O8TA 3VBVA 2J9MA 3F7ZA 3Q4TA 5DE2A 3SW4A 3W2CA 3ATSA 2DQ7X 3V51A 4F08A 3H10A 3U6HA 3R6XA 3QX4A 3F5GA 5J95A 5JFXA 2WMXA 4QMZA 2C3KA 5L8LA 4J97A 2XNEA 3UJGA 4YJTA 3NUPA 2PUPA 2Z60A 5TE0A 3PWYA 4YJSA 3WILA 4NKAA 4DEIA 4DCAA 4NM0A 3O5AA 5FXRA 5JQ8A 3PE1A 5DR2A 1Z57A 5AUYA 3D5VA 4YZNA 3ALNA 4GK3A 3LXLA 2PVNA 3PXKA 4L45A 4OGRA 5HE0A 4BCJA 3W0QA 3T9TA 1FQ1B 3QQFA 3BU5A 4UMQA 4BDAA 1JKKA 2VO6A 4E5WA 4ZSAA 5JGBA 2Y0AA 4ORKA 5LOHA 3UIBA 4MBJA 2VRXA 2CMWA 1PRYA 1AGWA 3W33A 1ZRZA 4AF3A 4AG8A 4WRSA 3UVPA 5BUJA 3UOJA 3SG9A 3W2QA 1PYEA 2XNMA 5IUIA 2VX3A 2YZAA 4FKOA 5IA1A 2JD5A 2W99B 2ESMA 3BPRA 4FK3A 4BDKA 2YHVA 2C6TA 3BLQA 2RL5A 4YJNA 5A4LA 4D2TA 5A46A 3W10A 5IEXA 2VWXA 3TT0A 4USDA 5KE0A 3UG2A 2WIPA 3C50A 2OJJA 4XV1A 4KKEA 3FZPA 3MB7A 3HEGA 2R0UA 4JDHA 2WFYA 5EI6A 4E26A 2CHLA 4D9UA 4F65A 2YJSA 2I0YA 2HY0A 1IA9A 4NM5A 2XKCA 1BKXA 1XH4A 4OBOA 3OUNB 5HVYA 4ASEA 4ZLOA 5BYYA 5CEKA 2Q83A 5M09A 3OD6X 4TZRA 2DYLA 5AP5A 2XK3A 3LFCA 3R9NA 5CANA 3A7JA 3PJ8A 4JX3A 2VAGA 4PPBA 3VWAA 3WARA 3ATTA 3SV0A 3O17A 2BALA 5BVEA 1G3NA 3MV5A 3SXFA 3FY0A 2O3PA 4ENXA 2J6MA 2WQNA 4FZAB 5D7VA 4NK9A 3IK3A 4I23A 2WTCA 3TTJA 4EUTA 3DQWA 1PYXA 2B4SB 1Y91A 3WF6A 4ARKA 4TWCA 4E93A 2GQRA 4ZXTA 3OT3A 2OIBA 4MNEB 4FTQA 4EOIA 4CD0A 4LMUA 1J3HA 4J8NA 4ZTLA 1WBPA 3A7HA 5D41A 4F9WA 4CFMA 1A48A 3KIOC 1PXKA 1P4OA 3B8RA 4KWPA 3RPSA 1ZOHA 3C0IA 4W4YA 2OG8A 3HMOA 1G8KA 2Y6MA 4NIFB 3ZRKA 4UZDA 3PFQA 5CI6A 3LFAA 4FKGA 4YJVA 3LQ5A 3P0MA 5EM7A 5ETFA 3KMWA 3IKAA 4IM3A 3FUPA 4D2RA 3Q3BA 2CDZA 4FT5A 2OU7A 4KUJA 5FGKA 2F7EE 5AADA 3L8XA 3ZBXA 3ANQA 5ANEA 4LRJA 2RG6A 3AD6A 4Q9ZA 5FEDA 5CLPA 4FV8A 4F09A 5HBHA 4AGUA 1ZMUA 2PVYA 1PXNA 2XIKA 3FZ1A 3KA0A 4NT4A 5IU2A 2VX1A 3WE4A 1V0PA 4L68A 2ITVA 5HCZA 3EZRA 3E8NA 3PA3A 3GU8A 3VW8A 3GVUA 3BHYA 3UVRA 2HAKA 5J1WA 4C2WA 4Z9LA 4HPUE 3JR1A 4CCBA 1YXVA 3KF7A 3N4UA 4WHZA 3OW4A 3KK8A 1KV1A 1OGYA 5AAEA 4HZSA 3IW6A 4CEGA 5C8NA 3SQQA 2PU8A 2R64A 2ITYA 4CSVA 4UXLA 4A4LA 4ZZNA 2X0OA 4G6LA 4DFNA 4M8TA 3QGYA 4K2RA 3PJ1A 4NFNA 1XBAA 1YDRE 4FT3A 4O38A 4M0ZA 4YP8A 2J5EA 2LGCA 5IEYA 3RHXA 2VWIA 2IVUA 5CQUA 3L1SA 4TYGA 1H01A 2Y7JA 3VBTA 4BYIA 4A9SA 1K2PA 1OPLA 5IUHA 3QYWA 4I3ZA 4FF8A 5J5TA 3KN5A 4HCTA 3QZIA 4DEGA 4BDFA 4EJ7A 2XIRA 3ZLYA 2XK4A 4CGAA 4C4FA 1TVOA 3ORTA 4QMNA 5AMNA 2PUIA 5DHJA 2VTIA 2R5TA 4FEUA 2WMUA 2J0KA 2A27A 4JAIA 4FEWA 5CSVA 4ZMEA 5CNNA 3F2AA 4IEBA 3I6WA 3EQBA 4KBKA 3UC3A 3RALA 3HKOA 5H8BA 4ANOA 2JBOA 1Q8UA 3FLNC 4HGLA 1ZWSA 3D9VA 3PVBA 2CKEA 1PY5A 2QODA 3Q4UA 4P90A 2AUHA 4E3CA 3Q6WA 4QPSA 4EKLA 3F5UA 1ZOEA 2BZKB 4RIXB 1J7LA 4PMMA 3OWPA 2X0GA 1ND4A 2CN5A 4KS7A 3TWJA 2I0VA 3ODYX 4GIHA 4D58A 5CEMA 2Y8OA 4X6QC 2C4GA 2JAMA 4AAYA 3BRBA 3HA6A 3LFSA 3QTZA 5C1QB 3MFTA 4FZDB 4KBAA 4X3JA 5A3XA 4AQCA 4BI0A 1IAHA 3RK9A 4AXAA 3QD2B 4DLIA 2V7OA 3TZ7A 2GS2A 4DH5A 4C7TA 3ANRA 3NS9A 4NW5A 3CCNA 4DTKA 2WQOA 3UDSA 1Q8YA 4A4OA 2JIIA 3IONA 3FPQA 5LVOA 3W8LA 3NVMB 4IB1A 2IF8A 4HGSA 5CAOA 3U6IA 1SZMA 4FNZA 4XX9A 5DBXA 4ZAUA 3CE3A 3EQPA 3LAUA 1MQ4A 3CD8A 3OCSA 2OH0E 2OSCA 4HYUA 3R8PA 3DBDA 3UGCA 4ACHA 3SW7A 4CQGA 3SA0A 2OIQA 3IW4A 2YCSA 4U8ZA 4EOOA 3D5WA 2CN8A 1O6KA 4AE6A 3NYXA 5LVPA 1UA2A 4Q2AA 2VUWA 1UWJA 3F3UA 5BVDA 1YHWA 4PMPA 4AA5A 1WBSA 2OIDA 3QRJA 1OI9A 5M57A 4D4YA 4YC8A 3OMVA 4IDTA 4RLLA 5ANOA 4EEVA 5I9XA 2HZ0A 3P1AA 2WOUA 3BIZA 3KFAA 1BI8A 4IMYA 5BNJA 5HZNA 3R7YA 4DC2A 4K18A 2XB7A 3DBCA 3HV6A 5AP3A 4CG8A 4X3FA 4RFZA 2BCJA 3TZ9A 3DT1A 4UMRA 3NUYA 4O2ZA 4ACDA 1BUHA 3FQEA 4FZ6A 3FYKX 4CFFA 5CTPA 3I5ZA 2W1HA 3OS3A 5HESA 1Q62A 3TCPA 1Y57A 4BCQA 5CU0A 4CCUA 1OL2A 3C4EA 4QP4A 2XKFA 3ACKA 3VS5A 4RWKA 3VQUA 3DPKA 4BTKA 3ZDIA 5L6PA 4IB3A 4IC8A 4RZWA 5CENA 3TZMA 2CNQA 3W16A 4L9IA 4PTGA 1DS5A 1ZARA 5AUVA 4HCUA 5LJJA 3E7OA 2WB8A 2YERA 4OTIA 4BKZA 4D1ZA 2QONA 4F6UA 5JH6A 5JN2A 4GUBA 5AV3A 4FZ7A 4OW8A 3CQEA 3ODZX 4BDJA 4O96A 2ITXA 2OWBA 3QA8A 2R3JA 2QNJA 3CPBA 3PG1A 1FPUA 3BHHA 2VGOA 4DHJA 2C3LA 2NO3A 3EQDA 2BTSA 4F0GA 3HYHA 1APME 3AC2A 1P5EA 2JDVA 1SNXA 2F49A 5HE3A 4A06A 4OTHA 4PMSA 1YDSE 2AYPA 4EC9A 1U54A 4HYIA 3QWJA 4USEA 3W0SA 1SM2A 3TV6A 3N4TA 4FV1A 1YQJA 3DK6A 3BHUA 3BL7A 4EWQA 4O0YA 5IQAA 2F2UA 3DGKA 3W32A 3WIGA 4JVGA 2OZOA 4FNXA 3R7IA 4AW0A 1GY3A 2VWUA 3MPMA 1ZXEA 5L8KA 4EK5A 3Q2JA 3F3WA 1E9HA 3ZFYA 3QX2A 4MUQA 2VWZA 3BBWA 4USFA 1Q3WA 2VTAA 5J1VA 5BUIA 3VONA 5HVJA 2QD9A 4O27B 3WBLA 4ASDA 4XG2A 4PL5A 4KSQA 4JDKA 1F0QA 1QL6A 3FXWA 4GT5A 3JYAA 3R1NA 1M2PA 3QKKA 4FSWA 5K5NA 4TRLA 1Q8WA 1SNUA 4RFMA 1OKWA 1NVSA 1Y6BA 3ID6C 3RK7A 4AXCA 4D2PA 4QMVA 3R83A 4QYFA 1MRUA 5CU2A 5IH6A 5EW8A 2ZV2A 4PMTA 4ALVA 4ZIMA 4BIBA 3ETAA 4D5HA 4D4SA 4EQUA 3PVWA 4ID7A 2FSLX 2QO2A 1NVRA 5AUTA 3G0FA 3MTFA 3QYZA 3O2MA 4PF4A 1W84A 5BVNA 3JVRA 4W9XA 5IUGA 5DEWA 4FJVA 3AC4A 3VS2A 2BIKB 1HCLA 4ZY4A 2I0HA 4BJJB 3OFMA 3FMKA 5ETCA 4FEVA 4MWHA 2QKRA 3NGAA 4UYAA 4CV9A 3C0GA 4XLVA 5CEOA 1GNGA 3AMYA 5DA3A 3ZM4A 3WZJA 4DEDA 3JY9A 4ASZA 2X4ZA 3C7QA 4I6HA 4AFEA 4FTTA 4QYEA 3QC9A 4S32A 1TKIA 3I5NA 4II5A 3PUPA 3W18A 1KOAA 4FKRA 4QQCA 4BRXA 5M51A 4O6LA 3ZU7A 3QL8A 4PTEA 3AT3A 4A7CA 4EHZA 3HDNA 1ZY4A 3GP0A 4HOKA 4ZTSA 3V8TA 4FSQA 5F20A 3DY7A 3ZM9A 3WF7A 1KE8A 3DJ5A 2BFYA 4PNIA 5LMKC 1ZYSA 3TIYA 4L43A 5KO1A 1IRKA 4JBQA 3V5QA 5KHWA 4NCTA 3VS1A 2HZ4A 1H4LA 2UW8A 2HK5A 1Y6AA 3PRFA 2QR8A 5M06A 4XG6A 5CU3A 1OL5A 4G3GA 4ERWA 4BI2A 3RPRA 4BZOA 3VUHA 3ZZEA 4NTSA 3OEZA 4B99A 2BZIB 3VO3A 4XV2A 1VEBA 2BFXA 3D7TB 3DNDA 3LM0A 1YXUA 3R21A 4BKYA 4U44A 2XNBA 5IQHA 2W5AA 2A2AA 2WU6A 5I3OA 5HLWA 5KZ0A 4L46A 1OIQA 3QTXA 4O4DA 2WMRA 5M08A 2O0UA 4ANMA 2ZM3A 3I79A 3A7GA 3NVKI 3IQ7A 2W9FB 4JG6A 4V0GB 4ZK5A 3SOAA 4BCFA 4FTCA 4FGBA 4YJPA 5EYKA 3R8VA 4RX5A 4QPAA 3LLAA 2OF4A 3R8ZA 2C6LA 2YISA 2GNGA 4KABA 2Y4IC 5ANGA 4ZSGA 4D4RA 4F7SA 2RKUA 3O7LD 5AFVA 3EB0A 4R3CA 3VRYA 1KV2A 3OWLA 2GQSA 3VUKA 2O8YA 3MH1A 2W1CA 2F4JA 3NPCA 3CPCA 3DAJA 4ONAA 4U7ZA 5EFQA 2R4BA 3LKMA 1H25A 2UW7A 5C8KA 4O1PA 4ACGA 2JEDA 1KE7A 2Z8CA 4DFLA 2GDOA 4BGHA 2YZLA 4H39A 4A9RA 2FYSA 4OAUC 3OHTA 1PXPA 1W83A 4E4XA 2UUEA 5HD4A 2VO3A 2UZLA 3H9OA 2OZAA 3RP9A 1BX6A 4IACA 4D28A 2WHBA 5CWZA 5DMZA 2OKRA 2YAKA 3R1SA 2XNPA 1VYWA 3LFBA 4YZ9A 2XK8A 3VUDA 4FVPA 3TNHA 1W0XC 2QOOA 4TTHB 3I60A 4CVAA 5FP6A 2ETMA 3TNWA 5CT0A 4R7BA 2AQXA 4P5ZA 4MXXA 2E9UA 4QYYA 3BGQA 3SOCA 4Z55A 3R28A 1EH4A 2XK6A 5KMJA 2JGZA 4RIOA 1FGIA 3F3VA 3DAEA 3UG1A 3OG7A 2EXEA 4GK2A 1SVGA 4AS0A 4IZYA 5BVWA 4LGDA 3EKNA 3JS2A 5EYDA 3B8QA 1CDKA 4N70A 4AU8A 3GXLA 3VRZA 4XV3A 3LIJA 5IDNA 4FSMA 1H08A 3PIYA 3I7BA 4WUNA 4APCA 4ZSJA 4C37A 4AN9A 4ASXA 4GVAA 2VTQA 3AKKA 3VF8A 4LUDA 3OBJA 2YM4A 2PE0A 4FRFA 3HRCA 3WF5A 4WOVA 3T9IA 4A07A 4L42A 4QYHA 5HG9A 2HZNA 4NM7A 1LEZA 1NT2A 3FZOA 5KHXA 2BROA 5CVHA 2QOLA 2JKKA 4QRCA 3LQ3A 3HZTA 2J0JA 4P4CA 4WO5A 3A4OX 4ZEGA 2BRGA 3GC0A 3F69A 5DI1A 4JR7A 5D12A 3LMGA 4IC7A 2UZEA 3BWFA 5T68A 3LM5A 3W2SA 2XMYA 4XP3A 2P33A 3ZFXA 4WNPA 5M07A 2BRBA 2ONLA 4L53A 5AR4A 1PXOA 2IVVA 5KZIA 4F9AA 2YN8A 4FSYA 4O7YA 4JIAA 4F4PA 1CTPE 4FA2A 2R3QA 4I4EA 3MWUA 3ENMA 2ZV9A 1QMZA 4OAVB 4MXYA 2BRMA 3NCGA 3NYNA 5AR2A 5AV1A 1YDTE 3RPYA 4Y73A 5ETIA 3QAME 3BYUA 4KRDA 3COHA 3OUKA 3NR9A 3NDMA 4AZEA 3WZEA 2WMVA 3P23A 4B8LA 4F6WA 4X3FC 4C59A 4YGAA 4E4LA 3G6GA 3SX9A 4DT9A 2OFUA 1O6LA 2CGWA 2FSOX 2C0TA 2WEVA 3DBQA 4IAYA 4BDHA 2XUUA 5D1JA 2B54A 5A54A 5IF1A 3S0OA 5FTOA 4JG7A 4CTCA 3UC4A 2VD5A 4EI4A 2JDOA 2PWLA 3A60A 2UW0A 4MNEA 4WT6A 3NSZA 4DH7A 5IMXA 4F1OA 5A4QA 5CF4A 4GUEA 5EH0A 2C6OA 4IE9A 1XH9A 4M14A 2FB8A 1ZMWA 4CFXA 3PXRA 5E8UA 2WMBA 2IZRA 4BCPA 4QMWA 3VUTA 4IVDA 3THBA 3ULZA 3Q5ZA 4UXQA 4BIDA 1Y8GA 4I6FA 3FDNA 3NIZA 4NJDA 5AUWA 1KWPA 1FMKA 4MQ1A 4D2VA 1O6YA 3QQKA 1JQHA 2HWOA 2R3LA 2X6EA 3PZHA 4UALA 5L2SA 4PL3A 2JKOA 4DA5A 2OZAB 5E8VA 4QP6A 5FG8A 4YJQA 5JRSA 3GFWA 4X0MA 3QQJA 3ML1A 3LXKA 2H34A 4W4XA 3DXNA 5DOSA 4E6DA 2QG5A 3FQHA 5AR3A 2BDFA 3ZDUA 4IXPA 1Q8TA 3PYYA 3CKXA 4TPTA 5CS6A 3F5XA 3COKA 3ZUUA 5FDPA 2ZMCA 4LI5A 3FKOA 4W4VA 2GHGA 5FEEA 1QPCA 5AJQA 1UU7A 2CNUA 4RVKA 5FP5A 4BWPA 2BZJA 5CU6A 2IN6A 4MCVA 2R3GA 2QHNA 4KIOA 4DFYA 3KREA 4O7RA 3D0EA 2VTOA 3LFFA 4JQ8A 4AUAA