5CY3A

Syk catalytic domain complexed with a potent and orally bioavailable benzisothiazole inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
278
structure length
276
Chain Sequence
PKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVTDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Orally bioavailable Syk inhibitors with activity in a rat PK/PD model.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 89
structure length 276
sequence length 278
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cy3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cy3A01
1STCE 3BEGA 3L8SA 4RJ3A 5F95A 1H08A 3QQUA 4EHZA 3OD6X 1R3CA 4AU8A 4EK3A 3BU3A 1IRKA 3QX4A 5IQCA 3MWUA 4FZ6A 4M14A 4ZS0A 2EWAA 4GUBA 2F2CB 1FVRA 3I4BA 5D7AA 3F5XA 4S31A 3IW6A 3GC8A 5DA3A 4I5PA 4WA9A 3HVCA 2H34A 3BE2A 3SAYA 3MB6A 4C4GA 3ZMMA 2C68A 5C8MA 4X2KA 3SA0A 4G3EA 3QHRA 3MY5A 3QTWA 4I6HA 4RLLA 4XG6A 5CI6A 4CKIA 4DH7A 1R78A 4BDHA 2RFNA 4C0TA 4CLJA 2CNVA 3SX9A 4CKJA 4F7SA 1YXUA 2UZVA 3WF6A 4GSBA 4I6QA 4CTBA 4C62A 2Y4PA 1UU7A 4RA5A 4EK4A 4DG0E 2C1BA 1OL5A 4F9BA 1PW2A 4TNBA 3COHA 4O7SA 3UIXA 4RX9A 4PNKA 5J79A 3S3IA 3R0TA 4XCUA 4DGGA 2ZV2A 4QNYA 3R6XA 1SYKA 4MQ2A 4E4NA 4NU1A 3BYOA 1XH7A 4D1XA 4ZLYA 5C1QB 4E5WA 4YURA 1BYGA 4WUNA 3E8DA 2UUEA 3UPZA 2A0CX 3M42A 2R7BA 3ITZA 4QTAA 2ITPA 4FNZA 5AUVA 4JDJA 3KN6A 2WEVA 3ELJA 4GU9A 3LFQA 3QGWA 4I3ZA 4O0VA 3SHEA 3IOKA 5E8SA 4C36A 4C59A 3OBJA 1Q61A 3GU8A 4UYNA 3QKMA 4C4FA 4EHEA 4TYGA 5L3AA 2V7OA 4YJSA 3MH2A 1XH5A 3F5UA 4IZYA 5DNRA 3VBXA 4EQMA 4IC8A 3KRRA 3HUCA 3QUDA 4CCUA 2PL0A 4X2JA 4I92A 3OT8A 4BICA 5EKOA 4YR8A 3AMYA 2FVDA 3OCTA 2QD9A 3MH1A 4E6AA 5KHWA 1LR4A 1WBSA 1TQIA 1P4OA 4M69A 2VO3A 5IKWA 3C50A 1OMWA 2J2IB 3CD3A 4FL2A 4J7BA 2IVTA 3CKXA 3LFAA 3D83A 2ZDUA 3E62A 4R8QA 2GHMA 2P2IA 3OC1A 2XJ0A 4X21A 4CQEA 5KMOA 3FI4A 4RVMA 3C4XA 4Y85A 3EN9A 5FBNC 2IJMA 3FDNA 3BHTA 3M1SA 4FTUA 1Y6BA 3DB8A 2XVDA 5C8NA 2CKPA 3LLAA 4NW6A 4O82A 4EK5A 2UW3A 2CGUA 4IADA 2WMWA 2ONLC 2R0UA 1F3MC 2HENA 2YJRA 1KOBA 3ZOSA 4C35A 4F64A 5B2MA 3PDTA 4NSTA 2IW6A 4WHZA 5TO8A 3UYSA 4MEDA 4D9UA 3IDBA 4XUFA 3PZEA 1FOTA 4DFYA 4UX9A 5HVJA 3I5NA 2EB3A 5CANA 4DGLC 1QPEA 4M69B 3HV4A 2VWXA 3IW4A 3MFSA 3OY3A 3PXQA 5AP1A 3UOKA 2BIYA 3HMMA 3NUPA 1WMKA 5HD4A 2I0YA 4O91A 3IS5A 4IAZA 3HNGA 1VR2A 2WMRA 3REPA 4E8AA 5AFVA 4EOQA 4OW8A 4QMLA 3V6RA 3T9IA 1G3NA 5DH3A 4JBPA 3RI1A 3WZKA 4BCIA 1DI9A 2PVNA 2XNBA 3AC5A 3K5VA 1XH6A 3OUNB 5EM5A 4D4YA 3G9NA 4N57A 3FZSA 3MESA 1JSUA 3EZVA 3MH3A 4XLVA 1DAWA 2BZIB 4U79A 3RNYA 3DBQA 3Q4ZA 4G31A 2YWPA 4MF0A 4QT1A 3R8LA 3EQFA 4FKIA 5BMSA 2XK7A 4KAOA 4RX8A 2ITQA 1PJKA 2OKRA 3EN4A 4QMOA 4CMOA 3R02A 3EH9A 2C0OA 1Q3DA 2C6MA 3QWKA 4GFGA 2PVYA 5CVHA 1Q5KA 4XX9A 3V3VA 5B7VA 2PE0A 4MAOA 5HEZA 4K1BA 2V62A 4FT7A 4EKLA 1JSVA 3DOGA 1PKDA 3D5WA 2PE2A 5J95A 2DS1A 4L42A 2Z7LA 3C4FA 3MJ1A 2I1MA 4QP1A 4RG0A 4JG7A 4BTMA 2VTTA 3GCPA 3TT0A 5JRSA 4DT8A 5EYDA 3NYXA 2XKDA 5IDPA 3FZTA 3NYNA 3WF5A 3PG3A 4AZVA 1GOLA 2IN6A 3N51A 3OHTA 2X6DA 4C61A 2QOKA 1X8BA 2XCHA 2CDZA 3N4TA 3WIKA 5EOBA 4FTTA 4PDPA 5TOZA 5IQBA 3DNDA 2ITVA 4IB1A 4FG8A 4BWXA 1PHKA 2PUPA 2JAMA 4M15A 4AW1A 2PYWA 3ORPA 4NCTA 4CFUA 2OZOA 1H0WA 2O63A 4XYFA 4FTMA 3QGYA 2ZOQA 4YTHA 4BI2A 4BCKA 4ZAUA 3TV7A 1H0VA 3ZO1A 3BYVA 2PTKA 3E87A 3MPMA 2BDFA 3BYUA 1GNGA 3LAUA 4JQ7A 2XMYA 5M56A 5IA4A 4EBWA 2QR8A 5JK3A 5C01A 3TZ8A 4HCUA 3KREA 2JITA 4AGCA 3LJ0A 5HTBA 2ZJWA 3QRTA 2A2AA 2GHGA 3OWLA 2X1NA 3PLAE 4WBBB 3SKCA 3QTSA 2WFYA 4U7ZA 1F5QA 3LE6A 3LQ3A 4XOZA 5CTPA 3RCDA 3GUBA 4E6QA 4CNHA 5CX9A 3CEKA 4O21A 1ZYDA 2JEDA 2YM8A 3E92A 5GJFA 4ZXTA 3ZLWA 3U54A 4WNKA 5T3QA 2C6TA 4IZ5A 4DFNA 4DTKA 4U8ZA 5EHLA 4ZTLA 4FODA 3VJNA 4XV9A 1YOLA 3ORKA 1MP8A 2JKKA 3V5QA 4C4EA 3Q2JA 1ZYJA 3U6JA 2GFCA 2CHLA 4IFGA 3R8VA 5HE0A 1YRPA 3NZ0A 4Y5QA 2A1AB 5LMAA 1VZOA 4ITHA 2Q0BA 5H3QA 4YJRA 5TF9A 5IUHA 2QONA 1YHVA 5A9UA 3RVGA 4MBIA 4N6YA 2EXEA 5HORA 3COIA 3VF8A 3QD0A 4CFVA 5CNOA 4FGBA 4GUEA 4J8NA 1LEZA 4RQVA 1H1SA 1P4FA 4I24A 5A46A 4FEXA 5DPVA 5E4HA 1Y8GA 3O71A 5KMKA 5GIPE 3E3PA 2PPQA 3Q6UA 3AD4A 1ZXEA 2HW7A 2RG5A 4X3FC 2VX1A 3FLQA 2EB2A 4FT5A 5J9LA 3MDYA 4AG8A 4L7FA 2PMOX 3BZ3A 4IACA 4RFYA 2PMLX 5EK7A 4USEA 2B55A 4YC3A 3RWQA 4DFXE 5HX8A 3PXFA 3UBDA 3DDPA 3QX2A 3OW3A 5FEEA 3F61A 3ROCA 4CFXA 3FBVA 1YOJA 3QUPA 1UU9A 5HG9A 4RC2A 4A4LA 2BZKB 4O27B 3HZTA 4HNFA 3UQFA 3GCQA 3BRBA 4GCJA 3POZA 2X0GA 4AGUA 3I60A 2YAKA 3Q60A 4YZBA 4QMTA 4TRLA 1QL6A 3HDMA 3D94A 4L68A 1R1WA 4H36A 4FTAA 5FTGA 2GNGA 2H6DA 4WO5A 4FV4A 4AZEA 4HYSA 4Z55A 2XKEA 2B53A 3ZO4A 4EYJA 4ANBA 3LCSA 4LV5A 4W4XA 3W10A 3KF7A 2LGCA 3THBA 3LXPA 4FVPA 4FTKA 5M44A 2CPKE 4GYGA 3N9XA 2WTKB 4GIHA 5HESA 2JAVA 3V04A 3OVVA 2YIYA 1P5EA 2C5VA 3MV5A 5ETIA 3C4CA 3HMIA 3Q04A 3C5UA 5CSXA 4F0FA 3MI9A 2WTWA 3D2KA 3OMVA 3FXWA 3AQVA 3PJCA 3PJ2A 4CSVA 4LUDA 3R71A 5M53A 2HOGA 4QMPA 4W8DA 3WE4A 3WYYA 2RF9A 3K3JA 4E6CA 4FC0A 3VBYA 1RW8A 4U97A 3KQ7A 3W1FA 4F7NA 5KMNA 2GMXA 3KMMA 3WIGA 3LFEA 1BUHA 3OXIA 3FJQE 4C38A 4BI1A 4E4MA 4HGTA 1FBNA 4FTQA 3FHRA 4FKVA 4AW0A 2R0IA 2IW9A 3KCFA 4XG8A 3ZS5A 5IMEA 5J5SA 3K2LA 3UVRA 3W2PA 1H24A 3DZOA 3DKFA 3E63A 3P78A 3A7IA 3SRVA 5EG3A 2WMVA 3ID6C 1OGUA 3ZFYA 5CLPA 3VHKA 3MVMA 4ALUA 2ZMDA 5AEPA 3W18A 5EKNA 3D2IA 4O0SA 4GL9A 4JDKA 5IQGA 3FLZA 3CGOA 2XBJA 4YJOA 5JFVA 3MVJA 4EQCA 1B38A 3Q96A 5GHVA 3FMDA 4KB8A 2YM6A 3NDMA 5CVFA 3ZM4A 3ZZEA 4UN0C 3QCQA 2PVLA 5IUGA 2OIBA 4P7EA 4FV8A 5EH0A 2WMQA 3QRUA 4H58A 3FXXA 4A06A 3ENMA 3R8ZA 1BL6A 3IG7A 4PMSA 1CDKA 3SRVB 1FMKA 1O6YA 3BWFA 5IQFA 4ZSAA 4V0GB 5JGBA 2P2HA 3CPCA 3N4UA 1ZOHA 3CJFA 2WOTA 2KTYA 3DZQA 3VBQA 4FKPA 3ZUVA 2XB7A 1OKWA 1AQ1A 3HA6A 4DITA 4HVHA 3FI2A 4I41A 1BLXA 4FKTA 3HV6A 5ANJA 5H8GA 3V8SA 2YAAA 3HGKA 3QC9A 3PSBA 2R3QA 4BFMA 3FKOA 5AR8A 3TJCA 3DGKA 2IVVA 4FT3A 5LMBA 2G1TA 3SVVA 5DIAA 5CEQA 3HEGA 4NM5A 1REJA 1YWVA 5JMSA 3DKCA 4AACA 4O0XA 1H1PA 4KKEA 5FG8A 5AWMA 4EH4A 3BI6A 1Q8WA 5KMIA 4I23A 2JKOA 4AFEA 4GK2A 2WEIA 2ERKA 3EFLA 1V0BA 2SRCA 3RZBA 3ZYAA 3C4WA 5AR7A 1WVXA 4GFOA 5LARA 4IDVA 4QO9A 4E4XA 5HIBA 2UZTA 2ETKA 4FTIA 4GS6A 3UE4A 3JR1A 3ATSA 4I94A 4MXAA 5BVEA 4ANSA 4PF4A 3EL7A 4MD8E 4D2VA 3GI3A 3RM6A 3E7VA 2Z7QA 4I20A 1H28A 2FSOX 3FAAA 3GQLA 1PY5A 5GINE 3KN5A 4RBLA 5DR2A 5K4JA 2C3JA 3VBTA 2WMUA 2PMIA 4NM0A 4EL9A 2WTJA 4WSQA 4KIQA 3NUSA 4HVGA 1O6KA 5LWNA 1MUOA 1Q3WA 3D15A 3MPTA 5C03A 3WZJA 5EM6A 3L9MA 3NX8A 4FKUA 4KABA 4OT5A 4YZNA 2R3KA 1OL2A 4AT4A 2P3GX 2O65A 3QCSA 2HZ0A 2UW5A 4NWMA 3GOKA 4KRDA 4W8EA 4JBVA 3ZC6A 5A4EA 1NVRA 4E73A 1BI8A 2YIRA 4A4XA 4BKZA 4CKRA 4AW2A 1LEWA 2JDRA 4EH8A 3CXWA 3UVPA 2OK1A 4EC9A 5AAEA 1T45A 4X6RA 4HJOA 1PRYA 4DGNA 2O2UA 2R5TA 5LCJA 1M7QA 5HO6A 4WG3A 1NT2A 4XNEA 4RX7A 3BV3A 3MB7A 4ONAA 1KE7A 4U42A 5FM3A 3NEWA 3GFEA 3FLWA 3ZBFA 2JIIA 4EI4A 3FMNA 1PXNA 5DRDA 5FXQA 3FMEA 5CYIA 4CZTA 4K11A 1OBGA 4YBKA 4JR7A 4ZP5A 4KKHA 3PA3A 2W1CA 3GU4A 4AQCA 5EYKA 2YWVA 4H1MA 2W5AA 1J1BA 4JX3A 3PE2A 1IR3A 2YEXA 2XNNA 3FZRA 4W9WA 4ANOA 4BY9E 4QMQA 4TYIA 4FKSA 4LFIA 4RWIA 3VN9A 1WAKA 5HBHA 2XM9A 4XG4A 3FL4A 1IASA 5HICA 3RAKA 2X9EA 4AA5A 4WRSA 4QTEA 4YGAA 3CTHA 4FV0A 4H39A 2C6LA 1JQHA 4DH3A 3G15A 3HV5A 1TQPA 2BTRA 2C6KA 1CKPA 5DGZA 5BMMA 5IMXA 5KKRC 2NRUA 2ZB0A 4MYGA 2PU8A 3QWJA 4JQEA 3B8QA 3GCSA 3HDNA 4I93A 3MGYA 3KXNA 1FQ1B 3OWPA 4FSNA 2OO8X 2XRUA 3ORNA 1OBDA 5EQYA 3PIYA 5ICPA 5JZNA 4CFWA 5HLNA 4FZAB 3FKNA 3PG1A 4BZDA 4BDJA 3T3VA 4FIFA 3P7AA 5AR3A 1SNXA 4O0TA 4WIHA 2G2HA 4IX6A 1BI7A 2VWZA 4PL5A 4D2RA 1I44A 3AD5A 3GEQA 3ODZX 4RVKA 5ETFA 4HPUE 4BBFA 3NNXA 4HVSA 4D1SA 4MF1A 4YLJA 2WTVA 1QCFA 5M4UA 4I1ZA 5EHYA 1XH8A 1JVPP 3HECA 2UZWE 2E2BA 2W4OA 3Q9WA 3H9RA 1KE5A 3PVUA 4FYOA 4AUAA 4TWCA 4PMMA 4RQKA 4G17A 4YC6A 4DYMA 5K0KA 4YMJA 2GNHA 4C57A 2J0MB 4PDYA 2W1EA 5J9ZA 3FMMA 4C33A 4ANNA 4RIXA 1IAHA 3IDCA 3QF9A 4K77A 3UMWA 5AV3A 5KCVA 4WNMA 3Q2MA 3BLHA 5HZNA 5DOSA 5BVKA 5AP0A 1OZ1A 4L45A 1UWJA 3EQRA 2I40A 4Q2AA 3S95A 4PPCA 3MJ2A 4X2FA 4FEUA 2X8EA 5CU3A 3DV3A 2C5YA 2Y4IB 3QUEA 4IE9A 3VWAA 4FT0A 3ZFXA 3FI8A 4RWKA 3F3VA 3FLSA 3NNUA 3VVHA 2IG7A 5LVPA 4F99A 4XV1A 4X7QA 4I5CA 1OL7A 3JUHA 5J7HA 3D5UA 5JH6A 3S00A 3AC4A 4MXZA 2UW7A 3MBLA 4EJNA 1R39A 2CGWA 2W05A 2X4ZA 2Z2WA 3F66A 4JIKA 4ZLOA 4EWQA 4ENYA 3UDBA 4BCHA 4GT5A 3R73A 5JFXA 3HV3A 2RSVA 2BCJA 2XK6A 4FTCA 5IQDA 1W0XC 4ZSJA 3D5XA 1MRUA 3A7HA 3LFDA 4KS8A 1XR1A 5BVFA 2VUWA 2W1FA 3I0OA 3RGFA 3EL8A 5I9XA 5J5TA 3KXXA 4KWPA 2HK5A 5IUIA 4D0WA 4ALVA 3ODYX 4YJQA 4L8MA 4S33A 1OB3A 3DJ5A 4ZTNA 3EHAA 4RIWA 2VU3A 3SLSA 1XBCA 2BIKB 5IA1A 2DWBA 3BE9A 2WQOA 2GCDA 2YM3A 2QOCA 3TEIA 3LMIA 4H05A 2WMSA 2C30A 2QCSA 3IPHA 5ETCA 3PIZA 3TNHA 5HNIX 4A9UA 3EIDA 2ETMA 3A7GA 3BCEA 4NUSA 2QI8A 3KVXA 3DLSA 4I21A 5L2QA 2OF4A 3C9WA 3U87A 3ZFMA 4EKKA 4F1TA 1ZWSA 4A9RA 4D2TA 3GFWA 3R7OA 2UW0A 5HNBA 3W2RA 4CD0A 4WNOA 4DTBA 4R5SA 4GV1A 4FV2A 2EVAA 4EOOA 1RJBA 2VO0A 4L00A 4HCTA 5E8ZA 5DWRA 1ZRZA 1PXMA 1GY3A 4JI9A 4O0WA 2VWBA 1XH9A 2IVUA 4R7HA 4C37A 5HTIA 3UO5A 3C4EA 2FUMA 3RAHA 3PPZA 3DT1A 2BHEA 4U40A 3OWJA 3Q32A 4LGDA 5AIKA 4USFA 3VUGA 2X2KA 3F6XA 3NCGA 5CEIA 2QG7A 4H3QA 3FZPA 4ACHA 3UO6A 4CLIA 3I81A 2FH9A 3TZ9A 4DCEA 5CSHA 2F2UA 3BYMA 5A3XA 2OXYA 4Q9SA 3AD6A 4ZTSA 4BDCA 4AFJA 4ZLZA 3PVWA 3QRJA 3A60A 1CM8A 2HCKA 4DFZE 3IO7A 4K33A 4FE2A 4CZUA 5L6PA 4ID7A 4CRLA 5FWKK 5AUXA 3KRLA 3QQHA 4GT3A 4G6LA 1OUKA 3QKKA 3ANQA 3Q9XA 3W2OA 4AA0A 4IX3A 4GT4A 4R3PA 5AADA 3NUYA 5FTQA 3BGQA 3ZHPC 4RIOA 2WAJA 4YSMA 3NVKI 4OTIA 2WHBA 2ZM1A 4RSSA 4LGHA 2B9HA 4UWCA 4I0RA 1OL1A 2B9FA 4RA4A 5AAFA 3VUMA 1H27A 4QYEA 2C0TA 3P7CA 4FI1A 3BV2A 4HZRA 5E92A 3MVHA 3BHVA 1Y57A 2ITWA 1WVWA 4MTAA 3R2YA 1OUYA 4TTHB 2OWBA 3UNKA 3PXYA 1OIRA 5IEXA 4FV5A 4BHZA 2QKRA 2V7AA 3E88A 4PQNA 2ITUA 1ZLTA 2HW6A 4FIHA 3OP5A 1YXXA 3MIAA 3OOGA 5AM7A 4YTIA 3S0OA 3TUCA 2GQSA 4QP6A 3ZC5A 3RAIA 2PZYA 5CU4A 1URCA 3NNVA 4KD1A 5AP4A 3NS9A 1JKTA 4EUUA 2PVJA 3P23A 2JFLA 4UXQA 3ULIA 3VUKA 5CZHA 3BWJA 3JY9A 5EHOA 4S32A 4BCJA 3TM0A 2VAGA 4EK6A 3FZ1A 1U59A 3QQJA 2YN8A 3MA3A 1KSWA 3TN8A 4FKLA 4DFLA 4ZZMA 2B1PA 2GTMA 3QTUA 4JT3A 5IZFA 5CU2A 1GAGA 4IX5A 5CALA 1IA8A 4N4SA 4RX5A 3F69A 5CENA 4G9CA 4IANA 2C5XA 3MPAA 3QQFA 4I5MA 4FKOA 4TWOA 4FOBA 4USDA 3L8VA 3WOWA 5HOAA 1IAJA 4AW5A 3BBWA 1YWRA 4RJ5A 4FIGA 5L4QA 1XH4A 5JFSA 4FV1A 2VNYA 3HMPA 4MD7E 3ZTXA 5IH5A 4BZOA 3KXZA 4LL0A 4S2ZA 5DEWA 3LXKA 1FPUA 5LJJA 4O7LA 4M0YA 4ZZNA 2O3PA 3DNEA 3QFVA 4RPVA 2UVZA 4XG9A 4DF3A 4Y72A 2R3JA 3FYJX 2ZV7A 3EYGA 4JXFA 5FD2A 3EOCA 3FXZA 3UP7A 3TUDA 2YIQA 3L9LA 2QQ7A 5HIDA 2RFDA 3O0GA 5K5NA 4AE9A 2WPAA 3DB6A 5M06A 4FVQA 4F0IA 5D1JA 4BZNA 4E26A 3SDJA 3H9OA 3TG1A 4BDIA 3WF7A 3DK6A 2BPMA 3ZRMA 4B7TA 5GNKA 2XK9A 4DLIA 4XBUA 3DY7A 2EUFB 2VTJA 1JPAA 4GH2A 4MCVA 5LVMA 4IIRA 4FSMA 1JKKA 2OZAB 4NFNA 2B54A 4FEVA 5AUUA 1YXVA 2W9ZB 4QP4A 1Y91A 5FXSA 1HOWA 4Z9LA 4NEUA 4BCNA 1SVHA 1FMOE 1M2RA 4FSZA 4M84A 5DRBA 2WTDA 3MY0A 4C02A 5J1WA 1AD5A 3JY0A 2CCIA 3ZXZA 5E1SA 4EH7A 3O50A 4UV0A 1BKXA 4ACGA 3K3IA 2ZYBA 5CWZA 2XM8A 3C0HA 3LCTA 4V05A 5HG7A 1FGIA 2QVSE 2XNMA 4J98A 5CAPA 3FYKX 1UU3A 4C4JA 3LFFA 3MS9A 5D41A 1ND4A 3W2CA 2VO6A 3ZZWA 4QMWA 4GU6A 4L01A 3QRKA 1H25A 3HP5A 4NKAA 4EOSA 4EUTA 2UV2A 2YABA 4I5HA 4GKHA 4YPDA 2XK8A 3BGZA 3F3ZA 1IEPA 2V5QA 2PMNX 3CKWA 4OUCA 2GNLA 4XBRA 5CVGA 3UC3A 3R9OA 4G6OA 2YCSA 3GNIB 4B99A 3FHIA 5DFPA 4Q5EA 4BYIA 2XZSA 1SM2A 3OXTA 4MVFA 4O0RA 4OTPA 3QXPA 4XHKB 4QYHA 3WI6A 5AUTA 4U0IA 1KE6A 5E1EA 3SC1A 4ALWA 1ZZ2A 3L1SA 3MTLA 3QXOA 4GJ3A 4PP7A 4EZ5A 1FGKA 3RM7A 2GDOA 4FMQA 1P2AA 5LCKA 3KC3A 3PY3A 5EW3A 3UG2A 2O8YA 4FICA 5BVNA 4IEBA 1SVGA 4BVUA 2QLQA 2BRMA 4BB4A 4Z7GA 3VW6A 3TTIA 2YLFA 2Q83A 2W5BA 5BUJA 5EW9A 3OW4A 3PLSA 3RPRA 4EWHA 5HE2A 5FP5A 3EQBA 4XV2A 5E8UA 4ZOGA 3GCVA 3H30A 5D10A 5I3OA 3EFWA 1WBNA 5ETAA 2W17A 5FEDA 4DBNA 4YZMA 2UZNA 2ZVAA 3I5ZA 4WSYA 3DQXA 1OITA 1HCLA 5AX9A 4RT7A 2OBJA 5EOLA 4G6NA 1KE8A 1MRVA 4MWIA 3O2MA 4K2RA 5IISA 3V01A 3EQCA 3VRYA 3NUUA 3PWDA 3TNIA 4D2PA 4QMNA 2CNUA 2F7ZE 2WKMA 4NCTC 1CKIA 3EZRA 3AGLA 4AOJA 3LCDA 4WG5A 5GZ9A 1G8SA 4X2NA 5JGDA 3E64A 3G6HA 2HELA 4F6UA 1PMEA 1TVOA 2P0CA 3ETAA 2ZB1A 4GMYA 1RDQE 3OF0A 4NZWB 4PPAA 4AA4A 5CEMA 1ZMWA 4AWIA 4F63A 4UZDA 3R83A 2BDJA 3UNJA 1W7HA 2RFEA 4ZMEA 3ORXA 4L3JA 5E8TA 4IB3A 5BX0A 4QYFA 5BYLA 3QCXA 2XEYA 4C4IA 4JDIA 4ZIMA 4LUEA 4YNOA 1NY3A 2Z7SA 5J1VA 1NXKA 2GTNA 3M2WA 4O1PA 3RPVA 2HY81 3NIEA 2AC5A 5A4QA 4TW9A 4HGEA 4BWPA 4X0MA 5HQ0A 3ZDIA 4U45A 4KIKA 4XEYA 2Z7RA 4D9TA 3UTOA 3HYHA 4OBQA 2OFVA 4LL5A 4DGMA 2PK9A 4QNAA 4ZY5A 3PTGA 3FQSA 2OIQA 1UKHA 2X9FA 5BYYA 4GEOA 2ITZA 3VQHA 5CZIA 3NW7A 2VX0A 3R9HA 3UG1A 3VS3A 4AN2A 4QTDA 4F9YA 4AT3A 4A7CA 4R6VA 3P9JA 3PXRA 1H26A 1Z9XA 3ERKA 3CD8A 4OAVB 3SGCA 1V1KA 4QYGA 3M11A 3UO4A 1OPKA 2UZEA 4KIKB 3FSFA 5CNNA 3II5A 2Y9QA 4KIPA 4FSRA 3HA8A 2R7IA 3B2WA 4P4CA 4QQ5A 5IG1A 4I0SA 5KNJA 1Q4LA 2XH5A 4ZMFA 2Y6MA 2P4IA 3A4OX 2WMBA 4FSYA 4FUXA 3COMA 3VUIA 2G01A 1UVRA 4YLLA 2WQNA 3TKUA 3HLLA 5DEYA 1ZYCA 4ANQA 4X3FB 2XJ1A 5H2UA 3ZSHA 3OFMA 3KGAA 3Q53A 2X39A 4QPSA 1DM2A 1IG1A 2X7FA 4M67A 5C9CA 4GJ2A 3A4PA 3FKLA 1OPLA 3LCOA 4X3JA 3GGFA 4A07A 5J7BA 3UOHA 4LRJA 3NRMA 4C34A 4P90A 3VNTA 2VTMA 4TXCA 4JBOA 2ITOA 4Y5HA 5FGKA 5L6WL 3R8PA 1SNUA 5CU0A 1PXOA 4I6FA 4CFMA 4QMYA 5AR5A 4AXAA 2OW3A 3R1SA 3AMAA 2BFXA 5ANEA 4ACDA 1ZARA 1JWHA 3R1YA 5K9IA 3A8WA 3O96A 4FV6A 2PE1A 4WRGA 1GJOA 5AX3A 3U8WA 5M4FA 1E1XA 3PJ3A 3ZLXA 4C7TA 4F6WA 3T8OA 1NVQA 1OVEA 2X8IA 3NUAA 2RG6A 3DTWA 4MXOA 5L8JA 1ZY4A 4DT9A 3ALOA 3H9FA 5DT0A 4YTCA 5I0BA 3CLYA 3VRZA 3F2RA 3ZSGA 4EZ7A 3PXZA 3QBNA 5D12A 4NJ3A 4CMTA 3V5PA 4ZJJA 3HP2A 4CEGA 4FIIA 4C58A 3MYGA 3TI1A 3F3TA 4FBXA 3R7UA 2CN5A 3AC1A 4V0GA 3VAPA 4QTBA 4KSQA 4ZK5A 4BIDA 4GK4A 3F88A 3KXMA 2DQ7X 4ARKA 1R0EA 5K3YA 2OU7A 1BL7A 4FL1A 1ZAOA 3LCKA 4FTJA 3WZDA 4BI0A 1MQ4A 4F4PA 4RLKA 4BCQA 2BAKA 5AR2A 3GC0A 3HX4A 4IWDA 2BDWA 4DC2A 2JGZA 3ROYA 4O7ZA 4OTGA 3IQ7A 4R1VA 5AP7A 4CVAA 3DBEA 3LKMA 3P79A 3NSZA 4TPTA 4YJNA 4J97A 2OSCA 3A7FA 4IQ6A 2HWOA 4GW8A 3GB2A 3TJDA 3NNWA 5CSWA 1PXIA 1UNHA 3ZM9A 4PL4A 4P5ZA 4CRSA 3ZH8A 3UIUA 5C4LA 3GC9A 3HRCA 4HVDA 2J5FA 5AR4A 2A19B 3LJ1A 4TN6A 4DEIA 2BZHB 4AGWA 4BBEA 3QZIA 5ACBC 1MQBA 3IW5A 3O7LD 3Q6WA 4BTFA 3MFRA 4DCAA 2ZMCA 4DG3E 3A2CA 5AM6A 5IQHA 4FKQA 5B0XA 3EKKA 3ZLSA 4D5HA 4KA3A 2XIZA 4UWBA 2CMWA 4IHPA 4EHVA 4CT1A 3VS1A 5BPYA 4IJ9A 2VN9A 4OLIA 3O8UA 5FQDC 5KZIA 3TTJA 4BCGA 5HG8A 2A27A 2G9XA 2ZAZA 2CGXA 3BPRA 3ZEPA 1W83A 1YW2A 2Y0AA 3FMKA 3I0QA 4O6LA 4TL0A 5EQPA 2YJSA 2CKEA 4U3YA 3H3CA 3VIDA 3WF8A 4GVJA 4FK6A 2IO6A 4MX9A 3QKLA 2QOBA 4O6EA 5M4IA 4TZRA 2QLUA 2QO9A 3UMXA 3AMBA 2QHNA 4O7NA 4E5BA 1Z57A 2RIOA 4PMPA 2WXVA 1H4LA 2J5EA 3Q4TA 3WARA 3RZFA 4ERWA 3TKHA 4L9IA 5F94A 5E90A 5FM2A 4F08A 2CN8A 2CKQA 1CSNA 2C6DA 1LPUA 4G3CA 4U5JA 3SW7A 1AGWA 3D5VA 4MNEA 3F7ZA 4IVDA 4M97A 3HMOA 1QPDA 1KOAA 4C2WA 4BC6A 1YQJA 5DE2A 3UOLA 1XJDA 3P08A 1Q8ZA 4AGDA 4DEAA 3QYWA 2Z02A 5KMJA 2ERZE 3K54A 3VHEA 2W5HA 3AG9A 5EI6A 4CG8A 2OI4X 4A9TA 2B0QA 3PSDA 2XNPA 3UJGA 3CY2A 3VW8A 3MSSA 5LVNA 1M17A 1YXSA 3LFBA 5AA8A 1A48A 3KB7A 1Z5MA 4PPBA 4EYMA 4EH6A 2OJ9A 3BX5A 3DK7A 4IZAA 4AP7A 2QOHA 4NM3A 4RFMA 4BHNA 5E9EA 4HOKA 4MNEB 4ITJA 4DHFA 1ZYSA 4RZWA 2CSNA 4PX6A 5JFWA 1Y6AA 2FSLX 2W1ZA 4PL3A 3UP2A 2YM5A 4HGLA 4G5JA 3NPCA 3WE8A 5B2KA 3BHYA 4NTTA 4P2KA 4EJ7A 4DG2E 5C4KA 4Y83A 2ZM4A 2IWIA 4FF8A 1RQQA 2Y6OA 3IOPA 3QD4A 4GG5A 4IC7A 1Q8YA 4O38A 3U9CA 3QTIA 2OG8A 4NIFB 3U4UA 3CY3A 2REIA 3L9PA 2BRBA 4QTCA 3FE3A 5AP3A 3C4ZA 5J87A 4G16A 2OH0E 2R3PA 4FV9A 3W2QA 1W98A 2JIVA 2J6MA 4AOTA 2GS2A 3R2BA 2YIXA 4DA5A 3KL8A 5CAQA 3H0ZA 1J7IA 4C3FA 4I4FA 3HMNA 4B8LA 2FSTX 1KE9A 4J52A 2ZDTA 1VEBA 4GK3A 1WBVA 2XS0A 4OTWA 3OWKA 2F4JA 2BUJA 4K6ZA 3TV6A 3BHHA 3QTQA 4FG7A 3VUHA 2R9SA 3W55A 4NW5A 3F3UA 3NIZA 3NW5A 1NVSA 1GZ8A 3MIYA 4YJTA 4YBJA 4EOPA 1JKSA 5GZAA 5A14A 2E9NA 3TCPA 4E1ZA 3LM0A 5IQAA 3WF9A 4PNIA 4MD9E 3MFUA 4WKQA 3U55A 3OCSA 4AOIA 2R4BA 2VX3A 2JLDA 4EOJA 5CY3A 5ANOA 4OTQA 2HYYA 3VS4A 4FVRA 5LMKA 4RMZA 2IZTA 5M4CA 4TYJA 5ACKA 3Q3BA 3VBWA 5CXHA 2ESMA 2HXQA 5F9EA 4JS8A 1GZKA 2B4SB 2GU8A 3DU8A 3GT8A 5E8WA 3T3UA 5HO7A 3VS5A 3QLFA 2UZLA 2E9OA 4GIIA 4BN1A 2VTNA 3ORIA 3ACJA 4JOAA 5HVKA 4RVLA 3NWWA 4O96A 3LFNA 3KFAA 4R78A 3VS6A 4RZVA 4W9XA 5DLSA 5KKRB 5IQIA 3NAXA 3FLYA 5EDPA 3JXWA 4DAWA 1DI8A 3P7BA 3KRWA 2WQMA 2XA4A 1B6CB 3OCGA 4MK0A 2RFSA 4HYHA 4X6QC 3UYTA 3ZRKA 4F1OA 5FXRA 1OKZA 3I79A 1HCKA 2VZ6A 1ATPE 2XYNA 4BIBA 2BFYA 3EB0A 2WQEA 3QL8A 4X2GA 5TKDA 2JKQA 3E3BX 3OUKA 2OFUA 3OBGA 5LVLA 4AX8A 5KX8A 3QA0A 4RVTA 1CTPE 3SD0A 5GJGA 2Y4IC 5CU6A 4D2WA 4DEEA 3ZEWA 3HRBA 4B9DA 3DKOA 4F1MA 3POOA 3G5DA 4C4HA 3DLZA 1EH4A 3BYSA 4RC3A 2OXXA 2JDOA 4G5PA 5DI1A 4BR3A 1H07A 3A99A 1YDTE 4DE4A 2XP2A 1VYZA 5CQUA 1PMVA 3RCJA 4UYAA 1REKA 4ZTHA 3GQIA 3CTJA 3QAME 3U4WA 2W96B 1M14A 3SXFA 3ZSIA 2I0VA 1ZZLA 3TNWA 4XMOA 3SXRA 4IVCA 4P5QA 4O1OA 4FT9A 2VNWA 2WZJA 1J7UA 2OXDA 4OTHA 4JJRA 3GOPA 4R3RA 2WU6A 2R3LA 3R28A 2BRHA 2HZ4A 1BX6A 2YCRA 3DFCB 5A4LA 4FYNA 2VGPA 4OTRA 4DH1A 3FEGA 5CS6A 2JBPA 2JD5A 4FR4A 4ZY4A 3RKBA 1YHSA 2XF0A 4MBLA 2R3HA 4YHFA 2B9IA 3E8EA 4AN3A 3KCKA 4JRNA 1O9UA 3QYZA 5AP5A 3G33A 2YERA 4WOVA 3O8PA 3FSKA 5T6KA 5IQEA 4O83A 5CQWA 1YKRA 2GNFA 4GFMA 3PE1A 3T9TA 4JAJA 4LRKA 3EQPA 1XO2B 1ZOEA 3DJ6A 3EYHA 2YITA 3Q4UA 2GS7A 2QU5A 3V8TA 2QURA 3UZPA 3UC4A 3H0YA 4TYHB 3BBTB 3B8RA 5EM7A 3TKIA 5HU9A 4IM2A 5IA0A 1JOWB 3W32A 2NP8A 3DK3A 2GNIA 2X8DA 1H1QA 5HE1A 4ASZA 3JVRA 4JRVA 4KNBA 3F2AA 2YIWA 4XOYA 1DS5A 2X6EA 3EJ1A 3I7BA 4TY1A 2PWLA 3G51A 3R9DA 4YO4A 4I4EA 4KS7A 3DBFA 4QRCA 3KKVA 3NYVA 3NGAA 4YSJA 4DH8A 2HIWA 3QCYA 4U3ZA 4W4VA 2OJFE 3UNZA 3QTXA 1M52A 4I22A 2WNTA 4IVBA 5LXMA 4XH6A 3IECA 3R7VA 2XNEA 2Y8OA 3A8XA 3R7YA 5HHWA 4YP8A 3GC7A 3RK7A 4EOIA 4O2ZA 1W84A 3F2NA 3KRXA 4IMYA 3KXGA 1YHWA 4QP7A 3O23A 4F65A 4YTFA 3MA6A 3PVBA 4RWJA 4CFNA 2WO6A 4CT2A 5IEVA 2R3IA 3TXOA 4JQ8A 3ET7A 2XIXA 3GVUA 3FQHA 3CC6A 2J4ZA 2R3RA 4QMSA 3VS2A 3Q9ZA 4KINA 3P1AA 4G1WA 4D4SA 4BBMA 5AAGA 4IH8A 3SG8A 5TE0A 4MQ1A 2OF2A 2VV9A 2XKFA 2H9VA 2W06A 4IZ7A 4NFMA 4E93A 2BTSA 2ITYA 3Q9YA 4FIEA 4DFUA 3FY0A 3V8WA 3L8XA 4DLJA 2VO7A 4N6ZA 5AMNA 3ZO2A 4C3RA 5CF5A 2XNGA 5K0XA 4HYUA 2YZAA 4U43A 3UQGA 4YNEA 1E9HA 2RGPA 3COKA 3GP0A 3PPKA 3PSCA 3IGOA 4DINA 5J9YA 1KUTA 4Q9ZA 4QPMA 3BQRA 2IW8A 3Q5IA 1U4DA 4QQCA 3PZHA 1SVEA 3KULA 3OZ6A 4LMNA 3CQEA 3ULZA 4OAUC 4FV7A 2XBAA 3QA8A 3R7GA 4PTGA 1ZYLA 3D4QA 3OT3A 5CI7A 3PP0A 3SOCA 4V04A 3F3WA 4UMRA 3DXPA 1JAMA 2BMCA 3BIZA 4U41A 5M55A 5DN3A 2FO0A 1H01A 4EH9A 3QD2B 4BYJA 2RL5A 2JDSA 3NW6A 2QKWB 3CE3A 1GIIA 3CIKA 1MRYA 3QZHA 2J50A 4JIAA 3PJ1A 2IZSA 1JNKA 4M3QA 3DAEA 3DBCA 4TWPA 3ZLYA 4YZ9A 3KULB 4C2VA 4JAIA 4EORA 3BU5A 4UWYA 3GU5A 2WOUA 4M13A 4ACCA 5LOHA 2F57A 4PUZA 3D0EA 3EN5A 3TNPC 4K9YA 4RRVA 5G1XA 5KUPA 4BGGA 4O7YA 4UMQA 4XJ0A 2OJGA 5CXZA 1PMNA 3U6IA 3FMHA 5FEQA 4MXCA 3HAVA 3TNQB 1M7NA 3BHUA 2OZAA 2ZM3A 4TNDA 3PFQA 5DHJA 4CYIA 3MW1A 3QQLA 2CLXA 2WIPA 4DH5A 5F20A 2W4KA 4XP2A 4CZYB 1Y8YA 3QALE 1CKJA 4R7BA 1YI6A 2EXCX 5CEKA 4TYEA 4PV0A 2W1DA 2XIRA 3E93A 3PRIA 5I9WA 2J7TA 4MH7A 4BCOA 2QO7A 1YVJA 2VTOA 3LFSA 2GQGA 5HX6A 3IK3A 5HGIA 3JPVA 4PDOA 4EHGA 1OKYA 1E1VA 3E7OA 3C13A 1WCCA 3WBLA 5ANKA 5ANIA 3R30A 3ZXTA 4KBAA 3V6SA 3U9NA 3ZBXA 5A4CA 3RHKA 2XK4A 2ONLA 2J0KA 5M08A 1YDSE 1Q8UA 3C5IA 4Y46A 5M57A 4O0UA 4UMPA 2ITTA 4J95A 2I7QA 3SXSA 2IPXA 1J7LA 3PUPA 3CBLA 4RWLA 4TKSA 3NCZA 1IA9A 5EI8A 5FUTA 5BNJA 2Z60A 3C0GA 1YWNA 2OJJA 2UW9A 3LQ5A 5HKMA 3L9NA 4QOXA 4E7WA 2F49A 2VGOA 2XRWA 2VWYA 3ORZA 3OTVA 3ZUUA 3MFTA 5FLFA 5GZ8A 4YZCA 4YLKA 4R7IA 3FWQA 3R8UA 3BLQA 4J1RA 2X7GA 4FX3A 2C3IB 4U81A 5KMMA 2YA9A 4BDDA 1U54A 4KBKA 5D11A 4ZSGA 4RIYA 4F7JA 3PIXA 3P86A 3R8MA 3G2FA 2WIHA 4IWOA 4MHAA 5AV2A 4F7LA 4EOLA 4FKGA 5E8VA 1VJYA 4YO6A 3GU6A 2JKMA 1XBBA 5T68A 2E9UA 2XYUA 5DMZA 5IA2A 4L52A 2PUIA 1JSTA 3C51A 4O7RA 4PTCA 4E20A 2QOLA 3QTZA 1U5RA 4L3LA 2EXMA 3VS0A 4G3FA 2W9FB 3BELA 3O8TA 5AP2A 4AS0A 5JT2A 1TQMA 2VTQA 1WBPA 3D7TA 2IVSA 2W7XA 3NLBA 5H8EA 3VC4A 4BTJA 4FZDB 4L43A 4ZS4A 4NK9A 1U54B 5CASA 4DN5A 2C6OA 4RIYB 2PULA 4BIEA 2VTSA 3IDPA 2EU9A 3N4VA 3C0IA 1M2QA 3TACA 4PMTA 5EW8A 4EZ3A 1J1CA 1ZY5A 3V5LA 1ZMVA 3VS7A 2VTAA 4B0GA 2GPHA 5A54A 3TZMA 4AN9A 4ASDA 2BRGA 5CEPA 2X7OA 4WG4A 3F9NA 3I6UA 4IBMA 4RJ8A 4YPSA 4FTLA 4QMZA 5EDQA 4BRXA 3ORLA 4TWNA 5JQ8A 4BCFA 3RK5A 4FTOA 4M7IA 5LQFA 4CTCA 3D7TB 3KK9A 4S30A 4FKJA 3LZBA 1CMKE 1H1WA 3A62A 3NUXA 2FYSA 3LHJA 3OG7A 4NH1A 4NKSA 3RALA 4F9AA 5B2LA 4F70A 5L2IA 4D5KA 5KBQA 3DXQA 4L46A 3HL7A 3LXLA 3S1HA 2OLCA 5CF6A 1Q8TA 1L8TA 4NL0A 2VTLA 2CNQA 2AUHA 1XQZA 4M0ZA 4XRLA 2XEZA 2PZRA 2PVMA 4D58A 4N70A 4CMUA 5IPJA 3ORTA 4J99A 1A06A 4A4OA 4BTKA 4S34A 4D1ZA 2H96A 5AV1A 3CS9A 4IXPA 1PF8A 5EYCA 1XHAA 4Y8DA 4BKJA 5CAOA 1PYEA 4RJ4A 2GFSA 4FG9A 5KO1A 5EDRA 4L44A 3FMLA 2UVYA 2E9VA 2FB8A 2R3OA 3AT4A 3KA0A 4PP9A 5DVRA 1UKIA 4WNPA 4L3PA 4NJDA 3I1AA 2WD1A 4OBPA 4CG9A 4BGHA 3FLNC 5GJDA 1YDRE 4FUYA 2H8HA 4G9RA 4JL9A 4LOQA 2VWVA 2P33A 4YJVA 5FDPA 4Z16A 4NYEA 3HV7A 4YHTA 2C6IA 3Q4CA 3O7LB 5E8XA 3LXNA 4IAAA 1B39A 2BALA 3WZUA 1WBOA 2AC3A 2CJMA 3U6HA 3DKGA 3CQWA 4EONA 2PHKA 3OROA 4ZJIA 4ZSLA 3UOJA 3P4KA 5HE3A 5CT7A 2X81A 2X2MA 3NYOA 4M8TA 5AIRA 3GXLA 3ANRA 4CV9A 2NPQA 4AF3A 5ITAA 5EM8A 4M12A 3EQHA 1LP4A 3AGMA 2I6LA 2RKUA 4WT6A 5AUYA 1UV5A 4IAYA 4R5YA 4F09A 4JNWA 4DTAA 3RBWA 2HWPA 3AC2A 5M07A 3HRFA 4J71A 4O2PA 4JVGA 3JVSA 4R1YA 5K5XA 3DFAA 4FSTA 3DA6A 4M66A 4ZEGA 4X3FA 1WBTA 2X4FA 4QP3A 4ZTRA 2XK3A 1WZYA 3DPKA 4W4WA 3ZU7A 2IZRA 4G2FA 4LMUA 3R01A 3LPBA 5HO8A 4ZZOA 3R04A 3DQWA 4FNYA 3RPSA 4IAKA 1UU8A 3CCNA 1APME 3G9LX 4L7SA 4WBOA 5FTOA 4Y95A 4HNIA 5CAUA 2OIDA 2V22A 5A6NA 1SMHA 3QD3A 4BCMA 4CXAA 1K9AA 4FIJA 4FNWA 2YM4A 4E3CA 4K18A 4KIOA 2BRNA 3FMJA 3Q5ZA 4U6RA 3ZO3A 5JGAA 3IW7A 3BKBA 5C26A 4H3BA 4LQMA 2O64A 1W8CA 1ZOGA 5GIOE 1O6LA 5AJQA 4LRMA 5JRQA 3NUNA 3CJGA 4II5A 3RINA 3KRJA 5TR6A 1FINA 2W0JA 2WGJA 2WTKC 2OGVA 3MH0A 3QQKA 2W1IA 2CCHA 2B9JA 4JDHA 1GZNA 4LOPA 2C4GA 3IKAA 5HLWA 2XNOA 4XG3A 4ZTQA 3PWYA 3RK9A 2HXLA 1S9JA 3D14A 3R1QA 1XWSA 4G3DA 1F0QA 4YUQA 4HYIA 2PVHA 2CGVA 3PRFA 5TT7A 3JYAA 4KSPA 5JSMA 1LUFA 1H1RA 2HAKA 5I4NA 5HCZA 5HIEA 2QNJA 4LOOA 2PY3A 5DT3A 2XUUA 3SW4A 4D4VA 4JR3A 3IONA 2J0LA 3W8QA 2HY0A 3KU2A 4UB7A 4JG6A 2XKCA 4KBCA 4W4YA 3SG9A 4KRCA 1R0PA 3I6WA 2VD5A 4M68A 3F5PA 4TT7A 5KE0A 1K3AA 1Q97A 4APPA 4BF2A 3PP1A 3AT3A 5E8YA 1L3RE 3E8CA 4A9YA 5ANGA 1J3HA 3MVLA 3F5GA 4FNXA 2XCKA 5DR6A 1PXKA 2C69A 2I0EA 3LLTA 3E5AA 2Y7JA 2OH4A 4CGAA 4WUAA 3CPBA 3PJ8A 4Z7HA 5BUEA 4PWNA 5HTCA 2F9GA 2FGIA 3LW0A 3OY1A 4YHJA 3VO3A 4IM0A 4ERKA 5EYMA 1QMZA 4F0GA 2BKZA 2PSQA 2UZDA 5IH6A 4QMXA 1KV2A 3BQCA 4L53A 2C47A 3FV8A 3HKOA 1YI4A 5HI2A 1FVTA 3ZCLA 3NR9A 3W33A 3F7WA 5F4NA 3Q52A 2XJ2A 4FSUA 4FV3A 1UNGA 4NM7A 3RJCA 1I09A 3AOXA 1ERKA 1Q24A 2FSMX 2NO3A 3DJ7A 4FSQA 4BGQA 2NNWB 3G90X 2F7XE 5BYZA 3UODA 5AP6A 1QPJA 2WTCA 3VBVA 2YM7A 3CP9A 5IU2A 1G8AA 4LYNA 4KUJA 5D9HA 4BDAA 3LQ8A 4EH2A 3CGFA 4IFCA 3RPYA 4D0XA 4QMUA 5HBJA 4BDKA 2C1AA 3QLGA 3QC4A 3D7ZA 4PY1A 3TIZA 3QRIA 4EH3A 4UY9A 2PVRA 4AZSA 4IAIA 3EWHA 1JKLA 2JC6A 4MWHA 4NT4A 3R9NA 1OECA 2BAJA 2PZPA 1A9UA 4LM5A 3HAMA 2J9MA 4BDGA 1NA7A 4F9WA 5A4TA 1YXTA 4HCVA 1T46A 2KULA 4FL3A 5CSVA 2HZIA 4JLCA 5CT0A 4PDSA 4AZFA 5KMLA 1PMUA 3TDVA 3S2PA 2E9PA 3O51A 4AZWA 2W1HA 3PVGA 2PVKA 1GIJA 4ANMA 3TL8A 4Z3VA 4UBAA 4ZY6A 4HW7A 1PYXA 5CEOA 5I9YA 3RTPA 3QHWA 5IH4A 4IW0A 4QD6A 1S9IA 3MTFA 4FGRA 1XBAA 3PYYA 3R63A 3D9VA 3V5WA 1QPCA 5F1ZA 1XKKA 3AT2A 2UVXA 5E7RA 2C5NA 3L8PA 3P0MA 3TWJA 2JDTA 3EQIA 3EQDA 4UZHA 5L8LA 2I0HA 4A9SA 4CQGA 2DUVA 1G5SA 2ACXA 4FKWA 1WFCA 4I0TA 4XG7A 2NRYA 1Q41A 4FA2A 4O22A 4BKYA 1PXLA 2XIYA 3SQQA 2GNJA 3GU7A 1URWA 2UW6A 2WELA 3PXKA 5ANDA 5BUIA 5KZ0A 5HD7A 4D55A 1H8FA 4O0YA 2BVAA 5EQEA 3OXZA 4Q5HA 4CCBA 4FEWA 3MY1A 4WD5A 4RJ7A 2C6EA 4E5AX 2R64A 1OKVA 5CF4A 4O86A 3KMWA 4FTNA 4NIFA 3ENHA 5EI2A 3KF4A 4GVAA 1SZMA 4R3CA 4APCA 3AXWA 3PY0A 2PVFA 4IB5A 4ENXA 3OTUA 2JIUA 4QMVA 5CAVA 4OGRA 2QR7A 4OBOA 2WB8A 3B2TA 3QTRA 4FZ7A 2BROA 4U9AA 4ZTMA 3KK8A 4ASXA 2QO2A 2YDIA 4XP3A 2W1GA 3DAJA 2B52A 2GS6A 2YACA 3C1XA 4JG8A 5HVYA 4RC4A 4B4LA 3IGGA 5K4IA 4D2SA 4K8AA 3LJ2A 2BHHA 4CV8A 2ZV8A 5HNGA 4LI5A 5IF1A 4BCPA 5M09A 2F7EE 3ZONA 2Q0NA 2GQRA 3ACKA 3EFJA 3FI3A 3ORMA 3RNIA 3EN7A 4B8MA 3CTQA 5I9ZA 3LIJA 2QOOA 3R00A 2QG5A 2J90A 1OM1A 4QP2A 4YC8A 5FBOA 3UIBA 4JX7A 4LG4A 2J0JA 2O0UA 4L67A 2AYPA 3WILA 1KV1A 3ZRLA 3ZDUA 4ANLA 3LMGA 3LM5A 3BU6A 4AAAA 3DAKA 3W8LA 5DYJA 4XLIA 3OOMA 3G6GA 1GZOA 3O17A 2CKOA 3EN6A 4XRJA 2VTHA 4D4RA 4UMUA 2BILB 1KWPA 3FC1X 4QYYA 4MXXA 2A4LA 4QQTA 5L2WA 2YZLA 4DEDA 2WMTA 1OPJA 2X2LA 5DBXA 3TV4A 3TDWA 2W99B 3F82A 3RPOA 1V0PA 1OI9A 5JEBA 4XV3A 4RFZA 4HGSA 4QP9A 3G0FA 2YHVA 4G3GA 5EFQA 3V5JA 2PUNA 3RWPA 3S4QA 2HZNA 2WTIA 3DDQA 5FDXA 5JZJA 5LVOA 4F6SA 3K5UA 3DTCA 5BVOA 3OEFX 3P5KA 4IWPA 4MXYA 4FK3A 3LMHA 3ZUTA 5CSPA 3KY2A 4LGGA 2C5OA 2R3GA 5FRIA 4NTSA 3FPQA 5H9BA 2UZBA 5AV4A 2YFXA 4KKGA 4U44A 4IAFA 4JBQA 5D7VA 4YU2A 1DAYA 5L2TA 3QZGA 4EK8A 2GHLA 4QP8A 2QOFA 2JBOA 4BDEA 1Q62A 5LMKC 4MNFA 3R7IA 4C3PA 3RAWA 3EFKA 3SOAA 4QMMA 4PTEA 3MN3A 4HZSA 3R7EA 3H10A 2R3NA 4DEGA 5I5ZA 1UNLA 4IDTA 4EBVA 1H00A 2B7AA 5HLPA 5CF8A 5L6OA 2QODA 1U5QA 2PZ5A 5HG5A 4K0YA 3EKNA 4ITIA 4CYJA 2V0DA 3FZOA 4DEHA 3FUPA 2C3KA 4AE6A 4UALA 4IWQA 5E91A 5DT4A 3KXHA 2ETRA 3JS2A 4FKRA 2BZJA 3FY2A 5IA5A 2VWIA 4O7WA 3FC2A 4DFBA 1OIYA 2JDVA 3R21A 3GCUA 2YISA 5A6OA 4GYIA 3VF9A 5AV0A 2VTPA 3CSVA 1NW1A 2ZV9A 4RJ6A 3GBZA 5J8IA 3RHXA 3E8NA 3R1NA 4CFFA 3CQUA 4FSWA 4YJUA 4C8BA 2UZOA 2YDJA 4EH5A 4XS2A 4LV8A 4J8MA 2PZIA 2QOQA 3EQGA 2BR1A 5DR9A 3PPJA 2QC6A 2G2FA 2OICA 2R3MA 1Q99A 1V0OA 4ORKA 5JN2A 4ASEA 4DGOA 4RGJA 3PA4A 4BDFA 3BGPA 4OT6A 2G2IA 1K2PA 1ZMUA 2BAQA 5BQ0A 5HCXA 3PY1A 4V01A 5HU3A 3NAYA 2ITNA 3DBDA 3QU0A 4BDBA 5G6VA 3W2SA 3AC8A 4IX4A 2R3FA 3WYXA 5KHXA 4DBXA 5AUWA 5LWMA 1PXJA 4O7TA 1P14A 2WMXA 3TIYA 4D28A 4TYHA 2ITXA 4UEUA 3WZEA 2YLEA 2J51A 1GIHA 2QOIA 4U80A 3UPXA 5L8KA 3ATTA 2Z8CA 4H3PA 3TZ7A 2YDKA 2IZUA 5BVDA 4RIXB 2C3LA 2P55A 4EQUA 4EOMA 2VTRA 1J91A 2FA2A 2WU7A 1TKIA 3CR0A 5AA9A 4R77A 3R9RA 4GKIA 2VTIA 4FOCA 5C27A 3V5TA 5JKGA 3QQGA 3VUTA 2VWUA 3I7CA 4DEBA 3OS3A 3VUDA 4YZDA 2G15A 3LFCA 1PKGA 4MBJA 4BWKA 4AZTA 2PUUA 1U46A 4O84A 4XG2A 3UZRA 2WMAA 3UZTA 1WBWA 1FVVA 2QHMA 3KVWA 5AUZA 5DG5A 3A7JA 5BVWA 1JLUE 3IW8A 2C0IA 2J0IA 3FQEA 4ACMA 5KBRA 2GSFA 4FEQA 5I3RA 2R2PA 3LOKA 3VULA 4OTFA 3OEZA 3UQCA 3RMFA 2LAVA 1PXPA 4O7VA 5JQ5A 3VJOA 1OIUA 3G0EA 5IA3A 4HVIA 2UW8A 2VWWA 3ALNA 3KEXA 4H1JA 3BEAA 5I9VA 4O81A 5HBEA 2QU6A 3BLRA 1WVYA 2XIKA 4E4LA 2V55A 2JFMA 2YCFA 4F9CA 1OL6A 3EMGA 4GG7A 3C7QA 2UW4A 2YCQA 4EOKA 4IJPA 4IVAA 3QZFA 4J53A 4RIWB 4ZSEA 5IEYA 3UGCA 4AT5A 3HUBA 5HCYA 2CLQA 4B6LA 2W4JA 4HPTE 4I6BA 5H8BA 3RP9A 4QQJA 3LVPA 2DYLA 3UVQA 3V51A 1YOMA 4EC8A 4ZJVA 4L6QA 1OIQA 4QPAA 5IDNA 2WQBA 3R22A 4UXLA 3W16A 2VRXA 4IM3A 3H4JA 3KMUA 1RE8A 5L2SA 3SV0A 3OCBA 1VYWA 5M51A 2OJIA 1JBPE 3UIMA 3AC3A 3FPMA 1UA2A 4PRJA 4Y73A 3FL5A 4GRBA 3DS6A 3U51A 3GENA 4IB0A 5I9UA 2UZUE 3TUBA 5FP6A 1W82A 4OTDA 4MKCA 5C8KA 2O5KA 2BKKA 4FTRA 4G34A 4BL1A 4OR5A 1M2PA 4E6DA 3DCVA 1YI3A 3NVMB 3A61A 4YJPA 4J96A 1BMKA 3PA5A 4N0SA 3VQUA 4EEVA 1UWHA 4UMTA 3DXNA 3NMUF 4XP0A 4FZFB
chains in the Genus database with same CATH superfamily
1STCE 3BEGA 3L8SA 4RJ3A 5F95A 1H08A 3QQUA 4EHZA 3OD6X 1R3CA 4AU8A 4EK3A 3BU3A 1IRKA 3QX4A 5IQCA 3MWUA 4FZ6A 4M14A 4ZS0A 2EWAA 4GUBA 2F2CB 1FVRA 3I4BA 5D7AA 3F5XA 4S31A 3IW6A 3GC8A 5DA3A 4I5PA 4WA9A 3HVCA 2H34A 3BE2A 3SAYA 3MB6A 3W0PA 2X0OA 3ZMMA 2C68A 5C8MA 4X2KA 4C4GA 4G3EA 3SA0A 3QHRA 3MY5A 3QTWA 4I6HA 4RLLA 4XG6A 5CI6A 4CKIA 4DH7A 1R78A 4BDHA 2RFNA 4C0TA 4CLJA 2CNVA 3SX9A 4CKJA 4F7SA 1YXUA 2UZVA 3WF6A 4GSBA 4I6QA 4CTBA 4C62A 1XMMA 2Y4PA 1UU7A 4RA5A 4EK4A 4DG0E 2C1BA 1OL5A 4F9BA 1PW2A 4TNBA 3COHA 4O7SA 3UIXA 4RX9A 4PNKA 5J79A 3S3IA 3R0TA 4XCUA 4DGGA 2ZV2A 4QNYA 3R6XA 1SYKA 4MQ2A 4E4NA 4NU1A 3BYOA 1XH7A 2A98A 4D1XA 4ZLYA 4E5WA 4YURA 1BYGA 5C1QB 4WUNA 3E8DA 1XMLA 2UUEA 3UPZA 2A0CX 3M42A 2R7BA 3ITZA 4QTAA 2ITPA 4FNZA 5AUVA 4JDJA 3KN6A 2WEVA 3ELJA 4GU9A 3LFQA 3QGWA 4I3ZA 4O0VA 3SHEA 3IOKA 5E8SA 4C36A 4C59A 3OBJA 2XANA 1Q61A 3GU8A 4UYNA 3QKMA 4C4FA 4EHEA 4TYGA 5L3AA 3KIOC 2V7OA 4YJSA 3MH2A 1XH5A 3F5UA 4IZYA 5DNRA 3VBXA 4EQMA 4IC8A 3KRRA 3HUCA 3QUDA 4CCUA 2PL0A 4X2JA 4I92A 3OT8A 4BICA 5EKOA 4YR8A 3AMYA 2FVDA 3OCTA 2QD9A 3MH1A 4E6AA 5KHWA 1LR4A 1WBSA 1TQIA 1P4OA 4M69A 2VO3A 5IKWA 3C50A 1OMWA 2J2IB 3CD3A 4FL2A 4J7BA 2IVTA 3CKXA 3LFAA 3D83A 2ZDUA 3E62A 4R8QA 2GHMA 2P2IA 3OC1A 2XJ0A 4X21A 4CQEA 5KMOA 3FI4A 4RVMA 3C4XA 4Y85A 3EN9A 5FBNC 2IJMA 3FDNA 3BHTA 3M1SA 4FTUA 1Y6BA 3DB8A 2XVDA 5C8NA 2CKPA 3LLAA 4NW6A 4O82A 4EK5A 2UW3A 2CGUA 4IADA 2WMWA 2ONLC 2R0UA 1F3MC 2HENA 2YJRA 1KOBA 3ZOSA 4C35A 4F64A 5B2MA 3PDTA 4NSTA 2IW6A 4WHZA 5TO8A 3UYSA 4MEDA 4D9UA 3IDBA 4XUFA 3PZEA 1FOTA 4DFYA 4UX9A 5HVJA 3I5NA 2EB3A 5CANA 4DGLC 1QPEA 4M69B 3HV4A 2VWXA 3IW4A 3MFSA 3OY3A 3PXQA 5AP1A 3UOKA 2BIYA 3HMMA 3NUPA 1WMKA 5HD4A 2I0YA 4O91A 3IS5A 4IAZA 3HNGA 1VR2A 2WMRA 3REPA 4E8AA 5AFVA 4EOQA 4OW8A 4QMLA 3V6RA 3T9IA 1G3NA 5DH3A 4JBPA 3RI1A 3WZKA 4BCIA 1DI9A 2PVNA 2XNBA 3AC5A 3K5VA 1XH6A 3OUNB 5EM5A 4D4YA 3G9NA 4N57A 3FZSA 3MESA 1JSUA 3EZVA 3MH3A 4XLVA 1DAWA 2BZIB 4U79A 3RNYA 3DBQA 3Q4ZA 4G31A 2YWPA 4MF0A 4QT1A 3R8LA 3EQFA 4FKIA 5BMSA 2XK7A 4KAOA 4RX8A 2ITQA 1PJKA 2OKRA 3EN4A 4QMOA 4CMOA 3R02A 3EH9A 2C0OA 1Q3DA 2C6MA 3QWKA 4GFGA 2PVYA 5CVHA 1Q5KA 4XX9A 3V3VA 5B7VA 3W0OA 2PE0A 4MAOA 3O5AA 4DHZA 5HEZA 4K1BA 2V62A 4FT7A 4EKLA 1W2DA 1JSVA 3DOGA 1PKDA 3W0RA 3D5WA 2PE2A 5J95A 2X0QA 2DS1A 4L42A 2Z7LA 3C4FA 3MJ1A 2I1MA 4QP1A 4RG0A 4JG7A 4BTMA 2VTTA 3GCPA 3TT0A 5JRSA 4DT8A 5EYDA 3NYXA 2XKDA 5IDPA 3FZTA 4AXEA 3NYNA 3WF5A 3PG3A 4AZVA 1GOLA 2IN6A 3N51A 3OHTA 2X6DA 4C61A 2QOKA 1X8BA 2XCHA 2CDZA 3N4TA 3WIKA 5EOBA 4FTTA 4PDPA 5TOZA 5IQBA 3DNDA 2ITVA 4IB1A 4FG8A 4BWXA 1PHKA 2PUPA 2JAMA 4M15A 4AW1A 2PYWA 3ORPA 4NCTA 4CFUA 2OZOA 1H0WA 2IEWA 2O63A 4XYFA 4FTMA 3QGYA 2ZOQA 4YTHA 4BI2A 4BCKA 4ZAUA 4QDEA 3TV7A 1H0VA 3ZO1A 3BYVA 2PTKA 3E87A 3MPMA 2BDFA 3BYUA 1GNGA 3LAUA 4JQ7A 2XMYA 5M56A 5IA4A 4EBWA 2QR8A 5JK3A 5C01A 3TZ8A 4HCUA 3KREA 2JITA 4AGCA 3LJ0A 5HTBA 2ZJWA 3QRTA 2A2AA 2GHGA 3OWLA 2X1NA 3PLAE 4WBBB 3SKCA 3QTSA 2WFYA 4U7ZA 1F5QA 3LE6A 3LQ3A 4XOZA 5CTPA 3RCDA 3GUBA 4E6QA 4CNHA 5CX9A 3CEKA 4O21A 1ZYDA 2JEDA 2YM8A 3E92A 5GJFA 4ZXTA 3ZLWA 3U54A 4WNKA 5T3QA 2C6TA 4IZ5A 4DFNA 4DTKA 4U8ZA 5EHLA 4ZTLA 4FODA 3VJNA 4XV9A 1YOLA 3ORKA 1MP8A 2JKKA 3V5QA 4C4EA 3Q2JA 1ZYJA 3U6JA 2GFCA 2CHLA 4IFGA 3R8VA 5HE0A 1YRPA 3NZ0A 4Y5QA 2A1AB 5LMAA 1VZOA 4ITHA 2Q0BA 5H3QA 4YJRA 5TF9A 5IUHA 4AXFA 2QONA 1YHVA 5A9UA 3RVGA 4MBIA 4N6YA 2EXEA 5HORA 3COIA 3VF8A 3QD0A 4CFVA 5CNOA 4FGBA 4GUEA 4J8NA 1LEZA 4RQVA 4DHIB 1H1SA 1P4FA 4I24A 5A46A 4FEXA 5DPVA 5E4HA 1Y8GA 3O71A 5KMKA 5GIPE 3E3PA 2PPQA 3Q6UA 3AD4A 1ZXEA 2HW7A 2RG5A 4X3FC 2VX1A 3FLQA 2EB2A 4FT5A 5J9LA 3MDYA 4AG8A 4L7FA 4BJJA 2PMOX 3BZ3A 4IACA 4RFYA 2PMLX 5EK7A 4USEA 2B55A 4YC3A 3RWQA 4DFXE 5HX8A 3PXFA 3UBDA 3DDPA 3QX2A 3OW3A 5FEEA 3F61A 3ROCA 4CFXA 3FBVA 1YOJA 3QUPA 1UU9A 5HG9A 4RC2A 4A4LA 2BZKB 4O27B 3HZTA 4HNFA 3UQFA 3GCQA 3BRBA 4GCJA 3POZA 2X0GA 4AGUA 3I60A 2YAKA 3Q60A 4YZBA 4QMTA 4TRLA 1QL6A 3HDMA 3D94A 4L68A 1R1WA 1ST4A 4H36A 4FTAA 5FTGA 2GNGA 2H6DA 4WO5A 4BJJB 4FV4A 4AZEA 4HYSA 4Z55A 2XKEA 2B53A 3ZO4A 4EYJA 4ANBA 3LCSA 4LV5A 4W4XA 3W10A 3KF7A 2LGCA 3THBA 3LXPA 4FVPA 4FTKA 5M44A 2CPKE 4GYGA 3N9XA 2WTKB 4GIHA 3BL7A 5HESA 2JAVA 3V04A 3OVVA 2YIYA 1P5EA 2C5VA 3MV5A 5ETIA 3C4CA 3HMIA 3Q04A 3C5UA 5CSXA 4F0FA 3MI9A 2WTWA 3D2KA 3OMVA 3FXWA 3AQVA 3PJCA 3PJ2A 4CSVA 4LUDA 3R71A 5M53A 2HOGA 4QMPA 4W8DA 3WE4A 3WYYA 2RF9A 3K3JA 4E6CA 4FC0A 3VBYA 1RW8A 4U97A 3KQ7A 3W1FA 4F7NA 5KMNA 2GMXA 3KMMA 3WIGA 3LFEA 1BUHA 3OXIA 1ST0A 3FJQE 4C38A 4BI1A 4E4MA 4HGTA 1FBNA 4FTQA 3FHRA 4FKVA 4AW0A 2R0IA 2IW9A 3KCFA 4XG8A 3ZS5A 5IMEA 5J5SA 3K2LA 3UVRA 3W2PA 1H24A 3DZOA 3DKFA 3E63A 3P78A 3A7IA 3SRVA 5EG3A 2WMVA 3ID6C 1OGUA 3ZFYA 5CLPA 3VHKA 3MVMA 4ALUA 2ZMDA 5AEPA 3W18A 5EKNA 3D2IA 4O0SA 4GL9A 4JDKA 5IQGA 3FLZA 3CGOA 3BL9A 2XBJA 4YJOA 5JFVA 3MVJA 4EQCA 1B38A 3Q96A 5GHVA 3FMDA 4KB8A 2YM6A 3NDMA 5CVFA 3ZM4A 3ZZEA 4UN0C 3QCQA 2PVLA 5IUGA 2OIBA 4P7EA 4FV8A 5EH0A 2WMQA 3QRUA 4H58A 3FXXA 4A06A 3ENMA 3R8ZA 1BL6A 3IG7A 4PMSA 1CDKA 3SRVB 1FMKA 1O6YA 3BWFA 5IQFA 4ZSAA 4V0GB 5JGBA 2P2HA 3CPCA 3N4UA 4O4CA 1ZOHA 3CJFA 2WOTA 2KTYA 3DZQA 3VBQA 4FKPA 3ZUVA 3VONA 2XB7A 1OKWA 1AQ1A 3HA6A 4DITA 4HVHA 3FI2A 4I41A 1BLXA 4FKTA 3HV6A 5ANJA 5H8GA 3V8SA 2YAAA 3HGKA 3QC9A 3PSBA 2R3QA 4BFMA 3FKOA 5AR8A 3TJCA 3DGKA 2IVVA 4FT3A 5LMBA 2G1TA 3SVVA 5DIAA 5CEQA 3HEGA 4NM5A 1REJA 1YWVA 5JMSA 3DKCA 4AACA 4O0XA 1H1PA 4KKEA 5FG8A 5AWMA 4EH4A 3BI6A 1Q8WA 5KMIA 4I23A 2JKOA 4AFEA 4GK2A 2WEIA 2ERKA 3EFLA 1V0BA 2XARA 2SRCA 3RZBA 3ZYAA 3C4WA 5AR7A 1WVXA 4GFOA 5LARA 4IDVA 4QO9A 4E4XA 5HIBA 2UZTA 2ETKA 4FTIA 4GS6A 3UE4A 3JR1A 3ATSA 4I94A 4MXAA 5BVEA 1W2FA 4ANSA 4PF4A 3EL7A 4MD8E 4D2VA 3GI3A 3RM6A 3E7VA 2Z7QA 4I20A 1H28A 2FSOX 3FAAA 3GQLA 1PY5A 5GINE 3KN5A 4RBLA 5DR2A 5K4JA 2C3JA 3VBTA 2WMUA 2PMIA 4NM0A 4EL9A 2WTJA 4WSQA 4KIQA 3NUSA 4HVGA 1O6KA 5LWNA 1MUOA 1Q3WA 3D15A 3MPTA 5C03A 3WZJA 5EM6A 3L9MA 3NX8A 4FKUA 4KABA 4OT5A 4YZNA 2R3KA 1OL2A 4AT4A 2P3GX 2O65A 3QCSA 2HZ0A 2UW5A 4NWMA 3GOKA 4KRDA 4W8EA 4JBVA 3ZC6A 5A4EA 1NVRA 4E73A 4O4BB 1BI8A 2YIRA 4A4XA 4BKZA 4CKRA 4AW2A 1LEWA 2JDRA 4EH8A 3CXWA 3UVPA 2OK1A 4EC9A 5AAEA 1T45A 4X6RA 4HJOA 1PRYA 4DGNA 2O2UA 2R5TA 4AQKA 5LCJA 1M7QA 5HO6A 4WG3A 1NT2A 4XNEA 4RX7A 3BV3A 3MB7A 4ONAA 1KE7A 4U42A 5FM3A 3NEWA 3GFEA 3FLWA 3ZBFA 2JIIA 4EI4A 3FMNA 1PXNA 5DRDA 5FXQA 3FMEA 5CYIA 4CZTA 4K11A 1OBGA 4YBKA 4JR7A 4ZP5A 4KKHA 3PA3A 2W1CA 3GU4A 4AQCA 5EYKA 2YWVA 4H1MA 2W5AA 1J1BA 4JX3A 3PE2A 1IR3A 2YEXA 2XNNA 3FZRA 4W9WA 4ANOA 4BY9E 4QMQA 4TYIA 4FKSA 4LFIA 4RWIA 3VN9A 1WAKA 5HBHA 2XM9A 4XG4A 3FL4A 1IASA 5HICA 3RAKA 2X9EA 4AA5A 4WRSA 4QTEA 4YGAA 3CTHA 4FV0A 4H39A 2C6LA 1JQHA 4DH3A 3G15A 3HV5A 1TQPA 2BTRA 2C6KA 1CKPA 5DGZA 5BMMA 5IMXA 5KKRC 2NRUA 2ZB0A 4MYGA 2PU8A 3QWJA 4JQEA 3B8QA 3GCSA 3HDNA 4O4DA 3NFFB 4I93A 3MGYA 3KXNA 1FQ1B 3OWPA 4FSNA 2OO8X 2XRUA 3ORNA 1OBDA 5EQYA 3PIYA 5ICPA 5JZNA 4CFWA 5HLNA 4FZAB 3FKNA 3PG1A 4BZDA 4BDJA 3T3VA 4FIFA 3P7AA 5AR3A 1SNXA 4O0TA 4WIHA 2G2HA 4IX6A 1BI7A 2VWZA 4PL5A 4D2RA 1I44A 3AD5A 3GEQA 3ODZX 4RVKA 5ETFA 4HPUE 4BBFA 3NNXA 4HVSA 4D1SA 4MF1A 4YLJA 2WTVA 1QCFA 5M4UA 4I1ZA 5EHYA 1XH8A 1JVPP 3HECA 2UZWE 2IF8A 2E2BA 2W4OA 3Q9WA 3H9RA 1KE5A 3PVUA 4FYOA 4AUAA 4TWCA 4PMMA 4RQKA 4G17A 4YC6A 4DYMA 5K0KA 4YMJA 2GNHA 4C57A 2J0MB 4PDYA 2W1EA 5J9ZA 3FMMA 4C33A 4ANNA 4RIXA 1IAHA 4LV7A 3IDCA 3QF9A 4K77A 3UMWA 5AV3A 5KCVA 4WNMA 3Q2MA 3BLHA 5HZNA 5DOSA 4O4EA 5BVKA 5AP0A 1OZ1A 4L45A 1UWJA 3EQRA 2I40A 4Q2AA 3S95A 4PPCA 3MJ2A 4X2FA 4FEUA 2X8EA 5CU3A 3DV3A 2C5YA 2Y4IB 3QUEA 4IE9A 3VWAA 4FT0A 3ZFXA 3FI8A 4RWKA 3F3VA 3FLSA 3NNUA 3VVHA 2IG7A 5LVPA 4F99A 4XV1A 4X7QA 4I5CA 1OL7A 3JUHA 5J7HA 3D5UA 5JH6A 3S00A 3AC4A 4MXZA 2UW7A 3MBLA 4EJNA 1R39A 2CGWA 2W05A 2X4ZA 2Z2WA 3F66A 4JIKA 4ZLOA 4EWQA 4ENYA 3UDBA 4BCHA 4GT5A 3R73A 5JFXA 3HV3A 2RSVA 2BCJA 2XK6A 4FTCA 5IQDA 1W0XC 4ZSJA 3D5XA 1MRUA 3A7HA 3LFDA 4KS8A 1XR1A 5BVFA 2VUWA 2W1FA 3I0OA 3RGFA 3EL8A 5I9XA 5J5TA 3KXXA 4KWPA 2HK5A 5IUIA 4D0WA 4ALVA 3ODYX 4YJQA 4L8MA 4S33A 1OB3A 3DJ5A 4ZTNA 3EHAA 4RIWA 2VU3A 3SLSA 1XBCA 2BIKB 5IA1A 2DWBA 3BE9A 2WQOA 2GCDA 2YM3A 2QOCA 3TEIA 3LMIA 4H05A 2WMSA 2C30A 2QCSA 3IPHA 5ETCA 3PIZA 3TNHA 5HNIX 4A9UA 3EIDA 2ETMA 3A7GA 3BCEA 4NUSA 2QI8A 3KVXA 3DLSA 4I21A 5L2QA 2OF4A 3C9WA 3U87A 3ZFMA 4EKKA 4F1TA 1ZWSA 4A9RA 4D2TA 3GFWA 3R7OA 2UW0A 5HNBA 3W2RA 4CD0A 4WNOA 4DTBA 4R5SA 4GV1A 4FV2A 2EVAA 4EOOA 1RJBA 2VO0A 4L00A 4HCTA 5E8ZA 5DWRA 1ZRZA 1PXMA 1GY3A 4JI9A 4O0WA 2VWBA 1XH9A 2IVUA 4R7HA 4C37A 5HTIA 3UO5A 3C4EA 2FUMA 3RAHA 3PPZA 3DT1A 2BHEA 4U40A 3OWJA 3Q32A 4LGDA 5AIKA 4USFA 3VUGA 2X2KA 3F6XA 3NCGA 5CEIA 2QG7A 4H3QA 3FZPA 4ACHA 3UO6A 4CLIA 3I81A 2FH9A 3TZ9A 4DCEA 5CSHA 2F2UA 3BYMA 5A3XA 2OXYA 4Q9SA 3AD6A 4ZTSA 4BDCA 4AFJA 4ZLZA 3PVWA 3QRJA 3A60A 1CM8A 2HCKA 4DFZE 3IO7A 4K33A 4FE2A 4CZUA 5L6PA 4ID7A 4CRLA 5FWKK 5AUXA 3KRLA 3QQHA 4GT3A 4G6LA 1OUKA 3QKKA 3ANQA 3Q9XA 3W2OA 4AA0A 4IX3A 4GT4A 4R3PA 5AADA 3NUYA 5FTQA 3BGQA 3ZHPC 4AAYA 4RIOA 2WAJA 4YSMA 3NVKI 4OTIA 2WHBA 2ZM1A 4RSSA 4LGHA 2B9HA 4UWCA 4I0RA 1OL1A 2B9FA 4RA4A 5AAFA 3VUMA 1H27A 4QYEA 2C0TA 3P7CA 4FI1A 3BV2A 4HZRA 5E92A 3MVHA 3BHVA 1Y57A 2ITWA 1WVWA 4MTAA 3R2YA 1OUYA 4TTHB 2OWBA 3UNKA 3PXYA 1OIRA 5IEXA 4FV5A 4BHZA 2QKRA 2V7AA 3E88A 4PQNA 2ITUA 1ZLTA 2HW6A 4FIHA 3OP5A 1YXXA 3MIAA 3OOGA 5AM7A 4YTIA 3S0OA 3TUCA 2GQSA 4QP6A 3ZC5A 3RAIA 2PZYA 5CU4A 1URCA 3NNVA 4KD1A 5AP4A 3NS9A 1JKTA 4EUUA 2PVJA 3P23A 2JFLA 4UXQA 3ULIA 3VUKA 5CZHA 3BWJA 3JY9A 5EHOA 4S32A 4BCJA 3TM0A 2VAGA 4EK6A 3FZ1A 1U59A 3QQJA 2YN8A 3MA3A 1KSWA 3TN8A 4FKLA 4DFLA 4ZZMA 2B1PA 2GTMA 3QTUA 4JT3A 5IZFA 5CU2A 1GAGA 4IX5A 5CALA 1IA8A 4N4SA 4RX5A 3F69A 5CENA 4G9CA 4IANA 2C5XA 3MPAA 3QQFA 4I5MA 4FKOA 4TWOA 4FOBA 4USDA 3L8VA 3WOWA 5HOAA 1IAJA 4AW5A 3BBWA 1YWRA 4RJ5A 4FIGA 5L4QA 1XH4A 5JFSA 4FV1A 2VNYA 3HMPA 4MD7E 3ZTXA 5IH5A 4BZOA 3KXZA 4LL0A 4S2ZA 5DEWA 3LXKA 1FPUA 5LJJA 4O7LA 4M0YA 4ZZNA 2O3PA 3DNEA 3QFVA 4RPVA 2UVZA 4XG9A 4DF3A 4Y72A 2R3JA 3FYJX 2ZV7A 3EYGA 4JXFA 5FD2A 3EOCA 3FXZA 3UP7A 3TUDA 2YIQA 3L9LA 2QQ7A 5HIDA 2RFDA 3O0GA 5K5NA 4AE9A 2WPAA 3DB6A 5M06A 4FVQA 4F0IA 5D1JA 4BZNA 4E26A 3SDJA 3H9OA 3TG1A 4BDIA 3WF7A 3DK6A 2BPMA 3ZRMA 4B7TA 5GNKA 2XK9A 4DLIA 4XBUA 3DY7A 2EUFB 2VTJA 1JPAA 4GH2A 4MCVA 5LVMA 4IIRA 4FSMA 1JKKA 2OZAB 4NFNA 2B54A 4FEVA 5AUUA 1YXVA 2W9ZB 4QP4A 1Y91A 5FXSA 1HOWA 4Z9LA 4NEUA 4BCNA 1SVHA 1FMOE 2XAMA 1M2RA 4FSZA 4M84A 5DRBA 2WTDA 3MY0A 2ZFYA 4C02A 5J1WA 1AD5A 3W0QA 3JY0A 2CCIA 3ZXZA 5E1SA 4EH7A 3O50A 4UV0A 1BKXA 4ACGA 3K3IA 2ZYBA 5CWZA 2XM8A 3C0HA 3LCTA 4V05A 5HG7A 1FGIA 2QVSE 2XNMA 4J98A 5CAPA 3FYKX 1UU3A 4C4JA 4QDVA 3LFFA 3MS9A 5D41A 1ND4A 3W2CA 2VO6A 3ZZWA 4QMWA 4GU6A 4L01A 3QRKA 1H25A 3HP5A 4NKAA 4EOSA 4EUTA 2UV2A 2YABA 4I5HA 4GKHA 4YPDA 2XK8A 3BGZA 3F3ZA 1IEPA 2V5QA 2PMNX 3CKWA 4OUCA 2GNLA 4XBRA 5CVGA 3UC3A 3R9OA 4G6OA 2YCSA 3GNIB 4B99A 3FHIA 5DFPA 4Q5EA 4BYIA 2XZSA 1SM2A 3OXTA 4MVFA 4O0RA 4OTPA 3QXPA 4XHKB 4QYHA 3WI6A 5AUTA 4U0IA 1KE6A 5E1EA 3SC1A 4ALWA 1ZZ2A 3L1SA 3MTLA 3QXOA 4GJ3A 4PP7A 4EZ5A 1FGKA 3RM7A 2GDOA 4FMQA 1P2AA 5LCKA 3KC3A 3PY3A 5EW3A 3UG2A 2O8YA 4FICA 5BVNA 4IEBA 1SVGA 4BVUA 2QLQA 2BRMA 2X0PA 4BB4A 4Z7GA 3VW6A 3TTIA 2YLFA 2Q83A 2W5BA 5BUJA 5EW9A 3OW4A 3PLSA 3RPRA 4EWHA 5HE2A 5FP5A 3EQBA 4XV2A 5E8UA 4ZOGA 3GCVA 3H30A 5D10A 5I3OA 3EFWA 1WBNA 5ETAA 1G8JA 2W17A 5FEDA 4DBNA 4YZMA 2UZNA 2ZVAA 3I5ZA 4WSYA 3UDZA 3DQXA 1OITA 1HCLA 5AX9A 4RT7A 2OBJA 5EOLA 4G6NA 1KE8A 1MRVA 4MWIA 3O2MA 4K2RA 5IISA 3V01A 3EQCA 3VRYA 3NUUA 3PWDA 3TNIA 4D2PA 4QMNA 2CNUA 2F7ZE 2WKMA 4NCTC 1CKIA 3EZRA 3AGLA 4AOJA 3LCDA 4WG5A 5GZ9A 1G8SA 4X2NA 5JGDA 3E64A 3G6HA 2HELA 4F6UA 1PMEA 1TVOA 2P0CA 3ETAA 2ZB1A 4GMYA 1RDQE 3OF0A 4NZWB 4PPAA 4AA4A 5CEMA 1ZMWA 4AWIA 4F63A 4UZDA 3R83A 2BDJA 3UNJA 1W7HA 2RFEA 4ZMEA 3ORXA 4L3JA 5E8TA 4IB3A 5BX0A 4QYFA 5BYLA 3QCXA 2XEYA 4C4IA 4JDIA 4ZIMA 4LUEA 4YNOA 1NY3A 2Z7SA 5J1VA 1NXKA 2GTNA 3M2WA 4O1PA 1TZDA 3RPVA 2HY81 3NIEA 2AC5A 5A4QA 4TW9A 4HGEA 4BWPA 4X0MA 5HQ0A 3ZDIA 4U45A 4KIKA 4XEYA 2Z7RA 4D9TA 3UTOA 3HYHA 4OBQA 2OFVA 4LL5A 4DGMA 2PK9A 4QNAA 4ZY5A 3PTGA 3FQSA 2OIQA 1UKHA 2X9FA 5BYYA 4GEOA 2ITZA 3VQHA 5CZIA 3NW7A 2VX0A 3R9HA 3UG1A 3VS3A 4AN2A 4QTDA 4F9YA 4AT3A 4A7CA 4R6VA 3P9JA 3PXRA 1H26A 1Z9XA 3ERKA 3CD8A 4OAVB 3SGCA 1V1KA 4QYGA 3M11A 3UO4A 1OPKA 2UZEA 4KIKB 3FSFA 5CNNA 3II5A 2Y9QA 4KIPA 4FSRA 3HA8A 2R7IA 3B2WA 4P4CA 4QQ5A 5IG1A 4I0SA 5KNJA 1Q4LA 2XH5A 4ZMFA 2Y6MA 2P4IA 3A4OX 2WMBA 4FSYA 4FUXA 3COMA 3VUIA 2G01A 1UVRA 4YLLA 2WQNA 3TKUA 3HLLA 5DEYA 1ZYCA 4ANQA 4X3FB 2XJ1A 5H2UA 3ZSHA 3OFMA 3KGAA 3Q53A 2X39A 4QPSA 1DM2A 1IG1A 2X7FA 4M67A 5C9CA 4GJ2A 3A4PA 3FKLA 1OPLA 3BLAA 3LCOA 4X3JA 3GGFA 4A07A 5J7BA 3UOHA 4LRJA 3NRMA 4C34A 4P90A 3VNTA 2VTMA 4TXCA 4JBOA 2ITOA 4Y5HA 5FGKA 5L6WL 3R8PA 1SNUA 5CU0A 1PXOA 4I6FA 4CFMA 4QMYA 5AR5A 4AXAA 2OW3A 3R1SA 3AMAA 2BFXA 5ANEA 4ACDA 1ZARA 1JWHA 3R1YA 5K9IA 3A8WA 3O96A 4FV6A 2PE1A 4WRGA 1GJOA 5AX3A 3U8WA 5M4FA 1E1XA 3PJ3A 3ZLXA 4C7TA 4F6WA 3T8OA 1NVQA 1OVEA 2X8IA 3NUAA 2RG6A 3DTWA 4MXOA 5L8JA 1ZY4A 4DT9A 3ALOA 3H9FA 5DT0A 4YTCA 5I0BA 3CLYA 3VRZA 3F2RA 3ZSGA 4EZ7A 3PXZA 3UDSA 3QBNA 5D12A 4NJ3A 4CMTA 3V5PA 4ZJJA 3HP2A 4CEGA 4FIIA 4C58A 3MYGA 3TI1A 3F3TA 4FBXA 3R7UA 2CN5A 3AC1A 4V0GA 3VAPA 4QTBA 4KSQA 4ZK5A 4BIDA 4GK4A 3F88A 3KXMA 2DQ7X 4ARKA 1R0EA 4QEBA 5K3YA 2OU7A 1BL7A 4FL1A 1ZAOA 3LCKA 4FTJA 3WZDA 4BI0A 1MQ4A 4F4PA 4RLKA 4BCQA 2BAKA 5AR2A 3GC0A 3HX4A 4IWDA 2BDWA 4DC2A 2JGZA 3ROYA 4O7ZA 4OTGA 3IQ7A 4R1VA 5AP7A 4CVAA 3DBEA 3LKMA 3P79A 3NSZA 4TPTA 4YJNA 4J97A 2OSCA 3A7FA 4IQ6A 2HWOA 4GW8A 3GB2A 3TJDA 3NNWA 5CSWA 1PXIA 4JMQA 1UNHA 3ZM9A 4PL4A 4P5ZA 4CRSA 3ZH8A 3UIUA 5C4LA 3GC9A 3HRCA 4HVDA 2J5FA 5AR4A 2A19B 3LJ1A 4TN6A 4DEIA 2BZHB 4AGWA 4BBEA 3QZIA 5ACBC 1MQBA 3IW5A 3O7LD 3Q6WA 4BTFA 3MFRA 4DCAA 2ZMCA 4DG3E 3A2CA