5CYMA

Hiv-1 reverse transcriptase complexed with 4-iodopyrazole
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
556
structure length
546
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNDKLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rapid experimental SAD phasing and hot spot identification with halogenated fragments
doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 151
structure length 546
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5cymA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cymA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cymA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cymA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5cymA05
4C8KA 1W9HA 3K57A 4TQSA 4H4OB 1HNIB 3HVTB 2C28A 3VN5A 4JS4A 4DFJA 4CJLA 3JYTA 1NK5A 3VQ5A 3JYTB 3QO9A 2AWZA 3KNAA 5I3UB 4J9PA 2XRIA 4FK4A 2XI2A 2R8HA 4MIBA 1JKHB 4O4RA 1SH3A 5DGBA 5L1KA 2C2RA 2UUWA 5C25A 4O3QA 4I2QB 1HQUA 3I0RA 3KK2B 1SKWA 4FJHA 3H5SA 4RW7B 2YNHA 5DQIA 2XC9A 4TY8B 1SV5B 2W42A 3V9WA 2DTUA 3DI6A 5KG4A 2DFFA 4JRQA 1QTMA 3G6YA 3CO9A 1U49A 1J54A 4LD0A 4KHSA 1YVUA 5KFKA 3L2QA 1NJXA 4I7FB 4F4ZA 3PX0A 4NRTA 1XR5A 3AV9A 3EYZA 4Z4GA 1HARA 1D0EA 2XCAA 4ELUA 3T5KA 4CHPA 4CEQA 3RWUA 2GUIA 4CJRA 3U3YA 1IKWB 4DSJA 4M3XA 4WFYA 1ASWA 1RILA 2Y1JA 5F9LA 3OYGA 3ZT4A 2IAJB 4ZHRA 1W25A 3OSPA 4RNNA 1I39A 3DM2B 1LWCA 2W8LA 4E19A 3WNGA 3KIOA 2IM2A 1K1SA 3HVAA 2EX3A 3QETA 5KFTA 1SKRA 4KB1A 4O44B 4CJTA 1J9AA 3IG1A 4CJWA 2R2TA 1LWFB 2P51A 1REVB 3OL6A 2GC8A 1RNHA 3LALA 3H08A 2X78A 5FRMA 4ED2A 2IOCA 4TN2A 3RAXA 1TKXA 2IC3A 2P1JA 1SL2A 3IRXA 4DEZA 5HBMA 1RYSA 3LANA 1RTHB 4GW6A 1T94A 2ASJA 2W9BB 1RTJA 3ZSWA 4E1MA 1YVFA 3QIDA 2R8IA 5J2QA 3ZSRA 3Q8QB 1BQMA 5T7BA 2O5DA 2E9TA 3S3MA 4WXWA 5KGXA 1EKEA 3K5MA 2GBZA 3CJ5A 3HYFA 3LAMA 2HAIA 3JSMA 4M95A 3C95A 3RB0A 1U04A 4WYWA 4CJPA 2HVHA 1Q8IA 1C1AA 3NAHA 3ZT0A 2WOMB 1IKVA 4O44A 1JLBA 4BWMA 1HNVA 5EWFA 4DS4A 2HHUA 4F3TA 3OYHA 4Y1CA 5F8HA 4YNQA 2ASLA 1RTJB 4KB0A 1GX5A 5HP1B 2WB4A 2YHBA 3UPFA 4J9SA 3RB3A 2J6SA 5K14A 3CM6A 1RTDB 3MF5A 5KG5A 1HNIA 1RA6A 1WSIA 4Z0UA 1NJZA 1C1BA 3AO2A 3SI8A 1OS5A 3MEGA 2XY8A 2Z1IA 4HVJA 1RT4B 2HHWA 4ED6A 3QIPB 1LWFA 4ID5A 3KD1E 3V1QA 1BGXT 4RW8B 4IG0A 3H59A 1S0MA 3L3VA 4CJFA 4OPJA 4K8XA 3HP9A 3V4IB 4NLSA 4DU4A 4NLDA 4FJMA 3SQ0A 3CFPA 4OKKA 1XI1A 4QAGA 1DTTB 2OPRA 3DRRA 1RTDA 4PQUB 2BE2B 3NGZA 2UVWA 1XWLA 3I0SB 3ZSOA 4YMEA 1JLFA 4E89A 3SPZA 1SL0A 2FVRA 4E7LA 4E7KA 3ZSVA 1HYSA 3VA0A 2WCXA 4DTNA 3E51A 3CYMA 4PWDB 3N6LA 1ZBLA 1JLGA 2R2UA 2YNGA 5JS1A 4PY5A 3MEDB 1XHZA 4HUGA 2OPSB 1JLAA 4DTUA 4CK2A 4FZXC 3DLBA 4DMNA 1RT2A 2QKKA 3DYAB 3GV8B 2R8JA 3RR7A 2R8KA 3ZSQA 1VSDA 3I5CA 1S49A 4CK1A 2E6LA 5KFAA 2IA6A 3K5NA 1QAJA 4IR9A 1RTHA 3V9UA 2WONB 1S1XB 1SL1A 1IKYB 3KLHA 1CLQA 2O4IA 3NH0A 4CEEA 4MH8A 3SI6A 1KLMB 3QIOA 1HJRA 3KLFA 3RMCA 3SUNA 4IRDA 3GIMA 1UWBA 4O3SA 4J9NA 4CHZA 5KFCA 1REVA 3PR4A 2JEJA 3S3OA 3RB4A 2ALZA 4K4UA 3JSMB 4PWDA 1X1PA 1W0HA 1T03B 3TVKA 3DOLA 2B5JA 5L1JA 3RRGA 1JXLA 5C24A 3M8QA 1TL3A 4DSIA 4U7CA 4Y3CA 5DG9A 4FS2A 4H4OA 1NK4A 4IH5A 1WAJA 4RW4A 4O0JA 4EP4A 4CGJA 1JL2A 2B6AA 1JIHA 5KFSA 4KFBA 3VQSA 2W8KA 3VA3A 4HUFA 3HHKA 3SV3A 4FM0A 1S10A 4DFKA 4GC7A 4H54A 1R0AB 4DG1A 2W9CB 3LP2B 2QK9A 5KFHA 3KHLA 4UQGA 1BQNA 4FXDA 2KQ2A 4M41A 4OLBA 1FKOB 4ECSA 3ITHB 1UA1A 4ZVFA 1HQEB 1QSSA 4WE1B 4DFMA 3B6PA 5DQGA 3L2RA 3DI6B 3TR8A 3KLGB 3T3FA 4H8KA 1RT6B 3BSCA 1JXEA 4CFAA 2KFZA 3RBEA 1RBSA 2FJVA 1I3AA 3NF7A 5KG7A 4NRUA 4IFYA 4URQU 3C6UB 4EP5A 2BRKA 1IKWA 3PJWA 3AVBA 3NF8A 1IO2A 3TAEA 4FBUA 5KFZA 4ICLA 3DLEA 3CWJA 3SPYA 2ILZA 2FLNA 3PW0A 3MXIA 3A2FA 1RT4A 2DY4A 3ZT2A 1C2PA 4EBCA 4B08A 3EZ5A 4CFDA 3ISND 2RKIB 5D3GA 4B9LA 4CIFA 3VQQA 4RW9A 3G86A 4WXOA 3P1GA 4CJQA 4AHUA 2FBXA 1NJWA 2JC1A 4E7JA 1KHWA 1RBTA 1TL1A 1L3TA 3I0SA 4DTOA 1S97A 2VG6A 4KPYA 2JEIA 3SQ2A 3T5JA 5F8GA 2OYQA 1G15A 4B9TA 1BHLA 4RW6B 3H2LA 1S9EB 1A5XA 4F2RA 3V6DB 3AA2A 4NYNA 3V6DA 5L1LA 1S5JA 1RAJA 4MIAA 3QIPA 2G8FA 2YNGB 5KFOA 4LY7A 4QWBA 5F8MA 3OYDA 4GC6A 3IG1B 3RAQA 1RA7A 3LAKA 4XPEA 2XCPA 3M9NB 5KTQA 3OS1A 5CYMA 3ZT3A 4C8LA 4Z4FA 2V9WA 1Q9XA 3NBPB 5HP1A 4KE5A 1S1VA 4CF1A 1EXQA 1DTTA 1FKPA 3FFIB 4ZPCA 1TKXB 4CJ4A 2PYJA 4DTPA 3HJFA 3KLVA 4MQ3A 1N6QA 3U6FA 2BQRA 2B4JA 4I9QA 4EO8A 1U47A 2C2EA 4FJ5A 4M45A 4RNMA 4CECA 3CJ4A 4N5SA 4LH4A 1TV6B 4K4VA 3LP0B 1DTQA 2OPQB 2YNIB 3CVKA 3M9OB 1C6VA 1YTAA 3O3FA 3KLIA 4JS5A 3KLIB 1RDRA 2NUBA 3NGYA 4C8OA 2HNZA 4Y2CA 2IM0A 1JLGB 1SV5A 3CFOA 1XR6A 4I2PB 3KLFB 4RNOA 3GYNA 3AVCA 4FJLA 1TKTA 3BDPA 3DOKA 5KG0A 4NCAA 4DQPA 4CJ5A 1D1UA 4ZP9A 2YKNB 5HLFA 3GIJA 3IAYA 2BANB 3VQEA 4IH6A 3CDWA 4OVLA 1U48A 4CCHA 3GIKA 4O0IA 2VA2A 1RBUA 2PYLA 3NH2A 1XC9A 3L2UA 4B8CA 2E6MA 4PQUA 4YR3A 2V4RA 4M3YA 1S9FA 5KFXA 3HXMA 3GIIA 1JLCB 2QXFA 4NLVA 1GX6A 3HL8A 3QINA 1KFSA 3DLHA 3ITHA 4DF8A 4CJ3A 4FJ9A 1TK0A 5F8LA 2B43A 1UWBB 3MEGB 4DSKA 3LDSA 3IN5A 3MR3A 2YNFA 2Z1JA 4FW2A 4FK0A 2ZE2B 2BQ3A 3AA4A 3KKRA 4F4YA 1WNSA 1WN7A 4N56A 4KHNA 3NAEA 5KT3A 3EPIA 3B6OA 2OPPA 5CZ1A 4OKEA 2RF2A 1JLEA 4PUOB 3C6UA 5L1IA 4BACA 4WZQA 4ECTA 3C94A 5K14B 2JC0A 3AVFA 3QZ7A 2XY6A 1C0MA 1RT5A 2AGOA 1HPZA 4C8NA 2Y1IA 5J2MB 5KFUA 3DMJB 4KTQA 1NJYA 4ECZA 5T14A 4NCGB 1VSMA 3C6TB 4OPKA 4DU3A 4QOZB 4BE1A 1VSHA 5J2PB 3PO4A 4CE9A 4CJKA 2EHGA 3DLRA 3AO1A 1HYVA 4CEDA 4QCLA 1ITGA 3DLEB 1BQMB 3S3NA 1MU2B 3HK2A 4JRPA 2UUTA 4CJSA 3IS9B 4WFZA 2P5GA 2ZD1B 1HQUB 1BCOA 4GMJB 3U3GA 4CESA 4ED8A 4FLUA 1D8YA 3Q8SB 3G0ZA 1VRUB 1C1CB 1ZTTA 5CYQA 1B9DA 5J1EA 2BE2A 4CEBA 1FKPB 3NHGA 4LQ9A 5KG2A 2Z1HA 4E0DA 4B3OB 1VSJA 1GOCA 4AHTA 3AVGA 4DL6A 1TL1B 4BWJA 4HYKA 5DG7A 1BIZA 1TAQA 3M8PA 1QE1A 3QGGA 2G8KA 1RDAA 3WNFA 5KG3A 3CDUA 3OYMA 3MEEB 5DQHA 1TV6A 4ED1A 5FDLA 2KTQA 3FQLA 4JLHA 4HTUA 2G8HA 4BDPA 1MMLA 3H98A 4MK9A 2A1SA 5I42A 1EP4B 4WYLA 2FVCA 4CGDA 1ZYQA 4ECUA 4H4MA 3AVIA 1C0UA 2VWJA 4R5PB 1HMVB 4FJJA 3NMAA 1XR7A 5CYMB 3BSNA 3G6XA 3QYYA 3AA5X 4CF8A 2HNYB 3QEWA 3PVXA 4DU1A 1BIUA 2BGGA 3BQ0A 1WSFA 3T5LA 4LSLA 1I6JA 5SWMA 4CIEA 3OY9A 4HUEA 2WHOA 1EETB 3VQCA 2DFEA 4Z4HA 4NLTA 4ED7A 4E7IA 5J2NA 2ITGA 5J2PA 2D5RA 4TXSA 1QSLA 4KV8A 1RT3A 1RT3B 2HWIA 1NOZA 1TGOA 1S4FA 1KTQA 1KCFA 3N6MA 5HROA 4IRCA 2J6TA 4EBDA 5EUHA 3HO1A 3F9KA 1NKEA 4CJEA 4ED3A 1S6PA 4CHQA 2Q3SA 2I5JB 3AVMA 2RPIA 1VRTA 5KFQA 4FLYA 2B6AB 5KFYA 5F9NA 4IQXA 3FSIA 4FLVA 2IC3B 3V6HA 4ID1A 4IG3A 4ZPAA 3CQ8A 2D0AA 4F4KA 3ULDA 4TYBA 3OHBA 2AU0A 4DL7A 2OA8A 5KFBA 3BGRB 1RT1B 2GV9A 3PW7A 2IS3A 4G3IA 1HQEA 1NK7A 3QLHB 3CJ0A 1ASVA 2HB5A 2QKBA 5KFRA 4RW6A 5KFNA 4K4TA 4NLRA 3SFUA 5C42B 4O4GB 4G1QB 1TKZB 1X9MA 3SUOA 1JLEB 1RCHA 5KFDA 3AVJA 3SJJA 3NBPA 2OPPB 4IFYB 2HWHA 2GIQA 1C1CA 3LPTA 2ZKUA 3VQ9A 3I5AA 4W5NA 3CFRA 4IKFA 3HPGA 4OL8A 3KLGA 3PX6A 4HHTA 1RT7B 4B9MA 1QUVA 4FS1A 1S48A 1LAWA 4TSXA 4O3RA 3AVKA 5JXSA 3AO5A 2P5OA 3P5JA 4KO0A 4KO0B 5KRTA 4MKBA 4F2SA 1JX4A 2HHSA 4TYAA 4RW7A 3QEVA 3MEEA 3GQCA 3H40A 1JKHA 4DG1B 2W9CA 4NLXA 2XGQA 1SUQA 3E01B 2YKMA 3KK2A 4Y1DA 3ZSZA 1JXBA 2YNHB 4CHNA 3DLGA 5KFGA 3HT3A 3KLEA 4BE0A 4FM1A 4NLQA 2I5JA 4IOBA 2JLEA 3OYLA 3ZSYA 4K8ZA 4R0EA 1N4LA 1HRHA 1VSKA 1SKSA 4RNFA 2BDPA 1ZBIA 4EYIB 3UIQA 2BANA 3M8QB 4CGFA 5KT6A 5EU7A 3MECB 2BR0A 4OGCA 4CF0A 3KOAA 2D3UA 2O4GA 1S9EA 2R8GA 1LV5A 3SCXA 1ZETA 3HVWA 4JV1A 3NF6A 3KK3B 1WSEA 3VQ8A 1NK6A 4NYZA 3LWLA 3AVNA 4MK8A 2IM1A 3D45A 3K5LA 4URGA 1C1BB 2R2RA 4KHWA 4DSLA 4NLGA 3V6JA 4QWAA 4ZMMA 4TQRA 5DMRA 3VQ6A 3NH1A 2D0CA 3DLKA 1LWEB 3OYKA 1UOCA 2YKNA 4Z4IA 2XGPA 1RT2B 1NHVA 4H4MB 3MR6A 4CFBA 3TWHA 3TI0A 5J1EB 4NLPA 3OL9A 4O3PA 2HNDA 3HKWA 3K58A 1WNEA 4OJRA 5F8NA 1BISA 2HVIA 2PY5A 2FLLA 1X9SA 1J5OA 4M3WA 3OYIA 2VA3A 2FBVA 4CEFA 3DRSB 1T05B 3QGIA 4ZTJA 4Q43A 3KJVA 5J2NB 2CJQA 5KT5A 1JLCA 4W5QA 3OL8A 2RN2A 2R2SA 2W7OA 3PV8A 4FZYA 3DLKB 1B92A 3CM5A 4B9NA 4ECYA 4F50A 3SQ1A 4EEYA 3F73A 4CF2A 4IR1A 2V0NA 1T8EA 4B3OA 3D5MA 4IFVA 3OYFA 1N5YB 2ZD1A 2F96A 2KW4A 3DRRB 4FZZA 1Z25A 4U6PA 2HW3A 4NCBA 4J9OA 1WLJA 4CHYA 2ASDA 2WTFA 4Q0BA 2WRMA 4TY9A 4XIUA 3QLHA 3QZ8A 1A5WA 3FRZA 4ELTA 4QW8A 4KV8B 2X74A 3LP3A 3NFAA 4GVMA 2I1RA 3MFHA 3V9ZA 3AO3A 4WZMA 3Q8PB 4AHCA 3NE6A 3PHEA 3H4DA 2XY7A 1T3NA 5KGWA 3OYJA 2OZSA 1N5YA 1N56A 2QE5A 3SUQA 4J9QA 4KSEB 2E4LA 2RF2B 3KMSA 2KZMA 2XHBA 4DF4A 3IS9A 2Z1GA 1TK8A 2DPJA 1VRUA 4I2PA 3TAGA 1SH2A 4RG8A 5KRSA 1HMVA 4J9KA 3HVRA 3TAQA 1NKCA 2X6SA 4ED0A 3LP1A 3H4BA 3OS2A 1NOYA 2FVPA 4ZP8A 1BL3A 4KKOA 4NCGA 3K5OA 4KB7A 1BQNB 4FK2A 4ECRA 1VSIA 3ZCMA 2XY5A 1VSEA 4O3OA 3GV5B 1T7PA 1RT5B 4J9MA 1C0TB 1D9DA 4Q8FA 3IGNA 4IBNA 1R0AA 1L3VA 3D28A 3I0RB 2IGIA 3V9SA 3WNEA 4AH9A 4RUAA 2YV0X 5KFLA 1WSHA 1LAVA 5KFWA 2IJNA 4O4GA 1BCMA 3LWMA 1RT6A 1S1VB 4EYHB 4CGGA 3NL0A 1T03A 1KHVA 1QSYA 1FK9A 1Z4UA 2B5JB 5HLFB 4NLUA 4LSNB 3KHHA 3DYAA 5C24B 4EZ9A 3TABA 4DWIA 1WSGA 4CHOA 2F8EX 4DLEA 1TQLA 3PR5B 2W9AA 1S1UB 2HMIB 4ZVGA 4K4SA 3LPUA 4LH5A 2EC0A 2OPQA 3PW4A 1KRPA 1S9GB 4IRKA 4K4ZA 3LP2A 2FVSA 3HP6A 3C6TA 2PZSA 4I9LA 3KKSA 3M8RA 1FKOA 4DS5A 3QEIA 1Y97A 1S1XA 3UDLA 4JV2A 3DMJA 3THVA 1WSJA 4IH7A 5KFVA 4O5BA 4DL5A 2JEGA 3LZIA 1VK0A 1S1WA 1TK5A 1S1WB 1Q9YA 4IFVB 2RDJA 1TKDA 2G8IA 5HRNA 3KLEB 4FLWA 3QEXA 4URSA 4G1QA 4ECWA 5KFEA 2A1RA 4ZPBA 4RUCA 4AHVA 3MEDA 3BR9A 3SV4A 3V4IA 4N41A 5KT4A 3DRSA 1T05A 1UAXA 4E3SA 2IDOA 1NK9A 3ZSXA 4TLRA 3M9MB 1ZBUA 1GOAA 1VSFA 2BQUA 2ATLA 1YTUA 5FRNA 5J2QB 4FLZA 1RDDA 1RTIB 1S1TA 3TAMA 5L9XA 3OYAA 3WNHA 3DM2A 5KFIA 3S9HA 4KBIA 1WAFA 1IKYA 4KREA 4Q8EA 1S6PB 3PX4A 3QGHA 1C0UB 5KT7A 3PW2A 2OH2A 4BDYA 4AILC 2AGPA 2KFNA 1TKTB 1TKZA 3RRHA 5KG6A 4PUOA 3BSAA 1J53A 3BJYA 3ASMA 4FW1A 2FVQA 2OPRB 4M3ZA 4FJIA 1LW2A 4FVMA 5F8IA 1K6YA 4RU9A 2RKIA 1TVRA 2FJXA 4Y34A 3G10A 1YT3A 1S9GA 3K59A 3NGIA 4CJUA 4CFCA 4F3OA 4FJGA 4CGIA 2WONA 2R7YA 3CG7A 4CEOA 1TP7A 5C25B 1SH0A 3M8SA 5SZTA 1QHTA 2DPIA 2XWYA 1HPZB 4TY8A 4NYFA 4KTWA 4PA1A 2VG5B 4W5OA 3H5UA 3O4NA 4FLXA 3PW5A 5DG8A 2IBKA 4DQSA 4QWEA 2FBYA 3Q8RB 3AVHA 4FM2A 3DOLB 1EP4A 4ZVEA 2DFHA 2YHAA 2D0BA 5EWGA 4R5PA 3KHGA 1MU2A 5DGAA 3DOKB 3T19A 2D7SA 1S1UA 2WOMA 1JLQB 3QEPA 4QW9A 1HNVB 5KFFA 1O1WA 2X6NA 4ELVA 2FLPA 3MECA 1RT1A 3OHAA 3HPHA 3TAFA 2AX1A 3QNOA 3SZ2A 4IG3B 4KAZA 5CY4A 1IG9A 1KVAA 4CK3A 1S0OA 4DTRA 1B9FA 3NGDA 3RTVA 2IJFA 1IKXA 4DSFA 3NF9A 4X2BA 3KD5E 4NZ0A 2UVRA 3H5XA 2ETJA 3ISNC 4J2EA 3L3UA 3OVNA 1NK8A 3SQ4A 4Z4EA 1LW0A 1TL3B 4RW9B 4FCYA 4ID5B 2GIRA 4EZ6A 5FROA 2AJQA 3TARA 3MXJA 2WK4A 3D0PA 3NDKA 4YP3A 3KK3A 3L8BA 3RMAA 1S0NA 1DTQB 2YNIA 3LP1B 4NLWA 4RZRA 3H5YA 2OZMA 3I5BA 4ICLB 4KAIA 3MAQA 1JLFB 4RW4B 2F8TA 3O3HA 4O55A 4YR0A 2ATQA 1RTIA 1S1TB 3HM9A 1KVCA 5CYQB 1F21A 1LWEA 5DLGA 4WFXA 3OLBA 3VQBA 4K4XA 4M94A 4B8AB 3BQ2A 3OLAA 3MR5A 3NKYA 2BRLA 5DK5A 4CGHA 1L3UA 3QESA 4I7FA 2UVUA 4ZVHA 4ZTFA 1U4BA 4BDZA 4R8UA 1CZ9A 3L2WA 4NLOA 2HHTA 3KJVB 4YFUA 3UR0A 1D5AA 4QWCA 3TQ1A 3OYCA 4Q44A 1K1QA 3QO9B 3P83D 3V9XA 4OLAA 3DDKA 4DTMA 1LWCB 4E1NA 2UVVA 1N6QB 1S6QA 3RB6A 5HBMB 3PZPA 4J9LA 2JGUA 4M3UA 4J9RA 1U45A 3ALYA 3PJXA 3SNNA 3HPOA 3TAMB 4FYDA 5D3GB 1ASUA 4OGEA 5E41A 5C5JA 4IDKB 4W5TA 4RW8A 3DRPA 3MFIA 3V81B 4YR2A 4KTZA 2IM3A 4DL3A 4HKQA 1KVBA 3AVAA 4DFPA 4W5RA 1L5UA 3QERA 3TANA 3OJUA 3NAIA 4KI6A 4DQIA 3AO4A 3GV7B 1TVRB 4NLYA 4ECVA 3SFGA 2J6UA 4OKJA 3EZUA 4KHQA 4I2QA 5JS2A 4KHUA 5HRSA 5I3UA 5KI6A 1DLOB 3MTKA 2D41A 1QAIA 3EY1A 2YNFB 4CEAA 4BE2A 4FJ7A 2C22A 2ZE2A 4L8RB 4CEZA 3PO5A 5KG1A 2ZQBA 4CIGA 4JUZA 5DLFA 1QS4A 4J2AA 1JLAB 3RR8A 4M42A 1JLQA 2G8UA 4FJKA 4LSNA 2AQ4A 2XO7A 4Q0BB 2AX0A 3BGRA 3KLHB 4KHRA 2FBTA 4ZP7A 1L3SA 3K2PA 1KLMA 3BREA 4YQWA 1RDBA 3AA3A 3VQ4A 1DLOA 4ZHRB 3O4QA 1IKXB 2VG5A 3RMDA 3TAPA 3MR2A 4O3NA 4XO0A 3KMQA 3RMBA 3CDEA 1NK0A 5HRRA 3T5HA 3NCIA 1BI4B 1C0TA 4DSEA 3LZJA 5HRPA 1NHUA 1QQCA 3OYEA 3KHRA 4KRFA 2G8WA 2D3ZA 4IKAA 4K4YA 5HROB 4ZPDA 3G6VA 2HNZB 1RDCA 2VG7A 4R8UB 4AHRA 3OSNA 4KHYA 4FLTA 4MFBB 3AVLA 4FJNA 4N76A 4B9SA 3BSOA 3V6KA 4MKAA 4DTXA 3PY8A 1CZBA 4DQRA 1KFDA 3FFIA 3V1OA 2W9BA 3KTQA 2ILYA 1IM4A 2RDIA 1ZBFA 4Y2AA 2HNDB 1BI4A 3KK1B 3KK1A 3QNNA 4ZP6A 3T1AA 1UA0A 1Z26A 1S6QB 2CKWA 3FDSA 4B9UA 1KSPA 5JUMA 3VQPA 2G8VA 4HCBA 2HHXA 4Q45A 4RNHA 3CJ2A 4J2DA 4DQQA 1JLBB 4KHMA 1SUQB 3E01A 3IGVA 5KFJA 2KZZA 3OS0A 3UQSA 4K4WA 4WE1A 1IKVB 5CZ2A 4Q5VA 3I8DA 1CSJA 1X9WA 4IG0B 3DRPB 2VG7B 1LW0B 2XI3A 1RT7A 2LSNA 4MFBA 5KT2A 2VG6B 5KFPA 3LP0A 4XPCA 1EX4A 3OYBA 1XHXA 4MK7A 4FJXA 3HSTB 1QE1B 3RBDA 1RYRA 4FJ8A 1JL1A 4CJVA 3HVTA 4EBEA 2IAJA 4Z4CA 2QV6A 4CF9A 2VWKA 1NKBA 5I42B 4QPXA 4E7HA 2E9RX 4HCCA 4F4WA 4DTSA 4AHSA 4ECQA 2FJWA 1HYZA 1ZTWA 1IH7A 2AGQA 1GOBA 4DL4A 4N47A 3L2VA 4KKOB 3O3GA 1FK9B 2FC0A 3EPGA 4LSLB 1TAUA 1ZBHA 5EWEA 3OJSA 4JV0A 4B9VA 1LW2B 3VQDA 3N6NA 1D9FA 1VRTB 4F8RA 4LQ3A 4KFBB 3CIZA 5J2MA 3SUPA 3FQKA 2W7PA 1RBVA 4M3TA 3SYZA 4ECXA 2HHVA 5F8JA 2JEFA 4DLGA 3ICLA 3IRXB 3OL7A 2YKMB 4KI4A 1NNDA 3BQ1A 3DLGB 4EO6A 2HHQA 5C42A 4J2BA 4QWDA 5FDLB 3CJ3A 1KLNA 1N48A 2IMWP 1U09A 1VSLA 4M3RA 1CXUA 3VQAA 4DL2A 4FBTA 2OPSA 3GILA 3VQ7A 3OYNA 1A5VA 4K50A 3ZT1A 4IDKA 3V1RA 1CXQA 5KFMA 2V4QA 2HMIA 5EDWA 1FXXA 2F8SA 2C2DA 4CERA 3MXMA 4F4XA 3V81A 1J5OB 4C8MA 2E9ZA 4DTJA 2HNYA 1EETA 3PUFA 1HYSB 1RBRA 3M8PB
chains in the Genus database with same CATH superfamily
3D2EA 1IQZA 4E98A 3K57A 3AQPA 2DIVA 5D4PA 1O6XA 2C28A 2LVWA 3MM7A 3CC2N 4DV7K 3JYTA 3JYTB 4HVZA 4HHHA 1JKHB 4O4RA 3AOCA 3POTB 1SJ1A 5L1KA 1MLAA 5C25A 4O3QA 4I2QB 5B0DA 1RP5A 3M8YA 1FX2A 1M5VC 1SKWA 3D9BA 1EHWA 1SV5B 4NXNJ 4UOGA 4QIEA 2KYXA 3HCXA 2YJFA 3L6QA 4JRQA 3CCLN 2HBZB 4OYXA 2HS0A 4LD0A 1Y7PA 1YVUA 2N7YA 4NI2B 2QZ8A 1WDDA 2FHMA 3AV9A 4BRMA 1T9YA 1Q86O 2Y1JA 5FD1A 4LMZA 2C3OA 2A42A 4ZHRA 3GG1A 4RNNA 5LJVA 2W8LA 2O8DA 3FCVA 4PG7A 3ENQA 3WNGA 2LECA 5BXIA 5AQMA 3VEZA 3QETA 3ADAC 4CJTA 4CJWA 4GMKA 2UXCF 4ZCKA 4FYYB 3MMAB 4M8LA 3CCTA 3G87A 3OL6A 2IOCA 2AT1B 3RAXA 2QWPA 4A8KA 2C3YA 5FPNA 2JH3A 2IC3A 2UYTA 1W2BR 2P1JA 4X62J 1RWXB 1HW9A 3LANA 3U8XA 1T9TA 4GW6A 4AQYJ 4LR7A 1D4XA 1YVFA 2H4WB 2A2DA 3QIDA 3T9NA 4WBFA 3PEHA 3Q8QB 2VOOA 2XLJA 3N4PA 3G96A 2X3GA 5KGXA 3QBCA 3K5MA 2NXUA 1VQ6N 1F9EB 3JSMA 4ISGA 4MJKA 2NREA 1G99A 1X9JA 4CJPA 2OMLA 2HVHA 2UU9F 4G6VB 1KBRA 2D9PA 5F8HA 3CDAA 4KB0A 4FPIA 5I3PA 5HJXA 1HKCA 3ZX0A 4IQMA 4X4UA 1PSDA 1SJ4P 3HT0A 4J9SA 2J6SA 5K14A 3CE8A 5KG5A 1VC0A 2C3UA 1WSIA 4LT6A 4DV6F 1FJGF 4EMDA 4DR5K 3T1YK 4KHPK 2DNQA 1I3OB 1OS5A 2Q97A 4YB1P 3MEGA 3PFEA 1FO1A 2HMPA 2W7AA 2HBYB 1LWFA 3VTHA 3R1HA 1J5EF 3KD1E 3V1QA 2MKJA 1KD1T 3H59A 4J9VA 1Y9OA 3KFWX 4NLSA 4BRAA 1YITN 3CFPA 3M32A 3DXBA 4GVBB 4ZOSA 1FHTA 2OPRA 4PQUB 3L9ZA 1TYQA 2VPXB 3U1LA 2DNRA 2UVWA 2EFPA 1XWLA 3QDKA 1R31A 1V5VA 2ZHOA 4BCAA 2FVRA 2ADCA 3ZSVA 1BLUA 3VA0A 5AZJA 1UPMB 4DTNA 3E51A 5D78A 4FKYA 4FF2A 4YY3K 4P75A 1VQYA 4A8YA 1IBCB 4PWDB 1M5SA 1ZBLA 1JLGA 4OI3A 4TLQA 3H0PA 2YY3A 3MEDB 2E7VA 4CK2A 1PC4A 4E8UA 3DLBA 4J5OA 1TUUA 4DMNA 2QKKA 3GV8B 2AYMA 4C6AA 1CS4B 1VQ8S 1R59O 2N82B 1V6HA 2YHWA 3U27A 1CJKB 5ADXA 4NPOA 1H6KX 1YGYA 1S49A 4DV7J 3BBFA 1JWWA 3N28A 4A61A 1NH8A 2GGPB 3PACA 4N8NA 5AQWA 4IR9A 1S1XB 2O4IA 1TUVA 1SAZA 3CCUS 4EHTA 1KLMB 3CC4N 3KLFA 3ENAA 3GE9A 3CD0A 2VDIA 1UWBA 2GQQA 2PBDA 4CHZA 3S3OA 5KFCA 2Y3YA 3RB4A 2ALZA 3TVZA 1X1PA 2JSXA 3M6UA 2BKPA 1W0HA 2CPJA 5A2QO 2A6MA 3VAJA 3ZLJA 5D4LA 1QVGM 2V9KA 1YJNS 2J9CA 2V2VA 4OV1A 5MAOA 4H4OA 4RW4A 3G25A 5KFSA 3E3XA 3VQSA 4JOUA 4WKYA 4ILMA 2DT9A 4F7VA 4FM0A 1S10A 3BN7A 3FNNA 4GC7A 3A8EA 4DG1A 2KVQE 2QK9A 3BZKA 4DR3K 5KFHA 4A5BA 1D09B 1BQNA 4FXDA 2N3LA 4OLBA 4ECSA 5ETOA 2H51B 2XMWA 3JTNA 1UA1A 4ZVFA 3O44A 1BY9A 1U2CA 4PKIA 4NI2A 1QSSA 4WE1B 1DJ0A 2HGLA 2RIJA 2O8BA 1UFLA 2W2OP 2PO4A 3TR8A 3KLGB 1RT6B 2UXDK 4FYWB 2K1RA 4CFAA 4C23A 4CZHA 1I3AA 3J7YP 2ZHBA 3SSSA 3NF7A 4URQU 2HLTA 3UNGC 3ELHA 3WT0A 2GELA 4OI4A 1PCAA 1C4CA 1UKUA 1VIOA 3EGVA 2NXEA 3PEJA 2QXLA 3AVBA 2HBQB 1LXNA 3ZNUA 2PC6A 3NF8A 2GVZB 4MKYA 3TAEA 3CMQA 1GLEG 2M8DB 3DDIA 2FLNA 3PW0A 3MXIA 3HM8A 3UCUP 5L46A 3ZT2A 4GKJJ 2VBWA 4EBCA 5HQMA 2K7JA 3EZ5A 1VDHA 5GAGU 2B0GA 3QQCD 5BR8K 2W2MP 2UUBJ 3R6MA 4OYAA 2VFUA 4B9LA 4CIFA 4DX7A 5LMNF 3LGNA 1NJWA 1KOHA 2ZGYA 1TL1A 4DOZA 3OXGA 4BRDA 5JLHA 1S97A 2XS2A 4ZN3A 2JEIA 2D4WA 1YBAA 3BZQA 3SQ2A 2OYQA 1BHLA 4OLOA 5GIPA 4RW6B 4B3RJ 2WUSA 2ZBPA 4FO0A 2R42A 2W6LA 4F2RA 1A5XA 4DJBA 4A48A 3V6DB 4NYNA 4P74A 1IBLK 1H7WA 1S5JA 4USTA 1RAJA 3QIPA 4IEIA 3SMSA 2Q79A 2M52A 3EXCX 1RU1A 3OYDA 1MWQA 1DT9A 4GO5X 5H9EJ 1RA7A 4U7UD 3P6YC 2RRNA 3M9NB 3VEVA 3PCOB 1QJHA 4Z4FA 5GIOA 1Q9XA 3NBPB 1S1VA 4LF6K 1EXQA 1FXLA 1K0VA 1TU0B 2Y8YA 1FKPA 5D77A 4CLTA 4DTPA 3KLVA 1N6QA 2MKSA 1YJVA 3OT9A 3UE2A 2B4JA 4I9QA 1RLCL 4OZLA 3BB5A 4RNMA 4CECA 3CJ4A 3B6BA 4N5SA 2CGLA 3D2WA 2FJBB 3O3FA 2FC8A 3CVKA 1C6VA 4U95A 1Y5NB 2I6WA 1RDRA 3NGYA 2IM0A 2DO0A 3NNHA 1RUSA 3RG6A 1XR6A 3VEYA 3IMQJ 4I2PB 3KLFB 4FJLA 2P9NB 4DHVA 4ZP9A 2YKNB 4HDHA 1WSRA 3IAYA 2BANB 1U48A 2VJUA 5LM7E 2FHOB 1YRUA 1HD0A 4TVAB 4WFAL 4JI7F 1WKKA 3H42A 3MCMA 3NH2A 2E6MA 3EWGA 4YR3A 4ISEA 1HWLA 4Z7CA 2VWBA 1JLCB 1UEKA 3TP2A 4NLVA 4RBVA 1KFSA 3HL8A 1NM2A 3GFYA 1PC5A 1EQ0A 2FF3B 4DF8A 4FJ9A 2B43A 5B7WA 4NYOA 4JI7J 3LDSA 3NWRA 1OH5A 2YNFA 3BGOP 2KI2A 5L38A 2ZE2B 2BQ3A 4DV3F 3KKRA 1OKJA 1Y5IB 5B08A 4KHNA 2RS2A 1CPZA 5KT3A 3EPIA 3TTFA 2OPPA 5CZ1A 1Z05A 3PIOQ 2BJ3A 4UY8T 2ZEJA 1RJJA 2Z56B 4C1NK 1RT5A 3UKUA 2HQDA 1HPZA 4DR4F 1FD8A 2EG2A 2HHPA 2F7VA 4KTQA 2CZVC 1NJYA 4YHHK 4ECZA 1BWEA 5AFUH 3C6TB 4OPKA 5CAAA 1VSHA 5J2PB 4CE9A 5C2GA 2WSFC 1HYVA 5EGYA 4GO7X 3DLEB 3FRYA 2CQ3A 4XDCA 1MU2B 3S3NA 3G6EN 5F0WA 3CCQN 3CMAN 2BW7A 4WFZA 2HBLA 1HQUB 1D8YA 4GMJB 2L3MA 3Q8SB 2O8CA 1C1CB 1FF2A 1SKUB 3T1HF 3Q7BA 3NHGA 1VQLS 4GKKF 3N5BA 3HHLC 1T95A 1PJ5A 2R7VA 1BIZA 1SJQA 1K8AO 2CH6A 4BROA 3WNFA 3F56A 5GADI 2FB0A 1NGEA 4KIAA 4ED1A 1OY9A 4B1UB 2YKOA 5AE3A 4YS2A 2V8DA 1FRIA 4L76A 4CGDA 4PEOA 4ECUA 3TZWA 1QUPA 1HMVB 2VFTA 1R8BA 2OSRA 1ULRA 3BSNA 3G6XA 2C3MA 3AA5X 1YBUA 3THPA 3PVXA 2LA6A 4CDIA 1P90A 2V4JB 1I6JA 4GKJF 1KVKA 5D8HB 2VL1A 3OFFA 3VGSA 4W98A 4JI4F 2WHOA 4A8MP 4ED7A 4J8FA 4E7IA 2DVIA 5J2PA 2D5RA 2RD5C 1QSLA 3ZETA 4TKTA 5K8OA 3CJ8A 2CNKB 2HWIA 3BH6B 5JMVA 3EE9A 3CC2S 7AT1B 1KCFA 2KU7A 3E9LA 1X5SA 5EUHA 3F9KA 1NKEA 1LEOA 1X31C 5MLCV 2FSJA 1S6PA 2GWKA 1IV0A 2JVRA 3AVMA 2B6AB 1N36K 2GMHA 1WACA 3ULHA 2OFHX 3VVUA 2PFDA 4YOXA 4TYBA 2AU0A 3AB4B 4F02A 1YIJS 2P2CB 1HQEA 3I87A 1RTZA 2MKHA 2J5AA 1ASVA 2QKBA 4RW6A 5HMZA 1HBUB 2PFUA 1NMEB 3GZ7A 5LXYA 1IWAA 1BA0A 1PJ7A 5BYRA 2ZBQA 1LXJA 2MEWA 1U0SA 3I5AA 1AUDA 4W5NA 1Q79A 3CFRA 3TEHB 1CC7A 5GAHU 4IKFA 2DKOB 4OL8A 4LJMA 1B4SA 1S48A 1WD6A 3L7PA 1IBMK 1LAWA 1FDNA 2P5OA 3P5JA 4KO0A 1EAYC 4KO0B 4MKBA 4LFBF 4F2SA 1JX4A 2HHSA 5E26A 2QA4N 4RW7A 3MDFA 2WVDA 2ZUAA 3CIPA 2RE2A 2GVZA 2C2ZB 3E01B 2YKMA 3KK2A 4Y1DA 3D6RA 4B3MJ 3ENWA 1WEZA 4LF2A 3HT3A 4BE0A 3I56N 4NLQA 4IOBA 2JLEA 2RQMA 4K8ZA 2W40A 1M1HA 3AFGA 2MHNA 3H2VE 4H5RA 1G3OA 1ZBIA 1X0PA 1VHFA 1WI6A 1IBMF 3M30B 3EUNA 4QOTA 3GJQB 1LQ9A 3WZ0A 1T6CA 3MECB 3IO1A 4OGCA 3C14A 3CQYA 1DKGD 2LKZA 1S9EA 4JI6K 2WZ1A 4WFBQ 4MK8A 2QW9A 2V69A 3MURP 3KNGA 3K5LA 3SQOP 1C1BB 4MKVA 2R2RA 4FYVB 2LDIA 3GOIA 3CCVN 3E9PA 4TQRA 5DMRA 3VQ6A 4LF9K 5BPMA 4BRNA 3E9OA 1NHVA 4H4MB 1U6FA 3C46A 3MR6A 3TI0A 4CFBA 3IFEA 4NLPA 3W9HA 2E1ZA 3TJ8A 1Q5YA 4PXEA 1O8BA 1S72S 3GJSB 1Y00A 2VA3A 1VHXA 1WB9A 4DV2F 1HI1A 2FJDB 1IBKJ 1WC3A 4DPOA 3A5NC 4W5QA 4HT5A 2QIFA 2AYGA 2ZDPA 1VYAA 4ANEA 1Q7LB 3D2FA 4JK8A 3HHEA 2CZ9A 3F73A 3IA0A 2X7IA 1T8EA 4K41A 2FY1A 4IFVA 2ZD1A 2F96A 2UV8G 2KHCA 3R7SB 1E6YA 4HTJA 1UJ4A 3DOMB 1YI2N 3EJMA 3ZZTA 4IO8A 1ZZNA 2ASDA 5A8WB 4TY9A 3QLHA 4ELTA 4KV8B 3NGUA 2MQLA 4ZJLA 5HJYA 2P9GA 1KAYA 4P52A 3NFAA 4GVMA 2DD8S 3V9ZA 1HR0F 3AO3A 4WZMA 3NE6A 3PHEA 2Q6BA 4EUVA 1T3NA 3H20A 3MM7B 3K8VA 2IRUA 2QLFB 3C7NB 1URNA 1YG0A 1LOUA 2E1AA 1OVYA 4ZN1A 2P9LB 4I2PA 2H1YA 3MM6A 2CQ1A 4BC9A 4CZFA 4Y2MA 3ILLA 3CI5A 4DU8A 3TAQA 4ILRA 2JNJA 1WHVA 3LM2A 3PYFA 3R5DA 3UN5A 3CCSS 3OR1B 3FJ2A 4FK2A 3FGVA 4ECRA 2LQ5A 2CJKA 3Q23A 1BUPA 1RT5B 3UKUB 4J9MA 2E1YA 5FIIA 3OVSA 4B3SJ 3BDEA 3ILIA 3J80U 3I0RB 2IGIA 3WIUA 4JI3J 5EHHA 1BO5O 1WSHA 5AQVA 4CWBA 2DH7A 2LLZA 5CCLA 4CIOA 3ETOA 5KFWA 2YWKA 4Q2MA 2EBGA 4O4GA 1GK8A 4BY9C 3G82B 1S1VB 4EYHB 4CGGA 3PNIA 2HQCA 1KHVA 3KVGA 4CNZA 4NLUA 4DWIA 1WSGA 4CHOA 4OV6A 2F8EX 4DLEA 1ZOTA 1RU2A 5A8KB 1S1UB 4ZVGA 4K4SA 4DN0A 3LPUA 1S9GB 3ILOA 4USKA 1ZZFA 4K4ZA 3LP2A 2J0XA 2PZSA 3KKSA 1WBBA 1FKOA 1Y97A 1RZMA 4JV2A 3MHYA 3DMJA 3LDNA 4IH7A 2E1RA 4I68A 2NYIA 3LZIA 1ZPWX 1VK0A 3C16B 3FZHA 1SBRA 1S1WA 4ZPTR 2O8FA 3G71S 1TKDA 2E66A 5HRNA 1VQPN 4URSA 1RKIA 2RQCA 3MX5A 4G1QA 3CCEN 5D0RA 4ZPBA 3VF2A 4CW7B 1W7AA 4B9QA 1NLKL 2E2OA 4PKDB 3SV4A 2GW8A 3P31A 5LMUF 1T05A 4ZA1A 4C2MA 1S79A 3T6JA 4DL0C 3L3CA 1SZ2A 3M9MB 3TSPA 2ATLA 4YOEA 3TWZA 5AZIA 3G2XA 3HD1A 3I32A 5F0XA 1RTIB 4IFEA 4OQJA 4UUXA 4V1Ak 5KFIA 1IKYA 4Q8EA 2WTUA 5IC6B 1C0UB 3W8PA 3PW2A 1FXRA 1FNMA 4L6V3 2CJXB 2AGPA 1ZA2B 3BSAA 1J53A 2FVQA 4M3ZA 1P27B 4I67A 4RU9A 3TX8A 3VAMA 4G65A 1WELA 3G9CA 2RH3A 5C2CA 4LFBK 2E8AA 3NGIA 4F4AA 4BLGA 4F3OA 3DGPA 2PMZD 3W5YA 4IO9L 5D4OA 5IQ6A 3CG7A 5IT9Y 1F5CA 5C25B 3OTEA 4A62A 2HEKA 3H3NO 3QSYB 1M1GA 2W6KA 1Z2LA 4KTWA 2LU1A 4OHYA 2VG5B 3LDPA 1NPRA 3FZ2A 5L8RC 2VBYA 1SJRA 1XMOJ 4NASA 4DQSA 4LBIA 3MX2A 4QWEA 1EQMA 2V67A 5CXTA 5BRDA 2NUUG 2ITMA 2EC2A 2UUBF 1NPKA 2COLA 2GJIA 3FR0A 5DGAA 4FXWA 1V3ZA 4M63A 3T19A 3A3NB 4XH1A 1N33J 2WOMA 1JLQB 3QFHA 1NSPA 1HNVB 1XEZA 2I7PA 2JJ4D 3MECA 1RT1A 4B02A 4XTTA 4FVCA 2AX1A 3BPDA 3F0NA 3VERA 4HACB 3QNOA 3KDNA 2HRTA 4USJC 1T02A 1K9MT 4KAZA 5CY4A 1IG9A 5A0YA 2CNNB 3D1QA 2IJFA 3KUHA 1CBKA 4CBXA 4NZ0A 4OHZA 2WVEA 4QYZK 2W2PP 1LOTB 4BRKA 3SQ4A 1FVQA 1Q8KA 1TL3B 1Y0HA 4RW9B 1B0PA 4ZS6A 2VQFK 1LFWA 2D1KA 1NDKA 3O08A 2O67A 4KT0C 4OIXA 3NDKA 2Z4PA 4CZCA 3Q8YA 2WC9A 4XDDA 1VQ7N 1DTQB 2E20A 5HVGA 3JXUA 5I3QA 3I5BA 2V50A 4KAIA 2BE7D 4RW4B 1IR0A 3ZTRA 3O3HA 3ZXWA 4CLPA 3FCHA 4YR0A 3SAHA 4X4PA 1S1TB 1X4HA 1JMTA 3R5JB 2EVZA 5LJ5Y 3AAQA 1F21A 4JI7K 4J91A 3VQBA 1DHMA 3L4IA 2NRRA 2O8CB 4P6QA 3OLAA 1X4GA 2MJNA 4CGHA 2QLXA 3MOZA 2UVUA 3FBCA 4BDZA 4AFFA 3L2WA 2EKYA 1OSCA 2HHTA 3D0HE 5AXLA 3KJVB 3OBIA 5A2QY 3OYCA 1LK5A 2E7WA 4Q44A 2ZJRQ 3J81Y 2GNKA 4WP3A 4DTMA 3CCLS 3M2UA 1CVJA 5KOXA 4E1NA 2RE1A 3CC4S 1JJHA 2E2PA 4M3UA 1PYTA 3W2WA 1UW4A 5TKYA 5E3CA 1HLUA 1U45A 1KS2A 2L48A 1LNQA 1CJVB 2B8PA 1RLDA 3HPOA 1XMQK 2AZ3A 5D3GB 5E41A 1K73O 5C5JA 4IDKB 1VQMS 5A8RA 4W5TA 1S12A 1YJWS 2XZWA 4QU7A 4RW8A 4OPHA 4YR2A 4U8VA 4KTZA 4DL3A 3QSIA 3QJLA 2CQ2A 4I6YA 5C15A 1S7IA 1BHNA 4M5GA 4K5SA 4TU8A 2V7ZA 2Y1LB 1NLVA 4ECVA 4BQLA 1B0TA 3SFGA 1ATRA 1SQFA 3EZUA 3KUEA 5CHCB 2HIYA 1HIYA 4FPRA 2DNOA 6FD1A 1P1LA 2YH1A 3VGKA 5I3UA 4HWIA 1K9MO 3J81j 2ZH3A 4FYXB 2D41A 4HTIA 1NGCA 3CCES 1QAIA 2R7OA 4CEAA 4S0MA 5C2FA 1HBNA 4BE2A 4TU7A 1M90O 3AHPA 1SCJB 4CEZA 1NB2A 1XJWB 2ZQBA 2GFFA 1Q7YO 5LL6Z 3GSDA 5AQYA 2DXFA 4PG8A 4FJKA 2UXBJ 2QGFB 1O13A 2M0GB 4HT7A 3KG1A 3UFCX 2C2OB 2HF3A 2P9SA 4OI0A 2RQ4A 4ZP7A 1L3SA 1RISA 3BREA 3LUYA 1DLOA 4ZHRB 1HNWK 2KB2A 3VEWA 1YITS 2K3KA 2EG1A 4XO0A 1RHRB 1BI4B 3BBBA 4QIWD 3LZJA 1QQCA 5LOQA 3NGRA 3BO3A 2D3ZA 1YIJN 3G6VA 4O5FA 1S57A 3HHLB 2VG7A 4R8UB 4N77A 4MFBB 4N76A 2F65A 2CQGA 1VIXA 1J6ZA 4BG9A 3BSOA 4DTXA 3C19A 2VQFJ 3CULA 1CZBA 3AA8A 2IVMA 2UUCK 3ZZ0A 3D67A 3FEYB 1ZBFA 4Y2AA 3KK1B 1MWKA 2LFVA 3KK1A 3QNNA 3UCZP 1I5OB 4PYDA 4AQYF 1UA0A 3ZYYX 4PR6A 2MGZA 3VQPA 4HCBA 2HHXA 4Q45A 4RNHA 1VQKS 2Q0RA 5BN9A 3CPWR 4L74A 4C3KA 1JXVA 4P7TA 2KZZA 3IGVA 1YF5L 2G2YA 4JI0J 3D1OA 4ZPVR 3LGHA 4WE1A 5EX5A 1ZAVA 3B54A 2IRYA 1CSJA 3DRPB 1RT7A 5THWA 2XMVA 4MFBA 3D0GE 3FZFA 5KT2A 1KC8O 1GXUA 2QWLA 2P9UA 1EX4A 4X65J 4FJXA 1E6YB 3HKZD 3RBDA 5GINA 4AXJA 4K25A 1OJ4A 4DBQA 2GX8A 2QSFA 2NPFA 4IOCL 4R0JA 1TL5A 5E33A 2IAJA 2VWKA 4DR1J 2SXLA 1NGIA 5I42B 3L7UA 4QPXA 4CLKA 4F4WA 3DXKB 1VK3A 4DCOB 3D3BJ 2FJWA 1IH7A 1KVIA 4LFBJ 4CZEA 4N47A 4ZKAA 3B82A 3BKFA 1FWPA 1FK9B 4PKGA 4CT8A 4LSLB 2V51B 4JV0A 1KXPA 2XYHB 4B9VA 3CJ9A 1LW2B 3N6NA 4YUDA 1D9FA 5CD4A 3QBXA 4KH1B 4FPAA 4KFBB 3QRRA 1EKRA 1U2RA 3VV2B 3DLLQ 3SUPA 3FQKA 2F4VJ 3MPUB 2V5HG 2HHVA 5F8JA 1H72C 3J7ZT 1BA1A 3BQ1A 2H3GX 2ZH4A 2HHQA 5GAEU 3CJ3A 3RSEB 2K06A 1IG8A 2P9EA 2GVDA 1BXNA 2E29A 2MB0B 3DKDA 3ZT1A 4IDKA 1CXQA 3TJ9A 4IJAA 4WFNL 2DNGA 5DETA 5KFMA 2HMIA 5EDWA 2F8SA 1QQOA 4WTOB 2H5EA 4A8FA 3SXLA 5H1SQ 1HYSB 3DHXA 1RHKB 4NXMJ 3IM8A 1S99A 3CJQA 3VN5A 2BJEA 1BE4A 1T9VA 4JI2J 2XS7A 1JCGA 1UMJA 2V2ZA 5AQNA 2VV5A 2CJAA 3KNAA 2NS1B 1SS6A 1GMWD 2VZ9A 2R8HA 4IOCQ 1NNEA 2C2RA 1HQUA 2CDRB 3IKMA 2BACA 1OH6A 4RW7B 5DQIA 4IOAL 1T9XA 4EGLA 2DTUA 3HSGA 1JCEA 2APOA 4KHSA 4UOFA 5KFKA 2V63A 4I7FB 2Y0SD 3B8AX 1MN9A 2OEMA 3PX0A 3MCSA 3R3LA 2OFGX 3EYZA 1TZ0A 2P9PA 1HARA 1XNRJ 4OFZA 2VOPA 3T5KA 4CEQA 2M9KA 2GUIA 4CJRA 1DZ5A 4DSJA 4FOEA 2VKZG 1XC3A 4M3XA 4WFYA 1RILA 4LRAA 3OYGA 3ZT4A 1BWVA 1W25A 3C15A 4OI6A 1LWCA 4UF4A 4ZVOB 2V8GA 1T9WA 3FK4A 2G9OA 5AQZA 1VBXA 2EX3A 2AF6A 4O44B 3H3OB 4M63C 1T0TV 2OO4A 3IG1A 5H9FK 1HBUA 4B3TJ 2F4FA 2R2TA 3TTDA 1IJJA 1LWFB 2P51A 3ENOA 3U9ZA 3JAMU 2DGWA 1VQ7S 1RNHA 2GC8A 3SCJE 4UOCA 3LALA 2HG4A 4ED2A 1NZ8A 2OANA 5BR8F 2IIHA 3A3OB 5LSRA 1SL2A 5IT9U 5DDQC 4J90A 1RYSA 4GKKK 1VQKN 3GG0A 3N0VA 1F6TA 2VYPA 2W9BB 4HTLA 4OYZA 3CJTA 4NLBA 1BQMA 3S3MA 1HNXJ 4WXWA 2GBZA 3CJ5A 2HAIA 2M5YA 4M95A 3RB0A 1CEZA 2XZTB 1YI2S 2AJ4A 1FERA 3NAHA 3J7YU 1HW8A 2W4PA 1HNVA 4H5VA 3WIVA 4U67L 4DR4J 4UOHA 5K5MA 2HHUA 4F3TA 4MAKA 2YWEA 4P2FA 4DZ6A 4Y1CA 4YNQA 3CNQP 3EGZA 2DNHA 1U0HA 5CABA 2FJAB 3AJ2A 1BU6O 3UPFA 3HFZB 4YDXA 3CM6A 4CZMA 1QM9A 1X4DA 4LVNP 1QZ6A 2P9IA 3BEGB 5IFMA 1C1BA 1ZPVA 2CAJA 2CVIA 4DR6F 3MWTA 2Y0BB 2V2KA 2Z1IA 4CH1A 5GVQA 2HHWA 3M3ZA 4ED6A 3CMEN 3QIPB 1RWVB 4F9OA 1DQ9A 1TFWA 4B1XB 4RW8B 4BGAA 2VBZA 1S0MA 3L3VA 5F3TA 4CJFA 4K8XA 3HP9A 2QWNA 4LRFA 4AM6A 3U1MA 3SQ0A 1JJCB 2KXFA 3M1VA 1RTDA 2V2QA 1N8RT 1RADB 3NGZA 3G6ES 3CJ7A 1K47A 3FMBA 7FD1A 1CS4A 1SL0A 3JQKA 3SDEB 1PYOB 2IIRA 4E7KA 1SB6A 1LK7A 2F8MA 5JVHL 4OZ3A 4CM2A 3TX0A 1Q78A 1DEJA 2CYYA 4DKWA 3ZZRA 2IA0A 2W01A 3CYMA 2J7WA 2ZJRL 3N6LA 5IM0B 3OW2R 3MR7A 5JS1A 3GR0A 1XHZA 4BBYA 4W92B 1RT2A 5L9NA 5DDOC 3DYAB 5GADP 2KH9A 2EW9A 3GONA 4CLYA 2R8JA 2GEMA 4I4BA 2MZQA 3ZSQA 3J81O 1QDUB 2PA8D 2MQMA 2E6LA 3WQUA 2ZJQL 4K0KF 2IA6A 3HZEA 1XMOF 1U2VB 2GS8A 1RWMB 4OZ5A 1B64A 3V9UA 3MM9B 4HI1A 4X64J 3SI6A 1WF2A 1U1RA 3IWXA 3QIOA 1HJRA 1QAXA 4GVLA 4O3SA 1REVA 3JSMB 2AIRB 3E8OA 3AD8C 3LTOA 2MQQA 3THXB 2J9EA 1KNZA 1NMNA 4L3KA 2DGTA 3OFGA 4Y3CA 1HD1A 3EMTA 1NK4A 4O0JA 4EP4A 1JL2A 5LMNJ 4KFBA 3KWIA 3RJMB 3BO4A 1HLWA 1UZHA 3HHKA 1JJ2M 3J7ZO 3SV3A 5AQHA 1U1NA 3WXIA 3VESA 2JDJA 1RKJA 3MN5A 2MQPA 3NY0A 4OYOA 4RUHA 5B09A 4DFMA 4IJNA 4USIA 5DQGA 3L2RA 3DI6B 1V5IB 2J8AA 2J0QD 5K20B 1ZH5A 3HBTA 4PG5A 3T3FA 5IT4A 3CCSN 3ZC4A 3IMXA 2VONA 2KFZA 5T41A 3SAGA 5KG7A 4NRUA 3N4QA 4LBPA 1E4FT 2FTRA 2DR9A 2BRKA 3PJWA 1CG2A 3O1WA 3S41A 3ZX3A 3WC0A 5KFZA 3DGPB 3QATA 3U9DA 2EWHA 3CWJA 2XMUA 1U25A 4JI4K 1WOQA 1IJFB 2ROPA 4I6WA 1GLFO 2G1HA 1S77D 3DN9A 3EKUA 3EGWB 3OHRA 1HQ2A 4PG4A 4EK2A 5D3GA 3VQQA 4LC9B 5DO2A 5HVHA 4TNOA 4DUZF 4A2AA 2HFSA 2FSKA 5AQRA 4AE5A 3FVYA 4UY8O 3M2UB 3T5JA 2KN4A 2K2PA 4B9TA 3FLCO 1IUJA 4CZLA 1YBTA 2IVFB 1O51A 1B3TA 2WW8A 3AAWB 3AA2A 2R9LA 1GAOA 4Y2KA 2R7UA 2QO3A 2ZM6F 2R4FA 2WBNA 5F8MA 4GC6A 2XMKA 1N32F 4F04B 2UXCK 2HURA 3LAKA 4XPEA 1SC1B 4RR5A 3LA0A 3OS1A 3HSZA 3RRKA 5CYMA 3ZT3A 3ZTSA 2V9WA 1Z1ZA 5HP1A 4I1TA 2IMOA 2E5LF 3RYLA 4P71A 4EWTA 2BX6A 1Z6RA 4CJ4A 4X4SA 3HJFA 4MQ3A 2FZCB 2BQRA 1C0FA 3W2VB 4LFCK 4FJ5A 3C6AA 4LH4A 4DCJB 2W25A 4K4VA 3LP0B 1JK9B 3PRVA 1DTQA 3TTCA 5A6WA 2L9DA 4Y2CA 3GTYX 1NHKL 3CFOA 3M2RB 3GB0A 4H0YB 3AVCA 4RNOA 5KQ8A 4DV1J 3EDRB 1BUXA 4JYAJ 1D1UA 1RBOB 3DC2A 5HLFA 3CXCR 3GIJA 3VQEA 4IH6A 5LL6d 2J9DE 1N5TA 3M4XA 3GIKA 4K8RA 5IQQA 4O0IA 1KP6A 2MKCA 4USHA 3ZZYA 4B8CA 4PQUA 1XNRF 4CTAA 1NDPA 1S9FA 3MD3A 1RGIA 3NMUA 3HXMA 2GJFA 4FWKA 1IBKF 2GAGC 4DV2J 2PN6A 3QINA 1VQMN 2YQ0A 3BP8A 3OFHA 5F8LA 1CC8A 1OH8A 3PJ9A 3D0IE 4FW2A 1HWUA 4WWSA 3CCZA 4F4YA 3DAWA 4N56A 1W26A 3CJAA 3NAEA 3B6OA 2O3DA 1S72N 3SMZA 4L72B 2CFXA 2RJZA 3C6UA 5LY3A 4ILJA 3C94A 5K14B 3CSKA 1GLJO 2ZDOA 4NXMK 3AVFA 1C0MA 5DDRC 3OXLA 4JI0K 5J2MB 3NOCA 1FX4A 2D9OA 3DGVA 4FDFA 5T14A 2M2BA 5ETKA 2MKIA 1OQ3A 4QOZB 4DV1F 3R5CA 3HHDA 2Y9HA 3DLRA 3R5AA 3AO1A 3K9JA 4BC5A 4LF4K 2DNPA 3W5ZA 1FJCA 2OHDA 4JRPA 3I96A 2UUTA 4CJSA 4RCHA 2P5GA 2ZD1B 2CQCA 3U3GA 5IXUA 4ED8A 3G0ZA 4CO5A 1VRUB 3JAMO 1B9DA 1A7GE 5J1EA 4CEBA 5KG2A 2LDYA 1RE1B 4NA3A 4LF6J 1GOCA 2NLWA 3AVGA 4DL6A 4BWJA 1VQPS 4M5NA 4HEA9 1J2VA 1TAQA 2O1PA 3ZTPA 3GL1A 1RDAA 2FGOA 4JD2B 3BM7A 2A6OA 3MEEB 5DQHA 1TV6A 1FTRA 4PABA 2KTQA 4HTUA 2G8HA 5F1XA 1MMLA 4C48A 2AYEA 2QWQA 2C2MB 3P4IA 1EP4B 1UFWA 1G6BA 2FVCA 4H4MA 4F36A 2KXHA 3DXKA 1WBDA 2V7YA 2FHJA 3UVJA 5AQJA 3ETMA 2A6AA 4FZVA 3UD4P 3QYYA 2DHXA 3DHWC 5CH7B 1K8AT 1HHSA 2EWSA 4M1KA 3BPSP 4Y0WA 3BQ0A 3CERA 3T5LA 3OY9A 4DUZJ 5F41A 5LT5A 3CD6S 4RWTA 1ZM2A 2QJ3A 4IO1A 4Z4HA 4NLTA 4XK8C 3VAGA 4KYZA 4RWXA 5J2NA 2ITGA 3NCPA 4TXSA 3CC7N 1RT3A 4JI0F 2B3TB 1TGOA 2F40A 2VH7A 1PBUA 1Q53A 1N5SA 4EBDA 4CJEA 2WVBA 4ED3A 2Q3SA 4FL9A 2RPIA 5KFYA 3T69A 3J7YI 5F9NA 5CHIA 4FLVA 2X1BA 2NSCA 1TELA 2CWXA 1OH7A 2JWNA 3CQ8A 1QVFR 1NBEB 3ULDA 4ILLA 2OI2A 1YJ7A 5G0RB 3LQVA 5KFBA 3BGRB 3F41A 5DRKA 4UT4A 3PW7A 3ATVA 2IS3A 4G3IA 2KHOA 2DXDA 2NXCA 3VGMA 3QLHB 2QSWA 2VC1A 5KFRA 5DS7A 1RAGB 3AQOA 1JQGA 3L7OA 5HSPA 2QM1A 3SFUA 4AM7A 5C42B 3AY9A 3CCVS 2UUCF 1R0CB 4OYPA 1S4EA 1WHXA 3SUOA 5BR9A 4QYRA 5KFDA 3EN9A 3SJJA 1RAEB 3AY0A 2RQKA 4U9RA 4KHPF 1YJ9N 3KLGA 1FE0A 3PX6A 4HHTA 1RT7B 4Z37A 3ID8A 3H7HB 2O01C 4O3RA 2MSSA 5JXSA 5F3ZA 3QRQA 3AO5A 3IP0A 4ZVPB 3ENBA 3MDQA 4TYAA 1UJ5A 1DFDA 2KKHA 3H40A 1JKHA 2ZHAA 3H1VX 4DG1B 2B4PA 4NLXA 2B56A 1G7CB 2HK3A 4ZLJA 1JXBA 3ZSZA 3KG4A 3DLGA 3RU0A 4FM1A 3UKRA 2HS4A 3CCUN 1Z2ZA 1B99A 4R0EA 1YX2A 1HRHA 1YTYA 2UUAK 4C97A 1VSKA 2DR8A 2BDPA 5HL7L 1UVJA 4EYIB 4WU2A 3QFPA 2BANA 4JI1J 5KT6A 2P9PB 2D0OA 1FKAF 2BR0A 1H0HB 4CF0A 3KOAA 4RO0A 2D3UA 2O4GA 2R8GA 2PEHA 1ZETA 4JV1A 4C1NI 3VQ8A 3VEXA 3SBGA 4V19J 2ZOGA 4Y00A 2DNMA 3PTWA 2RHSB 1V4SA 1BG3A 3CHWA 5A8RB 4NLGA 2DGOA 5DZ7A 1VJWA 4BC7A 2OTLN 3V4MA 2POKA 2D0CA 3DLKA 3NH1A 1UOCA 4Z4IA 2XGPA 2R7SA 2KT2A 1J5EK 2H4YB 3TPQA 3K17A 3HKWA 4WQ4C 2I0XA 5F8NA 1ZC6A 2HVIA 4DUTA 5IWAK 1J5OA 3OYIA 4A2BA 2FBVA 3U7JA 4CEFA 3PM9A 4ZTJA 4L75A 3KJVA 3WC2A 5J2NB 1QD1A 3Q24A 1X7VA 2GIFA 1WG5A 5AJ3F 1P9YA 2RN2A 3KXDA 5IV4A 4X4TA 4P10A 2W7OA 3PV8A 1IVZA 4FZYA 3DLKB 5AQXA 3KG0A 3O4WA 4DR6J 2PE8A 3SQ1A 1BMQB 2KRBA 2NXJA 2XG8A 3TZZA 3MOJB 2CGKA 3OYFA 1EQYA 2KW4A 1Z25A 3QT7A 4FN5A 3MN6A 2JFKA 1TTHB 4CHYA 2V94A 4EI2A 2FQQB 2G13A 2UU9K 4XIUA 3QZ8A 3QFWA 5CZVA 4QW8A 2X74A 3KKFA 4OYMA 4JD2A 4MYUA 2MLZA 3TEGA 3N4WA 3EGNA 2IDLA 3QICA 3H4DA 2KKZA 3OTOF 3FEZA 4IWVA 4B1VA 2L9WA 1N5YA 3TSQA 2QE5A 3SUQA 1NBWA 4AQYK 3SSQA 5I4MA 2DJWA 2EKNA 4ZVTB 4DF4A 3IS9A 4QIGA 2Z1GA 2OGUA 1JJ2R 1VRUA 5HATA 2XBPA 3ZZZA 1R0BG 2K1RB 2QL7B 4DCHA 4ES3A 1NKCA 3LP1A 1NOYA 4CI0B 2OTJS 3ULEA 4NCGA 5KPZA 3M05A 4KB7A 1BQNB 4BRFA 1VSIA 2XY5A 3ZCMA 1VSEA 4LFAJ 1JCFA 2NCKL 1T7PA 3EZOA 4B3RF 1D9DA 2I9SA 3V2UC 1YJRA 4IBNA 2RUSA 5IV3A 4BR7A 3FZLA 1MROB 4AH9A 4RUAA 4W90B 1VQ6S 5JVGL 2YV0X 1FDDA 1ZA1B 1QQNA 3UW1A 5AE1A 5A76A 3LWMA 1DY3A 3OBYA 2IRXA 3WX4A 3WXJA 1X5PA 1QSYA 2B5JB 1X4AA 4QU6A 5EX0A 5HLFB 1MWYA 4LSNB 2M7SA 3KHHA 3W0LA 3HZ6A 1GLBG 4DPXA 3N01A 3PR5B 5B0CA 1X60A 4PRFA 2E1CA 3IWNC 2F9TA 1GXTA 2EC0A 3OUYB 1KRPA 1N34J 1I94J 2CDQA 3HP6A 3EICA 4F67A 2UUAF 4DS5A 3UDLA 2E2NA 3JTOA 3PG9A 3THYA 3THVA 1WC4A 4KQZA 3WEEB 1WSJA 2BJ8A 5KFVA 4K42A 2WAQD 3NCRA 2JEGA 2Y8WA 1S1WB 1Q9YA 2RDJA 3GDQA 2VIHA 3A5OC 2G8IA 2YX7A 4A8SA 1YVNA 3ENVA 4ECWA 2QEXS 5KFEA 2A1RA 3FSXA 2QA2A 4C11B 3HMJG 4CVNE 3MEDA 3BR9A 2IVNA 2Z2LA 2CQIA 1GQEA 3SLCA 2MTLA 1UAXA 1NXIA 4YDUC 3C14B 2IDOA 3J7A1 1NK9A 2VDHA 1VLYA 1K8KB 1GOAA 2W4DA 4DU7A 2CXEA 1URRA 2BUNA 1U02A 1M5PC 5J2QB 2YHYA 5L9XA 4P9SA 4JKHA 4KBIA 3PX4A 5ETRA 4JKFA 4BDYA 4LUBA 1TKTB 4LF7K 3RRHA 2FHKA 5KG6A 1MW7A 4F3QA 4CM0A 4JI3K 5BYSA 4MT1A 3BJYA 1NZAA 4FW1A 2AYBA 2OPRB 1LW2A 4FVMA 3NWGA 5ETPA 2F4VF 1TVRA 2FJXA 2W24A 3FGUA 2NLXA 2QWOA 2DK2A 1S9GA 4WYBA 1QAYA 9RUBA 4CLFA 3OR2B 2F9JA 1EZZB 2ZZTA 3M8SA 1QHTA 5CYJA 5KPRA 1QLNA 1HPZB 5F2RA 4NYFA 4PA1A 4W5OA 2ZH2A 3H5UA 2YHXA 1OQ6A 5JMNA 5DG8A 4X64K 2MYFA 2FBYA 4PXDA 4DR1F 2Q66A 3DOLB 3KK7A 2EFVA 4ZVEA 4B3SF 2D0BA 2OJ3A 2HVEA 2VCPA 1WOPA 2P5VA 3OVAA 3W7BA 5FLXU 3IXQA 4ELVA 1OY8A 2HFNA 2MLXA 2NQPA 5HN0A 3OHAA 5LMNK 3HPHA 2AA4A 2HFZA 4DMZA 1P6TA 1Q16B 1YHQS 4QIVA 2IHR1 3CC7S 2CWKA 3IDHA 2JWKA 5AQFA 2P9KB 4CK3A 1SIWB 1EB0A 1S0OA 3RTVA 3KD5E 5ITHA 4WKRA 1T6DA 2UVRA 2ETJA 2HQFA 3OVNA 1ITPA 1F1BB 2CA9A 2DNYA 2XHCA 2E5GA 5HMYA 3IUCA 5A8KA 3P3DA 1RWUA 4EZ6A 5FROA 3TARA 3ENHA 4DV6K 3WUHA 1FJGK 3MPDA 1ATSA 3L8BA 2LMIA 3BUZB 2ZZMA 3TUJC 2X51A 3Q22A 2C42A 4NLWA 1VHIA 3J80O 1P1TA 4PZVA 5B0AA 4ICLB 3DRYA 3MAQA 4DV6J 1JLFB 1FJGJ 3W5XA 1HBMA 2XWXA 3NS6A 3B8HA 1DRZA 2XULA 3L4BC 1KVCA 1GLAG 3AOBA 3P38A 1VAZA 3FCWA 1VQLN 4BRGA 3BQ2A 5E5NA 3MR5A 3BY5A 3NKYA 1L3UA 2PT0A 3QESA 4ZTFA 1U4BA 1TR0A 2CQHA 4YFUA 1WHYA 1TFYA 4JI6J 4D3GA 2HVDA 3QT5A 1KQKA 1K1QA 3V9XA 2DPNA 4ISFA 1LWCB 3RB6A 3PZPA 4LVOP 1FRJA 3WEEA 3NS7B 3THYB 2HIQA 4X62F 5D15A 5IWAF 3U4LA 2CJBA 4ATNA 2GTDA 3D1HA 4PL7A 4OGEA 2YI1A 3P39A 4DR2J 5GAHP 1ESVA 4AD6A 4HKQA 4UY85 4DFPA 2NRZA 3AVAA 4CLZA 4HI2A 4DQIA 3A1YG 4I6MB 3AO4A 5GAHI 3GV7B 4NLYA 3TUPA 5EVZA 1HHQA 1IBMJ 1N54B 3LL3A 2NNWA 3FEXB 2DH9A 1Q5VA 3RZAA 4ZCIA 3QWPA 4OKJA 2CPEA 2Z2YB 3H45C 4BR2A 5KI6A 1R8AA 5E2QA 4BC4A 2YNFB 3KJQB 3UCGA 4L8RB 2Q43A 2DEJA 4CIGA 4E2FB 4JUZA 5DLFA 2ZM6K 3W3SA 4ER8A 1TUYA 2DGQA 1GFWB 4M5JA 3Q0AA 2AQ4A 5ADXH 4GV9A 4Q0BB 2ZJQQ 1ZBTA 4NXNF 3BGRA 3JS6A 4KHRA 5HOOA 4PPZA 3K2PA 1KLMA 3KJNB 4YQWA 2BEFA 2DNLA 4NLCA 3R5BA 3W64A 4BC2A 3CDEA 1NK0A 3CDBA 3T5HA 3VF6A 2QLWA 5HRPA 1NHUA 2ZF5O 3P8BB 4GY2B 1QHAA 4UQTA 2H5JB 2FF6A 3OYEA 4KRFA 4PAAA 2G8WA 2MPUA 4LFAK 3EX7B 4O0NA 4ZPDA 1FFGB 4KHYA 4FLTA 4P73A 3AVLA 4JN4A 4WF9L 4FJNA 3PY8A 2BZ2A 2YWFA 4QR1A 2B9EA 4YOUA 3V1OA 4DV0J 1ZBSA 2IBOA 1IM4A 1YJUA 4E1JA 2HNDB 1N36J 3Q7CA 2MZSA 2NZTA 8RUCA 1Z26A 1DGKN 4DQ8A 1S6QB 1YJ9S 2RVJA 5JUMA 3VENA 1VQ9N 3GLJA 3CJ2A 4J2DA 4OZ2A 1JLBB 4JKGA 1Y3KA 2NZ4A 1E3MA 2HGMA 2K7KA 3E01A 1A6LA 2MKKA 1P9QC 3OS0A 2F4VK 3CIMA 4K4WA 1IKVB 4DUYF 4K7QA 4MLEA 3A8JA 3I55N 1N34F 4JI4J 3J7AN 1HBOB 2DHAA 5IWAJ 4FF3A 5KFPA 2X3DA 3NG8A 1U7LA 2V52B 4OYBA 2KO1A 4JI5J 4TU9A 3HSTB 3P5TL 4DX8H 1DARA 4CJVA 4EBEA 1UEVA 1S59A 4C8ZA 2I2YA 2QV6A 2GA7A 2YJEA 4BGBA 4E7HA 2O8BB 5BYQA 2FYXA 4DR2K 4DTSA 4ECQA 4BREA 1Y4ZB 4QR0A 1HYZA 2NR0A 1ZTWA 3K0JA 2GMJA 5C7PA 2AGQA 3ULEB 3O3GA 2FC0A 3I4PA 3EPGA 1TAUA 2B4VA 2A0FB 1ZBHA 1S3XA 3OJSA 2OIHA 2B9XA 3VQDA 4BHQA 3SDEA 4F8RA 2J76E 3QMLA 4LQ3A 1RAIB 4OI2A 3CIZA 5J2MA 2W7PA 2LQ8A 1RBVA 1NGGA 4WQ5C 4CZJA 3HTVA 3SYZA 4FVUA 2JEFA 4FP9A 4PXCA 3ICLA 4DLGA 3IRXB 1OVQA 4U7UK 3T1HJ 3FBFA 3E66A 4EO6A 1XK8A 1RWOB 5C42A 2MZJA 5FDLB 1KOOA 2JZ5A 1N48A 1RWWB 2CPYA 1U09A 4M3RA 1Q82O 3UD3P 4FBTA 3WBZA 3GILA 4K50A 2DHSA 2DNNA 3EM1A 3LDOA 1FXXA 4A8QA 3V81A 4PYAA 3I9V9 5HANA 1VQON 3MCNA 3DXMB 3QBWA 4H4OB 1OYEA 1HNIB 3HVTB 3B4MA 5EXWA 4CJLA 4JK9A 4B3SK 2QFIA 3C3LA 3V5RA 3VF4A 5BRFA 2AWZA 5DJBA 4J9PA 2XRIA 4FK4A 5DGBA 2OTLS 2UUWA 3O8MA 4FJHA 3SK3A 2XC9A 3V9WA 3ATUA 2QA4G 5KG4A 2DFFA 3GWCA 3CO9A 3PRBA 3UN2A 1J54A 4V19S 3EZWA 5D6GA 4OZNA 4F4ZA 2QWRA 4FWRA 5FPDA 4NRTA 4Z4GA 3DRXA 3M30A 1H2TZ 3HRGA 3RWUA 3U3YA 1PIEA 1IKWB 1P8GA 3MMCA 1ASWA 3TVYA 1CJKA 2IAJB 1WHWA 1I39A 3DM2B 2BYCA 4GKJK 5ETSA 3CJCA 4LSZB 1FEEA 2NZCA 2ASOA 3KIOA 2IM2A 2QT7A 2YBVA 1VJQA 2XMTA 2L9NA 1K1SA 1RABB 3LDLA 1HKAA 5KFTA 1SKRA 4KB1A 4IZ9A 3MD1A 1J9AA 2G0CA 1ZAWA 2XNRA 5IZHA 1YDLA 3H1QA 1TL7B 1VQ9S 1UL3A 1I1GA 1HNWF 4JNEA 3DDNA 2X78A 5FRMA 1OSDA 2QMXA 2HSEB 4TN2A 3IAS9 3R1LA 1AA1B 2Q31A 1TKXA 3HX9A 4DEZA 1D8ZA 4JI1F 1RTHB 4LIRA 1VFJA 2ASJA 1FW6A 1NPPA 3ZSWA 4E1MA 3TU5A 2MHEA 3W3DA 2J7UA 3K0SA 3M2VB 3MPYA 2R8IA 5J2QA 2CG4A 2DITA 3ZSRA 5T7BA 1XNQJ 4FPBA 1EKEA 3MM5B 4DR3J 2GO9A 3HYFA 3LAMA 1K0TA 4A59A 3C95A 3A8YA 1HR0J 3SBMA 1YQHA 4WYWA 3GCWP 3A5LC 4ITSA 1Q8IA 1ZXOA 3ZT0A 1JLBA 4DUZK 3MCPA 3HFVA 3K2YA 4BWMA 3O9SA 2DR6A 4DS4A 3U02A 3VMFB 1ELOA 2P8IA 3JAMY 2YKPA 3OYHA 3GSIA 2ASLA 5ELZA 1GX5A 1XMOK 3MXHP 3TJAA 2YHBA 2BBEA 4KHPJ 2AMCB 1V4TA 1RTDB 3GMGA 3MF5A 1HNIA 4Z0UA 3BN4A 4EHUA 2LQBA 3QT6A 2CGJA 3SI8A 2AJ2A 2C2NA 4JV5J 2XY8A 2BJ1A 4HVJA 1RT4B 3L09A 3PIPQ 1BGXT 2YVSA 4OPJA 1YWXA 3EE3A 3V4IB 3A3PB 4BRHA 2EFGA 5M2UA 1SC3B 2VGMA 3Q2TC 2PDAA 4OKKA 4QAGA 3W8GA 2V68A 4LF8F 2BMBA 2BE2B 3OV7A 1TL4A 2ROEA 4AUKA 2ZVIA 1WOOA 3ZSOA 2BOAA 4E89A 3SPZA 2ZVSA 2GZOA 3MN9A 4XH5A 2ZH6A 1OO0B 3HLUA 4L3QA 4X62K 4DR7K 2R2UA 2E44A 4C3MA 4PY5A 2FJEB 4HUGA 2OPSB 1JLAA 2YWHA 4DTUA 4CO2A 1ICEB 2A5XA 2AZ1A 1FE4A 2ASYA 3GPAA 3RR7A 3SQGB 3H8YA 4LF7J 1N33K 1VSDA 2HQIA 2ZH7A 1FWLA 4Z7YA 4CK1A 3DCAA 2Q36A 5KFAA 1LKZA 2Z2MA 3K5NA 4KY3A 3K5PA 3NP5A 1RTHA 2CPFA 3AAPA 1A0OB 1SJ3P 2B7BB 2WONB 1SL1A 3KLHA 4FWLA 3NH0A 1G1XA 3M2RA 4CEEA 1UVKA 2VB6A 2CQ4A 3RMCA 4ZK7M 5AQGA 4IRDA 1Y10A 2VD3A 3FZBA 3DWLA 3DLLL 4J9NA 3PR4A 4PWDA 1FNOA 3C66A 2JWLA 5AXMA 3P45B 3TVKA 2DO4A 1RHMB 3LW5C 3R2CJ 2B5JA 3RRGA 3CF5Q 3T6BA 1F3VA 1U1MA 3M6GA 4ANCA 4YY3J 3CCMN 4I0WA 1TL3A 4DSIA 1H73A 4C11A 2FDNA 4FS2A 2OSQA 2RB7A 3CJKB 3TZYA 1DQ8A 2ZITA 2ZH8A 3LH2S 1XERA 2W8KA 2BUPA 4ES2A 3CEDA 4DFKA 2XTJP 2DY9A 4CLWA 4H54A 1R0AB 1O0PA 1VQSA 3LP2B 4UQGA 5ETLA 4LF5F 2KQ2A 1AUSL 2EXUA 1PG5B 4CLLA 2QTDA 4ILHA 1HQEB 3O5TB 2DGSA 2ZUGA 2HGNA 3MK6A 1S6UA 4EFAC 4H8KA 2AP6A 4R25A 1JXEA 3BF4A 4DR5J 4FXVA 4IFYA 2YKAA 3C6UB 4EP5A 1WF0A 2MKYA 4M5IA 2ZH5A 1L3KA 3UR3C 1FXDA 1HBMB 2KT3A 1IO2A 1Q81T 4ICLA 3DLEA 3OXFA 5ETVA 4C8YA 2ILZA 4IOXA 1J5EJ 3ZETB 4OX9J 1RT4A 2DY4A 1C2PA 2L41A 1VISA 3D7EO 5AQOA 3WQTA 2W2QP 2CQDA 3GE1A 4ED4A 4WU3A 4CFDA 3ISND 3B4DA 3UDEA 3R2DJ 2ZC4A 1GXLA 4A47A 3G86A 4WXOA 3P1GA 2BKNA 1RFQA 3VZHA 4H0PA 1IQTA 2JC1A 4E7JA 3QFUA 1KHWA 3BGLA 4CYUA 3I0SA 4DTOA 4BR9A 4K59A 3JSRA 4O23A 2VG6A 2LA4A 3OW2M 4DV0K 2A18A 3R9LA 1IBKK 1MG7A 2GHPA 3H2LA 4JYAF 2M88A 1S9EB 4A8WA 5CR4A 1U1OA 3V6DA 4C7QA 4MIAA 1UEUA 5GAGI 2QC3A 3O6QA 2WSCC 4NL5A 5KFOA 4QWBA 3TZXA 5AFUA 3IG1B 2DYAA 5MLCQ 2XLKA 3P96A 4ZIVA 2MDAA 3W9JA 2XCPA 4C8LA 4KE5A 4RJVA 2NRWA 1XUPO 3TOQA 4ANDA 2I8EA 1W97L 3M32B 4ZPCA 1TKXB 2PYJA 4WF9Q 5C0YA 2R7RA 2XQCA 3U6FA 2E5LJ 1TYQB 4EO8A 1U47A 2C2EA 2V8HA 1TV6B 1AZSA 1VBYA 2YNIB 1YTAA 3HSDA 3KLIA 1SC4B 4JS5A 3KLIB 3UI3A 2A40A 2HNZA 4RLEA 2ZM6J 4PPDA 1UAWA 1BD6A 3HHLA 3GYNA 2U1AA 4MDAA 1TKTA 4NCAA 1HNZF 1YJNN 3G8SA 3SIPB 1VQOS 3CDWA 4OYWA 4DN9A 4CCHA 3S6EA 5AJ3K 5HMXA 4OZJA 1TUGB 3IBCB 2Z58B 1DURA 4F3MA 1NGFA 4FWSA 1RBUA 4H5NA 3CGIA 2QA4S 3L2UA 1XBWA 1S7HA 4CI6A 1RSCA 4I64A 5KFXA 1M5OC 3B78A 1XTZA 3I33A 3A13A 2LYVA 1GX6A 3DLHA 5ETNA 4CJ3A 1TK0A 3US5A 1M0SA 3EL2A 2CPHA 3MWBA 2XMJA 3N9UC 3DNCA 2GWJA 1WNSA 4AXIA 2WVFA 2VU5A 3D6MB 1Q8BA 4OKEA 2QTWA 2RF2A 5K9FA 4CD1A 1UVIA 3D3CJ 3W65A 1ZAXA 5DM6Q 4WZQA 4ECTA 1G4CA 2JC0A 4ETXA 3Q89A 3MCAB 3QZ7A 2XY6A 2AGOA 3PYGA 4CZGA 8AT1B 2LP4A 5CZXA 2Y1IA 3I9ZA 3Q8UA 4FWQA 5KFUA 4A46A 3Q8VA 1XNQK 3JSYA 5HVFA 1RHJB 4WIQA 2ZOMA 4CJKA 2EHGA 4QCLA 4CEDA 1EWRA 5I9EB 1ITGA 1HPMA 3D6HB 2Z30B 1BQMB 4LF6F 2AW0A 1NGDA 1S76D 3M6WA 3E1YA 1BCOA 3TW0A 4CESA 4FLUA 4JI8K 3KJFB 4F25A 5AE2A 1YJWN 1RXOB 1FKPB 2XM3A 2Z1HA 4E0DA 1VSJA 1UP1A 4Y28C 4AHTA 3BO2A 1S22A 1SQKA 1K44A 4HYKA 3BV8A 2QYCA 2PD1A 2ZOFA 2XZDB 3M8PA 3QGGA 1VC6A 4FNHA 5KG3A 4OJ3A 2FLOA 3OYMA 3I31A 4XAKA 4NB4A 3UDCA 3IWLA 5FDLA 5GMDA 4BDPA 3H98A 4MK9A 1E6VB 2GX9A 1FTCA 1MDUB 2A1SA 3MM5A 1WG4A 1Q8LA 3AVIA 1N8RO 1CJVA 1C0UA 4R5PB 3BS9A 5CYMB 4X64F 1CQMA 2HNYB 2YX1A 1LFPA 3P4UB 1BIUA 3TA0A 4K0KJ 3R6GB 5SWMA 4CIEA 1N0UA 4WP9A 4LFCF 4OX9F 2EK1A 1EETB 3VQCA 1HWJA 1SXLA 2OP5A 3FFKB 2CNLB 3M7VA 4RBTA 1KAXA 4CBWA 4KRWA 4HHUA 1RT3B 1F60B 1Y5LB 1HNXK 1IM6A 1NOZA 3PIOL 3GR1A 1Q95G 3AODA 3QWUA 2KDOA 3N6MA 4LBHA 2HBRB 2LXIA 4WK1A 1EO1A 2J6TA 3HO1A 4RPFA 2UZAA 3R3TA 5KAKA 1B0VA 2N3OA 2QYGA 3MPWA 2I5JB 4UTGA 1WWHA 3SQGA 1VRTA 4FLYA 3ZO7A 5K8NA 5M2RA 2MY7A 2IJRA 4IQXA 3L4QA 3MAHA 1F0XA 3V6HA 4A4JA 3KYLA 2OCEA 3CJSA 4QIFA 1M5HA 4F4KA 3OHBA 4IXCA 4DL7A 3NGKA 1NJIT 4LF4J 1RT1B 2GV9A 1GLLO 1WC6A 5LSLA 4GRSA 1M1KT 1P8ZA 1AXQA 2ZWHA 1NK7A 3CJ0A 2HB5A 3C2PA 3NNAA 3FSYA 1FA0A 4PHTX 4O4GB 4MMOA 4ZJQA 2HBJA 2BTFA 1TKZB 4CD3A 3J7Z5 2F7TA 1JLEB 1KTVA 1REGX 4OX6A 2EFQA 1C1CA 3LPTA 2VFSA 2ZKUA 3QAEA 4C3LA 3CCRS 1LCUA 3HPGA 4HACA 3QB0A 1XIQA 4B9MA 4FS1A 2OELA 4H4KC 4TSXA 3AVKA 3OUYA 4FOIA 1Q7YT 1YZ6A 2LQJA 3DXSX 2HAFA 1RAFB 1Q81O 1KR4A 3I8BA 1RI7A 1X4EA 2V8VA 3QEVA 3MEEA 1NEEA 1KD1O 1QVGR 1QZ5A 4LF1A 5EX3A 2W9CA 1SUQA 2J4RA 3G71N 2YNHB 4CHNA 5KFGA 3JTPA 1HNXF 4WQ4A 2D3O1 3OYLA 3ZSYA 1RGVA 3PSFA 1IN0A 3SSRA 3FUYA 3RAMA 2NYHA 2HYIB 3MMBA 2P9UB 3UIQA 5GMKa 2J0SD 3M8QB 4I6MA 1R27B 2A41A 4H5TA 1IJEB 1NM1A 3MN7A 3SCXA 1GT8A 3KK3B 1WSEA 3WHIA 5FJ4A 2JOQA 1NK6A 4NYZA 3AVNA 3ZX2A 4YOVA 3W61A 3D54A 4CLSA 2WBMA 3D45A 4BR4A 3JSBA 2JVOA 4QWAA 4OO1J 2HSTA 3OYKA 2YKNA 4KH6A 1RT2B 2HBKA