5CYMA

Hiv-1 reverse transcriptase complexed with 4-iodopyrazole
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
556
structure length
546
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNDKLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Rapid experimental SAD phasing and hot spot identification with halogenated fragments
doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase
total genus 151
structure length 546
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5cymA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cymA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cymA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cymA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5cymA05
3KLGA 4NLXA 4IQXA 5DG9A 1IKXB 3ZSRA 2GIRA 4U6PA 3QLHB 2WK4A 3CM6A 5KG0A 3QERA 3WNHA 4F4WA 2EX3A 3KHHA 4HUEA 4ED6A 4EZ6A 4CJPA 3G86A 3SQ2A 5CYQB 4EP5A 4RW8B 2YKNA 2UUTA 2Q3SA 2V0NA 2HMIB 3SV4A 4GC6A 3ALYA 1JLFB 3AA4A 3SQ1A 2JC0A 4K4SA 4CECA 3V6HA 4H4OB 2CKWA 1S0NA 4HKQA 2IM1A 3G0ZA 3KK2B 4Z4CA 4J2BA 3HP9A 3H5SA 4CEBA 4AHUA 4ECTA 2DPJA 2ATQA 4Q45A 4DWIA 3E01B 1S1UB 5K14B 3KLFB 4RNNA 4IG3A 4TQSA 4I7FB 1U09A 4FLWA 4C8MA 4M95A 3HT3A 3I0RB 2B4JA 1VRUA 4RUAA 2O4GA 1RA6A 4IRDA 2AGQA 1TL1A 2QK9A 1RILA 2X6SA 3MXMA 4DL5A 4ID5A 4O4GA 1VSDA 5DMRA 4ZMMA 4CHPA 2ZE2A 2DFHA 1RDAA 5FRMA 3TR8A 4TY8A 1RA7A 3ISND 1EXQA 5J1EB 4BDYA 2ZQBA 5KFNA 3L8BA 4NCBA 5JS1A 3KLEB 3M8QB 1TV6A 3K2PA 2Z1HA 1GOBA 1BI4B 2ITGA 1REVA 5JUMA 4TSXA 1NK8A 2ZD1B 1X9SA 4FK4A 3BREA 1JKHB 1TKZB 4KHYA 3LZJA 2D7SA 2E9RX 4DTOA 3DLRA 3MEDB 2HHUA 3CJ4A 3HPGA 5L1KA 1IKVA 2WOMA 4E1NA 4N76A 4JV2A 3KTQA 5KT3A 2BRLA 3RB0A 3IRXA 4CEZA 2UVWA 4FJ8A 2IJFA 2DFEA 4KREA 4DSLA 1NJYA 4ZHRB 4NCGB 3QNOA 3MR5A 1TKTB 1B92A 1S9GB 4O3PA 3VQQA 3I5CA 4JRQA 1RT3A 3KK1B 5C5JA 4G1QB 2YNGA 1SUQB 4NLVA 1ZTWA 3T19A 4M3YA 1NKBA 2YNFB 1HNVA 4MQ3A 3QO9A 2OPQA 4CERA 4KAZA 5HLFB 3DLGA 3PX4A 5C25A 4O3QA 5KFAA 3SUOA 1TL3B 3CDEA 3KJVB 3QZ8A 3VQSA 2C22A 5KFPA 4I9LA 4TY9A 1LW2A 2JC1A 3AVKA 2QXFA 3LP3A 3PW7A 1NJZA 3KHGA 2JLEA 3CIZA 1RYSA 4FZXC 4B08A 4DTSA 3SPZA 4CIFA 4YFUA 3LP2A 3BQ1A 4QWEA 5KFBA 1NK6A 3GIJA 5CZ1A 2IJNA 3HYFA 4BDZA 2HNYB 3V6DB 4CHNA 2VA2A 3O3GA 2KZMA 3AA2A 3CVKA 3TQ1A 3LAKA 4PA1A 4FLVA 4DLEA 5HROA 2YHBA 2AJQA 4O0IA 4WZQA 4LSNB 3HHKA 1SH3A 4ECZA 4FK2A 1DTTB 2HW3A 4Q44A 4H4MB 4EBEA 4KTZA 4GC7A 4K50A 5J2MA 4ZVFA 3C94A 2FLNA 4KHNA 2HWIA 3V1QA 4YR0A 1RBSA 3Q8SB 4NLQA 1BISA 4CGDA 1EKEA 3PX0A 4O44B 1L3VA 4KPYA 3BDPA 2E6MA 1S1WB 3KNAA 3HPOA 4MK8A 5KFDA 4FLTA 3MR2A 4O3SA 2R2TA 3G6YA 4MFBB 2BANB 1TK0A 1UA1A 5F8LA 1S1VB 2FJWA 5L9XA 4K8XA 1C1CA 3NE6A 2RPIA 3VQ6A 4FJKA 4DSJA 3EPIA 2UVUA 4E19A 3RR7A 4FJGA 3LPTA 1QE1B 4CK2A 3K58A 4FJHA 1RCHA 1TGOA 3OYEA 4DFPA 3C6UB 1BHLA 4MH8A 3A2FA 2YNHB 4B3OA 4DU4A 3FFIA 1TAQA 4RUCA 1JIHA 4PQUA 2YNIA 3L3VA 4FJNA 3PW5A 1J5OB 4KE5A 3MEEB 3V9XA 1RDBA 2IC3B 3QIOA 3N6NA 4E7LA 5D3GB 4OLAA 3HSTB 3CJ3A 3P83D 4ZPDA 3S9HA 3SJJA 3OL9A 1EX4A 3DOKA 1J53A 4ECSA 2G8VA 2J6SA 4DS4A 5FDLA 3NGDA 4QPXA 2B6AA 1C0TB 5C24A 3SFUA 1JL2A 3QZ7A 4RW4A 4E7JA 2QKKA 3AVIA 1D9FA 4DG1B 4NLOA 3DMJA 4YR3A 5KFSA 3HP6A 3SPYA 1Q8IA 1RYRA 1Q9XA 4DSKA 3TARA 1G15A 3LP0A 4DMNA 1IKWA 3V6JA 4Q0BA 5DG8A 4CEAA 3GV8B 2WRMA 3CJ5A 1BIZA 1BQNB 3DRPB 1JLEA 2IAJB 2F8SA 3VQ8A 1NK9A 1HRHA 4YQWA 4CGJA 3IAYA 4DTJA 2JEJA 4L8RB 2BGGA 1S97A 3LP1B 4K4WA 3OJSA 4FLXA 4K4UA 2FBVA 1IKYB 2W9BB 3CYMA 4KB7A 1D9DA 3ITHB 3DRRA 1HPZA 4DL3A 2XY6A 3HVTB 2HHWA 2WONA 2HNDB 5DQHA 3HVWA 3NKYA 3NH0A 4C8LA 4KHUA 2R8JA 3F73A 1S1XB 5J2QB 1C0MA 3QEPA 5KFGA 1VSKA 4Y1CA 2RN2A 1S1TB 4R8UB 3SZ2A 4H54A 4E7IA 4F4ZA 4K4YA 4CGHA 2KFNA 1X1PA 4K4VA 2VG7B 3DRSA 4CHQA 3IS9A 2RKIB 5I3UB 4LH5A 2VA3A 5HBMB 5F8JA 4QAGA 2AX0A 4Z4HA 3MXJA 4NYZA 2YKMB 3L2WA 3BSOA 1VRTA 3M8PB 2BRKA 4KFBA 1WSFA 1NK7A 1RT5A 3OYIA 2XRIA 2FBXA 5KRSA 3DYAA 4I2QA 3VQ7A 2OH2A 4HVJA 3FRZA 1SL2A 4ZTFA 4J2EA 5E41A 4ED3A 3MECB 2DTUA 1XR7A 1JLAA 5KRTA 3KK3B 4ECXA 2GUIA 3E51A 4ICLA 1NJXA 3LWMA 4TQRA 3OYMA 5KFVA 3O3FA 2FJVA 2ALZA 2EC0A 1RT4A 1O1WA 5F8HA 5KFTA 1K1QA 4CJSA 2IM3A 3MEGA 3GQCA 1B9FA 3OS1A 1X9MA 1CLQA 3RB4A 2XGQA 3NFAA 1FK9A 1HYVA 1N6QA 3SNNA 4ID1A 1JLGB 4Q5VA 1WAJA 4LSLB 5F8NA 1RTHB 1TVRA 4QWBA 1W0HA 3HJFA 4DQRA 4NLSA 4KO0B 1T94A 3AVMA 4B9UA 1IKXA 4YR2A 3GYNA 1W9HA 3TAEA 2ETJA 3QLHA 3CFOA 2A1RA 4DEZA 4RNOA 4IKFA 4R5PB 3P5JA 2FLPA 5CYQA 4Z4EA 3KIOA 1TKXB 4OPKA 1Z4UA 4QWAA 5HP1A 1JLFA 5KFKA 4CJKA 4CHYA 3IGVA 4O55A 4KHMA 4H4OA 1SL1A 3KK2A 1RDRA 1Q9YA 2ILYA 1I6JA 4IFVB 1A5WA 2XI2A 4KB0A 2BQRA 4RG8A 4BE0A 3E01A 1S1UA 5K14A 3KLFA 3NCIA 1KSPA 3DLEB 3S3NA 4I7FA 3THVA 3I0RA 3JYTB 4M94A 4EO8A 1CXUA 2V4QA 1I3AA 3NAHA 3I0SB 3SQ0A 3EY1A 1LW0B 5T14A 4XPCA 3RAQA 2WCXA 5F9LA 1S10A 4IRCA 5I42B 2C28A 4CEQA 4E7HA 2BE2B 4I2PB 4M3XA 3M9OB 3BQ0A 2GIQA 3TI0A 2ATLA 3K59A 1XHZA 3G6VA 4F50A 3DDKA 4DTRA 5J1EA 4RW6A 3BR9A 3CJ0A 1QS4A 4J9SA 1IG9A 2F96A 1Z25A 2OZMA 2JEIA 3VQAA 1U04A 4TN2A 5DGBA 3KLEA 2HVHA 3M8QA 2FLLA 3MFHA 1NK0A 4CF8A 1B9DA 3DM2A 1SL0A 1IM4A 4KHQA 3VQEA 4O0JA 4U7CA 4DLGA 4ZP8A 4E3SA 2PYLA 1JKHA 4F4KA 1JLBB 2W9CA 3V9SA 1RDCA 3AA5X 4CJWA 3MEDA 3AVAA 1CZBA 3TAMB 3PUFA 3ZSOA 1LAWA 1ZYQA 1KCFA 1XWLA 4DTUA 3AVCA 3D5MA 3OSNA 4OJRA 1FKOA 5HRSA 3KD1E 1HARA 3F9KA 4ECVA 3RMCA 3CM5A 3QYYA 1IH7A 1S9FA 4ZHRA 2R8KA 1S6PB 5KFLA 1ZBUA 5KFFA 2O5DA 1TKTA 4CK3A 3QETA 1S9GA 3L2UA 1SV5A 4IG0B 2XCPA 4GMJB 4CJQA 1OS5A 3LZIA 3K5LA 4CGIA 1SH2A 4ECUA 4WFYA 4O3NA 1GOCA 5L1IA 4OLBA 5CY4A 3KK1A 4G1QA 2HB5A 3NBPB 1SUQA 4DS5A 4CF2A 1ZBHA 3ZT2A 2P51A 4X2BA 1HQUB 2WB4A 1LWCB 4F3OA 4RW7B 4O3OA 1RT1B 5HLFA 3OLBA 4KI4A 3NF6A 5DLGA 1JLCB 2E4LA 1TL3A 4M41A 3KJVA 5KFHA 4IRKA 4Z4IA 3CDWA 4LD0A 2HHVA 2NUBA 5KT7A 4IH7A 3CO9A 3AVNA 3NGZA 4DF8A 2R2SA 4BDPA 1YT3A 4FLUA 3QEXA 4B9SA 4FBUA 4F2SA 4TLRA 1KTQA 3VQ4A 4AHRA 2R8IA 4KHSA 3Q8PB 5KFZA 2HNYA 3QIPB 3V6DA 3MR3A 1HMVB 5L1LA 4OGEA 1QSLA 5KG7A 1VSFA 3OYFA 5KFRA 1HNIA 1S6QA 2HNZA 3DI6B 1RTJA 2V9WA 3L3UA 3ZSZA 4IG3B 4NLWA 2E9ZA 1DTTA 2QKBA 4HHTA 2FBYA 1C2PA 4H4MA 2DFFA 1N5YA 4HUFA 1VRUB 4ZPCA 3NDKA 4DQIA 1WNSA 1T7PA 3T5LA 1ASUA 4KSEB 4Z4FA 3UDLA 1EETB 2Z1IA 4IH6A 4ED7A 2VG6B 4ID5B 2OPSB 4O44A 5KFXA 3ZSYA 4AH9A 2GBZA 2CJQA 4B9VA 5DLFA 4FXDA 5KT2A 4XIUA 1S1WA 4FLZA 2YV0X 4NLPA 4CIEA 3PW4A 2P5OA 1DLOB 4MFBA 4EYIB 3ZSVA 5HRPA 2BANA 3T3FA 4H8KA 3V81B 1S1VA 3D0PA 4Y1DA 5DQIA 3QINA 4LY7A 2D0AA 1QE1A 1S0OA 4CJUA 3OYGA 2R7YA 5F8MA 1SH0A 5HRRA 4BWJA 1KVBA 1RT6B 3NHGA 3TWHA 4CESA 1C0UB 3SI8A 4AHSA 1TP7A 4C8NA 1X9WA 4FM0A 2Y1IA 4DQPA 2EHGA 1J5OA 3GIIA 3MEEA 1VK0A 1T03B 5D3GA 3U6FA 4JRPA 2IMWP 4CGGA 2LSNA 3UPFA 3PJXA 1CZ9A 2FBTA 1C1BB 4CEFA 3OJUA 3ASMA 5CYMA 1C0TA 3GIMA 1RAJA 1D5AA 4N56A 4KHWA 4KI6A 4DG1A 4DFJA 3CFRA 4FJIA 1LWEB 4CEDA 5KFOA 4FJJA 4JS4A 1FKPB 4J9RA 1VSEA 3TAFA 3L2VA 3H08A 1UWBB 3RB3A 1RBVA 4IFYB 4MK7A 3PHEA 4CJTA 1NHUA 4DQSA 1BQNA 3QNNA 1NK4A 3DRPA 3KHRA 2IAJA 3QO9B 5KFEA 4F4XA 2OPQB 5DGAA 1QAJA 1Y97A 1RTDB 2BR0A 3IG1B 4YNQA 3LP1A 3ZSQA 1HQEA 1NNDA 4ELTA 3I5AA 2W9BA 4JV1A 4LH4A 3ITHA 3AV9A 2IBKA 4Q8EA 3HVTA 3WNGA 2HNDA 5F9NA 1RTIB 1JX4A 3PW2A 1J9AA 1KVAA 4ZPBA 3LP2B 1S1XA 5J2QA 4M3UA 1A5XA 1S1TA 4R8UA 1QUVA 5KG3A 5KG2A 3FQLA 3NH1A 5KFQA 2X74A 2D0BA 3DOLA 4AHCA 3V1RA 1T3NA 4DF4A 1TKDA 3NF7A 2VG7A 3LALA 3H2LA 5J2NB 4ED1A 3V4IB 2RKIA 5I3UA 3FQKA 1QAIA 3RAXA 2XC9A 3VQBA 3G10A 4MKBA 1HYSB 2YKMA 4WYWA 3M8PA 4YP3A 4Y2CA 4QCLA 3ZT3A 2R8HA 4ED8A 1K6YA 4FCYA 1WNEA 3MTKA 4NLTA 4OKKA 3RBDA 4IDKB 5C42B 3KK3A 1NOZA 2R8GA 3OL6A 2AGPA 3DLHA 4XPEA 3PO4A 4FK0A 1JL1A 3AO2A 2OPPB 2HHQA 3H4DA 4J2DA 1KRPA 4OKJA 2KZZA 1D0EA 3HK2A 2ZKUA 1DTQB 3OS2A 3OYAA 2UVRA 1WSHA 1LAVA 3PY8A 4MIBA 3ZCMA 1C6VA 2GV9A 3B6PA 3OYLA 3FFIB 3M8SA 4DTPA 3RMAA 4CFDA 4F2RA 3N6LA 1NHVA 4R0EA 2D0CA 3HVAA 4EYHB 3CFPA 4CJ5A 5DK5A 4LSLA 3HPHA 3SQ4A 1RTHA 1GX5A 5FROA 3JSMB 4KO0A 4JLHA 1U48A 3T5JA 4J9QA 2HAIA 4FS1A 3V6KA 4M3TA 4HYKA 4KV8B 5FDLB 3B6OA 3H5XA 3AO4A 5EDWA 4R5PA 3QIDA 1R0AB 4ECRA 2IM0A 1YTUA 3H98A 1W25A 1TKXA 3NAEA 2G8HA 1KHWA 2BQ3A 4W5NA 4CJ3A 1MU2B 1IKWB 2VWKA 4CEEA 3KOAA 5EWEA 2IDOA 4FJ7A 1RNHA 4IFVA 2G8KA 2PY5A 4PWDB 2C2DA 2P1JA 3HL8A 1K1SA 3NF9A 1NOYA 3DLEA 4DSFA 2DPIA 1S4FA 4DFMA 3JYTA 3OYDA 3S3OA 2G8FA 3K5MA 2X6NA 4FZYA 1LWFA 2E6LA 3DRRB 4AHVA 3ZT0A 1S48A 2WONB 2D41A 4K4ZA 4BWMA 4HCBA 2IM2A 4KHRA 2XY7A 4CEOA 4NYFA 2BE2A 3QESA 5J2PB 4ZVHA 3CJ2A 4DTNA 2IA6A 2B5JB 2OA8A 4NCAA 4DQQA 3M8RA 4CCHA 4RW9B 4DL2A 3AO5A 3QGGA 1N56A 2VWJA 2D5RA 1KLMB 4RW8A 4NLUA 5JXSA 2G8IA 2HMIA 4URSA 3TANA 3KLIB 5KFUA 5SZTA 2W42A 3AA3A 4QW8A 3MR6A 4W5RA 1SKSA 1T05B 4PUOB 4KFBB 4MIAA 2G8WA 1JLBA 1QHTA 4DU1A 1ZBIA 4ZP7A 2XCAA 4M3ZA 5SWMA 3TVKA 1BCMA 1U49A 1Z26A 2KW4A 4CJ4A 2W7OA 1RT7B 5KFIA 4KKOB 3VQDA 3PR5B 3OHAA 1ZTTA 3SUQA 2RDIA 3DLKB 2RF2B 4M3RA 4IR1A 4ICLB 2XY5A 4WE1B 2D3UA 2F8TA 3PX6A 3BSAA 2J6UA 3MXIA 3PJWA 3HM9A 3OHBA 3RR8A 1CSJA 1S49A 3GV7B 1JXBA 4CGFA 4FM2A 3NBPA 3AO1A 4AHTA 4B8CA 1BCOA 4FVMA 1L3UA 4FJMA 1EP4B 4WXOA 3WNEA 3TAGA 1HQUA 1WSIA 1S9EB 3OYNA 3K57A 3HXMA 3L2QA 1BL3A 3M9MB 5DQGA 1J54A 2VG5B 4WFZA 1RT1A 4W5QA 3MFIA 4URGA 4TYBA 1JLCA 1BI4A 1GX6A 4CFCA 4ECWA 2Z1GA 2ZD1A 2W8LA 3EYZA 4C8OA 4ELUA 4CF9A 2KTQA 4BE2A 1TKZA 5F8GA 3OYKA 1RT2B 3OYHA 4FZZA 1XR5A 1T8EA 4ECQA 3VQPA 1NJWA 5FRNA 3VA0A 2XI3A 5HP1B 1L5UA 4LQ3A 4CF1A 1WLJA 3RMBA 3QIPA 1UA0A 1HMVA 5EU7A 2OYQA 3RWUA 4M45A 2UUWA 5KG1A 2XWYA 2OPRB 3ZT4A 1ASWA 2V4RA 4NCGA 4AILC 4NLYA 3Q8RB 1YTAA 3PO5A 1GOAA 3DI6A 2W9AA 4JUZA 1BQMB 3KMSA 2FVCA 3H40A 3BGRB 3AVLA 3CG7A 1YVUA 2AX1A 4FM1A 1QSSA 4EEYA 1JLQB 3LAMA 4KRFA 4E89A 2YNFA 1EETA 2JGUA 4DTMA 4ZTJA 3OL7A 5KFYA 2VG6A 2I5JB 3QGIA 2ASJA 2OPSA 2G8UA 4CHOA 3KLHB 4FJ9A 3C6TB 2BDPA 4K8ZA 4BE1A 3KLGB 4ZVGA 4Z4GA 1VSJA 4CIGA 4Y3CA 2DY4A 1DLOA 4RW6B 1QTMA 3OSPA 3OYBA 4CK1A 1U45A 2UVVA 4NYNA 5KGXA 3OS0A 3V81A 3NMAA 4B9TA 3C95A 4QW9A 2XY8A 2YKNB 5KGWA 3Q8QB 5EUHA 3ZT1A 3DM2B 4B9LA 4B9MA 3MAQA 4O3RA 3OYCA 1RT6A 1RBUA 3EZ5A 4GW6A 1ITGA 1C0UA 3NGIA 1TK8A 1YVFA 2W9CB 3ZSWA 4Z0UA 4RNHA 2HWHA 1JXEA 3BJYA 3NL0A 1UAXA 4KTWA 1T03A 4LSNA 3O4NA 3BSCA 3RRGA 1F21A 2E9TA 1FKOB 1U4BA 3FSIA 4RZRA 4DL4A 1IO2A 3H5YA 1C1BA 2ASDA 4I9QA 2FVRA 4EO6A 1ZBLA 1TL1B 4TYAA 2FVSA 3TAPA 4ELVA 2YHAA 1SV5B 4O4GB 1LWEA 4HUGA 4Q43A 4E0DA 3OVNA 3HO1A 2ZE2B 1FKPA 2HHXA 4TY8B 3GIKA 2C2RA 1UWBA 3N6MA 3QEVA 4IFYA 4FJXA 3ICLA 1BIUA 4FJ5A 4MK9A 1VSMA 3D45A 3VQ5A 2WHOA 4GVMA 1A5VA 1VSLA 1TV6B 4WFXA 1RTDA 4YMEA 3K5NA 1REVB 3IG1A 4O4RA 3AO3A 3O3HA 1HYZA 3C6UA 1QQCA 1VSIA 4CJVA 2YNHA 5KG6A 3ISNC 2WTFA 2AU0A 2ILZA 4K4XA 3FDSA 4Y2AA 1RTIA 1IKVB 5CZ2A 3I5BA 2WOMB 1TK5A 2P5GA 2IC3A 3SFGA 4EZ9A 4MKAA 4OVLA 2O4IA 2HVIA 5HRNA 3NF8A 4ZP6A 3IRXB 1WSEA 3VA3A 5F8IA 1HNIB 2PZSA 3OL8A 4FLYA 4C8KA 1S6QB 2HNZB 5L1JA 1RTJB 5J2NA 1NKCA 2Z1JA 3V4IA 2PYJA 1RT3B 1N5YB 1HYSA 3RBEA 3RRHA 1UOCA 2A1SA 3SUPA 2YNGB 4WXWA 3I8DA 1D1UA 4F8RA 1NKEA 1HNVB 1ZBFA 4QWCA 4UQGA 3OYJA 3DLGB 3VQ9A 5C25B 4IDKA 2JEFA 3HKWA 5KFJA 1WSJA 5C42A 4NLRA 4RNMA 4JV0A 1LW2B 4J9LA 1IKYA 4Q8FA 4B9NA 3QGHA 4HCCA 4J9NA 5KG5A 1LV5A 2OPPA 4KAIA 4FJLA 3IGNA 3V9ZA 3UR0A 3MF5A 4FW2A 2FVPA 2XGPA 1DTQA 4EBCA 4HTUA 3LANA 3L2RA 3PZPA 3KKSA 4F4YA 3CWJA 4B8AB 3AVBA 4FW1A 3V9UA 2KQ2A 5KT6A 5HROB 2F8EX 4CFAA 1RBRA 3JSMA 3SI6A 3O4QA 1VSHA 1S5JA 4XO0A 4DSEA 4RU9A 4WYLA 3IN5A 5HBMA 4M42A 4N5SA 3BQ2A 1I39A 4KV8A 5J2MB 3V9WA 4FYDA 2KFZA 5CYMB 3GV5B 1R0AA 4KTQA 1XHXA 3K5OA 2FC0A 2J6TA 4G3IA 3OLAA 3T1AA 3MECA 4OKEA 1S0MA 1TAUA 4NRTA 3QEIA 1MU2A 1ZETA 1SKWA 2QE5A 3V1OA 1QSYA 4ED0A 4DSIA 3SYZA 4PWDA 5KTQA 4E1MA 3KMQA 1C1CB 3UIQA 2RDJA 4J9MA 5KT4A 4KB1A 2XHBA 4IR9A 4DU3A 2FVQA 2I1RA 4W5OA 4DL7A 3U3GA 5DG7A 1L3TA 1HQEB 4M3WA 2XO7A 3VQCA 3ULDA 3LWLA 4N41A 4B3OB 2R2RA 4PQUB 4BACA 2AWZA 2YNIB 1JLGA 3LPUA 4ZP9A 4OGCA 3UQSA 2Y1JA 3U3YA 4Y34A 5KFWA 5J2PA 4CF0A 2B5JA 3DOKB 2ASLA 3KLVA 4CFBA 4J2AA 3AVGA 4E7KA 3GILA 3DOLB 4RW9A 1WSGA 4WZMA 3CQ8A 4LQ9A 2B6AB 5C24B 2JEGA 4RW4B 1WAFA 1N48A 5KG4A 3RB6A 4CE9A 3PW0A 3HVRA 2B43A 1KLMA 3DMJB 5KFMA 5KFCA 4J9KA 3NAIA 5JS2A 3KHLA 4JS5A 3KLIA 3G6XA 1KVCA 3WNFA 3LP0B 2GC8A 3EZUA 4N47A 5EWGA 1T05A 3NGYA 4PUOA 4Q0BB 4OL8A 4QOZB 1CXQA 4W5TA 2BQUA 2FJXA 1JXLA 4TXSA 1JLEB 3AVJA 3M9NB 1RT7A 1KHVA 4KKOA 3S3MA 4FS2A 3DLKA 2RF2A 3I0SA 5KT5A 1HPZB 1LW0A 4WE1A 1KLNA 4IOBA 2D3ZA 4J9PA 4IKAA 1ASVA 4OPJA 5EWFA 2AQ4A 5KI6A 1L3SA 5I42A 1C1AA 4I2PA 4NRUA 2C2EA 2R2UA 4NLDA 5T7BA 1XC9A 4IBNA 1EP4A 1KFSA 4RNFA 1KFDA 1S9EA 3BSNA 1RDDA 1MMLA 4DL6A 4CHZA 3DRSB 3NH2A 2VG5A 3RMDA 3IS9B 4PY5A 2IOCA 2IS3A 3H5UA 4KBIA 4DTXA 1RBTA 4FBTA 2AGOA 4NLGA 4ECYA 3AVFA 1N4LA 2HHSA 4CJEA 3H59A 1VRTB 1XI1A 1RT5B 1RT2A 3CDUA 1FXXA 3DYAB 4I2QB 3TAQA 4ZVEA 3TAMA 2X78A 2W7PA 3PVXA 3D28A 3H4BA 3SUNA 4EBDA 1JLAB 4K4TA 2OZSA 3KKRA 3KD5E 3DLBA 2OPRA 4EP4A 4F3TA 1S6PA 3VN5A 1U47A 1WN7A 1XR6A 3T5HA 2W8KA 4URQU 4IG0A 3T5KA 1BQMA 4IH5A 4QWDA 3SV3A 1D8YA 3EPGA 2QV6A 2IGIA 4DFKA 1RT4B 4CJLA 3BGRA 4CJRA 3P1GA 1SKRA 3AVHA 3ZSXA 2HHTA 3MEGB 4NZ0A 3OY9A 4O5BA 1LWFB 1JLQA 1FK9B 3RTVA 3PV8A 1N6QB 3TABA 4CJFA 1TQLA 1BGXT 1HJRA 3QEWA 2I5JA 1LWCA 4ZPAA 4ED2A 4RW7A 3LDSA 1NK5A 1TVRB 3PR4A 3SCXA 3KLHA 4J9OA 3C6TA
chains in the Genus database with same CATH superfamily
1U6BA 2F4VJ 4BQLA 3ZSRA 3OFFA 4U6PA 2AYEA 3QLHB 2L9DA 4I4BA 4F4WA 5GADU 2BJ7A 4DR3F 4ED6A 4CJPA 3G86A 2KYZA 2X7IA 3AH6A 2RH3A 1VFJA 4R0JA 1BUPA 4GC6A 3ALYA 2P9EA 2DR7A 2Q3PA 4FF1A 1IQTA 1CS4A 1FVQA 1HLWA 1NSPA 4AHUA 2DPJA 1F5AA 1HWLA 2OCEA 4DWIA 3NWGA 3E01B 5K14B 4B3MJ 4DR6K 3J80Y 3WC2A 4IG3A 3OVSA 4CZEA 4FLWA 1U09A 3BKTA 3A5LC 2XULA 4Y2IA 2O4GA 2VHGA 1UCNA 2DH9A 3GPAA 3IMQJ 1RA6A 2MY8A 1IN0A 4BC5A 4BRHA 2HEKA 1RILA 4LF7K 4ZMMA 1N32J 4W92B 4USKA 5FPMA 2HK2A 5FRMA 2HHPA 3TR8A 1SXLA 1JK9B 4OHZA 1UEUA 5J1EB 4BDYA 4CTAB 2AZ1A 2XWXA 4TU7A 2A6MA 4WQ4C 5GAEI 4BQZA 1SQGA 2QWRA 2VPXB 1BI4B 3H1VX 3I9ZA 3H6EA 5JUMA 3T9ZA 2ZD1B 1X9SA 4WIQA 1JKHB 2F4VF 2B9XA 1B64A 5L1KA 4OX9J 4N76A 2DHXA 1T11A 4CEZA 4PR6A 4FJ8A 2DFEA 4C1NI 4DPTA 1ZBSA 3MR5A 2VQFK 1WI8A 1IBKJ 4B1WB 4USJC 4DU7A 1A7GE 3K8VA 4AXJA 4DPYA 4B3MF 4JRQA 4GKJJ 4JD2A 3KK1B 4DR1J 1SUQB 2HGMA 4ES1A 4R25A 3SLCA 2V4JA 1HNVA 3EMTA 3A3PB 3GDQA 1ZOTA 1HI1A 4I0WA 3JB9k 1YI2S 4NPOA 3DLGA 4O3QA 3SUOA 2JX2A 4MO4A 5CABA 1N5VA 1N32F 2XMVA 1RACB 3MN6A 5E33A 4IXCA 2JDJA 3ZZOA 3LO3A 3KHGA 4DUZJ 1RYSA 1HKCA 4NXMJ 4B08A 3X3UA 5HVGA 4DTSA 5GMEA 2NRVA 1U1LA 3UB5A 3VPZA 1FERA 3LP2A 1CJUB 4QWEA 4ETZA 2VUGA 3FEYB 3HYFA 3V6DB 4F67A 2DNPA 5AZIA 3RYLA 3AA2A 3L4IA 3TQ1A 1KAXA 1XNRJ 3LAKA 4DLEA 1KS2A 8RUCA 2FUG9 2O8EB 4O0IA 1WSRA 4WZQA 5LT5A 4LSNB 2YQ1A 5DM6L 1YHQN 4NZ6A 3ATVA 3L4QA 4FK2A 3CGIA 4OX9F 2LKZA 4GC7A 5J2MA 4OZ0A 2IYIA 4ZVFA 1P1LA 3IRWP 3C94A 5EY4A 2QLJB 1RBSA 5AQNA 4KPYA 1IBKF 1TFYA 3WXLA 1S1WB 3HPOA 5KFDA 1OH7A 3MAHA 5A0YA 5L46A 3HSCA 4GKJF 3EKSA 1GXLA 4DR1F 2FJWA 2H4YB 3NE6A 4FJKA 3EPIA 3LPTA 3A3OB 1QVGM 5LXYA 1VQMS 1Q0NA 3CCLS 4FJHA 3OYEA 1BHLA 1NRKA 3A2FA 5B0FA 2YNHB 4DU4A 1VQ8N 3FFIA 1JIHA 3FBCA 7AT1B 2FSJA 2YNIA 5ETLA 3L3VA 2OTJN 3O08A 4BRQA 3PW5A 4DUZF 5GADI 3V9XA 4NXMF 2QXLA 5M1NA 3VESA 1UEVA 3CCQS 3HSTB 2UXDJ 4TNOA 3DOKA 4DCPB 3HFVA 1EJ7L 1Y0HA 2HZVA 2KKHA 1GLJO 1YDLA 5FDLA 5GINA 1BY9A 2E20A 3QZ7A 4RW4A 1AFIA 2I2YA 4ZDNA 1XNRF 2JJ4D 3NNAA 4CLZA 3JTPA 2E2OA 1MSWD 3PYGA 5KFSA 3SPYA 2CNKB 1SC1B 4ILGB 2H54B 3P6YC 4YDUC 1TUGB 3CC7N 4CO3A 2B56A 2AKWB 3CJ5A 3D67A 1YUWA 3DRPB 2IAJB 3M2RA 4HTLA 1ZAXA 3HSDA 4YQWA 4CGJA 3UVJB 4DTJA 3G8QA 3VEZA 3X1LB 3OJSA 3R6MA 3CT9A 1FXDA 4K4UA 3R7SB 2CNNB 3CYMA 4FYXB 4K42A 2HHWA 1OY6A 2C2NA 3NKYA 2EKNA 3NH0A 4KHUA 1N5SA 4CT9A 4FPBA 2R8JA 2QA4S 3R5AA 2EG2A 3LDNA 1C0MA 2G2OA 5KFGA 5HVFA 2HHHJ 1VSKA 3K5PA 2RN2A 4RO0A 2YKQA 1T9YA 3IDHA 1VQ7N 3I55N 4K4YA 3CCES 1RLDA 1U2VB 1BG3A 4M1KA 2J9DE 3W9IA 1VQ9S 4CHQA 4GNIA 3QWUA 5I3UB 3THXA 2IFXA 2VA3A 5HBMB 4QAGA 3OUYB 2YKMB 2UXDF 3FEXB 4KFBA 2GO9A 3I56N 3SDEB 3OYIA 4DR3K 2CNOB 3N28A 2A2CA 5IT9Y 3MM7B 4L3QA 3VQ7A 4HVJA 5E41A 4WP3A 1VISA 4M5LA 4RU2A 4ILJA 1XR7A 1FEEA 4ZITA 1G1XA 2Z0GA 4QS9A 1N0VC 3KXDA 4BC4A 2DD8S 3E51A 1KVIA 1NJXA 2ZBRA 1E4FT 4H0PA 4TQRA 2NCKL 5KFVA 4YB5A 3MXHP 1SQEA 3US5A 4PKIA 1U2RA 4ZJOA 5JVGL 3LW5C 1V3SA 4QYZJ 1LK7A 2HBJA 1CLQA 2R3VA 1R31A 3BPSP 3D9BA 1M5KC 3NFAA 3JSBA 1HYVA 4KHPJ 1VQ4S 4LF2A 1BOTO 2ZZMA 2E1PA 3R7NB 1UFKA 2O8DA 2W24A 1IKXA 3GYNA 3TAEA 4WTOB 3SBMA 5GIPA 4ISEA 2HHHF 4DEZA 4RNOA 2P9LB 4R5PB 3EE3A 3P5JA 2PT0A 1YWXA 2QWMA 3QFHA 3Q8VA 5JLFA 4YOYA 4A62A 1Z4UA 2AJ2A 4U8VA 1YAGA 4OI4A 4BC2A 1FWKA 5GAHU 4O55A 2CPDA 4KHMA 1NGHA 2F4VK 3T1YJ 1SZ2A 1Q9YA 4X4RA 1I6JA 4BREA 4RG8A 1VQLS 4BRAA 3KLFA 2KH9A 2QLWA 3Q0AA 1KSPA 3DLEB 1WHXA 2XYPB 4P74A 1OJ4A 2E2QA 4C98A 3KYLA 4JKFA 3SQ0A 4A8XA 1Y00A 2FZGB 1HQ2A 4RTFD 3M32B 4M5JA 1WORA 3C7NB 2NXJA 1S10A 4IRCA 5I42B 4EMDA 3C46A 4CEQA 3DGPB 2GIQA 3TI0A 1WC5A 3DDKA 1UW4A 2DNYA 1V5VA 3CJ0A 3HKZD 4DV3K 2WAQD 1TL5A 2F96A 3MEKA 2OZMA 3M6XA 4TN2A 5KOWA 4KHPF 1K73O 2IDEA 1B9DA 1Q8BA 4DV4K 2DHAA 4JHDB 4B1YB 4CH0S 3ZTOA 3CD6S 3CPEA 4ZP8A 4JKBA 3DLLL 4E3SA 5D15A 2DHHA 1BE4A 4FXWA 3D3CJ 1PBUA 2RILA 5FLXO 3TAMB 2DB1A 3PUFA 5IZHA 2CUYA 5B0AA 3ZEUB 2ZH9A 4OJRA 2HS0A 3DOMA 3HT0A 1HARA 2VKZG 2OTLN 3G82A 4ECVA 1MLAA 2QWQA 2G0IA 4A48A 2QMWA 1OYEA 1HNZJ 3T1YF 2MHNA 4HT5A 4M5GA 1TKTA 1VHIA 1P8GA 3O9QA 3RSEA 3KG4A 4IG0B 1YTYA 5AQVA 2XCPA 1J27A 2A2DA 3D6HB 1X4HA 3AY0A 4WFYA 3TZZA 2EFPA 4G1QA 2HB5A 4K43A 1RWXB 2YXLA 4CF2A 2KL8A 3ZT2A 2P51A 4X2BA 2GVZA 2Q1LA 4HDHA 2ZEJA 4GV3A 3L3CA 1IBKK 4Y28C 4DCOB 3C14A 1TL3A 1T95A 5KFHA 4Z4IA 3PXGa 4PXDA 3CDWA 4H5VA 4BROA 2HHVA 4GKJK 4QIFA 3AD8C 3KNGA 3UN3A 2XLKA 5M1PA 1F2GA 1HA1A 3GG4A 4F2SA 2HRYA 1KTQA 3VQ4A 4AHRA 1FTCA 2R8IA 3THYB 4KHSA 3ZLJA 5KFZA 1NB2A 1HMVB 2P9PA 4Y2KA 4PG4A 4F02A 4OZ2A 3DXKA 1YBTA 4OYBA 3ENOA 4NXMK 3C16A 5HQLA 4LVNP 1S6QA 2HNZA 2CJYB 2M3DA 4IYQA 3HSJA 3L3UA 4IG3B 3ZZTA 4M5IA 4USIA 2QKBA 5AE3A 4FXVA 1KXPA 5AQJA 4H4MA 2RS2A 2YY3A 1N5YA 3T69A 2DO0A 4CBWA 5KAKA 2ZJRQ 1SI9A 4KSEB 4E1JA 1XNRK 3MPWA 4PG5A 5A8KB 4ED7A 4BR2A 1HNZF 2VBZA 2CJQA 4B9VA 5DLFA 4FXDA 1FNMA 2UU9J 4NLPA 4OHXA 2BE7D 4K7QA 2C42A 4MFBA 5HRPA 2BANA 4H8KA 1CVJA 3V81B 2VJUA 4Y1DA 3MR7A 5KPRA 2O8FA 1JNZB 1F3FA 1RSCA 5ITHA 1RWMB 3TWHA 1C0UB 1CLFA 2AW0A 4AHSA 3HZEA 1TP7A 4C8NA 3O5BA 4FM0A 2ADBA 2Y1IA 3F56A 4DQPA 3AOAA 2Q0RA 4GY2B 1J5OA 1T03B 5D3GA 2IMWP 2AP1A 2AIRB 2LSNA 3UPFA 4H5NA 4N7TA 3PJXA 4UW2A 5GAHI 1CZ9A 1KD1T 1C1BB 3ASMA 3UO0A 4KHWA 2KDOA 4KI6A 3AA9A 1WWHA 4DG1A 3CFRA 2VFRA 4DPUA 3A8YA 2FJBB 2KRBA 5IV3A 3VGMA 4J9RA 3TAFA 3OTBA 3L2VA 2G2YA 2UXDK 3QPIA 3CIMA 4MK7A 4EI2A 1G7CB 1JQGA 4DQSA 3QNNA 4K5RA 3KHRA 1MW7A 4HACB 3CJSA 3ZFVA 3MM6A 5DGAA 4FPAA 1QAJA 5M1QA 1SQFA 1HPMA 3ZSQA 1HQEA 2YX1A 4KQZA 2UUAF 1FDBA 3GTYX 4LH4A 2UU9F 3AV9A 4CZHA 3D1OA 2FHKA 4FSVA 1B99A 4OPHA 2CQ4A 3O9UA 5F9NA 2DEIA 3N4WA 1YJUA 4U9RA 4ZPBA 2EK1A 3LP2B 2BOAA 3HHLD 4P7TA 4WYBA 4M3UA 2GO8A 1S57A 4NL5A 4R8UA 5KG2A 1QD1A 2HBYB 1JMTA 2MKIA 2X74A 2BACA 1T3NA 1I94J 2HBRB 1CBKA 1YZ7A 2R7RA 2VG7A 2E5HA 5CR4A 1QAIA 1NUEA 2Z30B 3ZETA 3RAXA 2XC9A 3NMUA 1HYSB 4DBQA 4DN0A 3M8PA 3BBCA 1W2IA 2ZBQA 2N3OA 2QA2A 3D1HA 4LF6J 1K8KA 2BUPA 3M6WA 5I3QA 2NPIA 3D2FB 4IFEA 3CF5L 4WIIA 2G0CA 4X84A 2BE9B 5C42B 3BPDA 1U26A 2MJUA 1LXJA 3OL6A 4MAKA 1R8CA 3MMAA 2NRHA 2GCFA 5KQ8A 4NA1A 1RWUA 4J2DA 1FWLA 3RG6A 5EGYA 3GZ7A 4FKYA 2ZKUA 2NRWA 2IHR1 1WSHA 3PY8A 1LAVA 1VQOS 1C6VA 2GV9A 4K2XA 3FFIB 1M1HA 2ASMA 4CFDA 1NHVA 4R0EA 2D0CA 3CFPA 4EFAC 1SIWB 1OY9A 2FF6A 2I7PA 3ILOA 4M3TA 3OXFA 4HYKA 4KV8B 4F0HA 5FDLB 2ITMA 1X5SA 3H5XA 3DKDA 2GWKA 3W8PA 1NLKL 3QIDA 4NLCA 2BJ3A 3D2EB 1I94F 1VCTA 2DIUA 3NAEA 3UFCX 4WTYA 4W5NA 3BP8A 1MU2B 2V8HA 1OIAA 3H2VE 3KOAA 4J8FA 1VQKS 3AQOA 2RNEA 3D4JA 4IFVA 2G8KA 4B1VA 3HL8A 2C2DA 1O8BA 2DYAA 3NGSA 4LF6F 1QTNB 4CI6A 4B3RK 3JYTA 4P2FA 4FOEA 4IJNA 4LF9K 3DGVA 1LWFA 3T1YK 4PABA 5HOOA 2UUCF 1Q7LB 5JVHQ 4K4ZA 2E44A 4KHRA 1DKGD 2AEFA 5KPTA 3PRDA 3P39A 1S6UA 4ZIWA 1TL4A 5J2PB 4ZVHA 2YWFA 2IA6A 4BRMA 2B5JB 5LSLA 2LEPA 4CCHA 2VWJA 4OZNA 4CLPA 1KLMB 3A12A 5JXSA 2A10A 1T3OA 3THXB 2G8IA 1D4XA 2V7ZA 1WEXA 1AZSA 4URSA 4L6V3 4P6QA 3FK4A 1GLAG 2W42A 4QW8A 1TU0B 3DAWA 4KFBB 4MIAA 2G8WA 1NSKL 4UZBA 3TVKA 1B3TA 4J9VA 5FIIA 2IYGA 5IWAJ 4KKOB 3VQDA 2RDIA 1RWOB 3AJ2A 4ZCIA 3CC4N 1SC3B 5K8MA 1FI4A 4CW7B 4WE1B 4YOXA 1UEKA 2EBGA 1S49A 1SJ4P 3NBPA 3I31A 4X4UA 4WXOA 4PZVA 1HQUA 2AP6A 3VGKA 3OYNA 3HXMA 1HNZK 2J9DA 5AQRA 5AQOA 4BC3A 2E1YA 4PPZA 1OWXA 3MFIA 2NXNA 4LF4J 1IR2A 3TSUA 3DHXA 2Z1GA 3KZBA 3EYZA 3IA0A 3O1WA 4CF9A 4ZA1A 4BE2A 1TKZA 1ZC6A 4NZ7A 3FJ2A 1S7IA 3OYKA 2DRBA 3VQPA 2QSWA 2I7NA 4P71A 5BPLA 2XI3A 4DX8H 1GLDG 1WLJA 1HNWK 2OYQA 2YHWA 4A2BA 3ZT4A 2GJFA 2FXUA 3A5NC 1VC6A 1FJ7A 4NLYA 3DI6A 2QWPA 1BQMB 3D0IE 3A0IX 3P31A 4U95A 5F2RA 3NOCA 4I56A 5DJBA 3H40A 3BGRB 1V4TA 4FL9A 2BEFA 3CG7A 2LXFA 3BGFA 4FM1A 4X62J 4EEYA 3LAMA 3Q7CA 4KRFA 4E89A 2YNFA 1EETA 4K25A 3BZCA 3CJQA 2DGUA 1DBDA 4O23A 3KLHB 2BX6A 4GV6A 2CQ1A 4FJ9A 1PYOB 4BE1A 3KLGB 1C4AA 3P5TL 4DXLA 2QSFA 3J81j 1M1GA 4I6WA 4OYOA 2F5GA 3L7PA 2LMIA 4P2SA 4NMXA 1UVIA 3NMAA 2O8BB 3S41A 3IUCA 3C95A 4QW9A 2XY8A 2DXFA 1Q86O 3B8AX 2KHDA 3ZT1A 4CZKA 2YJFA 4GRSA 4UOGA 1U1MA 4FZVA 2UUAK 4BBYA 4LF4F 3O9SA 2IVOA 1RBUA 2OP5A 1S3XA 4ZCLA 4BG8A 5D0RA 4CIOA 3BJYA 3CCTA 5GAGU 3RRGA 4JI5J 1F21A 5ADXH 3G96A 1P9YA 1YJWS 1IVZA 3IR7B 5I4MA 2JH3A 1F6TA 1AT1B 3W8GA 4RZRA 4FDFA 3CF5Q 4C3KA 4I9QA 1EB0A 3H46O 2LEBA 4DV5K 1TL1B 3T6JA 4GO5X 4QS7A 1WDDA 4QPTA 4ELVA 3RSEB 4NX9A 3SAGA 3VQTA 4HUGA 3VENA 1DY3A 5HATA 3HO1A 2HHXA 3GIKA 2C2RA 1ZH5A 4I69A 4TLQA 1KBRA 3GL1A 3GJQB 4H0TB 1RGVA 3ICLA 2P9KA 3D45A 3VQ5A 4WP9A 3EKUA 4GVMA 1A5VA 1NAQA 1TV6B 4M5KA 3C14B 1REVB 3IG1A 3AO3A 4DN9A 3NS5A 4H4KA 1WOOA 3ISNC 2AU0A 2FF3B 1JJCB 2YX7A 4F7VA 4PQAA 1N34K 1RTIA 1IKVB 2WOMB 2IC3A 2DHGA 3TZYA 4NO7A 5KOXA 1B4SA 4MKAA 2O4IA 5LMUJ 2PDAA 3NF8A 5HJXA 4FYYB 4FO0A 4KR0B 2ADCA 5K8NA 4KH5A 2PZSA 4FLYA 1R0CB 5C7PA 1HLUA 3EL2A 3FBFA 1S6QB 2HNZB 5AFUH 5L1JA 5J2NA 3V4IA 3UE2A 1Z2LA 4UOHA 5LJ3Y 1RT3B 2KB2A 1N5YB 4JI5F 3N4PA 2A1SA 1XMOF 2YNGB 4Z7CA 3ZXWA 2C2MB 3I8DA 3JQKA 5BR8F 1NKEA 2RD5C 2HIYA 3G2XA 2Y9HA 2W01A 4J5OA 1QVGR 2ZITA 3AOCA 5C25B 2JEFA 3VGLA 1RTZA 2LXIA 4RWWA 2D9OA 1WSJA 4JV0A 2Z57B 4Q8FA 4B9NA 1X4BA 4HWIA 2GHWA 1Y11A 1N88A 5KG5A 4J9NA 2WSFC 2QGFB 1U0SA 2K7KA 4FJLA 3IGNA 3V9ZA 3UR0A 2NRRA 3CJ8A 4FW2A 4M8LA 4ITSA 2O8FB 3AAWB 1I1GA 3L2RA 4F4YA 2GQ2A 2YPZA 4JEPA 4B8AB 3HFZB 4FW1A 1E6VB 4LF5J 2UUCK 2Y8WA 5KT6A 4WFNQ 1T02A 3C15A 1EWRA 2GJIA 3U9ZA 3SI6A 4CWBA 1S99A 3EVOA 1U7LA 1FRHA 4V1Ak 4M42A 1J2VA 5LMUF 3V9WA 4FYDA 2KFZA 5JJBA 3GV5B 3VAMA 2IRUA 4OZ3A 2P9NB 3QBXA 3VEWA 3DFEA 4KTQA 1B0VA 2QW9A 2FC0A 2YI1A 1S0MA 4LBIA 1ZETA 3HHLB 5ETPA 5C15A 1PGZA 4EK2A 3NEKA 2XS5A 4E1MA 3N4QA 1C1CB 1HWUA 1XMQF 3MM6B 5KT4A 2FVQA 4CZFA 3U3GA 3BF4A 5DG7A 1RDUA 1UVLA 3BS9A 4LC9B 2KT2A 1HQEB 6AT1B 2VIHA 3C6HA 2R2RA 5IM0B 5HQ8A 4K41A 2BJ1A 2CDRB 3G71N 4PQUB 1DARA 2RRNA 1YJ7A 3LPUA 4ZP9A 1HNXJ 4A59A 1VRQC 2Y1JA 1UFLA 3PEJA 2K1RB 2OSRA 1VGYA 3TVZA 3FZLA 4IOCL 3DN9A 4QIVA 4J2AA 4ZS6A 4H5RA 2Z2LA 5C24B 2JEGA 2W40A 5HMZA 1N48A 3CHWA 4CE9A 4LF5F 4FNIA 3ENHA 1X5TA 1NO8A 3DMJB 5GAGI 4JI2K 5H9EJ 5JS2A 3KHLA 1YGYA 3ZETB 1RB0A 3W0LA 1QY7A 2B7CB 1KVCA 3LP0B 1QAXA 3EZUA 1T05A 2AF6A 1K8KB 2BQUA 1UJ5A 3CXCM 1AXQA 2GV1A 3I33A 2NYIA 1EQYA 3HFKA 1RT7A 1KHVA 4OZLA 3S3MA 1M90O 1K9MT 2DR8A 5IQ6A 3I0SA 2RF2A 1XJWB 1YXQA 5AQSA 2MDAA 1Q78A 2Y0SD 1U1OA 1L3SA 2WC9A 4NXNF 2FHJD 4I2PA 5F3ZA 4YORA 1VQNS 1WOPA 3ZC4A 3GJRB 3TP2A 5BPMA 4NLDA 4DHYA 4LRFA 3DXMB 3MD1A 1EP4A 4CM2A 2QI2A 2ZNZA 4RNFA 1S9EA 1LQ9A 2DIVA 1PILA 2F63A 3NH2A 2VG5A 1OKJA 4H0XB 3RW7A 2IOCA 3VZIA 2IS3A 3RW6A 1HNXF 3OD2A 2L41A 1UJ4A 3GSDA 2HHSA 4CJEA 1VRTB 2G2ZA 2XSJB 2QWOA 2BTFA 3VGVA 3CDUA 1FESA 5G4DA 1FXXA 3W60A 4I2QB 3VVUA 1VOMA 2VDHA 1QQNA 2A3ZA 3AT1B 3SUNA 3CULA 5DDOC 2M70A 3CB4A 4EBDA 2G9OA 1IWGA 4B1XB 5BN8A 2OD6A 3KD5E 3DLBA 3R1LA 2VFSA 4EP4A 4F3TA 1Q8LA 3VN5A 2GUPA 2FY1A 1M1KT 2GJ2A 2Y8YA 3PKYA 5AJ3K 3MM8A 2W8KA 1XN9A 2QT7A 4URQU 4YN3B 4BG9A 4WK3A 4AT1B 4DR7K 2QV6A 3QAUA 2YKPA 3JSYA 1H6KX 4CJRA 1KN6A 3MMCB 4NZ0A 1A6LA 2V50A 4O5BA 1DQ8A 1LWFB 1JLQA 2ZM6J 2C3YA 3RTVA 1IJEB 4I6MB 1N6QB 3R5JB 3TABA 4ENOA 2W41A 3NG8A 1X7VA 4C6AA 3MM9A 2AJ4A 1HBNB 3M4XA 3H1QA 2E88A 3C6TA 4HH0A 3W1YC 3ZO7A 4DUYK 1U1NA 3EWGA 3QERA 2NRZA 3ZX2A 2ABYA 2EX3A 4EZ6A 4B3SK 2XHCA 4AL7A 4QQBA 2YPYA 2Q3SA 4M63C 2V0NA 1X31C 3SQ1A 3SV4A 3GB0A 1JLFB 3OXLA 3J81Y 1GXUA 4YOWA 4H4OB 2CKWA 1S0NA 2IM1A 3KK2B 4C8YA 1RHUB 3TUIC 1UZHA 4HHHA 2B4VA 4CEBA 4P2XA 4ECTA 4R79A 1VQPS 2ZWOA 4CNZA 3OA9A 2PA3A 3ZZ0A 1V4SA 4TQSA 4I7FB 1DRZA 3ZX0A 4U7BA 1VRUA 3VWSA 3W9HA 2AGQA 1H2VZ 1UAWA 1S5ZA 4DL5A 2QO3A 2KXFA 4X4TA 4ID5A 4O4GA 4Y00A 1H7XA 3UKRA 1H73A 2B3TB 4YDXA 3FSYA 1VBXA 4JI5K 2D0OA 1RDAA 1XMOK 3W9JA 2M2BA 1RA7A 3ZZUA 2WBRA 5BR8K 1BU6O 3H3OB 2RDDA 3R5DA 3L8BA 2GWJA 2P9CA 4JI3J 2DNMA 2LQJA 1U0HA 5JS1A 4X66F 2MQQA 1JB0C 1GOBA 3W2WA 1AW0A 2JFDA 2MPUA 3OR1B 3D66A 1RUSA 2WB1D 1TKZB 4X4OA 4ZVQB 2HHUA 5D6GA 3HPGA 2JFKA 3KUHA 2ZC3A 4JV2A 3QT5A 3WXKA 3AB4B 3BEXA 3IRXA 2Q43A 3BN7A 3EGZA 1PAEX 2IJFA 4CBXA 4M5DA 3WIUA 2CQHA 2ZDOA 3K0SA 1NJYA 4GVEA 3EGNA 3SQGA 2HK3A 3VGUA 1B92A 4OPAA 1S9GB 4ISFA 1M5PC 1YI2N 4FWPA 1BWEA 1HR0J 2ZOMA 4RUBA 2EFVA 1VIOA 3GFHA 4X4SA 3MWBA 1ZTWA 3T19A 4KH1B 4PHTX 2YNFB 3O2IA 3OV7A 4DMZA 5LMNJ 2D69A 2DVIA 3MPDA 4TVAB 3S1TA 4KAZA 5HLFB 3PX4A 3CDEA 3QZ8A 2KT5A 4IOAQ 2C22A 5IXUA 2FGCA 3CCWA 5KFPA 1WD6A 1LW2A 2ZJPL 2CQ3A 4FZXC 4FVUA 3TZXA 2FC8A 3C2PA 2R7TA 3SPZA 1XMQK 4CIFA 1E6YB 4YFUA 2CG8A 4JI3F 3B4MA 2BJ9A 1Y7PA 1R6VA 1NK6A 2IJNA 3A13A 1CZAN 2FDNA 1JNRB 4ZVRB 2JSXA 2KZMA 1QUPA 3M2VA 3ETOA 2HFVA 4JI0F 4PA1A 3SCJE 4ETXA 4FLVA 3R1HA 5HROA 2NXCA 4HT7A 1U25A 4U8YA 2HYIB 4ECZA 2C1EB 2CQ0A 3UNYA 3HBTA 1T9TA 2V67A 2WZ1A 2FLNA 5HAOA 3LPEA 3C66A 5C0YA 1H74A 3Q8SB 1BISA 4CGDA 3ZNUA 4O44B 3FRYA 1VQMN 3MUTP 2E6MA 5ETVA 1YIJN 3KNAA 1HR0F 4FLTA 2MZ1A 5SUHA 1UA1A 4EHTA 5L9XA 2K3KA 2RPIA 3VQ6A 4DSJA 2UVUA 3RR7A 4E19A 5LMNF 3CCQN 4M7XA 1YRTA 4CK2A 1RCHA 4MH8A 3EXYA 4B3OA 4I67A 1TAQA 3FLCO 4YY3J 3H8YA 3MEEB 2IC3B 3I96A 3BO2A 4NXNK 3CJ3A 4ZPDA 3SJJA 3OL9A 4MIWA 1WEZA 4BRNA 3CE8A 2J6SA 3NGDA 4QPXA 4UQTA 3EO3A 2B6AA 1C0TB 1IR0A 1BMQB 3G87A 4L76A 1ZXOA 3SFUA 1JL2A 3AXKA 1KR4A 3AVIA 4OFZA 4OQJA 3LUYA 3FBEA 1VAZA 2QFIA 1H1VA 1HNXK 3HP6A 4BR5A 4ED4A 2NNWA 2VGMA 3TARA 2XB2D 2B8PA 4Q0BA 1JJHA 3PFOA 4CDIA 3GV8B 2M88A 1FE4A 3THTA 1BIZA 1BQNB 1JLEA 2VDIA 2V68A 3CQYA 3LL3A 3MHYA 1NK9A 1KTVA 1HRHA 1HD0A 3IKMA 4RWTA 3IAYA 2QA4N 3LDLA 1Q16B 4L8RB 2W2NP 5ELZA 9RUBA 3W63A 3WEEB 3VEVA 4A8WA 1FX2A 4JKEA 5AT1B 3ITHB 3CCEN 3QJPA 2HNDB 2MLYA 5DQHA 2DRAA 3HVWA 4C8LA 2V63A 5IFMA 4NLBA 4EGLA 3F73A 4DDFA 5J2QB 4C7QA 4LF8J 4Y1CA 4X65J 3CCVN 2PGCA 3B78A 1GTHA 3G4SS 2KJVA 4CGHA 3WQPA 1X1PA 1RAEB 2RKIB 2A42A 4LH5A 5F8JA 1EHWA 1NGCA 2CQGA 2VBWA 4OV1A 2AX0A 4DV2J 4KBOA 2BRKA 2FBXA 3DYAA 1D3WA 1FO1A 3POTB 2Z58B 4Q2LA 6FD1A 3MCAB 1PKUA 1QAYA 2EKYA 3VF6A 1JLAA 4YB1P 5KRTA 4C0HA 1Q81T 4ICLA 1VQ4N 3LWMA 3N0VA 3OYMA 1DHMA 2UXCJ 2VZ9A 1NLVA 5TKYA 3O3FA 1T9VA 2BZ2A 3D6TB 1RBAA 2AD9A 2CJKA 5F8HA 2DHSA 2IM3A 1B9FA 2JHEA 3RB4A 2XGQA 1FK9A 2MKSA 5BPNA 3SNNA 2FC9A 4ID1A 5A2QY 4Q5VA 2RHSB 1WAJA 4LSLB 1RTHB 3L7UA 4JKGB 2AEMA 4QWBA 2JNJA 4DQRA 2DT9A 4KO0B 5BXIA 5K9FA 1T94A 1NDPA 3U1MA 2NXUA 1HFEL 2RHQB 2OGUA 4YR2A 4WCEQ 3QLHA 3CFOA 2IVFB 2A1RA 4LF8F 2DJWA 4X65F 4IKFA 2B51A 4ZKAA 4I64A 1LCUA 2FLPA 4X66K 1FKAF 3LOUA 3FR0A 3VCDA 1TKXB 4OPKA 2CNLB 3HOTA 3OVAA 1YLXA 5KFKA 4CJKA 1F1BB 3M5RA 2ZH1A 1RDRA 2IMOA 1IG8A 2WVFA 2EWHA 2P9UA 5HVHA 2XI2A 4KB0A 1I3OB 1PJ5A 2HAFA 3HMJG 5LJ5Y 2UXBF 3E01A 2OLWA 5K14A 3NCIA 1FD2A 1A9NB 1H2TZ 3S3NA 2RE2A 3THVA 4M94A 3PNIA 2V4QA 3NAHA 3I0SB 3TSQA 4HI2A 3ZNJ1 5T14A 1H2UX 4XPCA 4IOXA 1Q4RA 4CLFA 2QA4G 1RADB 2L9NA 2WCXA 2PBDA 2ZJPQ 6FDRA 2UXCF 4I2PB 3BQ0A 3CD6N 2CQ2A 2WW8A 3G6VA 5J1EA 3KUGA 4CTAA 3QFWA 5IT0A 1IG9A 4Y6IA 1X60A 3OT9A 2JEIA 3BO4A 3NY0A 1NK0A 4AE5A 3KJQB 1IM4A 1UETA 2ZH5A 4NYPA 4O0JA 1F5BA 2PYLA 1JKHA 4F4KA 1VJQA 2AEJA 2O3DA 1RDCA 1T9UA 2IVMA 4CJWA 1R8BA 2BKNA 4RPFA 1GK8A 4AFFA 1LAWA 4JI3K 5HMYA 3CJBA 4Y0FA 2KJWA 2RVJA 3VEYA 2R7OA 2PA8D 3KD1E 3F9KA 2AYMA 3SBGA 1GMWA 1F2HA 3A8EA 4YEAA 2W25A 1UW9A 4JI0K 1XMBA 2Q2RA 2WVDA 1S9FA 2R8KA 5KFLA 2LLZA 3VGTA 1HHTP 3L2UA 1SV5A 4GMJB 4JI1K 4CGIA 1SH2A 3VR1A 4ECUA 3B82A 1RFQA 4FOIA 3KK1A 2O66A 1SUQA 3HZGA 3QT7A 3L95X 2R42A 4KH6A 4C8ZA 2HVZA 3F44A 2WB4A 1VQ5S 3MM9B 2CWXA 1RT1B 3OLBA 4DV0K 3FZ2A 1JLCB 4LFCK 3E9PA 1HR0K 3H20A 4LD0A 1NSAA 1NCLA 5KT7A 3OFEA 4IH7A 1P8ZA 3JQMA 2R2SA 1YT3A 4DR6J 3HDSA 4DV1F 3AAQA 1FRJA 4DZDA 3Q8PB 1CJUA 5L1LA 3QIPB 3V6DA 3MR3A 5KG7A 1YKWA 3IWXA 2J7KA 4XH1A 3Q2TC 1R8HA 2B9EA 2MXYA 2ZJQQ 5IC6B 4LF7J 4BVOA 3BM7A 3W5XA 3CI5A 2O8EA 2BV3A 1CJKB 4MTPA 2V9WA 2CQDA 3ZSZA 4ZOSA 5B0BA 4HUFA 1VRUB 4GO7X 4ZPCA 2BJEA 2PN6A 2VPYB 4RJVA 1ASUA 5AQHA 3UDLA 2Z1IA 1Q95G 4IH6A 5DM7L 4EFHA 4ID5B 2OPSB 1YJNS 5KFXA 4AH9A 3BEGB 3N5BA 1AA1B 4PXBA 5KT2A 2BBEA 3SQOP 1S1WA 1ZM4A 3TX0A 2YV0X 2NYHA 3PW4A 3TTDA 4KH0B 2W2PP 3OVBA 1U0HB 1Z2ZA 3BGOP 3QINA 3BN4A 2D0AA 3W2WB 1S0OA 1PYTA 2OEKA 1SH0A 5HRRA 5DZ7A 1KVBA 1RT6B 2HF3A 3NHGA 2EI5A 3SI8A 5ADZA 1R0BG 1R6YA 2VQFJ 3FZMA 3T7ZA 2EHGA 3GIIA 1KQGB 1VK0A 1X3NA 4DL0C 4DR6F 4QR2A 2NLWA 2EBEA 4DHVA 1ACMB 2E7WA 2AYGA 1T9XA 4CEFA 2FY8A 3KG1A 5CYMA 1U2FA 3GIMA 1VC5A 3CCRS 3U9DA 4W90B 4NB4A 1YJ9S 4LR9A 3LTOA 1D09B 4A47A 1MWMA 4LF7F 1LWEB 1SS6A 4CEDA 2DTJA 1YHQS 4M5NA 5TKWA 1FKPB 2KVIA 1VSEA 4YB6A 1QZ5A 1RBVA 4IFYB 5DDPC 3CTRA 2VC0A 1NHUA 1NK4A 3DRPA 2IAJA 4F4XA 2FHOB 2Q36A 1HWKA 3CJ1A 3UVJA 1RTDB 2BR0A 1OMSA 2HZCA 3EGVA 2DNZA 1RBLA 1ULRA 4JV1A 2OMLA 1NBWA 3CJAA 2W4CA 3K89A 2DGQA 3PLAA 3MDFA 2W2OP 1WKJA 4LRBA 3HI0A 2R9LA 5KG3A 1QUVA 3NH1A 2B4PA 2X1GA 3CCUS 1RAIB 3NF7A 1WHYA 1JWWA 4C97A 1S4EA 3Q2SC 5I3UA 3FQKA 1CULB 1WG4A 3ZZPA 2GEMA 4UY8T 3G10A 1F9FA 4MKBA 5ETSA 3OUYA 5CHCB 1RWVB 2YKMA 4WYWA 3AJ1A 3HX9A 3QT6A 1KVJA 3VV2B 3AOBA 3GCWP 3UKUB 4Y2CA 3SDEA 3ZT3A 3MM7A 2R8HA 4XDCA 3VERA 4OIXA 3ZX3A 5B09A 4OKKA 4DV7J 5ETRA 4UY85 1Q5VA 1B7YB 1F3VA 2ZHOA 2LDIA 1TFWA 2R8GA 4XPEA 3M6VA 3PO4A 4W98A 4FN5A 1RXOB 3GFXA 2DH7A 4B02A 3H7HB 1Y5LB 2UXBK 4OKJA 2EVZA 1D0EA 3HK2A 3TUZC 4JKHA 3OS2A 2HQDA 3VF0B 1AUDA 3NNHA 5DDRC 4DTPA 1UVMA 1TUVA 3LDPA 2XS2A 5ETMA 3H90A 1U1RA 5DK5A 2ALYB 3BR8A 3SMPA 2BM1A 3SQ4A 1GX5A 2VOOA 1REGX 1WUAA 2UXCK 3PIOQ 1WF1A 4Y65A 4ANCA 4JKCA 1Z6RA 4V19X 1RU2A 3NMRA 2UUBJ 1VQKN 4OX8A 3B6OA 1RZMA 2P9LA 3AO4A 4R5PA 3PDNA 1R0AB 1VQ7S 3I55S 4ECRA 2J9EA 1NB7A 2KRRA 4OYWA 1QM9A 2BQ3A 1FF2A 4CJ3A 2ROGA 2PC6A 2GMJA 3VEXA 3ILIA 4EWTA 2IDOA 2ZH3A 4FJ7A 3TOQA 3Q8UA 2PY5A 4PWDB 3BB5A 3J8AA 3Q24A 3NF9A 2HGLA 2Q97A 3DLEA 4DSFA 2XBPA 4CZGA 4KT0C 5BR9A 3D0HE 3FE1A 3NLCA 4NOHA 4CZCA 4CO0A 4A46A 4DV7F 4ZVPB 4C4WA 2MKJA 4NA3A 2VBYA 3K5MA 3HHDA 2X6NA 4FZYA 2E6LA 3M32A 3MGJA 4F26A 4BWMA 3GSIA 3C7NA 2LEAA 3EDQB 4CEOA 1ZA1B 1EQ0A 2I0XA 1VIXA 3DGPA 4DPXA 4DTNA 2J8AA 4C2MA 2FLOA 1ESVA 3FCVA 4RW9B 4DL2A 3R5BA 2RT3A 2K2PA 5CCLA 5F1XA 4RW8A 3SBTA 2CPJA 4H5WA 3K2YA 4WF9Q 2MKYA 4JHDA 3KLIB 3H25A 5SZTA 4XAKA 4FWLA 4HH1A 2KLAA 4DPOA 4PUOB 5AE2A 3ILLA 2UUBF 1ZBIA 4ZP7A 4M3ZA 4DV1K 3R3LA 2EXUA 3GE1A 1VMBA 5K5MA 2R7VA 2KW4A 1PG5B 4CJ4A 3M2UB 3ZEUA 4BY9C 5C2DA 1ZTTA 5T41A 1OQ3A 3DLKB 4IR1A 4ICLB 3OXGA 2NZTA 2OI2A 4E98A 5U47A 2F8TA 3PX6A 3MMJA 3WC0A 2ZVSA 3MXIA 3U1NA 3HM9A 1WJ9A 2XEXA 4FM2A 1NGIA 2XM3A 3NNCA 1R27B 2RB7A 1BCOA 3WNEA 3O1LA 3PRBA 1WSIA 3K57A 4LFAJ 4KY3A 2QLFB 1XTZA 4BRKA 2XZDB 5DQGA 3M9MB 4L3KA 1YF5L 4TYBA 4CFCA 2MLZA 4ECWA 3VZHA 4X64K 2CADA 3M1VA 4QIGA 1HBOA 2KTQA 1RAAB 2X51A 1CC7A 1RWPB 2V34A 1RT2B 5IQQA 3OYHA 1XR5A 4ECQA 4DR4J 3MMBB 4CP5A 3ID8A 2QL5B 4PEOA 5D0EA 3VA0A 3EE8A 1NEEA 3THYA 1L5UA 4UUWA 4CF1A 5C12A 3I6PA 1UA0A 1HMVA 5EU7A 4CJ7A 5EX3A 1UJ6A 2UUWA 3SMZA 2XWYA 2HBKA 4CO4A 2P9UB 3S8SA 2POKA 4NCGA 4AILC 1K9MO 2QZ8A 2J0XA 1NZAA 1GOAA 4JUZA 3PSFA 2YX4A 2ASPA 4L73A 1QQOA 3KMSA 5L38A 3ILJA 3NGTA 2DNLA 5AZJB 1YBUA 3AVLA 1YVUA 1FCAA 2OTLS 4DV3J 1K0TA 2U2FA 2V5HG 5THWA 1M5SA 2K06A 2JGUA 5A8KA 4DTMA 4ZTJA 4QS8A 3OL7A 2ASJA 4JV5J 4S0MA 4DV4J 1RU1A 3IMXA 1EIYB 4CHOA 2BDPA 1GLBG 4K8ZA 1Q53A 3B54A 4ZVGA 1CEZA 3QRPA 4DJBA 1J6ZA 2DY4A 1QTMA 3OYBA 1S76D 1U45A 4NYNA 4PRFA 3OS0A 3V81A 2GMHA 4ZPVR 2F65A 4IDHA 2YKNB 1G2EA 4LFAF 2NZ4A 4WU2A 1YJWN 4PWUA 2HBZB 4B9LA 4B9MA 3T1HK 3MAQA 1NDKA 1PO6A 3EZ5A 4OHVA 1ITGA 1C0UA 2RSQA 1FFWB 4Z0UA 2HWHA 1FW6A 1JXEA 2JWLA 1WF0A 3NL0A 2MKCA 1T03A 1M1KO 3HSGA 4DR4F 3V2UC 1VHXA 2E9TA 1U4BA 4AM6A 3MUMP 3OR2B 3CCJS 4IO9Q 3OHRA 1C1BA 1CG2A 3VAIA 1MNEA 1FXLA 1SC6A 3GFYA 3ULEA 1U6FA 4TYAA 4IEEA 4DQ8A 3THPA 1SV5B 1V5IB 4A5AA 4Q43A 5M2RA 3CETA 3OVNA 2ZE2B 4LT6A 1HKAA 5F3TA 4TY8B 3I87A 1O51A 4ATNA 3J7YU 2X1AA 4XTTA 4FJXA 4DV3F 3MCSA 5D77A 1MROB 2WHOA 4HACA 3MD3A 1RCOB 4JV5F 4DV4F 1UFWA 5DS7A 1D9AA 2R4FA 3O3HA 2W4PA 1VI7A 4CJVA 5KG6A 2WTFA 3NRBA 2ZH4A 4K4XA 3CERA 1ZS6A 3A4TA 3FDSA 1VC0A 5K8OA 4CLSA 2HLTA 4NEZA 1TK5A 1RHMB 3SFGA 2OHDA 4EZ9A 4OVLA 3TW0A 1WSEA 4CD3A 4C0BA 3BUZB 3K9JA 2QYGA 2O67A 3J81O 2QWNA 4GVBB 3AODA 2RIJA 3TWZA 5HK4A 3PJ9A 2PYJA 1M5VC 1HYSA 1UOCA 3ID6A 3JAMU 2VASA 3MZIA 3O5TB 2RQKA 4DI6A 5FLXU 1D1UA 3DDIA 5DRKA 3WX8A 3D2FA 3W66A 2KM8B 3GCXP 1SKUB 5LOQA 4I68A 4BR7A 4QWCA 3VQ9A 2NRXA 1BQXA 9ATCB 5C42A 4RNMA 1IKYA 2EFGA 1IM6A 3QGHA 4YDDB 1FJCA 3HCXA 3MF5A 1FD8A 1M90T 2XGPA 3TUPA 1C0GA 5HSPA 4DV7K 3KKSA 3D6RA 1GLFO 2HVDA 5B0CA 1Y3KA 3W7BA 2DK2A 4QYRA 1VSHA 4XO0A 3QRRA 2ATCB 2CQBA 4DSEA 1MDUB 2RAQA 4L74A 2K8GA 1S22A 3ISZA 4KV8A 1PIEA 4OI1A 5CYMB 1FDDA 1JCFA 3Q8YA 3FFKB 1V3RA 3D2EA 4XEIA 3C3LA 2F9JA 3K5OA 4LBHA 3MECA 5CYJA 4NRTA 1MU2A 4J7CA 1QSYA 4ED0A 1GFWB 2UUBK 3GYGA 3QJJA 2IVNA 3R6GB 3KMQA 3UIQA 2Z4PA 4J9MA 2ZJRL 4IR9A 5B0DA 2ZOFA 4W5OA 4DL7A 4WKYA 1P27B 4NASA 3RBZA 1N36F 3ATUA 2PFFB 2HPUA 3VQCA 3ULDA 2DGOA 3DDNA 1LEOA 1X8DA 2QEXS 1H98A 4WQ5A 1JLGA 3GU0A 1WF2A 4JI7J 3ZZYA 3N01A 4LIWA 3FC9A 4OGCA 3U3YA 2DGSA 2XSFA 5KFWA 1FHTA 5J2PA 4N77A 4CF0A 2B5JA 3K9KA 2AZ3A 3TNVA 4H0OA 4CFBA 1W2BM 3AVGA 1FT8A 2O1PA 4WZMA 3PW0A 1CJTB 1VBYA 3CIPA 1KLMA 4M5HA 5KFMA 3TQEA 4J9KA 3NAIA 3EEQA 2OELA 3G6XA 3MMVA 2CAJA 2GC8A 3P96A 1FRMA 4N47A 3NGYA 3JSRA 1Y9OA 3FCWA 1TUWA 2M7SA 5HL7Q 2KHOA 4CT8A 3AVJA 5BYSA 1FRXA 1H72C 4L72B 1BDGA 4E8UA 4RKUC 4KKOA 1TL7B 2VFVA 1VQNN 1NJIT 3TZWA 2FJAB 3WDOA 4ZPWR 1HPZB 4WE1A 1KLNA 4DV6K 1PAUB 4IOBA 2D3ZA 5D4LA 3L9ZA 2HOEA 1ASVA 4GKKK 5EWFA 1NG9A 4LSZB 4C11B 2PMWA 2BKPA 2E1MC 4JP8A 2IIRA 2C2EA 3PCOB 1QHAA 1Q82T 1KFSA 4IBNA 1UVNA 2HBMA 4DL6A 3DRSB 1DURA 3IS9B 4QOTA 1U02A 4JI7F 4Z2XA 4FBTA 2NZCA 5A8WB 3LH2S 4WU3A 4NYOA 4WKRA 2F7TA 2EEYA 1RT5B 3TAQA 1NGDA 4LFAK 4B3RJ 2W7PA 3PVXA 3RJMB 1JCGA 4Z37A 3CCSS 2E7XA 4LF9J 1NGJA 1WC4A 5F0UA 4K4TA 2OZSA 2H65B 4BGBA 5ETOA 3L7OA 4WQ5C 4UZCA 1XERA 2ZH2A 3P4IA 5AE1A 2OD4A 2XS7A 1XR6A 2PEHA 5A8RB 3T5KA 3SV3A 1BQMA 4QWDA 4DR4K 1ZAWA 1RAOA 2BUNA 3OTEA 1BLUA 1RT4B 3BGRA 3P1GA 2PI5A 1QDUB 3MEGB 4ALZA 3K8WA 1LWCA 4ED2A 1YRXA 1TVRB 2YKAA 3KLHA 3B8HA 2W2MP 3KLGA 4OHWA 2VQEK 4IQXA 2GIRA 3OTOK 3CM6A 5KG0A 1KOOA 2LCWA 1U1QA 2DNKA 3LA0A 3A8KA 2ZUGA 3KHHA 1VQPN 5JLHA 3IM8A 2WFBA 2O8BA 4YHHF 2EFQA 5CYQB 3SQ2A 4EP5A 4RW8B 4CRJA 3I9V9 2UUTA 4JV5K 3A8IA 3PTWA 3TYTA 2VV5A 3AA4A 2ZZNA 5AXNA 4CECA 2ZBCA 4N8OA 3V6HA 4HKQA 1SPBP 1DFDA 4J2BA 3JAMO 4IWVA 3CC2S 4Q45A 1S1UB 1Q81O 2LQBA 4RNNA 3UCGA 3S01A 4LFBK 4B3RF 3QWPA 4M95A 2IRXA 3I0RB 2CZ4A 2G0JA 4LF9F 4IRDA 1TL1A 2QIFA 2X6SA 2HIQA 2C2ZB 3FUYA 1ZAVA 1VSDA 1KQFB 1NMEB 4BRIA 4CHPA 1P6TA 2KXNB 1EXQA 2CIMA 2LA6A 3MTJA 3OQ2A 5KFNA 2LQ9A 2QM1A 2J76E 2B7BB 3R6LB 3KLEB 2CGLA 3M8QB 1TV6A 2Z1HA 1LWXA 3RU0A 5JVHL 1HNWJ 1REVA 3M1VB 4FK4A 1HBOB 4K59A 2EFNA 4KHYA 3GWCA 2C3UA 2D7SA 3AA8A 3DLRA 4FWOA 3MEDB 2BMBA 1IKVA 2WOMA 1V6HA 3IBFB 1MN7A 1ILYA 3KTQA 4ES3A 5AQIA 5KT3A 2BRLA 3RB0A 4LRAA 4Q7AA 2VL1A 3G8SA 1HUXA 4DSLA 3VAFA 4ZHRB 4NCGB 2OMOA 3IBWA 2MMYA 1MWKA 3JS6A 3MOZA 3RGIA 1HBUB 2N7CA 2HKEA 3W3SA 1RT3A 2PSZA 2ZBIA 5C5JA 3KHYA 2YNGA 4NLVA 4M3YA 4KPCA 1NKBA 5BRHA 2N3LA 4F0KA 1PCAA 4JI6K 1FTRA 5C25A 3IAM9 1YJRA 2UUAJ 5KFAA 3QMQA 3KJVB 5BRDA 3VQSA 1RHKB 1HI0P 5KPZA 2HWTA 4TY9A 3AVKA 3LP3A 2QXFA 1NJZA 3CIZA 1KWMA 5DETA 3BQ1A 4USTA 3D7SB 4MDAA 1N36K 3GIJA 4BDZA 2HNYB 2JOQA 2VA2A 3O3GA 4DV5J 1HNWF 3CVKA 3EZOA 3QJLA 1E6VA 2E66A 4CNYA 1JJ2M 1LFPA 2AJQA 4YOEA 3Q7BA 3HHKA 1SH3A 2DGWA 2OIHA 1DTTB 2RHKA 2HW3A 3T9NA 3IR6B 3TTCA 4OZ5A 3MPUB 2J9CA 4K50A 1CPZA 4KHNA 3ULEB 2L3MA 2P9NA 2CGKA 4OI0A 4Z7YA 1R7IA 4NLQA 3CCMS 1EKEA 1L3VA 2MQNA 2HQFA 1NPRA 5CH7B 3BDPA 4UF4A 3HHLA 4MK8A 1EZZB 3MR2A 3U4LA 2E5LJ 2R2TA 3CMEN 1N34J 4U96A 5MLCQ 3EICA 1TK0A 3P45B 4H03B 3TO8A 3AAPA 2P9SA 5F8LA 1S1VB 4MYUA 4K8XA 1LFWA 1C1CA 4JN4A 2M4MA 3LDQA 4FJGA 4BRDA 1QE1B 3K58A 2QMUB 4DFPA 4BGAA 5IM0A 1DJ0A 2D3O1 4RUCA 4PQUA 1ZBTA 1YITN 3FVYA 2PD1A 2MQOA 1RDBA 3N6NA 2DGTA 5AQXA 4E7LA 3CCZA 1XUPO 4OLAA 5IT4A 2K1RA 3W62A 2FZCB 3P83D 3R2CJ 3S9HA 2YX6A 4ZLLA 1EX4A 4X4PA 1GLEG 3O6QA 1HI8A 5AQWA 5C24A 1WKLA 4DV5F 4ES2A 4E7JA 1D9FA 3MDQA 3SEOA 5HJYA 1S79A 3CMAS 5EX5A 4NLOA 2MZJA 3DMJA 5L39A 3NGKA 4JI7K 1IQZA 2FQQB 1T9WA 1RYRA 1Q9XA 4USVA 1G15A 4V19S 3LP0A 4DMNA 4DR2J 2HF4A 3IFEA 2MGZB 2DNRA 4PG8A 4MJKA 1T3VA 5E3AA 3JXUA 1U2CA 1WBDA 3E3XA 3LP1B 4K4WA 1S97A 5E26A 2UUCJ 1WG1A 1IKYB 2W9BB 5CD4A 1HW8A 1D9DA 3DRRA 1T6DA 2XY6A 3FGUA 3HVTB 2E5LF 5GAEU 2WONA 1FNXH 4LVOP 1N34F 3KJNB 4WFBL 1IR1A 3O4WA 1S1XB 1S1TB 1R8PA 4CZIA 2FGOA 3SZ2A 3DXMA 3CUNA 3L0QA 5ETTA 4LF1A 4BHQA 1XK8A 1YSJA 2QTWA 1BHNA 3RVCA 2AMCB 1BC6A 1X0FA 2R7SA 3K7RA 4WPAA 2QLXA 1Q1KA 1X4GA 3L2WA 1VRTA 3J7YP 2XSJA 3MN7A 2H48B 1WUUA 2LP4A 3Q86A 2XRIA 5KRSA 3OW2R 4YHHK 2MKHA 4I2QA 3KDNA 1TUYA 4ZTFA 5CAAA 2YWHA 4ED3A 2QFJA 3MECB 3THWB 2N4DA 2D1KA 4JAXA 1IBMJ 2EFOA 3RUBL 3KK3B 4ECXA 2GUIA 4DR2F 3BKUA 1FJGJ 1HKBA 3TJAA 1X5OA 2DCUB 3TVYA 1APSA 3J80U 3GR1A 2MKKA 2DXDA 1K1QA 5KFTA 2Z2ZA 5E5NA 4CJSA 3MMCA 4U7UD 2CWKA 4I6MA 2F1FA 1N6QA 4LRDA 4OJ1A 1JLGB 3M8WA 1PSDA 4JI2J 3ZTSA 5F8NA 1HBNA 1W0HA 3C0BA 1R89A 2JLFA 3AVMA 3ENAA 3VF4A 2ETJA 1NM1A 4UY8O 1FA0A 2VWBA 2Z2YB 1KC8T 4LRCA 4OLOA 4WQ4A 3I32A 3UN5A 1JLFA 4CHYA 4WFNL 4JI8J 4YB7A 5M1OA 4H4OA 3CSKA 1SL1A 3KK2A 2QLBB 2ILYA 2MLXA 1X9JA 2GFFA 3HM8A 4ZVUB 2JWNA 3BDEA 1K0VA 4OHYA 4NE9C 3SSQA 4I7FA 2OAUA 4EO8A 4HTJA 1I3AA 3CJCA 1IBMF 3OTCA 5RUBA 2GAHC 4DX7A 2V2KA 3R97A 3J7AN 3WIVA 4CH1A 1FJGF 3PHTA 2C28A 3UCZP 4E7HA 2BE2B 4M3XA 1QZ6A 2E2NA 5H1SQ 2GQCA 2YQ0A 5CZXA 3BR9A 4RW6A 1IJJA 1QS4A 1GAOA 1MG7A 2A5XA 2XZTB 3NGRA 4A4JA 2DGVA 3NCQA 3VQAA 2XG8A 1MMDA 3UCUP 2FLLA 2LQ8A 2HVHA 3GJTB 4CF8A 4TKTA 4JI2F 3DM2A 1NH7A 1RI7A 4PWWA 1MWZA 5B0EA 1BO5O 3OR1A 3SJHA 3P4UB 4U7CA 2GELA 1JLBB 5AJ3J 2HFUA 4FWKA 3AVAA 2APOA 1CZBA 1ATRA 3ZSOA 4K5SA 4DR7J 3UI3A 5HQMA 5E3CA 3OSNA 1FKOA 1WEYA 3BKFA 3Q89A 2P2CB 2PFDA 4I1TA 4JI8F 2HMPA 3RMCA 4PPDA 3CM5A 1IH7A 3D6MB 1VQ5N 5KFFA 2O5DA 4ZVOB 4CK3A 3QETA 1S9GA 3EVWA 3ENVA 4HL9A 1OS5A 3LZIA 4XDDA 4ZCMA 3MN5A 3JXOA 1S72S 3BY5A 3SSRA 2NXEA 4DUYJ 2CPXA 1GOCA 5FPDA 5CY4A 4CM0A 2QL9B 2ZWHA 2W1BA 5LJVA 2NPFA 2FD2A 4DS5A 3TJ8A 1ZBHA 4B3SJ 2PMZD 1C0FA 1HWIA 2E8AA 1LWCB 2X3GA 1M5OC 4F3OA 1Y3JA 3PFEA 2CQPA 1ZZNA 5HLFA 1KP6A 1GQEA 2JVRA 5DLGA 2U1AA 1AFJA 3T6BA 2FSKA 5LJWA 5E3RA 3AVNA 4DF8A 5BYQA 2CZ9A 3QEXA 2MB0B 4B9SA 2A6OA 1E6YA 4FBUA 3O44A 2DNNA 3PKMA 1Y5IB 4MMOA 3LGMA 3QICA 3NCPA 4MLEA 1U8WA 5E84A 3AD7C 4UT4A 2E7VA 2ACMA 5AJ3F 3PEHA 1YJNN 4NLWA 4NI2B 4FF3A 4CLWA 2E9ZA 3C65A 1XMOJ 4HHTA 2FBYA 4DR7F 1RAFB 3EJMA 5BR8J 1OVYA 1G6BA 1WNSA 3T5LA 2Y0BB 2VG6B 4O44A 2VOPA 1WC1A 4JKDA 2GBZA 3EDRB 3DC2A 2RU3A 4FWRA 3R8EA 3MM5A 4DUYF 4CZMA 2P5OA 1Q18A 1DLOB 4WFBQ 4EYIB 4YDUA 3ZSVA 1N8RO 3FZHA 5JMVA 2IY5B 4B3SF 1PBAA 5DQIA 1URRA 4LY7A 2DR9A 3OYGA 3JTOA 5F8MA 5BRFA 3AHPA 3MX2A 3MURP 2HQ3A 4CESA 2Q66A 3DNCA 2E5LK 5I9EB 3CCRN 1YJ9N 3MEEA 3U6FA 1RDWX 4NMLA 1CQNA 2ZH8A 4CGGA 3L4BC 2RS8A 2FBTA 2H5JB 2HS4A 1RABB 2QC3A 1C0TA 4N56A 3EVMA 1OH5A 2NSCA 5CQGA 4DFJA 3CQXA 1HBMB 4FJIA 1MMNA 5KFOA 2DGXA 2AYBA 2HFNA 3J80O 3EN9A 4CO2A 1UWBB 5D0GA 3N5FA 2QJ3A 1XMQJ 3PHEA 1IV0A 1BQNA 5KFEA 3C8YA 3M30B 5IT9U 3PYEA 1WDTA 2E5GA 2WBMA 5ETKA 4YNQA 1YIJS 3RBXA 3WEEA 4AM7A 2KFYA 2ROEA 1ATSA 4F36A 2A40A 4DB3A 4DR2K 3ITHA 1NXIA 2A1BA 2BA9A 2IBKA 3CCUN 3WNGA 2HNDA 1AYEA 1JX4A 1NWKA 1IWAA 1KVAA 5EOYA 1EARA 2QTDA 4ID8A 4LR7A 5EVZA 5J2QA 3M1FA 5AR0A 2VF3A 2NS1B 2PE8A 3ET6B 3FQLA 1FX4A 5KFQA 2D0BA 4DF4A 1NGAA 1GLCG 1F9EB 1TKDA 1G4CA 4JI4J 2QL7B 5LSRA 3LALA 3H2LA 2VH7A 4TU9A 4ED1A 2RKIA 1EO1A 3HULA 2EK6A 3DJCA 3VQBA 3SAFA 4KJIA 3CD0A 3MWPA 3OPKA 4EAHD 2W4DA 4QCLA 3POTA 4D3HA 2RQCA 1N33K 4OX7A 2ZH7A 3MTKA 2V6AA 3RBDA 2C3OA 2RMLA 4IDKB 1K8AT 4H4KC 2P9IB 2VYPA 4BRLA 3E9LA 3DLHA 4BS2A 4A8KA 3FMBA 1SAZA 5H9FK 1JL1A 2VCPA 3AO2A 3GR0A 2P9SB 2OPPB 2HHQA 2DPNA 4NXNJ 2KZZA 4V19J 4WP8A 4O0NA 4BC7A 1DTQB 3FNNA 3OYAA 1Q8KA 1RP5A 4JK7A 2GNKA 1W2BR 3G6ES 1UL3A 4MIBA 3ZCMA 2IBOA 3B6PA 3OYLA 1IBMK 4CZLA 1LXNA 4E2FB 3RMAA 4F2RA 4IOAL 4J91A 5B7WA 5M1FA 5IOLA 3EE9A 1FJGK 4LSLA 3HPHA 1RTHA 3F0NA 3D1QA 1Z1ZA 2WVCA 5FROA 4JKGA 3JSMB