5CY3A

Syk catalytic domain complexed with a potent and orally bioavailable benzisothiazole inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
278
structure length
276
Chain Sequence
PKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVTDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Orally bioavailable Syk inhibitors with activity in a rat PK/PD model.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 89
structure length 276
sequence length 278
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cy3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cy3A01
3Q2MA 4RLLA 3W33A 3FQSA 4BZNA 4LM5A 2C6EA 1NVSA 3II5A 4JDKA 4U9AA 4MD9E 4RBLA 1QPDA 4GYGA 3MWUA 3KXMA 3C1XA 5HBJA 4AE9A 2JIUA 3ZH8A 3R02A 2R3FA 3EQRA 3VHKA 3EB0A 3QZFA 1WCCA 3DQXA 3Q5IA 2B9JA 2YDIA 4YJTA 5AR2A 2AUHA 1WBOA 2GTNA 3G6HA 4E93A 3B2TA 2ZM3A 3EQBA 4KWPA 4TY1A 2C0TA 3W32A 1HCLA 4ANQA 4D2TA 5AFVA 3BYSA 2XIKA 2QHMA 4O2PA 4LRMA 4ZJIA 4LI5A 2VWYA 4FK3A 2WMQA 3PY0A 4GK4A 4AW1A 3VIDA 1JWHA 4IW0A 5HEZA 3BPRA 4IX6A 4DH8A 4DCAA 4X2FA 4DH3A 3LJ1A 2WQMA 1IAHA 4ASXA 4GYIA 2E9NA 5HX8A 3KXNA 3NUYA 3ZSHA 3SVVA 2GNLA 3E3PA 2B9IA 3R21A 5CAPA 3M42A 4DBNA 3FZRA 2VTMA 4GG5A 3GBZA 1J7LA 2PVJA 4K6ZA 5DR2A 4H05A 3S3IA 3Q9ZA 4RA4A 4BCJA 1IAJA 4DGOA 2QO9A 1XR1A 3LFFA 3Q4ZA 3UNKA 3PXRA 4QTBA 5EK7A 2ZB0A 4HJOA 3RALA 4L43A 4BDCA 4RX7A 5AV3A 1BI7A 3TXOA 4HCVA 4CFFA 1A48A 3HV6A 5A6OA 3EQIA 2VGPA 3CY3A 2YA9A 2YEXA 5H8EA 2QOKA 2ZDTA 4O7LA 3IONA 3NW6A 5DNRA 2XK9A 4FV9A 4I0SA 3UG1A 3QQGA 2OIQA 3KRXA 2Z7QA 4YLKA 1ZY4A 4GVJA 4RMZA 1FGKA 3OHTA 4RZVA 5FEEA 3O2MA 3G5DA 4F7JA 3UZRA 5M44A 1H0WA 4Y95A 4O84A 3GCUA 4QT1A 3Q6UA 3QALE 3BV3A 4PWNA 1REJA 5F1ZA 4CZTA 1XBAA 4L3JA 2W06A 4ZTHA 4UMRA 5IQFA 4DFBA 3DJ5A 1XKKA 4FEWA 3E8CA 4O7SA 2A1AB 2XNEA 3RBWA 5FBNC 3R9RA 1H27A 4EOPA 2XH5A 3OEZA 2WEVA 5HLWA 1UWJA 1FOTA 4V0GA 2ITVA 1H1PA 2UV2A 4AGCA 4KB8A 2XEYA 4FT9A 2W17A 4ZXTA 3FSKA 3PIXA 2ZYBA 5FG8A 4KUJA 1F3MC 4H39A 4HNIA 5JT2A 3F7WA 4B9DA 4J8NA 4FBXA 4FICA 3QC9A 3A7IA 1J91A 3QQFA 5L2TA 1M14A 2YACA 4RJ8A 2AC5A 2PZPA 4YZNA 5LWNA 2YZLA 4GV1A 4RGJA 1KUTA 3R04A 4N70A 2CGWA 5AV0A 2GNGA 2X9EA 4FTOA 3HKOA 3DFCB 1Q8TA 3CSVA 4MD8E 3PYYA 2GNHA 2R3KA 3LXKA 1I09A 5CF8A 4FNZA 4YLLA 4C3FA 1S9JA 5F20A 3A2CA 1MQ4A 4L8MA 2ONLC 5AV4A 4NU1A 4WG3A 5H9BA 2ZV7A 4L67A 4IB1A 2IVTA 1DAYA 5AX9A 4BTFA 2B0QA 3ZTXA 2Q83A 4X0MA 4DT9A 2HIWA 4MKCA 4WBOA 3ZLSA 3E5AA 4XP0A 4BIEA 2VWXA 3QUDA 2PUPA 1P4OA 2GMXA 3D2IA 4HVDA 4J1RA 3AGMA 2VD5A 3OXIA 3P4KA 4YZCA 1YWNA 5B7VA 4DFZE 4M69B 2J0LA 4QQJA 3C4WA 4BDKA 3I6WA 2GHGA 2IVUA 3Q60A 5CNNA 4HGTA 3S95A 4R77A 5AIRA 5BX0A 1SZMA 2BHHA 2WKMA 4Z9LA 4D2VA 5JQ5A 3UOJA 4CMUA 5AA9A 3OW3A 2XIRA 2I1MA 5IF1A 4MBJA 5KMMA 3Q9YA 3GUBA 3PSBA 4HCTA 5L2QA 4RWIA 4FTLA 1BL6A 4KSQA 4UV0A 5HLPA 4NUSA 2EWAA 2JKQA 2VAGA 4L7SA 1WVYA 2BR1A 2XIXA 4FKTA 3SC1A 3IK3A 3OCBA 2ZM1A 1V1KA 4H1JA 3TTJA 4ENYA 2ETRA 3F5XA 3F5PA 4ZSGA 3VNTA 3ELJA 2BFXA 2O8YA 2IZSA 3HDNA 2FSMX 2PSQA 5TR6A 2XEZA 2Y7JA 4IVCA 4W4YA 3FLYA 4EBWA 2YIYA 5M4UA 3ITZA 3V5TA 3R30A 4O7WA 1U54A 2IWIA 3E8NA 4J7BA 4DH5A 2W4OA 1WVWA 2OJJA 2YLEA 2ITTA 4GVAA 4CFVA 4K2RA 4QQ5A 4RIYA 3CTJA 4AZEA 3FQEA 4CG8A 1Q24A 2VNWA 3BELA 4PL3A 3TI1A 3PJ3A 3UQCA 2B9HA 2QOCA 1CKJA 2GS7A 2W1CA 1PMUA 3UGCA 4GK3A 3BHYA 1XH6A 4CT2A 4C34A 1UWHA 5CXHA 4LOPA 1E1VA 2A27A 4BBEA 1JKSA 2R3NA 4YZMA 2J90A 4YGAA 4CTBA 5IA3A 2QU5A 2QOLA 4D1XA 3C0IA 4EWQA 5K4IA 4FKUA 2OI4X 5FLFA 3RHKA 3UVRA 3AC4A 2XRUA 4APPA 1KE9A 1YXUA 3ZM9A 3UIBA 2JIIA 4X21A 2P2IA 4Z3VA 4C4FA 1YHVA 3S0OA 5EQPA 3ANRA 3NYOA 4BKJA 4FF8A 3HA8A 3PLAE 4E73A 1Q8WA 1XBBA 3FLWA 3R0TA 3C51A 4FSUA 4EOIA 1O6KA 4QYEA 4NFNA 5EDPA 3ZRKA 5J7HA 5DMZA 3HUBA 2XNPA 2B7AA 3WIKA 1PXMA 3CBLA 4NJ3A 4WSYA 5GJGA 5HNIX 5HBEA 3ENMA 2J7TA 5B0XA 3O8TA 3TT0A 1H08A 4C4JA 5H8GA 3LFNA 2CN5A 3MTFA 4GUBA 4FG9A 4B99A 4TYIA 2G2HA 4JX7A 3P86A 2NRYA 3R22A 1SVHA 3ORNA 4M68A 3D5UA 3WZEA 1NVRA 3QQHA 4F63A 4XNEA 3ZU7A 5E1EA 3GI3A 2PMIA 3NPCA 4AQCA 4FKPA 3KN5A 4YJOA 3W16A 5CASA 2J4ZA 5BVDA 3HMMA 2I0EA 3VRZA 2UUEA 4I0RA 2ZAZA 4R5YA 4BN1A 4D2WA 5E4HA 4GS6A 4P90A 3OT3A 1UU7A 4A9UA 4RWJA 3T8OA 2PUNA 4JQEA 2WMRA 4QP3A 3IECA 4QQCA 4R7HA 5DEWA 5AV1A 4C4GA 3KXXA 5AP5A 4UYAA 5IA5A 3LLTA 4BWXA 4F7LA 3KXZA 4NYEA 1Y57A 5CQUA 3DS6A 4QNYA 5DYJA 4C4EA 3ZFXA 3VBQA 1YHSA 3BCEA 2GQRA 3QQKA 2X1NA 4FX3A 3F7ZA 2BALA 3PE1A 3QL8A 3A61A 3PPJA 4JJRA 3MJ2A 4R8QA 4F4PA 5L6OA 3BE2A 3RM7A 3DLZA 4AU8A 1OITA 4ZTNA 1KSWA 4FTTA 3VJOA 3LVPA 3COMA 3RINA 5E8UA 3D94A 2EB3A 5DT3A 2OIDA 5KKRC 4KKHA 2OFUA 5E1SA 5KKRB 1CSNA 3ETAA 2XK3A 3C0GA 4FT0A 2R3RA 4D4YA 4NM5A 3FI8A 3BWFA 4G31A 2X6DA 3VQUA 3ZXZA 4BGQA 2JC6A 2XMYA 5KUPA 3FQHA 3FXZA 5CENA 3NNXA 4XBUA 3SRVA 3PA5A 5I9XA 1DI8A 2XJ1A 2QLUA 3MFUA 4F6WA 2C0OA 1Z9XA 4RIXB 4JLCA 3FXXA 2XNNA 4IACA 4X6RA 5AM6A 5E7RA 4GSBA 1P4FA 2X4FA 2WTVA 5KHWA 2J5EA 2XK7A 3KULB 3ET7A 2ITQA 3TCPA 3FKOA 4RQVA 3HV7A 3NZ0A 4GIIA 1TQPA 4M66A 3VS6A 5FXSA 3NEWA 3G33A 4EC8A 5HOAA 2JDSA 3A60A 4NTSA 2CKOA 2CMWA 2QC6A 4C33A 3OCTA 5AAEA 1UNHA 2W1DA 1UVRA 3DBFA 4K77A 4ALUA 4OGRA 3ID6C 3BYMA 2VTPA 5CU0A 4L6QA 2V5QA 4JX3A 3QC4A 3IW8A 3ATTA 4F64A 3SXSA 4RLKA 3NW5A 4AT4A 2JITA 2Z8CA 4JDHA 2G15A 4YJSA 4JRNA 3ZRMA 3A62A 3Q9WA 4CFMA 5BVEA 3CS9A 3ALNA 4WT6A 2X9FA 2BRNA 1G5SA 3FKLA 3C13A 2IJMA 5M56A 1OKVA 3P7AA 4YO6A 5J87A 1O6LA 1LP4A 4BI1A 5JN2A 5HG9A 4NTTA 3V8WA 4BDBA 4BYJA 5GZAA 5HTIA 4AZWA 2HWOA 3BGZA 4PP9A 4UZHA 1Q8YA 5AUTA 3UG2A 3ZO3A 4FZ7A 3TNHA 2F57A 3TNPC 3LFAA 2V55A 3FL4A 2VUWA 2R3OA 3HEGA 4FV2A 4DEBA 5EYMA 5CQWA 3DOGA 2BZKB 3ORLA 2G9XA 4U8ZA 3ZLWA 4AT5A 4CVAA 3NX8A 5T6KA 3D9VA 2QG7A 4U5JA 3V51A 4EYJA 3R7YA 5DA3A 4ZLYA 5M55A 4WG4A 5HCYA 4A4LA 2GNIA 5IQIA 2WQBA 4MVFA 4C38A 3UIXA 4GT4A 4UXQA 3KU2A 3RWQA 4DTKA 4OTRA 3DK3A 3Q04A 3DJ6A 5ETCA 4IAKA 1IA8A 5DFPA 4U45A 3O50A 1NVQA 4TNBA 1H1RA 2I0HA 5FTQA 4QP4A 3LQ5A 5HO6A 2YM5A 2EXMA 3ODZX 2IZRA 3G0FA 3GU4A 5FDXA 2J51A 3CKXA 5GJFA 5T3QA 4HVHA 1M2RA 1WBVA 3OWPA 4L46A 1HOWA 4N0SA 4EORA 4TYHB 1REKA 4Q9ZA 3QBNA 3K2LA 1XWSA 4C57A 4AG8A 3BEGA 5AR3A 4QP8A 4AX8A 5HE0A 5HGIA 4CRLA 2XYNA 3EL8A 3MPAA 3PP1A 4GFMA 4TWOA 4ENXA 5A4CA 2HAKA 4G17A 4RA5A 2CDZA 4X6QC 5CF6A 2BRGA 5KHXA 3VUMA 3CPCA 3BEAA 3ACJA 2XCHA 4LL5A 4YTHA 3WZKA 4NW5A 4ANOA 1QCFA 4E6QA 3K54A 1VR2A 4GRBA 5H2UA 5JFXA 5EDRA 4LUEA 2RGPA 3DZOA 4G6NA 5D7VA 3UO4A 3QTRA 4IWPA 4PTEA 4DEGA 2YM8A 3DKFA 4GCJA 5HIBA 1ZARA 5AIKA 5HD4A 5EW8A 2V7AA 3R73A 3BE9A 5CF5A 4CYJA 3W2SA 5H8BA 3BU3A 1VYZA 3HVCA 4I1ZA 2RFEA 4NWMA 4JDIA 4FTIA 3JY9A 4HYUA 4G5PA 4EOLA 4KS8A 5IG1A 3E87A 5J1VA 3H9RA 2GNJA 3OZ6A 5CEQA 2OWBA 3VS2A 3W2OA 4BGGA 4E4NA 2C6KA 4V0GB 5HTCA 2JAVA 1V0PA 3ZUVA 2J5FA 4XRLA 3ALOA 4YSJA 3TZ7A 4RVLA 4F7SA 2JKMA 5M08A 4W9WA 4YPDA 5K0KA 4WRSA 4D1ZA 1SYKA 4UMQA 1OL6A 3GU6A 2X8DA 3BGPA 4IAFA 4R6VA 3CP9A 3FC2A 5AMNA 2EUFB 4RJ4A 3S00A 4KNBA 3G51A 1YXVA 3SXFA 2JD5A 4JVGA 4OTWA 3TJCA 5IEYA 1R0PA 5FUTA 2WPAA 4S34A 4FA2A 2PMOX 5I3RA 1DAWA 3R71A 2W1FA 3LXLA 3MS9A 4H3QA 1MQBA 2WAJA 3IDCA 4A9RA 4TYJA 4OT6A 5K5XA 2P33A 5D11A 4MHAA 1CKIA 2R3QA 3BQCA 3HGKA 3F2RA 4MXYA 5FWKK 4HGSA 4LGDA 5AUZA 5AP3A 2W9FB 4BKZA 4BR3A 1YI6A 1YKRA 3E93A 3W10A 1ZMVA 4F6SA 4IDTA 3TN8A 3BQRA 3WE4A 3E7VA 3NYVA 4QPSA 3NVKI 1OKZA 2CGVA 3KN6A 4ANNA 2W0JA 3CPBA 4H36A 2YFXA 4PDOA 3IW5A 4II5A 2ZM4A 4UWCA 4E20A 4WNMA 4I6BA 3EQGA 3SV0A 3R28A 2FVDA 3CGFA 4R1YA 4C36A 3DAKA 4XG9A 3O71A 4FSMA 4LUDA 1BI8A 4FYNA 4U43A 1NY3A 1SVEA 3R1NA 2R9SA 4OLIA 4FKRA 2OBJA 2OW3A 3LJ0A 3RK7A 4FV7A 2GS6A 4DF3A 4M13A 3FMHA 3SGCA 2PZIA 2Y9QA 3DZQA 4WKQA 5FQDC 3TUBA 2HK5A 2IO6A 4CV9A 5FXRA 1GAGA 3I81A 3KF7A 4XOZA 2Z2WA 4O82A 3JVRA 4K8AA 4EKLA 3E8EA 4DHFA 2Z7SA 3F82A 3MW1A 2BIYA 4RIYB 1Q97A 5E8WA 3KEXA 4I4FA 5CSPA 2YM4A 2RL5A 5AP0A 3R8MA 2E9UA 5ETFA 3TL8A 3DK6A 3MDYA 1Y6AA 2Y0AA 3QD4A 4TT7A 4BCPA 2XS0A 4F9WA 4RJ6A 4KIPA 4WIHA 5JZJA 5JZNA 4P7EA 4I3ZA 3ZONA 3DBCA 4BL1A 2B1PA 1GZNA 4CTCA 3COKA 3GCQA 3A4OX 5EM7A 1PXLA 2WMBA 4RVTA 5CVHA 2RG6A 5HIDA 4D0WA 4CKJA 2XA4A 2Z60A 3UPXA 4K9YA 5HNBA 3NYXA 3O51A 5A9UA 4UALA 5J9YA 3QXOA 4P5ZA 2C0IA 4JG6A 4PQNA 4E1ZA 3TV4A 4JAJA 3NR9A 2FA2A 2HYYA 2P0CA 1PYEA 2W1GA 3AC8A 1B39A 2C68A 3ORXA 3F2AA 3PZEA 3VBTA 5LVNA 4RJ7A 4UXLA 2IVSA 2QI8A 3SAYA 3VS4A 3RNIA 1XJDA 4EC9A 2WXVA 3P08A 2X2KA 4FSRA 5JKGA 4F65A 5LWMA 4X7QA 4E3CA 3PG1A 5T68A 4WUAA 1J1BA 5BVWA 2QD9A 2WQOA 4F1TA 2WD1A 4AWIA 5IQDA 3MVJA 3WF6A 3MY0A 2OG8A 3IPHA 2XP2A 4BDDA 4O22A 2Z7RA 4YJRA 4S31A 5CNOA 4BDHA 3CQWA 4DFLA 5AEPA 4DFYA 3BLHA 4LV8A 2PVFA 1J7UA 1Q41A 4YJPA 5KMNA 3QTWA 4KRCA 1B38A 3BBWA 4L9IA 3CC6A 4MF0A 3MIYA 4OR5A 4E4MA 5A4TA 3UE4A 3RZBA 4Y72A 3O17A 3Q5ZA 4JDJA 3ZOSA 1Y8YA 4Z55A 2VV9A 3V8TA 5FDPA 3C5IA 1M2QA 4Y85A 4GT5A 4BWPA 1V0OA 3OG7A 4PF4A 4ORKA 1SNUA 2B52A 4S33A 1WBTA 2PMNX 2ITNA 4QOXA 4C37A 3C5UA 3DPKA 4O7VA 4HVIA 3UOLA 1ZYSA 2VTOA 4UMTA 1PMVA 3UJGA 2IW6A 2F7ZE 2XZSA 3FAAA 3HMOA 2J2IB 4U97A 4B8LA 4AOTA 2WQNA 4UBAA 2WMTA 5E8XA 2RIOA 3R8LA 2VTRA 3OTVA 3OY1A 3ZZWA 3DLSA 3NRMA 4XG7A 5BUIA 4IFCA 2PE0A 5LVOA 3QGWA 2X39A 3HZTA 3FUPA 3TTIA 3RCJA 3W2PA 3NGAA 4ACHA 3KKVA 3DGKA 3TACA 5J1WA 3U4UA 4D0XA 3JXWA 2YHVA 4LFIA 4LMNA 2BROA 3SOAA 3I79A 3VRYA 3VWAA 4FYOA 1PRYA 3DBDA 5ICPA 4GT3A 3TV7A 3U51A 5IMEA 2YM3A 3B8QA 3A8XA 3TWJA 4ZLOA 5CAOA 4UWYA 4YC3A 3OCSA 4D9TA 3DKCA 3LFBA 2Y4PA 1MRYA 4F0FA 2IZUA 4ITHA 2GTMA 3I5NA 4W4XA 3PXKA 3D83A 4HYIA 4D4SA 3PZHA 3S1HA 4OTFA 4LRJA 4FNYA 4F1MA 4N6ZA 3OUKA 3L9PA 2P2HA 3D5WA 4YU2A 2QODA 1PXOA 1M7NA 3HMNA 5C4KA 1G3NA 3Q52A 3RCDA 2VO7A 2BKZA 4QMYA 5C8NA 4ASDA 4XBRA 3P0MA 1KE8A 3CD3A 1WAKA 5ANJA 2VTAA 2QOQA 1NXKA 1PJKA 2UVYA 3DB6A 4BICA 5IISA 3KQ7A 3WILA 2OF4A 3HP2A 3MN3A 4YJUA 2ZMDA 4L52A 5CWZA 5FXQA 3UBDA 5HI2A 4C4HA 1ZOHA 3I4BA 4FEXA 3ACKA 4AT3A 4XG3A 1OUYA 2NO3A 4RIOA 3BWJA 3PJ2A 3NDMA 3OFMA 1XH5A 3ZZEA 3MI9A 4IWOA 3PE2A 3Q3BA 5HVKA 1MRVA 2I40A 3Q96A 4FIEA 5GZ9A 2KTYA 1IA9A 4E5WA 5IA4A 2QOBA 2W9ZB 4F08A 4U3YA 4U81A 2W5BA 2JBPA 4C8BA 4AZSA 3KMUA 1OKWA 4U79A 5HQ0A 3PRFA 5BQ0A 4E8AA 4O86A 4RX5A 3GOKA 3F3VA 4LG4A 3UC3A 5KBRA 3QUEA 5CAUA 2RF9A 4DLIA 2QLQA 4L3LA 5IQBA 4JOAA 3RM6A 3RPYA 3A8WA 3QX2A 4FTQA 4GH2A 4FVRA 3G6GA 3FZOA 3UC4A 2PYWA 3VO3A 4S2ZA 2UZEA 2O63A 3ORIA 3EYGA 4FTCA 5AR4A 2R7IA 5CEIA 3ZO1A 2O5KA 3QTXA 2R2PA 2W5AA 3CQUA 5HG5A 3B2WA 4NZWB 1JKKA 5KE0A 4RSSA 2IPXA 4MXCA 4O96A 5K9IA 4M0YA 3VBVA 4JBPA 2ZB1A 5CS6A 3ATSA 4EJ7A 1OL5A 5LMKA 4XUFA 5DEYA 5IPJA 3FMNA 3HP5A 5AJQA 3VUGA 4RIWA 1YXXA 4X3FC 2UW3A 4APCA 4X3FB 3R9DA 2W96B 2ZMCA 4P4CA 3ZDUA 3OWLA 2VWWA 3QAME 4W4WA 5A46A 4HZRA 3U87A 2VU3A 4ACCA 4F9CA 4GJ3A 2XCKA 4DC2A 3VW8A 4E5AX 3R1YA 3PLSA 3QLFA 5DBXA 2C4GA 4G5JA 5HBHA 4AAAA 4CLIA 5C26A 5AM7A 4FL3A 5KMOA 5F9EA 2BDWA 4DLJA 2OIBA 4DTBA 4EOSA 4TKSA 2JKKA 2E2BA 4AOIA 4CRSA 3PVUA 1WBPA 5FM3A 4CCUA 3C9WA 2IG7A 2VTQA 2VTLA 1UKHA 4PDSA 3WOWA 2UZBA 4FI1A 4RJ3A 4EOQA 3GOPA 1T46A 3G0EA 4EK4A 4PNKA 5KZIA 5I9WA 2VTTA 2VTHA 5CT0A 2CNQA 2X7FA 1WFCA 2F2CB 2Q0NA 2YABA 4XG4A 2C47A 4FIIA 4HYSA 5CSXA 3KFAA 3R1QA 3PVGA 2C6LA 2OK1A 4FSNA 4I5HA 3AT4A 4HGLA 4BYIA 4E4LA 1U5QA 3WZJA 1Y8GA 1CTPE 3U6IA 3L1SA 3Q53A 3HDMA 2BIKB 3C0HA 4PX6A 4PPCA 5AP7A 3FPQA 3RAWA 1OMWA 4DG0E 5HLNA 4HPUE 2ACXA 2OJFE 3FMJA 4ITIA 4JBOA 5CZHA 2HY0A 3GGFA 4FVPA 4N4SA 3R7EA 3NVMB 3A99A 2YIXA 4IVAA 3SQQA 3FY2A 2W1HA 3JYAA 4KRDA 2LAVA 4GKHA 3TNIA 4Q5HA 3TDVA 2HXLA 5HESA 4A4OA 2NRUA 1STCE 4FG7A 3ORZA 4FKJA 4NJDA 2DWBA 3HX4A 3VC4A 4BB4A 1ZRZA 4C61A 3R7UA 2H6DA 3AOXA 4MWIA 4FODA 3UO5A 4C2WA 3C50A 4FC0A 2A4LA 4TW9A 4HZSA 2NP8A 2UZOA 3UZPA 5C8MA 2XYUA 3FE3A 4FTRA 4D2RA 3H30A 1JSUA 1MUOA 3LQ8A 4ANMA 5IA2A 3IDBA 4GW8A 4G34A 2B55A 4NCTA 1P2AA 3H10A 4D5HA 3PUPA 4KAOA 2OJ9A 5J79A 1YRPA 5DRDA 1PXKA 5HG8A 3OCGA 4XJ0A 1H4LA 2F49A 4RJ5A 2WOTA 5CX9A 3THBA 4KINA 3T9TA 3DBQA 3GFWA 3MTLA 4JG7A 4DTAA 3KREA 1KV1A 5D41A 5DVRA 4ACGA 5AUXA 1JNKA 2UW9A 2ZV8A 3MY5A 4BIBA 3SW7A 2PPQA 2VO6A 5EYCA 3BYUA 5EFQA 4A9TA 4QD6A 4XS2A 4O7TA 2R3GA 4YPSA 5EOBA 2CLQA 4NKAA 1H25A 3TNWA 5HX6A 3D5XA 3NNVA 4EH6A 3NNWA 3A7FA 4UB7A 1KOBA 5ANGA 5AUUA 4FSQA 4DFUA 3LM5A 3I0QA 4HNFA 3ZSIA 1LPUA 4TL0A 2G1TA 1YHWA 3OUNB 1G8SA 1TKIA 3GFEA 4Y5QA 5I3OA 5L2IA 1XH9A 2CHLA 4W8EA 4DH1A 2GDOA 3FZ1A 3DXNA 2JIVA 4ZMFA 3PP0A 3CTHA 4O0RA 4WNKA 4CGAA 4O0XA 3PJCA 5K0XA 4G6LA 4OTHA 4WD5A 2H9VA 3QHRA 4RC2A 4FKSA 4EQMA 2ITUA 3ZO2A 5ITAA 2OZAA 2H34A 4FG8A 2WTCA 3GXLA 3LW0A 1M7QA 4EK6A 3LCSA 3POZA 2OICA 4S30A 4UYNA 5HHWA 4OTQA 3W8LA 5HORA 4J52A 3DAJA 2DQ7X 4QYYA 3WYXA 2Y4IC 4ACMA 1YXTA 2REIA 2Y4IB 2BCJA 1GOLA 3MJ1A 4AA0A 4M7IA 4ACDA 4GU6A 5BUEA 3UPZA 3U9NA 4XG6A 4EHGA 4AN3A 2E9OA 3P23A 4I21A 5EHLA 3QRTA 5ANKA 2RG5A 3E7OA 3EWHA 1PF8A 2PWLA 3N9XA 3MGYA 3HMPA 4FTMA 4O6LA 4RT7A 1GZOA 3R1SA 3R83A 4LGHA 3A7JA 4JAIA 4QMSA 2UZDA 2GQGA 4R5SA 4R1VA 2O3PA 4YURA 3ZYAA 5LVMA 2CNVA 4IFGA 4M67A 2OGVA 2QURA 5JK3A 2UZLA 4W8DA 3LFCA 5M51A 3IKAA 2ETKA 2RFSA 4BRXA 4FKIA 4JRVA 1AD5A 5E8ZA 4AFEA 2DYLA 4XV3A 3V6RA 4RVKA 2C5XA 3QTIA 2C69A 4I6FA 4DCEA 1JQHA 1OGUA 5BUJA 4KA3A 4Y73A 2CGXA 5FTOA 4JT3A 4RG0A 3GU5A 2OF2A 3NAXA 4MD7E 2ERZE 3VUIA 3FC1X 3HV4A 3RAHA 3KRLA 5HE3A 3IOKA 4OTDA 3L9NA 5CI7A 3V01A 3LXPA 5AUWA 3REPA 5L2WA 2X2MA 3TV6A 5KMIA 2F2UA 4JBVA 1JKLA 4QMWA 1WVXA 4IAYA 3FLZA 2CLXA 2V0DA 5E8VA 5IH4A 1PHKA 2UW8A 1AGWA 3QLGA 4FTUA 4NIFA 4RFZA 5ETAA 1Q3WA 3UP2A 1Q5KA 4A06A 2R3JA 1Q4LA 1JPAA 4F0GA 4MNEA 5I9YA 3FLQA 4FVQA 5LVPA 3UOKA 3R7GA 5AP2A 4JR7A 1W7HA 4EK8A 1NT2A 4IZAA 5E8TA 4O2ZA 3MA3A 4OAUC 3QCQA 1I44A 3EJ1A 2JDVA 4ARKA 4CLJA 1GY3A 5CU3A 1JVPP 5F4NA 2BFYA 2VX1A 2RSVA 4AZFA 2XBJA 3GC8A 4PPBA 1MP8A 3NS9A 5CEPA 5D9HA 5IDPA 4IVBA 3EQHA 2FO0A 3MH0A 1UU8A 2X7OA 2P3GX 3BRBA 3NUNA 4GFGA 3UIUA 3Q4TA 2WMAA 3COIA 3DKGA 4AP7A 3L8XA 4AA4A 1J1CA 3PA4A 3QD0A 2UVXA 5C9CA 3WF7A 4C4IA 4DFNA 2O64A 4DGLC 2J0KA 3FDNA 2W1EA 3ZBFA 2C6OA 1JLUE 3EFWA 3MH3A 4P2KA 1E9HA 1W8CA 2XM9A 4Y46A 4BDGA 4TWCA 4Z16A 4ZY4A 2JEDA 4N6YA 3Q32A 5I5ZA 4ZSLA 3ZMMA 3MV5A 1GZKA 5DR9A 2P4IA 4NM0A 5CAVA 2BUJA 4L44A 4K33A 5KO1A 5D1JA 5ANOA 5AX3A 1KOAA 3BHTA 3G9NA 3ZLYA 4QTDA 2HELA 2HCKA 3P79A 3AGLA 4Y5HA 5FEDA 4BGHA 3ORMA 3R9HA 1Q8ZA 1X8BA 2YN8A 5TO8A 3C4CA 1RW8A 2C3KA 2X0GA 3I7CA 3E8DA 3OTUA 3PA3A 5EDQA 2VTSA 5EYDA 2WTWA 2PULA 4OTIA 3DFAA 1OZ1A 3EYHA 3DA6A 5AP6A 3EFLA 1GNGA 4FKWA 4ID7A 3DKOA 1SM2A 2XF0A 3FHRA 4MAOA 4G3FA 4RQKA 5AAFA 3V5LA 4FIJA 2VTJA 3QKLA 2YJRA 3UOHA 5JQ8A 4EZ5A 5EW9A 1OM1A 3WARA 4L7FA 1Q62A 3SOCA 5J9ZA 4M0ZA 3PVWA 4YUQA 1O6YA 4QYHA 5ACKA 4BDIA 4QMPA 4RC4A 1XH4A 2R4BA 3EIDA 3F9NA 2VTIA 3HA6A 4IC8A 3IOPA 4YBJA 4YC6A 4YZDA 4RWLA 4DG3E 4NSTA 2GSFA 3OP5A 2A19B 4K1BA 2QHNA 4ZK5A 4E7WA 4O7NA 2GHLA 1CKPA 2BRHA 4WHZA 3OROA 3ZLXA 4C2VA 3GCSA 1M17A 3CGOA 4I20A 3POOA 3ROCA 1RE8A 5E90A 3QGYA 4TXCA 4O0UA 5A6NA 1Q8UA 4QPMA 3KL8A 2XKFA 3NYNA 1OL2A 4NM7A 4D28A 5KBQA 5M57A 4WNOA 3MIAA 2W1IA 3PXFA 4CNHA 4CYIA 5HO7A 1H00A 1P5EA 3FSFA 3I6UA 4WO5A 4F99A 4AW0A 4IZYA 1YXSA 3GB2A 4XLVA 1GIHA 1JOWB 1A06A 2WMWA 3KY2A 5BYZA 4KKEA 3UMXA 4UMPA 3TDWA 3JS2A 2ZDUA 2CN8A 5BMMA 3SDJA 3DU8A 3EN4A 3QA8A 4EUUA 1ZWSA 2ITZA 3BYVA 4QYFA 5FP5A 2W5HA 4FNXA 3PXYA 1CMKE 1BYGA 2C1BA 2PY3A 2XB7A 1F0QA 4IVDA 5EOLA 4LQMA 5TE0A 3ZSGA 4A7CA 3AD4A 4YTIA 4WBBB 4D2PA 4TWPA 3VN9A 1FVVA 1PXIA 2G2IA 3ENHA 3NUSA 4NM3A 4IX4A 3UNJA 5LOHA 2R0IA 2PZRA 3SG8A 3EN6A 3CXWA 3LOKA 3HYHA 3OT8A 2J0JA 2ESMA 2WZJA 4FL1A 3VQHA 5IZFA 5GIOE 2ONLA 2WFYA 3AC1A 3D4QA 4X3JA 4I5CA 1UA2A 2PVHA 2NNWB 3OMVA 3S2PA 4E6AA 1TQMA 1Q61A 5KNJA 4IH8A 4CV8A 3P78A 4MCVA 4C3RA 4GG7A 4O1PA 5ANEA 2R7BA 2I7QA 3R8PA 4AUAA 4MF1A 4DAWA 5M07A 4EH9A 2R3PA 3PFQA 4OTGA 3RP9A 3ODYX 4UX9A 1VYWA 5M53A 5BVNA 4U42A 1T45A 2AYPA 4O21A 4ZMEA 4MYGA 4IANA 4ASZA 2ITWA 1O9UA 4ZSAA 2HZNA 3WBLA 4CD0A 4J95A 3VF8A 1U4DA 4A9YA 3QRUA 4PP7A 4YTFA 4QP7A 1OL7A 5AP4A 3SLSA 3VUDA 5CSWA 2VZ6A 4EZ7A 4N57A 4FGBA 3CE3A 3UVPA 1OB3A 2PVYA 3BHVA 4FOCA 5JFSA 2W4JA 4O0SA 2CJMA 2JBOA 1OL1A 1UKIA 1YDRE 3LXNA 5AUYA 4EH2A 5KMLA 3DQWA 4TNDA 5L8KA 2WOUA 2E9PA 5DPVA 2R3IA 1FPUA 4OW8A 2FGIA 2Y6OA 3HAMA 1OI9A 3EKKA 1UV5A 3IW7A 3LHJA 1P14A 4FUXA 4AW2A 4HVSA 2BTSA 4J71A 2FB8A 3QHWA 2BDJA 4I6HA 2ITYA 2YCSA 4G9RA 4NH1A 5EM8A 5IH5A 4FT5A 5GHVA 4WG5A 2WMXA 3FI4A 3R7IA 5JH6A 3D7ZA 2QO2A 4XYFA 2EXEA 4QMTA 3NUXA 3FYJX 4M97A 1PW2A 1APME 3EFJA 5DH3A 3K5VA 1U46A 3DDPA 3PIZA 4PL4A 3VULA 5J5SA 3SA0A 3MH1A 3DAEA 4AACA 1ZY5A 2G2FA 4FIFA 3EL7A 3H9FA 3PWDA 2R3LA 4GJ2A 1U54B 1E1XA 3QFVA 4CEGA 3LLAA 4L42A 3T3UA 2VX0A 5C4LA 5CYIA 4NCTC 3N4VA 4JXFA 4PPAA 3RVGA 4FTJA 4NW6A 5BVKA 3LCDA 3A4PA 3QYZA 3UZTA 5DGZA 2W99B 3LMHA 3OBGA 4OT5A 3GQLA 4O0VA 2VO0A 3F88A 4CZYB 1XQZA 2B9FA 2XIYA 3TM0A 2ITXA 2F7EE 4Y8DA 4AA5A 4FZDB 4IM2A 2O2UA 3EOCA 4OBPA 4QP1A 5FM2A 3PSCA 4D5KA 5IA0A 4BC6A 3KMWA 4ERWA 3JVSA 3P1AA 2BDFA 2XKCA 3GVUA 3O23A 3OEFX 3QA0A 3TJDA 2W05A 5CTPA 3MVHA 3GT8A 3ROYA 4I4EA 2CGUA 4BI0A 1FINA 3AMAA 2WTKC 3P5KA 5IEVA 3TZ8A 2WTKB 2X6EA 4YJQA 4RZWA 4JR3A 3O8UA 3CQEA 3SD0A 4UMUA 5IUGA 3L8SA 3H4JA 2WTIA 1L3RE 1OIQA 3FPMA 3QTSA 4R3CA 3PRIA 4A07A 4QP2A 2YWVA 3VBYA 4MTAA 4MX9A 2OZAB 2JLDA 3IGGA 4ZJJA 3MYGA 3G90X 2C3IB 4DN5A 1JKTA 2LGCA 4QMUA 2YZAA 4FKGA 4I6QA 4R3PA 3JUHA 1K2PA 2X7GA 2VWBA 2Y6MA 3LFEA 4G3CA 4R7IA 1QMZA 5LCJA 4C62A 2OFVA 1XO2B 5BNJA 1ZYDA 3OXZA 2VWIA 3W55A 4F1OA 2YIRA 4B7TA 5J95A 4O1OA 2JDTA 5EW3A 4DINA 2AC3A 5EHYA 4TWNA 4F6UA 2YWPA 2YCRA 4LGGA 2Z02A 3V3VA 2WEIA 4G6OA 3R01A 3C4FA 5ETIA 3EKNA 5D7AA 4KS7A 4XOYA 4P5QA 3ORTA 3PDTA 4PRJA 5I9UA 2YDKA 4JI9A 4QPAA 1UNGA 2VRXA 2WO6A 1GIJA 4IBMA 4C02A 4BTJA 3C7QA 1ZMWA 1PY5A 3LQ3A 2WHBA 3QXPA 4OTPA 2XVDA 3ZHPC 4CMOA 2J6MA 2X4ZA 3QCYA 3AD6A 3OF0A 4U0IA 4PNIA 3C4XA 4M14A 5FRIA 4CQGA 5M06A 4EONA 2QKWB 4FEQA 5BMSA 3BHUA 5KCVA 1VEBA 2QOFA 4MWHA 2XKEA 3GU8A 4MQ1A 1KE5A 4GKIA 4O38A 2OJGA 4QQTA 4FTKA 2C1AA 3QX4A 4RFMA 4AZTA 4F9AA 4XEYA 5HU9A 4KBCA 2EB2A 3EZVA 2YLFA 2JDRA 4IDVA 4FV4A 4XX9A 5TT7A 2YCQA 3OY3A 4IB5A 3RHXA 1KE7A 4L68A 3SRVB 4AN2A 4EHEA 2GQSA 2EXCX 2WIHA 4I41A 3W2QA 2FSTX 4LV5A 4H3BA 2F4JA 4ZSJA 4DGGA 3GP0A 4AF3A 4YR8A 4I0TA 4CXAA 3IS5A 3AC2A 4FTNA 4BCIA 5IQCA 4MNEB 4DGNA 3QCSA 3FEGA 2JAMA 3QF9A 1R3CA 2FSOX 2ZV2A 4L3PA 3NUPA 1UNLA 5IU2A 3NUAA 2O65A 4UN0C 5DWRA 5IQHA 3E64A 4YC8A 2W7XA 4RRVA 3BLQA 5D10A 4FKQA 4PDYA 3EN7A 2VWVA 4UY9A 4YSMA 4ZS0A 2VGOA 4E6DA 4IIRA 3RWPA 2JFMA 4B0GA 4OUCA 5A4LA 1U59A 5IUIA 4QMZA 4HOKA 4I5PA 2PK9A 4TN6A 1PXNA 3VVHA 2GHMA 4XV1A 4Q9SA 2WU6A 4J99A 3K5UA 4TRLA 3I5ZA 5CLPA 3UO6A 2V22A 2WMVA 4IADA 4WNPA 5CEKA 4I93A 4IMYA 3R7OA 3CKWA 4KIKA 1PYXA 2H8HA 4F9BA 4AFJA 4G1WA 3U6JA 4EOOA 5J5TA 1ZMUA 3W18A 2X81A 4ZIMA 4BCMA 4O0WA 2X8IA 1FMKA 2CNUA 5B2KA 5EM6A 2PVRA 4GK2A 3P7BA 3QUPA 2QOOA 4QMQA 5M4CA 1OVEA 3K3IA 4FSWA 3T3VA 4ASEA 5JSMA 2O0UA 4IAIA 5AWMA 3RK5A 5IQAA 1ZYLA 4ZZNA 3MVLA 2HZ4A 2PVMA 4W4VA 2RKUA 2CKQA 1UU9A 3EN9A 3UMWA 4G16A 2YAAA 3HNGA 4LMUA 4O27B 3QKKA 4ZY5A 1AQ1A 3EHAA 1BLXA 4TYGA 4L00A 1OIUA 3HRBA 3RPOA 5AR8A 3Q2JA 4TYHA 4MNFA 4BHZA 2FUMA 3U8WA 1YOMA 4PL5A 3JR1A 1HCKA 3PVBA 4YNOA 5M4IA 2IW9A 3NMUF 3D0EA 3KXHA 4RX8A 3OXTA 3ANQA 3M1SA 3KB7A 3A7GA 3RPVA 4DE4A 4KSPA 3FHIA 2PE1A 2V7OA 5KZ0A 4L01A 3SX9A 5HO8A 2XK6A 4FV6A 1ZZ2A 4EH8A 3E88A 1RQQA 2BZHB 1H0VA 4BDJA 3BKBA 3CIKA 3LZBA 4H58A 2X2LA 2PE2A 4NK9A 1TVOA 4BI2A 4KKGA 4BY9E 3IQ7A 5BVOA 2WQEA 3EQCA 4JIAA 3UTOA 3PPZA 3O7LB 4PMTA 4ANSA 4EOKA 4AS0A 1H26A 2OU7A 1PMEA 2ITPA 3TZMA 5HE1A 4QTEA 3FL5A 4MXOA 4DEAA 4EH3A 2UZTA 2CCHA 3L9LA 4ANBA 3RNYA 5BVFA 3GEQA 5EI6A 1U5RA 3BYOA 5CSVA 4XH6A 4BDAA 4K0YA 3VS5A 5M4FA 1LEWA 3GC7A 2WTJA 4EZ3A 3I0OA 4L53A 3R8UA 4F70A 3DJ7A 4DITA 3EQFA 4C3PA 4EOMA 4DH7A 5IQEA 4B6LA 1YQJA 3ZO4A 5TOZA 3EN5A 3H0ZA 3LFDA 3F6XA 1PMNA 4KBKA 2WIPA 3GCPA 1BKXA 5E9EA 3I7BA 4Q2AA 1ZYCA 3V5QA 4XG2A 3V04A 1YI3A 2JDOA 4FEVA 5FP6A 2OJIA 3QZIA 5L6WL 3T9IA 4B4LA 3E63A 3PWYA 2GU8A 3K3JA 5CY3A 1ZAOA 3IW4A 2W4KA 3FMLA 4QMLA 4BZOA 5B2MA 5C01A 4HGEA 2QKRA 5JRSA 4FE2A 2YITA 3LMGA 5HVYA 4AGUA 4F9YA 3EMGA 5LQFA 3E92A 2NPQA 2UW6A 5CVGA 3R63A 2OZOA 4UEUA 4IAAA 3RPSA 4ZJVA 4IM3A 5CSHA 3D7TA 3MSSA 3AMYA 3O0GA 3PG3A 3JPVA 3QKMA 4FKLA 4CKIA 5LJJA 1KWPA 5E91A 3DXPA 1BL7A 4GIHA 3MB6A 3CJGA 3GQIA 5IKWA 2CKEA 3VW6A 4D55A 1Q3DA 3LFQA 1YWRA 4IM0A 1ND4A 1XHAA 3KXGA 2XJ0A 4RPVA 4FV0A 4MBIA 4XLIA 2VN9A 2QU6A 4AOJA 5AA8A 3NIZA 4M12A 3FLNC 3AG9A 3DNDA 4ZSEA 5E8YA 5KMKA 2JFLA 1F5QA 2QQ7A 4KBAA 3Q9XA 5C1QB 4MK0A 4QO9A 4IAZA 2R3MA 2GFCA 3R00A 3MH2A 4BHNA 5D12A 3GENA 4DBXA 2G01A 3ZFYA 4GU9A 3PXZA 1FVTA 1QPEA 4PDPA 5HG7A 4CCBA 2BZIB 5AAGA 5EQYA 3EH9A 2QOIA 3VS3A 2CSNA 5DE2A 3PIYA 5E8SA 3SHEA 1IR3A 3G2FA 2C5OA 4USFA 3LIJA 3VAPA 1ZOGA 3U6HA 2HW6A 2PHKA 4EOJA 3VS7A 5IA1A 4O7RA 4QMOA 1H1WA 4PTCA 5DG5A 4EEVA 4HCUA 2QO7A 3R9OA 2BMCA 2OH4A 5CAQA 5CALA 2HOGA 3FZSA 3DV3A 3TIZA 3RAKA 2HY81 3R2BA 5HD7A 3ZCLA 4BBFA 2IN6A 4G3DA 2R3HA 5FGKA 3RGFA 2OXYA 3ZC5A 1ZXEA 5EI8A 4RFYA 4B8MA 2EVAA 4QP9A 3MFTA 3VJNA 1PKGA 2YM7A 2YDJA 3MFRA 2XUUA 3GNIB 3W1FA 4ITJA 4BCGA 4X2GA 5FBOA 3ULIA 1YVJA 4O91A 4X2KA 3V5JA 3KVXA 1W98A 2DUVA 3DT1A 4AE6A 3AC3A 5CU4A 3AD5A 4DA5A 2WMUA 1MRUA 2PZYA 1GZ8A 3ORPA 4YHTA 2IZTA 3U54A 2EU9A 3WZUA 5BYLA 1R39A 4QTAA 4V04A 4CFUA 4YNEA 4J98A 4U3ZA 1Z57A 4PTGA 2C5NA 4ZEGA 4I22A 2C30A 2J0MB 2X8EA 3QTUA 4IC7A 4XHKB 4DT8A 1RDQE 1H1SA 3SG9A 4I24A 3ZFMA 3F66A 1JBPE 4MQ2A 5E92A 3TG1A 3TKUA 4FL2A 4GFOA 5CU6A 1TQIA 3QRJA 4NL0A 2C6IA 3D5VA 3MVMA 3VBXA 5K3YA 3TKIA 1OPJA 2PZ5A 5CXZA 3UNZA 2H96A 4ZAUA 4ERKA 3ULZA 1K9AA 4IE9A 4W9XA 3SXRA 4K11A 1IG1A 2BVAA 3S4QA 2HW7A 5EI2A 2BILB 1LEZA 2XNOA 2PMLX 3PTGA 3F5UA 2CKPA 5LARA 4EQCA 2BAKA 2YJSA 3KC3A 3QWJA 4ZOGA 4MH7A 4E6CA 3LMIA 3QU0A 4IQ6A 4A4XA 4FUYA 3RK9A 3KRRA 2GCDA 1Q99A 5LVLA 4D4RA 5I0BA 1WBWA 1OBDA 3QQLA 3QQUA 5IUHA 4KIOA 4BCNA 2ERKA 4YHFA 1H8FA 5J9LA 4BCFA 4LYNA 4Q5EA 1SMHA 3CTQA 4IXPA 1Y91A 2P55A 5DN3A 5HKMA 4AW5A 5L2SA 4DEEA 4EK3A 3AXWA 4E5BA 2B54A 2IW8A 2WELA 3WE8A 3FMDA 3WI6A 4OBQA 2PUUA 5I9VA 4EH7A 1DM2A 5EKOA 5JMSA 1OIYA 3DK7A 3HL7A 4BDEA 4FGRA 3V5WA 2UW5A 3IGOA 4G3GA 4FT3A 3QQJA 2KULA 4NEUA 4I92A 4ZY6A 3LPBA 1CM8A 3G9LX 1DI9A 3OS3A 3FMMA 4G3EA 1R1WA 3H3CA 4WOVA 4YZBA 3EQDA 3CLYA 4BCKA 2W1ZA 3NCZA 4CT1A 3AC5A 3ZUTA 4WUNA 1FQ1B 3UQFA 4PV0A 2XK4A 3VUHA 4QMMA 3N4TA 4JL9A 3RZFA 4DYMA 4R78A 3OD6X 4JBQA 4F09A 2YAKA 2HENA 4O0YA 3NAYA 2YISA 2QVSE 3FBVA 4YHJA 4IZ5A 3KA0A 1H07A 2UZUE 4ONAA 1BUHA 1XH7A 2ETMA 3E62A 2XM8A 3RMFA 1FMOE 4I23A 4MXAA 1YI4A 3N51A 4CMTA 3R8VA 2VTNA 3Q6WA 2F9GA 3OWKA 3M11A 1KV2A 3B8RA 4OBOA 2JGZA 2SRCA 3VBWA 4DEIA 2FSLX 1OBGA 2VNYA 4HW7A 1M52A 4Y83A 3CJFA 3O7LD 4KD1A 2ITOA 4FKVA 3HRCA 4ANLA 1QPJA 3W2CA 4BDFA 4UWBA 5EG3A 5GIPE 4D58A 4MEDA 3A7HA 2PUIA 3D14A 5CEOA 3V5PA 1H01A 3F3UA 3NCGA 4ALVA 4AZVA 5A3XA 3GC9A 5CANA 1GIIA 4DG2E 3WZDA 3BBTB 3EZRA 3R2YA 4L45A 2YIQA 4FR4A 2C6MA 2I0VA 3KF4A 3MA6A 4GMYA 5ANDA 3SKCA 3U9CA 2GFSA 5JEBA 5B2LA 3Q4UA 5CVFA 1NW1A 5LXMA 2OXDA 3GU7A 3R6XA 5IH6A 1URWA 4GL9A 3LFSA 2OO8X 4FTAA 5HICA 4BTKA 3OBJA 3E3BX 5J7BA 1GJOA 3PSDA 1A9UA 4M15A 4BWKA 3F69A 2UVZA 1Y6BA 1EH4A 2UW0A 2YM6A 3FMKA 4HYHA 3AT3A 2XIZA 5H3QA 3UP7A 1Z5MA 2UW7A 2WGJA 1OKYA 2VO3A 1LR4A 4IX5A 4C0TA 3FV8A 4CZUA 5M09A 4R7BA 3C4ZA 3PPKA 2RFDA 3TKHA 2JKOA 4IB0A 5DLSA 3EQPA 4QYGA 2PL0A 4WSQA 4U41A 1WBNA 4X2JA 4YP8A 1S9IA 3HECA 3ZEWA 3D2KA 1NA7A 4FMQA 3GCVA 3NNUA 4QMVA 4USDA 3PJ1A 2UZNA 4RVMA 5IMXA 4U7ZA 3ORKA 4GUEA 1VJYA 1ATPE 3FXWA 4IWQA 4ZZMA 4NKSA 1DS5A 3O8PA 1PXJA 2R0UA 3QWKA 3LE6A 3L8VA 4KIKB 3WYYA 2UZVA 2GPHA 4M8TA 2J50A 4TTHB 1UU3A 2J9MA 4U44A 3VS1A 2R5TA 4V01A 4XMOA 4CQEA 2PVKA 3OW4A 4M84A 4U40A 3ZRLA 5KX8A 5HCZA 4U80A 3DNEA 3RJCA 2VWZA 3L8PA 3DDQA 5DRBA 5A14A 3TNQB 4O7YA 2WMSA 4XV2A 3QD2B 2YIWA 3KCFA 4C58A 5A54A 4USEA 1YOJA 3RTPA 2BPMA 3OVVA 4H3PA 4D1SA 4X3FA 2XK8A 3G15A 4EH5A 3L9MA 1ZLTA 2I0YA 2IVVA 1YW2A 3KVWA 4MXZA 3Q4CA 5EYKA 4BZDA 5DI1A 4C7TA 2XBAA 2XKDA 5ANIA 4JG8A 4QMXA 3RAIA 3VHEA 3ZM4A 2C5VA 1PXPA 4YLJA 3TUDA 4XCUA 4XP3A 3IW6A 4BKYA 3V6SA 2C6DA 3QRKA 5LMBA 2QG5A 4QTCA 2PTKA 3D15A 3IG7A 5JRQA 3UYTA 1H28A 3OC1A 5C27A 3MB7A 5BYYA 4R3RA 4GEOA 4XG8A 2C3JA 5IEXA 1L8TA 4FIHA 2BHEA 2Q0BA 4RX9A 4FZAB 5LMKC 1OPKA 3ZXTA 4FOBA 2OH0E 3COHA 3F3TA 4TZRA 4RIWB 3MPMA 3AT2A 3BX5A 4WA9A 4M69A 3UIMA 3TUCA 3N4UA 4H1MA 3BV2A 3HV5A 1IASA 3F3ZA 4ZLZA 2WB8A 3VUKA 4FKOA 2HWPA 1JSTA 4FEUA 1OECA 5GZ8A 3ERKA 3DCVA 4IWDA 5AUVA 4RC3A 2BAQA 5G1XA 4C35A 3FMEA 3RKBA 3PJ8A 2ZJWA 3I1AA 3UDBA 4DGMA 4YBKA 2HZ0A 2Y8OA 5HE2A 1B6CB 3QRIA 1VZOA 1YDSE 4O6EA 4Z7GA 4AN9A 5AR5A 2QR8A 4PMPA 4QNAA 3NIEA 2GNFA 3LCKA 4ZTRA 4IHPA 3EFKA 1V0BA 3NUUA 4EQUA 4PUZA 5DOSA 5HZNA 3UODA 3ZUUA 4IEBA 4HVGA 5K5NA 4IJ9A 3BIZA 4J97A 2QCSA 4U6RA 3F5GA 4ALWA 4AXAA 4E26A 5HVJA 3HLLA 4IB3A 3QCXA 4EWHA 2CCIA 5AR7A 3RPRA 1PKDA 4EBVA 4I94A 4FV1A 4TPTA 3NLBA 3ZC6A 1W82A 3C4EA 3LJ2A 2XJ2A 2BAJA 4EL9A 1IEPA 3TEIA 5A4EA 1G8AA 2OLCA 3LKMA 3BI6A 4FT7A 3FWQA 4CFWA 5AADA 2OSCA 2C5YA 3HRFA 3QD3A 4JIKA 4CG9A 4X2NA 3D7TB 4KABA 3ZDIA 4M3QA 1H24A 1JAMA 2YERA 3QZGA 4EUTA 3F61A 1YDTE 4PMMA 4E4XA 4EYMA 4LOOA 3W8QA 3MBLA 2QNJA 4G9CA 3P9JA 3FY0A 4YMJA 5DHJA 4O81A 3QZHA 1W0XC 3FYKX 3JY0A 5IQGA 5JGDA 2I6LA 3KK9A 4V05A 4ZTLA 4D2SA 5L8LA 2B53A 4C59A 2F7XE 5L3AA 5CEMA 4D4VA 3R9NA 3DXQA 3IDPA 2UZWE 3KMMA 4BCOA 4I5MA 1R0EA 2HXQA 3FLSA 5FEQA 4QMNA 3O96A 1WMKA 4RWKA 2Z7LA 3TZ9A 2UW4A 3U4WA 3LM0A 3VUTA 5CU2A 4BFMA 1J7IA 3ZEPA 2A0CX 4QP6A 3QYWA 3KCKA 3DTCA 3PXQA 5GJDA 3TIYA 2VWUA 1XBCA 5L4QA 4F0IA 1J3HA 2FYSA 1M2PA 4BCQA 2WTDA 5JGAA 3CD8A 3PY3A 3P7CA 3FKNA 5JGBA 4JQ7A 5DT4A 3BU6A 5HNGA 5J8IA 3SW4A 4FSTA 4HPTE 5CT7A 4S32A 5FD2A 3BU5A 4LOQA 4ZS4A 2YCFA 3CY2A 2PVNA 4NFMA 5L8JA 4Z7HA 2DS1A 5IDNA 5F95A 3DB8A 4FZ6A 2J0IA 5EM5A 2BRBA 3WF9A 4J96A 5EHOA 3CEKA 3LAUA 3R8ZA 4AGDA 3HAVA 1FBNA 2C6TA 3PY1A 4EH4A 1JSVA 4PMSA 4EI4A 4ZZOA 5HTBA 4XRJA 5I4NA 3MFSA 1ZZLA 3CR0A 3BLRA 4FIGA 3DTWA 5CI6A 5C8KA 4YZ9A 2ZOQA 5EKNA 4YJNA 5K4JA 1ERKA 4ZTSA 3GC0A 1FVRA 1OIRA 3M2WA 4EJNA 5I9ZA 4O7ZA 2PVLA 2R64A 1W84A 4NT4A 5DIAA 2HZIA 1OUKA 1LUFA 2QR7A 1SVGA 3FZPA 5C03A 3R7VA 1YOLA 3QTQA 4A9SA 5DT0A 5AV2A 1YWVA 4XP2A 4YO4A 4FSYA 2BZJA 5F94A 2A2AA 2BRMA 2WNTA 3OOMA 4D9UA 5HCXA 4FV3A 2QOHA 2XNMA 4PY1A 3DY7A 4UZDA 4MBLA 5LCKA 3UQGA 3LCTA 4BVUA 3AMBA 4OAVB 3OOGA 2E9VA 1URCA 4XV9A 2GS2A 3OWJA 3MPTA 5BPYA 4QRCA 5TF9A 1BX6A 5GINE 4J8MA 1SNXA 4LL0A 4DEDA 5DR6A 3HMIA 1RJBA 2QONA 1KE6A 2C3LA 3KK8A 1H1QA 4YJVA 3HUCA 2VX3A 4J53A 1QPCA 4CFXA 2XNGA 3BZ3A 3WIGA 4EHVA 4EHZA 4FZFB 3NWWA 4FK6A 4BIDA 1OPLA 3KRWA 4BBMA 4EK5A 5L6PA 5TKDA 5AP1A 1R78A 3NW7A 4FSZA 3ZS5A 5CF4A 5G6VA 2XRWA 4FV8A 3F2NA 4RIXA 3WF5A 3IO7A 2WU7A 3KRJA 4F7NA 4FNWA 3QTZA 1ZYJA 5CZIA 4YTCA 3UYSA 3LCOA 4CFNA 4IZ7A 2RFNA 4FV5A 2XNBA 3RI1A 4JNWA 3FI2A 1ZOEA 1BMKA 3KULA 4MXXA 5HU3A 2ZVAA 1FGIA 2B4SB 2BTRA 1QL6A 4IJPA 4WRGA 2FH9A 3KGAA 5EH0A 3WF8A 3VS0A 4K18A 5ACBC 2PU8A 3HV3A 4KIQA 3F3WA 2V62A 2CPKE 4O83A 3U55A 4BCHA 4ZP5A 4EKKA 2BKKA 1WBSA 3FZTA 3V8SA 1WZYA 5FTGA 3W2RA 3ZBXA 3BGQA 4G2FA 4O0TA 4JQ8A 4TYEA 5LMAA 4LRKA 3UVQA 1IRKA 1XH8A 3BHHA 4BF2A 4CSVA 3AQVA 3VF9A 3DBEA 3I60A 1CDKA 4AGWA 5KMJA 4IX3A 4NIFB 4ZTMA 4ZTQA 4DEHA 1W83A 2ZV9A 3MESA 3CCNA 3NSZA 5JFWA 3H0YA 3FJQE 5EQEA 3H9OA 4BTMA 4CKRA 4DFXE 2OKRA 4JS8A 5JFVA 5GNKA 5HIEA 1K3AA 2OXXA 3MY1A 3FI3A 5A4QA
chains in the Genus database with same CATH superfamily
3Q2MA 4RLLA 3W33A 3FQSA 4BZNA 4LM5A 2C6EA 1NVSA 3II5A 4JDKA 4U9AA 4MD9E 4RBLA 1QPDA 4GYGA 3MWUA 3KXMA 3C1XA 5HBJA 4AE9A 2JIUA 3ZH8A 3R02A 2R3FA 3EQRA 3VHKA 3EB0A 3QZFA 1WCCA 3DQXA 3Q5IA 2B9JA 2YDIA 4YJTA 5AR2A 2AUHA 1WBOA 2GTNA 3G6HA 4E93A 3B2TA 2ZM3A 3EQBA 4KWPA 4TY1A 2C0TA 3W32A 1HCLA 4ANQA 4D2TA 5AFVA 3BYSA 2XIKA 2QHMA 4O2PA 4LRMA 4ZJIA 4LI5A 2VWYA 4FK3A 2WMQA 3PY0A 4GK4A 4AW1A 3VIDA 1JWHA 4IW0A 5HEZA 3BPRA 4IX6A 4DH8A 4DCAA 4X2FA 4DH3A 3LJ1A 2WQMA 1IAHA 4ASXA 4GYIA 2E9NA 5HX8A 3KXNA 3NUYA 3ZSHA 3SVVA 2GNLA 3E3PA 2B9IA 3R21A 5CAPA 3M42A 4DBNA 1VLRA 3FZRA 2VTMA 4GG5A 3GBZA 1J7LA 2PVJA 4K6ZA 5DR2A 4H05A 3S3IA 3Q9ZA 4RA4A 4BCJA 1IAJA 4DGOA 2QO9A 1XR1A 3LFFA 3Q4ZA 3UNKA 3PXRA 4QTBA 5EK7A 2ZB0A 4HJOA 3RALA 4L43A 4BDCA 4RX7A 5AV3A 1BI7A 3TXOA 4HCVA 4CFFA 1A48A 3HV6A 5A6OA 3EQIA 2VGPA 3CY3A 2YA9A 2YEXA 5H8EA 2QOKA 2ZDTA 3NFFB 4O7LA 3IONA 3NW6A 5DNRA 2XK9A 4FV9A 4I0SA 3UG1A 3QQGA 2OIQA 3KRXA 2Z7QA 4YLKA 1ZY4A 4GVJA 4RMZA 1FGKA 3OHTA 4RZVA 5FEEA 3O2MA 3G5DA 4F7JA 3UZRA 5M44A 1H0WA 4Y95A 4O84A 3GCUA 4QT1A 3Q6UA 3QALE 3BV3A 4PWNA 1REJA 5F1ZA 4CZTA 1XBAA 4L3JA 2W06A 4ZTHA 4UMRA 5IQFA 4DFBA 3DJ5A 1XKKA 4FEWA 3E8CA 4O7SA 2A1AB 2XNEA 3RBWA 5FBNC 3R9RA 1H27A 4EOPA 2XH5A 3OEZA 2WEVA 5HLWA 1UWJA 1FOTA 4V0GA 2ITVA 1H1PA 2UV2A 4AGCA 4KB8A 2XEYA 4FT9A 2W17A 4ZXTA 3FSKA 3PIXA 2ZYBA 5FG8A 4KUJA 1F3MC 4H39A 4HNIA 5JT2A 3F7WA 4B9DA 4J8NA 4FBXA 4FICA 3QC9A 3A7IA 1J91A 3QQFA 5L2TA 1M14A 2YACA 4RJ8A 2AC5A 2PZPA 4YZNA 5LWNA 2YZLA 4GV1A 4RGJA 1KUTA 3R04A 4N70A 2CGWA 4O4FA 5AV0A 2GNGA 2X9EA 4FTOA 3HKOA 3DFCB 1Q8TA 3CSVA 4MD8E 3PYYA 2GNHA 2R3KA 3LXKA 1I09A 5CF8A 4FNZA 4YLLA 4C3FA 1S9JA 5F20A 3A2CA 5BV3A 1MQ4A 4L8MA 2ONLC 5AV4A 4NU1A 4WG3A 5H9BA 2ZV7A 4L67A 4IB1A 2IVTA 1DAYA 5AX9A 4BTFA 2B0QA 3ZTXA 2Q83A 4X0MA 4DT9A 2HIWA 4MKCA 4WBOA 3ZLSA 3E5AA 4XP0A 4BIEA 2VWXA 3QUDA 2PUPA 1P4OA 2GMXA 3D2IA 4HVDA 4J1RA 2A98A 2VD5A 3AGMA 3OXIA 3P4KA 4YZCA 1YWNA 5B7VA 4DFZE 4M69B 2J0LA 4QQJA 3C4WA 4BDKA 3I6WA 2GHGA 2IVUA 3Q60A 5CNNA 4HGTA 3S95A 4R77A 5AIRA 5BX0A 1SZMA 2BHHA 2WKMA 4Z9LA 4D2VA 5JQ5A 3UOJA 4CMUA 5AA9A 3OW3A 2XIRA 2I1MA 5IF1A 4MBJA 5KMMA 3Q9YA 3GUBA 3PSBA 4HCTA 5L2QA 4RWIA 4FTLA 1BL6A 4KSQA 4UV0A 5HLPA 4NUSA 2EWAA 2JKQA 2VAGA 4L7SA 1WVYA 2BR1A 2XIXA 4FKTA 3SC1A 3IK3A 3OCBA 2ZM1A 1V1KA 4H1JA 3TTJA 4ENYA 2ETRA 3F5XA 3F5PA 4ZSGA 3VNTA 3ELJA 2BFXA 2O8YA 2IZSA 3HDNA 2FSMX 2PSQA 5TR6A 2XEZA 2Y7JA 4IVCA 4W4YA 3FLYA 4EBWA 2YIYA 5M4UA 3ITZA 3V5TA 3R30A 4O7WA 1U54A 2IWIA 3E8NA 4J7BA 4DH5A 2W4OA 1WVWA 2OJJA 2YLEA 2ITTA 4GVAA 4CFVA 4K2RA 4QQ5A 4RIYA 3CTJA 4AZEA 3FQEA 4CG8A 1Q24A 2VNWA 3BELA 4PL3A 3TI1A 3PJ3A 3UQCA 2B9HA 2QOCA 1CKJA 2GS7A 2W1CA 1PMUA 3UGCA 4GK3A 3BHYA 1XH6A 4CT2A 4C34A 1UWHA 5CXHA 4LOPA 1E1VA 2A27A 4BBEA 1JKSA 2R3NA 4YZMA 2J90A 4YGAA 4CTBA 5IA3A 2QU5A 2QOLA 4D1XA 3C0IA 4EWQA 5K4IA 4FKUA 2OI4X 5FLFA 3RHKA 3UVRA 3AC4A 2XRUA 4APPA 1KE9A 1YXUA 3ZM9A 3UIBA 2JIIA 4AXEA 4X21A 2P2IA 4AAYA 4Z3VA 4C4FA 1YHVA 3S0OA 5EQPA 3ANRA 3NYOA 4BKJA 4FF8A 3HA8A 3PLAE 4E73A 1Q8WA 1XBBA 3FLWA 3R0TA 3C51A 4FSUA 4EOIA 1O6KA 4QYEA 4NFNA 5EDPA 3ZRKA 5J7HA 5DMZA 3HUBA 2XNPA 2B7AA 3WIKA 1PXMA 3CBLA 4NJ3A 4WSYA 5GJGA 5HNIX 5HBEA 3ENMA 2J7TA 5B0XA 3O8TA 3TT0A 1H08A 4C4JA 5H8GA 3LFNA 2AEGA 2CN5A 3MTFA 4GUBA 4FG9A 4B99A 4TYIA 2G2HA 4JX7A 3P86A 2NRYA 3R22A 1SVHA 3ORNA 4M68A 3D5UA 3WZEA 1NVRA 3QQHA 4F63A 4XNEA 3ZU7A 3PFYA 5E1EA 3GI3A 2PMIA 3NPCA 4AQCA 4FKPA 3KN5A 4YJOA 3W16A 5CASA 2J4ZA 5BVDA 3HMMA 2I0EA 3VRZA 2UUEA 4I0RA 2ZAZA 4R5YA 4BN1A 4D2WA 5E4HA 4GS6A 4P90A 3OT3A 1UU7A 4A9UA 4RWJA 3T8OA 2PUNA 4JQEA 2WMRA 4QP3A 3IECA 4QQCA 4R7HA 5DEWA 5AV1A 4C4GA 3KXXA 5AP5A 4UYAA 5IA5A 3LLTA 4BWXA 4F7LA 3KXZA 4NYEA 1Y57A 5CQUA 3DS6A 4QNYA 5DYJA 4C4EA 4F78A 3ZFXA 3VBQA 1YHSA 3BCEA 2GQRA 3QQKA 2X1NA 4FX3A 3F7ZA 2BALA 3PE1A 3QL8A 3A61A 3PPJA 4JJRA 3MJ2A 4R8QA 4F4PA 5L6OA 3BE2A 3RM7A 3DLZA 4AU8A 1OITA 4ZTNA 1KSWA 4FTTA 3VJOA 3LVPA 3COMA 3RINA 5E8UA 3D94A 2EB3A 5DT3A 2OIDA 5KKRC 4KKHA 2OFUA 5E1SA 5KKRB 1CSNA 3ETAA 2XK3A 3C0GA 4FT0A 2R3RA 4D4YA 4NM5A 3FI8A 3BWFA 4G31A 2X6DA 3VQUA 3ZXZA 4BGQA 2JC6A 2XMYA 5KUPA 3FQHA 3FXZA 5CENA 3NNXA 4XBUA 3SRVA 3PA5A 5I9XA 1DI8A 2XJ1A 2QLUA 3MFUA 4F6WA 2C0OA 1Z9XA 4RIXB 4JLCA 3FXXA 2XNNA 4IACA 4X6RA 5AM6A 5E7RA 4GSBA 1P4FA 2X4FA 3BL9A 2WTVA 5KHWA 2J5EA 2XK7A 3KULB 3ET7A 2ITQA 3TCPA 3FKOA 4RQVA 3HV7A 3NZ0A 4GIIA 1TQPA 4M66A 3VS6A 5FXSA 3NEWA 3G33A 4EC8A 5HOAA 2JDSA 3A60A 4NTSA 2CKOA 2CMWA 2QC6A 4C33A 3OCTA 5AAEA 1UNHA 2W1DA 4AXDA 1UVRA 3DBFA 4K77A 4ALUA 4OGRA 3ID6C 3BYMA 2VTPA 5CU0A 4L6QA 2V5QA 4JX3A 3QC4A 3IW8A 3ATTA 4F64A 3SXSA 4RLKA 3NW5A 4AT4A 2JITA 2Z8CA 4JDHA 2G15A 4YJSA 4JRNA 3ZRMA 3A62A 3Q9WA 4CFMA 5BVEA 3CS9A 3ALNA 4WT6A 2X9FA 2BRNA 1G5SA 3FKLA 3C13A 2IJMA 5M56A 1OKVA 3P7AA 4YO6A 5J87A 1O6LA 1LP4A 4BI1A 5JN2A 5HG9A 4NTTA 3V8WA 4BDBA 4BYJA 5GZAA 5HTIA 4AZWA 2HWOA 3BGZA 4PP9A 4UZHA 1Q8YA 5AUTA 3UG2A 3ZO3A 4FZ7A 3TNHA 2F57A 3TNPC 3LFAA 2V55A 3FL4A 2VUWA 2R3OA 3HEGA 4FV2A 4DEBA 5EYMA 5CQWA 3DOGA 2BZKB 3ORLA 2G9XA 4U8ZA 3ZLWA 4AT5A 4CVAA 3NX8A 5T6KA 3D9VA 2QG7A 4U5JA 3V51A 4EYJA 3R7YA 5DA3A 4ZLYA 5M55A 4WG4A 5HCYA 4A4LA 2GNIA 5IQIA 2WQBA 4MVFA 4C38A 3UIXA 4GT4A 4UXQA 3KU2A 3RWQA 4DTKA 4AXFA 4OTRA 3DK3A 3Q04A 3DJ6A 5ETCA 4IAKA 1IA8A 5DFPA 4U45A 3O50A 1NVQA 4TNBA 1H1RA 2I0HA 5FTQA 4QP4A 3LQ5A 5HO6A 2YM5A 2EXMA 3ODZX 2IZRA 3G0FA 3GU4A 5FDXA 2J51A 3CKXA 5GJFA 5T3QA 4HVHA 1M2RA 1WBVA 3OWPA 4L46A 1HOWA 4N0SA 3AKKA 4EORA 4TYHB 1REKA 4Q9ZA 3QBNA 3K2LA 1XWSA 4C57A 4AG8A 3BEGA 5AR3A 4QP8A 4AX8A 5HE0A 5HGIA 4CRLA 2XYNA 3EL8A 3MPAA 3PP1A 4GFMA 4TWOA 4ENXA 5A4CA 2HAKA 4G17A 4RA5A 2CDZA 4X6QC 5CF6A 2BRGA 5KHXA 3VUMA 3CPCA 3BEAA 3ACJA 2XCHA 4LL5A 4YTHA 3WZKA 4NW5A 4ANOA 1QCFA 4DHZA 4E6QA 3K54A 1VR2A 4GRBA 5H2UA 5JFXA 5EDRA 4LUEA 2RGPA 3DZOA 4G6NA 5D7VA 3UO4A 3QTRA 4IWPA 4PTEA 4DEGA 2YM8A 3DKFA 4GCJA 5HIBA 1ZARA 5AIKA 5HD4A 5EW8A 2V7AA 3R73A 3BE9A 5CF5A 4CYJA 3W2SA 5H8BA 3BU3A 1VYZA 3HVCA 4I1ZA 2RFEA 4NWMA 4JDIA 4FTIA 3JY9A 4HYUA 4G5PA 4EOLA 4KS8A 5IG1A 3E87A 5J1VA 3H9RA 2GNJA 3OZ6A 5CEQA 2OWBA 3VS2A 3W2OA 4BGGA 4E4NA 2C6KA 4V0GB 5HTCA 2JAVA 1V0PA 3ZUVA 2J5FA 4XRLA 3ALOA 4YSJA 3TZ7A 4RVLA 4F7SA 2JKMA 5M08A 4W9WA 4YPDA 5K0KA 4WRSA 4D1ZA 1SYKA 4UMQA 1OL6A 3GU6A 2X8DA 3BGPA 4IAFA 4R6VA 3CP9A 3FC2A 5AMNA 2EUFB 4RJ4A 3S00A 4KNBA 3G51A 1YXVA 3SXFA 3W0SA 2JD5A 4JVGA 4OTWA 3TJCA 5IEYA 1R0PA 5FUTA 2WPAA 4S34A 4FA2A 2PMOX 5I3RA 1DAWA 3R71A 2W1FA 3LXLA 3MS9A 4H3QA 1MQBA 2WAJA 3IDCA 4A9RA 4TYJA 4OT6A 5K5XA 2P33A 5D11A 4MHAA 1CKIA 2R3QA 3BQCA 3UDTA 3HGKA 3F2RA 4MXYA 5FWKK 4HGSA 4LGDA 5AUZA 5AP3A 2W9FB 4BKZA 4BR3A 1YI6A 1YKRA 3E93A 3W10A 1ZMVA 4F6SA 4IDTA 3TN8A 3BQRA 3WE4A 3E7VA 3NYVA 4QPSA 3NVKI 1OKZA 2CGVA 3KN6A 4ANNA 2W0JA 3CPBA 4H36A 2YFXA 4PDOA 3IW5A 4II5A 2ZM4A 4UWCA 4E20A 4WNMA 4I6BA 3EQGA 3SV0A 3R28A 2FVDA 3CGFA 4R1YA 4C36A 3DAKA 4XG9A 3O71A 4FSMA 4LUDA 1BI8A 4FYNA 4U43A 1NY3A 1SVEA 3R1NA 2R9SA 4OLIA 4FKRA 2OBJA 2OW3A 3LJ0A 3RK7A 4FV7A 2GS6A 4DF3A 4M13A 3FMHA 3SGCA 2PZIA 2Y9QA 3DZQA 4WKQA 5FQDC 3TUBA 2HK5A 2IO6A 4CV9A 5FXRA 1GAGA 3I81A 3KF7A 4XOZA 2Z2WA 4O82A 3JVRA 4K8AA 4EKLA 3E8EA 4DHFA 2Z7SA 3F82A 3MW1A 2BIYA 4RIYB 1Q97A 5E8WA 3KEXA 4I4FA 5CSPA 2YM4A 2RL5A 5AP0A 3R8MA 2E9UA 5ETFA 3TL8A 3DK6A 3MDYA 1Y6AA 2Y0AA 3QD4A 4TT7A 4BCPA 2XS0A 4F9WA 4RJ6A 4KIPA 4WIHA 5JZJA 5JZNA 4P7EA 4I3ZA 3ZONA 3DBCA 4BL1A 2B1PA 1GZNA 4CTCA 3COKA 3GCQA 3A4OX 5EM7A 1PXLA 2WMBA 4RVTA 5CVHA 2RG6A 5HIDA 4D0WA 4CKJA 2XA4A 2Z60A 3UPXA 4K9YA 5HNBA 3NYXA 3O51A 5A9UA 4UALA 5J9YA 3QXOA 4P5ZA 2C0IA 4JG6A 4PQNA 4E1ZA 3TV4A 4JAJA 3NR9A 2FA2A 2HYYA 2P0CA 1PYEA 2W1GA 3AC8A 1B39A 2C68A 3ORXA 3F2AA 3PZEA 3VBTA 5LVNA 4RJ7A 4UXLA 2IVSA 2QI8A 3SAYA 3VS4A 3RNIA 1XJDA 4EC9A 2WXVA 3P08A 2X2KA 4FSRA 5JKGA 4F65A 5LWMA 4X7QA 4E3CA 3PG1A 1G8KA 5T68A 4WUAA 1J1BA 5BVWA 2QD9A 2WQOA 4F1TA 2WD1A 4AWIA 5IQDA 3MVJA 3WF6A 3MY0A 2OG8A 3IPHA 2XP2A 4BDDA 4O22A 2Z7RA 4YJRA 4S31A 5CNOA 4BDHA 3CQWA 4DFLA 5AEPA 4DFYA 3BLHA 4LV8A 2PVFA 1J7UA 1Q41A 4YJPA 5KMNA 3QTWA 4KRCA 1B38A 3BBWA 4L9IA 3CC6A 4MF0A 3MIYA 4OR5A 4E4MA 5A4TA 3UE4A 3RZBA 4Y72A 3O17A 3Q5ZA 4JDJA 3ZOSA 4LV7A 1Y8YA 4Z55A 2VV9A 4QEBA 3V8TA 5FDPA 3C5IA 1M2QA 4Y85A 4GT5A 4BWPA 1V0OA 3OG7A 4PF4A 4ORKA 1SNUA 2B52A 4S33A 1WBTA 2PMNX 2ITNA 4QOXA 4C37A 3C5UA 3DPKA 4O7VA 4HVIA 3UOLA 1ZYSA 2VTOA 4UMTA 1PMVA 3UJGA 2IW6A 2F7ZE 2XZSA 3FAAA 3HMOA 2J2IB 4U97A 4B8LA 4AOTA 2WQNA 1W2FA 4UBAA 2WMTA 5E8XA 2RIOA 3R8LA 2VTRA 3OTVA 3OY1A 3ZZWA 3DLSA 3NRMA 4XG7A 2IF8A 5BUIA 4IFCA 2PE0A 5LVOA 3QGWA 2X39A 3HZTA 3FUPA 3TTIA 3RCJA 3W2PA 3NGAA 4ACHA 3NFGB 3KKVA 3DGKA 3TACA 5J1WA 3U4UA 4D0XA 3JXWA 2YHVA 4LFIA 4LMNA 2BROA 3SOAA 3I79A 3VRYA 3VWAA 4O4EA 4FYOA 2XAOA 1PRYA 3DBDA 5ICPA 4GT3A 3TV7A 3U51A 5IMEA 2YM3A 3B8QA 3A8XA 3TWJA 4ZLOA 5CAOA 4UWYA 4YC3A 3OCSA 4D9TA 3DKCA 3LFBA 2Y4PA 1MRYA 4F0FA 2IZUA 4ITHA 2GTMA 3I5NA 4W4XA 3PXKA 3D83A 4HYIA 4D4SA 3PZHA 3S1HA 4OTFA 4LRJA 4FNYA 4F1MA 4N6ZA 3OUKA 3L9PA 1W2CA 2P2HA 3D5WA 4YU2A 2QODA 1PXOA 1M7NA 3HMNA 5C4KA 1G3NA 3Q52A 3RCDA 2VO7A 2BKZA 4QMYA 5C8NA 4ASDA 4XBRA 3P0MA 1KE8A 3CD3A 1WAKA 5ANJA 2VTAA 2QOQA 1NXKA 1PJKA 2UVYA 3DB6A 4BICA 5IISA 3KQ7A 3WILA 2OF4A 3HP2A 3MN3A 4YJUA 2ZMDA 4L52A 5CWZA 5FXQA 3UBDA 5HI2A 4C4HA 1ZOHA 3I4BA 4FEXA 3ACKA 4AT3A 4XG3A 1OUYA 2NO3A 4RIOA 3BWJA 3PJ2A 3NDMA 3OFMA 1XH5A 3ZZEA 3MI9A 4IWOA 3PE2A 3Q3BA 5HVKA 1MRVA 2I40A 3Q96A 4FIEA 5GZ9A 2KTYA 1IA9A 4E5WA 5IA4A 2QOBA 2W9ZB 4F08A 4U3YA 4U81A 2W5BA 2JBPA 4C8BA 4AZSA 3KMUA 1OKWA 4U79A 5HQ0A 3PRFA 5BQ0A 4E8AA 4O86A 4RX5A 3GOKA 3F3VA 3W0NA 4LG4A 3UC3A 5KBRA 3QUEA 5CAUA 2RF9A 4DLIA 2QLQA 4L3LA 5IQBA 4JOAA 3RM6A 3RPYA 3A8WA 3QX2A 4FTQA 4GH2A 4FVRA 3G6GA 3FZOA 3UC4A 2PYWA 3VO3A 4S2ZA 2UZEA 2O63A 3ORIA 3EYGA 4FTCA 5AR4A 2R7IA 5CEIA 3ZO1A 2O5KA 3QTXA 2R2PA 2W5AA 3CQUA 5HG5A 3B2WA 4NZWB 1JKKA 3ML1A 5KE0A 4RSSA 2IPXA 4MXCA 4O96A 5K9IA 4M0YA 3VBVA 4JBPA 2ZB1A 5CS6A 3ATSA 4EJ7A 1OL5A 5LMKA 4XUFA 5DEYA 5IPJA 3FMNA 3HP5A 5AJQA 3VUGA 4RIWA 1YXXA 4X3FC 2UW3A 4APCA 4X3FB 3R9DA 2W96B 2ZMCA 4P4CA 3ZDUA 3OWLA 2VWWA 3QAME 4W4WA 5A46A 4HZRA 3U87A 2VU3A 4ACCA 4F9CA 4GJ3A 2XCKA 4DC2A 3VW8A 4E5AX 3R1YA 3PLSA 3QLFA 5DBXA 2C4GA 4G5JA 5HBHA 4AAAA 4CLIA 5C26A 5AM7A 4FL3A 5KMOA 5F9EA 4JMQA 2BDWA 4DLJA 2OIBA 4DTBA 4EOSA 4TKSA 4O4BB 2JKKA 2E2BA 4AOIA 4CRSA 3PVUA 1WBPA 5FM3A 4CCUA 3C9WA 2IG7A 2VTQA 2VTLA 1UKHA 4PDSA 3WOWA 2UZBA 4FI1A 4RJ3A 4EOQA 3GOPA 1T46A 3G0EA 4EK4A 4PNKA 5KZIA 5I9WA 2VTTA 2VTHA 5CT0A 2CNQA 2X7FA 1WFCA 2F2CB 2Q0NA 2YABA 4XG4A 2C47A 4FIIA 4HYSA 5CSXA 3KFAA 3R1QA 3PVGA 2C6LA 2OK1A 4FSNA 4I5HA 3AT4A 4HGLA 4BYIA 4E4LA 1U5QA 3WZJA 1Y8GA 1CTPE 3U6IA 3L1SA 3Q53A 3HDMA 2BIKB 3C0HA 4PX6A 4PPCA 5AP7A 3FPQA 3RAWA 1OMWA 4DG0E 5HLNA 4HPUE 2ACXA 2OJFE 3FMJA 4ITIA 4JBOA 5CZHA 2HY0A 3GGFA 4FVPA 4N4SA 3R7EA 3NVMB 3A99A 2YIXA 4IVAA 3SQQA 3FY2A 2W1HA 3JYAA 4KRDA 2LAVA 4GKHA 3TNIA 4Q5HA 3TDVA 2HXLA 5HESA 4A4OA 2NRUA 1STCE 4FG7A 3ORZA 4FKJA 4NJDA 2DWBA 3HX4A 3VC4A 4BB4A 1ZRZA 4C61A 3R7UA 2H6DA 3AOXA 4MWIA 4FODA 3UO5A 4C2WA 3C50A 4FC0A 2A4LA 4TW9A 4HZSA 2NP8A 2UZOA 3UZPA 5C8MA 2XYUA 3FE3A 4FTRA 4D2RA 3H30A 1JSUA 1MUOA 3LQ8A 4ANMA 5IA2A 3IDBA 4GW8A 4G34A 2B55A 4NCTA 1P2AA 3H10A 4D5HA 3PUPA 4KAOA 2OJ9A 5J79A 1YRPA 5DRDA 1PXKA 5HG8A 3OCGA 4XJ0A 1H4LA 2F49A 4RJ5A 2WOTA 5CX9A 3THBA 4KINA 3T9TA 4AQKA 3DBQA 3GFWA 3MTLA 4JG7A 4DTAA 3KREA 1KV1A 5D41A 5DVRA 4ACGA 5AUXA 1JNKA 2UW9A 2ZV8A 3MY5A 4BIBA 3SW7A 2PPQA 3TMOA 2VO6A 5EYCA 3BYUA 5EFQA 4A9TA 4QD6A 4XS2A 4O7TA 2R3GA 4YPSA 5EOBA 2CLQA 1ST0A 4NKAA 1H25A 3TNWA 5HX6A 3D5XA 4BJJA 4DDIA 3NNVA 4EH6A 3NNWA 3A7FA 4UB7A 1KOBA 5ANGA 5AUUA 4FSQA 4DFUA 3LM5A 3I0QA 4HNFA 3ZSIA 1LPUA 4TL0A 2G1TA 1YHWA 3OUNB 1G8SA 1TKIA 3GFEA 4Y5QA 5I3OA 5L2IA 1XH9A 2CHLA 4W8EA 4DH1A 2GDOA 3FZ1A 3DXNA 2JIVA 4ZMFA 3PP0A 3CTHA 4O0RA 4WNKA 4CGAA 4O0XA 3PJCA 5K0XA 4G6LA 4OTHA 4WD5A 2H9VA 3QHRA 4RC2A 4FKSA 4EQMA 2ITUA 3ZO2A 5ITAA 2OZAA 2H34A 4FG8A 2WTCA 3GXLA 3LW0A 1M7QA 4EK6A 3LCSA 3POZA 4QDEA 2OICA 4S30A 4UYNA 5HHWA 4OTQA 3W8LA 5HORA 4J52A 3DAJA 2DQ7X 4QYYA 3WYXA 2Y4IC 4ACMA 1YXTA 2REIA 2Y4IB 2BCJA 1GOLA 3MJ1A 4AA0A 4M7IA 4ACDA 4GU6A 5BUEA 3UPZA 3U9NA 4XG6A 4EHGA 4AN3A 2E9OA 3P23A 4I21A 5EHLA 3QRTA 5ANKA 2RG5A 3E7OA 3EWHA 1PF8A 2PWLA 3N9XA 3MGYA 3HMPA 4FTMA 4O6LA 4RT7A 1GZOA 3R1SA 3R83A 4LGHA 3A7JA 4JAIA 4QMSA 3O5AA 2UZDA 2GQGA 4R5SA 4R1VA 2O3PA 4YURA 3ZYAA 5LVMA 2CNVA 4IFGA 4M67A 2OGVA 2QURA 5JK3A 2UZLA 4W8DA 3LFCA 5M51A 3IKAA 2ETKA 2RFSA 4BRXA 2X0QA 4FKIA 4JRVA 1AD5A 5E8ZA 4AFEA 2DYLA 4XV3A 3V6RA 4RVKA 2C5XA 3QTIA 2C69A 4I6FA 4DCEA 1JQHA 1OGUA 5BUJA 4KA3A 4Y73A 2CGXA 5FTOA 4JT3A 4RG0A 3GU5A 2OF2A 3NAXA 4MD7E 2ERZE 3VUIA 3FC1X 3HV4A 3RAHA 3KRLA 5HE3A 3IOKA 4OTDA 3L9NA 5CI7A 3V01A 3LXPA 5AUWA 3REPA 5L2WA 2X2MA 3TV6A 5KMIA 2F2UA 4JBVA 1JKLA 4QMWA 1WVXA 4IAYA 3FLZA 2CLXA 2V0DA 5E8VA 5IH4A 1PHKA 2UW8A 1AGWA 3QLGA 4FTUA 4NIFA 4RFZA 5ETAA 1Q3WA 3UP2A 1Q5KA 4A06A 2R3JA 1Q4LA 1JPAA 4F0GA 4MNEA 5I9YA 3FLQA 4FVQA 5LVPA 3UOKA 3R7GA 5AP2A 3UDZA 4JR7A 1W7HA 4EK8A 1NT2A 4IZAA 5E8TA 4O2ZA 3MA3A 4OAUC 3QCQA 1I44A 3EJ1A 2JDVA 4ARKA 4CLJA 1GY3A 5CU3A 1JVPP 5F4NA 2BFYA 2VX1A 4AXCA 2RSVA 4AZFA 2XBJA 3GC8A 4PPBA 1MP8A 3NS9A 5CEPA 5D9HA 5IDPA 4IVBA 3EQHA 2FO0A 3MH0A 1UU8A 2X7OA 2P3GX 3BRBA 3NUNA 4GFGA 3UIUA 3Q4TA 2WMAA 3COIA 3DKGA 4AP7A 3L8XA 4AA4A 1J1CA 3PA4A 3QD0A 2UVXA 5C9CA 3WF7A 4I6LA 4C4IA 4DFNA 2O64A 4DGLC 2J0KA 3FDNA 2W1EA 3ZBFA 2C6OA 1JLUE 3EFWA 3MH3A 4P2KA 1W8CA 1E9HA 2XM9A 4Y46A 4BDGA 4TWCA 4Z16A 4ZY4A 2JEDA 4N6YA 3Q32A 5I5ZA 4ZSLA 3ZMMA 3MV5A 1GZKA 5DR9A 2P4IA 4NM0A 5CAVA 2BUJA 4L44A 4K33A 5KO1A 5D1JA 5ANOA 5AX3A 1KOAA 3BHTA 3G9NA 3ZLYA 4QTDA 2HELA 2HCKA 3P79A 3AGLA 4Y5HA 5FEDA 4BGHA 3ORMA 3R9HA 1Q8ZA 1X8BA 2YN8A 1TFFA 5TO8A 3C4CA 1RW8A 2C3KA 2X0GA 3I7CA 3E8DA 3OTUA 3PA3A 5EDQA 2VTSA 5EYDA 2WTWA 2PULA 4OTIA