5CYMA

Hiv-1 reverse transcriptase complexed with 4-iodopyrazole
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
556
structure length
546
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNDKLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rapid experimental SAD phasing and hot spot identification with halogenated fragments
doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 151
structure length 546
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5cymA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cymA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cymA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cymA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5cymA05
3QIPB 3PX6A 4FJNA 5DMRA 5J2NB 1XR7A 4DSEA 3ZT4A 4FJLA 2ALZA 1Q9XA 2VWJA 2XY5A 3SUNA 2B5JA 3NAEA 3BDPA 3V1QA 3OLBA 1W9HA 3ICLA 2Z1HA 4ID1A 1I39A 4K4VA 5KFFA 1NHVA 2D0BA 3MECB 2HMIB 4RNOA 4FLZA 4MIAA 4Y2CA 3V81A 1ZBFA 1KRPA 3OHAA 1JXBA 1T94A 2B5JB 3AV9A 3L2RA 2XWYA 5KG5A 1O1WA 1RDAA 4B3OA 4ZVHA 3AVIA 1TL3B 5KFSA 3ZSVA 3ZSYA 3AO4A 4IG0A 4TYAA 4CJ5A 3SPZA 2UUTA 3BQ0A 2C2DA 5CYMA 1X9SA 5I3UA 4NRUA 4IBNA 4Q8EA 2E6LA 3TAFA 1EKEA 4ZHRB 1S1TA 3DLEB 4BWMA 3NFAA 4CIGA 4J2AA 5F9LA 4PQUB 4ECZA 1DTTB 1SL0A 4NLGA 1C0MA 4KHNA 3PJWA 5C42B 3VQ4A 3KLGA 2HHTA 1KFSA 5DGAA 3IAYA 3HP9A 3BGRB 2G8WA 5J2PB 4NLUA 1QAJA 3BQ2A 2HHQA 5FRMA 1NHUA 1S9GA 2O5DA 4XPEA 1HQUB 3MEGB 2YHAA 5DG8A 5D3GB 1L3TA 3PO5A 3V6DB 4CGHA 3GV7B 4MK9A 3BR9A 4URQU 4ZVFA 3WNHA 3NF8A 3DLGB 1K1SA 4IH5A 4DL3A 1JLAB 3NAIA 3Q8QB 2X74A 3AVMA 4KHWA 2VA2A 5KFDA 3PW4A 4DFPA 1U04A 3P5JA 3M8QB 4KKOB 2IM3A 4W5NA 5L1LA 2VG6A 3RR8A 4EO6A 4IG3B 4DL7A 4KREA 3BJYA 4EO8A 4AHVA 4W5QA 1RYRA 3CDWA 3K57A 3V1RA 1IKYB 4IDKB 1RTHA 3B6OA 3K5MA 3FQKA 3ZSRA 3L2UA 3O3GA 1SH0A 2OPSA 4ZP9A 2BDPA 1JLBA 1HMVA 2IM1A 4DQPA 1IG9A 4RNHA 3H08A 4AHUA 3KTQA 4K4WA 3KKRA 4O3SA 4PUOA 3LZIA 4IR9A 2YNGA 1VSLA 4URSA 1SKWA 1LWFB 1IKVB 2BRKA 1KLMB 3OYLA 2R7YA 3TQ1A 2ASJA 1XC9A 1Z25A 3AVHA 5HP1A 3NAHA 3K5LA 3MFIA 4JV2A 4B8CA 3KHGA 1KTQA 4IQXA 4KTQA 1FK9B 3QESA 1IO2A 2OPRA 2B6AB 4ECUA 5KG1A 1RTIA 2IGIA 2D0AA 4ZPCA 5KT3A 3EY1A 3L3UA 4M3WA 1HRHA 1WN7A 3ISNC 4MKBA 3SNNA 3DRPA 3G10A 5CYQB 3Q8RB 5KT5A 4HHTA 5DLFA 1D0EA 2YNIA 3I5CA 5KFHA 3PX4A 4ED8A 5KFKA 4C8MA 1RTDB 1IKWB 1A5WA 4W5RA 4WZQA 4RNNA 1TGOA 3U6FA 2VWKA 2EC0A 2JLEA 1MMLA 4URGA 1BI4B 4N76A 1S0NA 2AJQA 1TKTA 5D3GA 3NDKA 2YNHA 4FK0A 3QYYA 4CGFA 4CECA 3SQ2A 3V9SA 3ZT1A 5DLGA 1XHZA 4J9NA 3JYTA 1LW0B 3CYMA 4CHYA 4DL4A 1S4FA 4Q5VA 3KHRA 4JRPA 3VQSA 4DWIA 4RW8A 2B4JA 3RB0A 1DTQB 2I5JB 2OPPB 2YNFA 4FVMA 3G0ZA 3CFPA 3K5NA 3AVNA 1T03A 4WE1B 3T5KA 4E7JA 4WE1A 4FJ9A 2RDJA 4OL8A 4QWAA 2UVRA 3NH0A 2P5GA 3DLBA 5FRNA 3KHHA 3K58A 1RA7A 2QE5A 5KG6A 2YNFB 1W0HA 4DLGA 1NK9A 4FLYA 3CQ8A 4DS4A 1RT4B 2YKMA 4IDKA 1YT3A 3OYDA 1RT3B 4DTPA 1D1UA 2HNDA 1LV5A 1SV5B 1NJYA 1KFDA 1C1CB 1JLEB 1GX6A 1SV5A 3TAMB 2W9CA 3SV3A 3TAMA 1NJZA 1ZETA 3NBPB 2IA6A 3OL9A 3DLRA 2XRIA 2XO7A 4XPCA 2GV9A 3QIPA 4QW9A 3M9MB 3PW7A 4KSEB 2ZD1A 3CM6A 3N6MA 4EZ9A 4E7HA 3LPUA 4FM1A 4K4SA 2W42A 4FLUA 4BE0A 1RT5A 5KTQA 4ECVA 1R0AB 1BIZA 4FM0A 2A1RA 1VSIA 4DSFA 3CJ2A 4TYBA 3PX0A 1KVAA 1TK0A 3V81B 1EETB 2O4GA 1SL1A 2OPQA 1TKZB 1TKZA 4CJQA 1NOYA 3HVRA 3SQ0A 5KG0A 3NKYA 1FKOB 4ECSA 1G15A 4B9UA 3RB6A 3KMQA 4E19A 4GMJB 1IKWA 5JS2A 3GYNA 3SFGA 3KLEA 3BSNA 3DLEA 1S9FA 3FDSA 3DI6B 1S1XA 3KLVA 4M95A 2R8IA 3T5HA 2HVIA 1HYVA 3SQ1A 2OA8A 3RRGA 1VSMA 3HXMA 3RBDA 4CFCA 2OPPA 2R2UA 1Q9YA 4N5SA 4CK2A 2QK9A 4OLAA 3AVKA 3QNOA 4FBUA 4C8LA 4IFYB 1LWCA 5L1IA 3BSCA 4QWCA 1KVBA 2DFHA 1RDRA 3TANA 1NK6A 1T05A 1Z4UA 3DMJB 4ED7A 2KFZA 3KOAA 4FZXC 3AVGA 4FYDA 4EP5A 4HTUA 4RW6B 5J1EB 4L8RB 4NLDA 4LD0A 3SFUA 3PJXA 4Z4HA 4CEOA 2GC8A 1K1QA 5FDLA 2RKIA 2HW3A 3JSMA 1ZBLA 1REVB 4MK7A 2WRMA 4IH7A 4LSNA 4G1QB 4N47A 4IKAA 1TL1A 1L3UA 1J54A 2RDIA 1FXXA 4ECYA 4QOZB 3OL8A 4FK2A 1RDDA 1JLBB 1HMVB 3DLKA 3E51A 4CEAA 1RBUA 1FKPA 3HT3A 3TVKA 4NCAA 4NLPA 3CJ5A 4NYZA 1ZTTA 1TQLA 2UVWA 1NKCA 5KFVA 2DFFA 2AGQA 1UWBB 3LP1A 4KV8A 4NLWA 3EPIA 4JS4A 4KBIA 3CVKA 5J2QB 1NK7A 3SI8A 3LP0B 2OPQB 3PVXA 1RDBA 4U6PA 4IOBA 3GIIA 4TN2A 4IFVB 4M41A 3G6VA 3GV5B 1WAFA 2VG7A 3ZSZA 1U45A 2R8JA 4Y34A 4NCGB 1RBVA 3QEVA 3KLIB 1JLCA 2V4RA 1QE1B 4ELTA 4DL5A 1HYSB 2V0NA 3M9NB 3AVLA 3ZSQA 2ATLA 4CCHA 4LSLB 4O4RA 1KCFA 3IS9A 4NLYA 3OVNA 2XI3A 3HPGA 3EZUA 3KHLA 4BE2A 1RT6B 1Y97A 1RTDA 4F2RA 3GQCA 4RW7A 1S97A 5C25A 1C0TA 4KO0B 1SL2A 3KLFB 3HYFA 5SZTA 3L8BA 1U09A 2J6SA 4B9NA 2VA3A 4DU4A 4YNQA 4N56A 4O3NA 4ED0A 5DGBA 3T5JA 3M8PB 5KFQA 3N6NA 1VSKA 3MEGA 1HQEB 1XHXA 2RF2A 4DEZA 5J2MA 1XR5A 2CJQA 1HPZB 4KAZA 2HMIA 2IC3B 5HRRA 3RWUA 1JX4A 3FRZA 4WFXA 4CJEA 4KHQA 1S0OA 5F8NA 3L3VA 3C95A 4DTXA 1RTHB 1VSHA 1ZBIA 1BHLA 4MQ3A 3HK2A 2FJWA 3D5MA 5KT2A 1EETA 3TAQA 2X6NA 4KTZA 4G1QA 3QZ7A 1KLNA 3Q8PB 4NLVA 2IBKA 3L2VA 1W25A 3K59A 4LY7A 3FQLA 3WNGA 4EYHB 3GILA 2V4QA 2R8HA 1S1VB 3OYHA 4CEZA 4OLBA 2XI2A 1HARA 2DPJA 5HP1B 4J9SA 3H4DA 3M8SA 4IFVA 3CFRA 3AO1A 3LDSA 1SUQA 2F96A 3NF6A 4PQUA 4TXSA 2W9AA 4Z4IA 4ZMMA 3KK1A 1S1TB 4XO0A 1VRUB 4Q43A 2JC1A 3CG7A 2Z1JA 3KLGB 5KFCA 3EZ5A 2HNYA 4I2QB 3H5XA 4FJ7A 4ECWA 2LSNA 3NF7A 1A5XA 1RT7A 1HQUA 2EHGA 3DMJA 4IH6A 4O3RA 5F8JA 2XC9A 2BQRA 3CJ0A 1D5AA 4CGIA 1JKHB 3VA3A 2JEJA 1JLAA 2BRLA 4B9TA 4ZVGA 4TLRA 3KK2A 2E4LA 3RBEA 3KLFA 1S6QA 3C6UB 1LWEA 2G8VA 1BL3A 1S1XB 4DS5A 4B9MA 4FBTA 4WYLA 4OJRA 5KFPA 4MFBA 1TV6A 3LANA 1TK5A 4EP4A 4TSXA 4R8UB 1S6QB 4DL6A 3VQQA 3H4BA 4DF8A 3ASMA 4KB7A 2IS3A 4DG1B 3HVWA 3OS1A 3H5YA 3NF9A 2W7PA 4DSIA 1GOAA 3ULDA 1ZBUA 2QXFA 4MH8A 4AHRA 4CEBA 1RTIB 2GUIA 3UR0A 5KFOA 3DOLA 4FW2A 3ZSWA 4WXOA 3GIJA 2QKKA 4ED2A 4J9OA 2E9TA 3H59A 1QS4A 4QWBA 1S9EA 3T19A 2ZE2B 4DL2A 3QLHB 4ZPDA 2HAIA 2AGPA 3O4NA 2D0CA 3QEWA 1R0AA 4EYIB 5CYQA 3OLAA 3IG1A 5KFNA 4CESA 4EBCA 4CGJA 4FXDA 1U4BA 4NLRA 4Z4EA 5KRTA 2F8EX 2D5RA 3V6JA 3MEDA 2FBXA 4YFUA 2FVCA 1MU2B 1QHTA 3KKSA 3AA5X 3HL8A 4CF8A 1U48A 4KPYA 3CM5A 5KFJA 4FLWA 3OYAA 1YVUA 4HKQA 4CF1A 1QSYA 3KD5E 2OH2A 3WNFA 4E7IA 2ZKUA 4ZTJA 4GC6A 3OL7A 3KK2B 2P51A 2HHUA 4KI6A 3RMAA 3OYGA 4Z4FA 5HRNA 4HVJA 3DI6A 3KD1E 4NCGA 3MR5A 4W5OA 3P83D 4OPKA 3E01B 3ZT3A 2PYJA 4PY5A 1WSEA 1N5YB 3HSTB 5JXSA 5T14A 4FLTA 3DLHA 5DG9A 1B9FA 4BDZA 3M8QA 4KKOA 2C28A 4RUAA 4YR3A 4MKAA 1DTQA 4AHSA 3PW2A 1TVRA 4R5PA 4CJPA 5KFWA 3H98A 3I5BA 3TARA 3D28A 1T03B 2R2RA 4IG0B 3QGGA 2XHBA 2Q3SA 2J6UA 1JIHA 3PUFA 4FJJA 3RAXA 4AHCA 4CF0A 1IH7A 1S1WA 3VQPA 4DFKA 1NJWA 2RF2B 1BCMA 3KMSA 3PR5B 4AH9A 1S48A 3OYIA 4M3XA 2CKWA 1OS5A 1UA1A 2B6AA 4J9RA 1UAXA 2OPRB 3KNAA 2XY6A 1UA0A 2WB4A 3OYMA 3QEPA 4KFBA 3QLHA 4FS1A 1F21A 2ZQBA 2VG5A 4ZPBA 3M8RA 1ZBHA 2KTQA 2FVSA 3HVTB 4DLEA 4PWDB 3V6KA 1BGXT 3LP3A 4QPXA 5KFMA 2WONB 3GIKA 1QQCA 3I8DA 1QTMA 1CLQA 3QNNA 3U3YA 1U47A 4JRQA 4FJKA 2YKNA 4XIUA 3RB4A 3KIOA 4DQQA 4H4MA 1ITGA 1EXQA 4DFJA 3MF5A 1CZBA 2HB5A 1JLFA 4CJFA 3PR4A 1IKXB 2W8KA 3D45A 1RBTA 3M9OB 4FLXA 5HLFB 2W8LA 3RRHA 3TAPA 4Q0BA 4J2EA 4Q0BB 5F9NA 4Y1CA 2AGOA 1TP7A 5KG7A 1JL2A 1WAJA 4DU1A 4E7KA 4Y1DA 4O44A 3OYBA 1RT2B 1C1BB 4O4GA 3VQCA 3SCXA 2P5OA 3QGIA 4ECXA 4RU9A 4RW4B 4LSLA 3I0SB 3NGIA 2KZMA 1SKRA 4HUFA 4IFYA 4DG1A 2GIQA 3G86A 3KLIA 2PZSA 5C24B 1VSJA 4BE1A 4FLVA 2OZMA 2XY8A 4CJ4A 3EYZA 1VSFA 1IKVA 1LWFA 4C8OA 1RYSA 1NOZA 2V9WA 3LAMA 4M3YA 4KRFA 4E3SA 2Y1JA 4B9LA 3VQ7A 4LH5A 5KFIA 3RR7A 3DRSA 5HBMA 3DYAB 5HRSA 5T7BA 2IOCA 2XGQA 3DRRB 3I0RA 2HNDB 3HO1A 4ZPAA 2ILYA 3MXIA 2ZD1B 2WHOA 3LAKA 4FZYA 4WFYA 3DLKB 1BQMB 4FW1A 3M8PA 4F3TA 1RT1A 3QETA 4CJKA 3CIZA 3RAQA 5KFUA 4CEFA 3NHGA 3MECA 4GW6A 4F8RA 3UPFA 4LH4A 3VQ8A 1C0UB 1KHVA 1RDCA 3MR3A 4CGGA 2X78A 3NGZA 1DLOB 4E1NA 4Z4CA 1RTJA 4LQ3A 2DY4A 3V9UA 5KG3A 1L3SA 2XGPA 4FJHA 4FJ5A 1WSGA 3OYFA 3VA0A 3QGHA 3DOKB 1X9WA 5FROA 2D41A 5KFAA 3MEEA 2AQ4A 4DSJA 2A1SA 3VN5A 2I5JA 1TKTB 2YNHB 3ZSOA 1YTUA 2BANB 2X6SA 3OYCA 2DFEA 3VQAA 2BANA 3K2PA 4I2PB 3GV8B 2R8KA 4M3RA 3I5AA 4R0EA 1EP4B 2IAJA 4I2QA 1RA6A 1D8YA 1NK4A 1SH2A 2WOMB 1Q8IA 4ZTFA 4DQSA 1T05B 4CFDA 4FJXA 4B9SA 1VRUA 2J6TA 2W9CB 1HNIA 4GC7A 4ICLA 4E89A 3ZT0A 4ELUA 5I42A 3VQ6A 1N48A 1VSEA 4IKFA 4JV1A 3LPTA 3CDEA 3OHBA 3DYAA 3NGDA 1N56A 5KI6A 4DTSA 3FFIA 5HROB 1RT7B 4NLSA 4KTWA 3L2QA 2XCPA 3S3MA 3HP6A 3T5LA 1KSPA 3JSMB 1HNIB 5FDLB 4NYNA 1LWEB 3OYNA 4K4TA 3AA2A 4G3IA 4KFBB 4OVLA 1BIUA 3SQ4A 2OZSA 3E01A 3DRSB 5HBMB 1VRTA 4CJ3A 1RCHA 1X1PA 3G6XA 1NJXA 5J2NA 4OPJA 2XCAA 4ELVA 2HHXA 4RNMA 3QEXA 4CHPA 1Z26A 1TL1B 4DQRA 2I1RA 2Z1GA 1RT1B 1WSFA 1C1AA 3PW5A 4I9LA 3AO5A 2FBTA 1UWBA 1TL3A 3MAQA 3H5UA 4RG8A 1S1VA 5KFRA 1FKPB 3SV4A 1JLGA 1GOCA 3KK1B 4E7LA 1TKDA 5K14B 4B08A 1I6JA 4NLTA 3V9WA 4O44B 1QE1A 1HYSA 1JLGB 2P1JA 4E0DA 3KJVA 2HWIA 1LW2B 1LW2A 4MIBA 4RUCA 2HHSA 4JLHA 1S10A 1LWCB 3OYEA 3RMDA 4BDPA 4H8KA 3HPOA 3AVFA 2BE2A 2AX0A 1JLCB 3AVAA 2IJFA 4NLXA 2JGUA 4OKEA 4FJ8A 3KK3B 4K4UA 3CO9A 4ID5A 1WSIA 2EX3A 4J9PA 2ASDA 1RNHA 1S1UB 3HVAA 3VQ9A 5J2PA 5KT6A 1NKEA 2QV6A 4KHUA 4Q8FA 1WNSA 1BI4A 4CERA 3OSPA 4DSLA 3LP2A 1XWLA 4NCBA 3UDLA 3V6HA 4R8UA 1S1UA 4NRTA 3DM2B 4EBEA 1NK8A 5C5JA 3HKWA 4DTOA 1NKBA 4M3UA 3MTKA 3KLHB 3UIQA 4ZP6A 4CFAA 2HVHA 4IRDA 1KVCA 3C6UA 3TABA 5DQHA 2JEGA 4X2BA 4LSNB 2WTFA 4CF2A 3AVJA 2IJNA 2HWHA 3B6PA 3SJJA 4FJGA 1J53A 5KRSA 4JS5A 4FJMA 4E1MA 4TQRA 4C8NA 4M3ZA 4QCLA 4UQGA 1NK0A 3CJ3A 1KHWA 5L1JA 4HUGA 4O5BA 3ITHB 1XI1A 5K14A 4FM2A 4CIEA 3D0PA 4YQWA 4ZHRA 4B3OB 5EUHA 3DRRA 3I0RB 3V4IB 1RT3A 4ECTA 3H2LA 3DOKA 3V4IA 1FK9A 1B92A 3AO3A 2E9RX 4DTMA 4CIFA 3SYZA 1BQNA 4KHRA 5EWGA 3HHKA 2XY7A 4QAGA 4HCCA 1SUQB 3S3OA 2OYQA 3DRPB 2DTUA 3CWJA 4RZRA 4IRCA 2HNYB 4C8KA 4Z4GA 5CYMB 3KK3A 4K4ZA 5JS1A 3TAGA 3SZ2A 4ED6A 4DFMA 1C0TB 4Y3CA 3QINA 2BQUA 4CF9A 3IG1B 2FJVA 2KQ2A 3N6LA 4KB1A 3IGNA 3IGVA 2HHWA 3QIDA 5HROA 4NLQA 2R2TA 4ECRA 1WLJA 3NGYA 2F8TA 5HLFA 4QWDA 5F8LA 4ED3A 3T3FA 5KFLA 3OYJA 5KFEA 3JYTB 3OY9A 1QAIA 3MEEB 1S9GB 4AILC 3LALA 3AA3A 3L2WA 5E41A 1VRTB 1ASUA 1N4LA 4KHMA 4OGCA 4CJWA 2D3UA 1NNDA 1HYZA 4I9QA 4DTRA 3OS2A 3AVCA 1EP4A 2IAJB 2AWZA 1RILA 4K4XA 5JUMA 1TVRB 4R5PB 1YVFA 4J9QA 4ZVEA 1XR6A 3FSIA 1VSDA 3VQ5A 3I0SA 4J2BA 4Y2AA 4DSKA 2OPSB 4KI4A 2Z1IA 4TY9A 3TR8A 3H40A 1BISA 3H5SA 5KGXA 5KT7A 4F2SA 3MXMA 3OS0A 2Y1IA 3PZPA 2KZZA 2AU0A 4WZMA 2RKIB 1K6YA 1SKSA 3ZCMA 3UQSA 4RW6A 1VK0A 4Z0UA 1BQNB 2BQ3A 2ZE2A 4HUEA 5I3UB 1S1WB 3NH2A 4FCYA 4DTNA 3LWLA 5KFXA 1T3NA 1RBRA 2G8FA 1RT5B 4K4YA 4CHOA 4QWEA 5CZ1A 2C22A 3AA4A 4B9VA 2HNZA 4LQ9A 5DG7A 2NUBA 4EEYA 4AHTA 1J9AA 1X9MA 1C6VA 3T1AA 3QO9A 3NMAA 1TAQA 3QO9B 3TAEA 1T8EA 2FJXA 3QERA 1S5JA 1RTJB 3RB3A 1TK8A 2HNZB 2GIRA 4CE9A 3SI6A 4CHZA 4F4WA 2RPIA 1J5OB 4Q44A 1IKXA 3OSNA 2JC0A 1CXUA 3OYKA 4OGEA 1L5UA 4RW4A 4M94A 5KGWA 4YMEA 4CJVA 2VG6B 4H4MB 4FS2A 3PO4A 1JKHA 2IM0A 3DLGA 4CEQA 4MFBB 3PV8A 1HJRA 1S6PA 1ZTWA 1HNVA 4TY8A 4CK1A 4B8AB 2UVVA 4CEEA 4WXWA 4J9KA 2FLLA 4NLOA 4ECQA 4NZ0A 3SUOA 1ASVA 5CZ2A 2G8IA 1C1BA 5F8GA 1D9FA 2G8UA 1TV6B 1RT6A 1HNVB 5SWMA 3O3HA 4O0JA 1IKYA 3VQBA 2W9BB 2G8HA 4DTUA 2YNGB 5EWFA 3LWMA 3AVBA 4I2PA 4M42A 3IS9B 4KHYA 4I7FA 4KHSA 4I7FB 2HHVA 5KFTA 4CJLA 4RW9A 3U3GA 3IN5A 5C24A 3NH1A 2D7SA 1WSHA 5EWEA 2R2SA 1RT4A 2YKMB 3V9ZA 2RN2A 3CJ4A 2BGGA 1CXQA 4O55A 2ILZA 3NL0A 4OKJA 3IRXA 1JL1A 1C0UA 4RW9B 4QW8A 3HPHA 5F8MA 2DPIA 4HCBA 2JEIA 4CJTA 4CJUA 2WK4A 4YP3A 4M45A 2PY5A 1HQEA 1D9DA 4MK8A 4CJSA 3F9KA 4BACA 3HVTA 1JLEA 5HRPA 4PWDA 3IRXB 2FLNA 3BSOA 4FZZA 3SUQA 4YR2A 3THVA 3BSAA 3NBPA 1GX5A 2VG5B 3TI0A 5EU7A 2JEFA 4H54A 1S0MA 2PYLA 3O3FA 1GOBA 4NYFA 3S3NA 1MU2A 2YKNB 1SH3A 4KB0A 1FKOA 1YTAA 1U49A 4K8ZA 4EBDA 3HJFA 4DMNA 1QSSA 5KG2A 3BREA 5DK5A 2WONA 2R8GA 2FBVA 4N41A 4WFZA 4WYWA 1DLOA 1LW0A 2VG7B 2KFNA 2O4IA 5KFBA 1CSJA 3LP1B 3PW0A 2G8KA 4CJRA 2W7OA 4CK3A 2F8SA 1JLFB 3F73A 3C94A 3LP0A 1S6PB 4TY8B 1JLQA 3SUPA 4CGDA 4F50A 3ZSXA 4F4XA 3P1GA 4IRKA 2FVRA 4H4OA 4ICLB 2C2EA 1LAVA 1S49A 3WNEA 1WSJA 5L1KA 3EPGA 2KW4A 1N5YA 3SPYA 3FFIB 3HM9A 3KLEB 2WCXA 4O3OA 4JUZA 3Q8SB 3K5OA 4RW7B 2C2RA 1B9DA 3TWHA 4FK4A 4J9MA 1C1CA 4KO0A 4F4KA 3A2FA 1TAUA 2ASLA 1TKXA 2D3ZA 4K50A 5J1EA 4GVMA 5KFGA 4U7CA 4KE5A 4KAIA 3O4QA 2ETJA 1WNEA 3RMBA 4PUOB 5F8IA 3OL6A 3RMCA 3MXJA 1HPZA 3RTVA 3OJSA 3ISND 3PY8A 2QKBA 5I42B 1REVA 1ZYQA 4Q45A 4F3OA 1RBSA 4CFBA 1I3AA 3LP2B 5J2MB 4CHQA 2ITGA 1QUVA 2IC3A 2AX1A 4IG3A 1BQMA 2IMWP 3CDUA 1JXEA 1JXLA 3C6TB 2FVQA 3C6TA 1UOCA 2FLPA 4W5TA 3NE6A 4IR1A 3CFOA 1EX4A 3GIMA 2YNIB 1BCOA 4O0IA 3G6YA 3ITHA 5F8HA 2GBZA 3BQ1A 3VQEA 3V9XA 3DOLB 2FBYA 1ASWA 2B43A 1CZ9A 4CHNA 3QEIA 4J9LA 4F4ZA 1KLMA 4KV8B 4O3PA 3MR6A 4ED1A 2E6MA 3ALYA 1S9EB 1T7PA 3VQDA 4OKKA 5EDWA 1JLQB 1QSLA 5C42A 3QZ8A 5DQGA 4J2DA 3MFHA 2UVUA 4RW8B 5J2QA 4F4YA 1LAWA 4BDYA 1DTTA 2WOMA 1L3VA 3QIOA 1N6QA 1RT2A 4JV0A 3KJVB 4DTJA 5KG4A 4O4GB 5KFYA 4FJIA 5KT4A 1IM4A 2W9BA 3MR2A 2BR0A 4CEDA 4ID5B 3AO2A 4EZ6A 5L9XA 3V6DA 4DU3A 4HYKA 5CY4A 3DDKA 2YV0X 1TKXB 4PA1A 3BGRA 2IM2A 4BWJA 3DM2A 4DF4A 2BE2B 4H4OB 4ZP7A 2ATQA 2FC0A 2YHBA 3LZJA 2FVPA 1RAJA 1N6QB 3ZT2A 1J5OA 3V1OA 5KFZA 2E9ZA 5C25B 3MEDB 3KLHA 1A5VA 2IDOA 1NK5A 4DQIA 4ZP8A 4M3TA 4O3QA 4RNFA 3NCIA 3PHEA 5DQIA 4YR0A 3OJUA 2UUWA 3S9HA 1C2PA 4TQSA 4K8XA
chains in the Genus database with same CATH superfamily
4USHA 4IJNA 2ADCA 2ALZA 4PYDA 1Y7PA 2QFIA 1ITPA 5AQRA 2VWJA 2QX0A 3NAEA 1W9HA 3TOQA 1NHVA 3ADAC 3Q0AA 1ZAWA 1V6HA 2Z8QA 1GLCG 1F2HA 1R43A 3RW7A 2NLWA 4Z37A 1T94A 3AV9A 2MB0B 3L2RA 2XWYA 3FNNA 4OLOA 2K8GA 1Y9OA 5B0GA 3FBCA 4QJVA 4TYAA 4OHYA 2FC9A 2DNZA 3GBTA 3PFOA 2KM8C 2DEIA 1NGGA 2ZHAA 3TAFA 1WKLA 3P4UB 4F0HA 1O8BA 1R31A 4EU0A 4H5WA 1BWFO 1S4EA 2CAJA 3RJMB 1DTTB 4FWNA 4HACB 3LM9A 4KHNA 2RE2A 1L3KA 5AE1A 2LDYA 3HP9A 3BGRB 3MAHA 4PWWA 2G8WA 2AD9A 1KP6A 2A18A 5BREA 3T1HK 2YKPA 1S79A 2HHQA 4RPFA 2W2OP 2NZ4A 3MEGB 3T6BA 2YHAA 5DG8A 1RI7A 3V6DB 3GV7B 4ZLJA 3BR9A 1FJ7A 2EKYA 1KQSR 2RHQB 3HBTA 4F7VA 2FB0A 3CJ9A 1I3OB 4LF1A 3R5CA 2CJXB 1Z05A 4HH0A 1SXLA 2CGJA 4JKEA 4KKOB 1N5SA 1EKSA 3R5DA 1NSAA 4EO6A 4KH5A 3N4PA 4DL7A 1UKUA 3BJYA 4EO8A 4DN0A 2CJKA 2CQPA 1VQ7N 3K57A 3V1RA 1EB0A 1IKYB 3J7YP 1F1BB 4PWUA 1RTHA 3ZSRA 4RUBA 4DOZA 2IM1A 5AQMA 4DCHA 3KKRA 2OELA 3JSBA 1RB0A 3ENVA 4B02A 4URSA 1KLMB 2P9KB 5LXYA 4HTJA 4BRFA 5AQSA 2V9KA 4GO5X 5HP1A 3NAHA 3WDOA 2P9LB 4JV2A 4DV6K 1FJGK 4DCJB 3R27A 2RU9A 4C98A 3QESA 3ZX2A 4KPCA 1RTIA 2IGIA 3O1BA 2E1YA 4ERDA 5KT3A 4GVEA 2C2ZB 4H0XB 5DM6Q 3DRPA 2CVIA 4JK7A 1J5EF 3Q8RB 1PILA 3O1LA 1GTHA 5KPZA 1HI1A 5DLFA 2Z57B 1C4CA 3EXCX 4HACA 1Q7LB 3LTOA 5KFKA 3PIOL 5D4OA 1RTDB 3SLCA 1A5WA 3ZTSA 2JWKA 4LR8A 4RNNA 1TGOA 2RT3A 2O8FB 3U6FA 3U8XA 2LXFA 1RHKB 2RS8A 2EC0A 3IWXA 5GAEI 1NDPA 4URGA 5CD4A 4N76A 1S0NA 3ZFVA 3V4MA 1V4SA 2RAQA 4CGFA 4CECA 4OX6A 5HVGA 2CADA 4RLEA 1WG4A 1S4FA 3KHRA 4JRPA 4DWIA 2IYIA 2Z30B 1TYQA 3GMGA 1NGIA 3G0ZA 1FWLA 4I6YA 3AVNA 1LWXA 4WE1B 4BRMA 5U47A 4QZVB 3DLBA 1Q18A 3ENBA 3K58A 3P5BP 5KG6A 2QE5A 4GV9A 3CO0P 4DLGA 4EWTA 1XNRJ 4RU2A 4LRBA 4DTPA 2HEKA 3QFWA 5D0RA 3A5MC 2YXLA 1XMQK 4Y0FA 2Q0RA 2JVOA 4P74A 2IA6A 2OCEA 2QFJA 4EFHA 2KHCA 3G8SA 5A2QU 3FK4A 2GV9A 1YJRA 1S22A 3JS9A 3W5ZA 1M90T 4QBUA 3J81O 4E7HA 4FM1A 4DV4F 1LK7A 2DR8A 3PTWA 5HMXA 1HKGA 1VSIA 3PX0A 4UY8O 3V81B 1EETB 2O4GA 2OPQA 3I9ZA 4LREA 1FKAF 4CJQA 1NOYA 3N01A 2AEJA 1VHIA 3NKYA 3G6EN 5CHIA 4DDFA 2EK6A 1G15A 2G2YA 2FF6A 3WQPA 2HFVA 2V34A 2LKZA 3CPWM 4GMJB 5AXNA 5JS2A 1FJEB 3FEYB 2UXCF 3ZZOA 3GWCA 1S1XA 3KLVA 2HVIA 4IOAQ 3GSIA 2O8DB 4EK2A 2DNRA 4CFCA 2OPPA 4CK2A 2FHOB 2QK9A 2CH6A 1G6BA 1VQ9N 3QNOA 4MDBA 4FBUA 3VF2A 3D6RA 1H3DA 3TNVA 2OEJA 4CYUA 5L1IA 3HOSA 5E3AA 3TP2A 1Q86O 3TANA 1NGBA 1WC0A 4CZJA 1KVJA 4R79A 1Z4UA 1JJHA 2VDIA 2KFZA 3FEXB 1HNWJ 4QOTA 1T9WA 4EP5A 4KH0B 5J1EB 4L3NA 4WF9Q 2PMHA 4U7UK 2LCWA 2EPIA 3NGTA 1WACA 3B6BA 4QR2A 3PXGa 1RSCA 3N0VA 4JI8J 2RKIA 2HW3A 2NRHA 1KDNA 4CO1A 4CW7B 2KYXA 2B9XA 1NMEB 1LQ9A 4FPAA 3MN9A 2OEMA 5C12A 1E6YA 4FF1A 2YVSA 1NGHA 1L3UA 1K9MO 1PBAA 4ECYA 4ZK7M 2NRXA 3OL8A 4UZBA 2R7OA 4X64F 3DLKA 1RJJA 3AQPA 1MLAA 1RHMB 4CEAA 4BG9A 3IP0A 3VAJA 4CDIA 1NKCA 4ANDA 2QGFB 3CDAA 2DFFA 4WPAA 1A0OB 4WP8A 4NLWA 1NB7A 3CSKA 3PVXA 1RDBA 5AQZA 4IOBA 4TN2A 2ZZTA 3LDLA 2XYHB 4M41A 1K9MT 3G6VA 3R7SB 4XH1A 2R8JA 3GYGA 1VQ7S 3IFRA 4Y34A 2HGLA 4UUXA 1RBVA 2I7NA 3KLIB 4C0HA 4ELTA 4M5DA 3CF5Q 4DL5A 5CZXA 1RXOB 2V0NA 1X5PA 2CZVC 2U1AA 1DKGD 4O4RA 3IMQJ 3FCVA 1YZ6A 4M5HA 3JAMU 3EZUA 2M7SA 2ZC4A 3KHLA 2YPZA 3KKFA 1R6YA 2XYPB 5HVHA 3E9LA 4ZDNA 2ZH2A 3GQCA 2HIQA 3M3ZA 4RW7A 1S97A 3ID8A 1SL2A 1CJVB 5EOYA 5SZTA 2AYMA 4O3NA 1BO5O 3T5JA 5KFQA 2QA2A 4ZA1A 1CJTB 3D1QA 1HPZB 2QYGA 2VWBA 2HBQB 1KD1O 4DJBA 2HVDA 3CJKA 1S0OA 4JV5J 4ZITA 3BV8A 1VSHA 1ZBIA 4OZNA 3HK2A 4MQ3A 2GAHC 4QIVA 2GVZA 2FY1A 5KT2A 3HSDA 3Q7BA 3CCEN 3DXMA 4X66F 4NLVA 3MUTP 3OTBA 2QSWA 3K59A 1HI0P 2IDEA 3WNGA 4EYHB 3GILA 3A5NC 2R8HA 1ATRA 1NPPA 4DUZJ 1QM9A 2DPJA 3DXSX 4KGXB 3NS5A 5CD4H 3C19A 2DO0A 1VLYA 5ETQA 1Q81O 2GJIA 1FEEA 4P9SA 3WIVA 3NEKA 3JXUA 4LF6J 2P9IB 4BVPA 2J7UA 3KK1A 4NLCA 5CCLA 5LJVA 1S1TB 4Q43A 4O5FA 2P9LA 2ZF5O 3EZ5A 1FD2A 2FY8A 2LXIA 2KG1A 2HYIB 4QS8A 3G8TA 2RQ4A 1N33F 4ECWA 4X66K 1TFYA 3NF7A 2O66A 3R97A 3ENAA 4O3RA 2XC9A 3DNCA 3OTOF 2BQRA 2H5EA 4ATNA 2VHGA 3VEVA 2KT2A 3CCRS 4DV7F 2L41A 6FD1A 5CXTA 1JLAA 1SIWB 2P9UA 3AFGA 3Q2TC 3SAFA 4BRIA 3L7UA 3HFKA 5CCMA 1YJNS 3PM9A 1TMMA 4FXVA 2QWMA 1H72C 2DVIA 5IT0A 2PC6A 2R7TA 4OZ0A 1S1XB 4DS5A 2HURA 4B9MA 5DZ6A 4J91A 4WYLA 4OJRA 3LANA 2ZDPA 3TUPA 4DL6A 1DRZA 4CBUA 1AZSA 3ASMA 4P6QA 2MKCA 1VQSA 2O8EA 2FHMA 2B7BB 2W7PA 4A62A 6FDRA 2YY3A 1Q16B 1UZDA 4DR2J 4MH8A 4A61A 1U26A 2EK1A 4CEBA 2GUIA 3TTCA 1KQSM 2MQLA 4DV2J 3NRBA 4BBYA 1XIQA 3DRYA 3JQJA 2XSJB 3ZSWA 3GIJA 2F65A 3J81j 2GZOA 2QIFA 3WT0A 2ZE2B 1BG3A 4JI3J 2P9SB 3O4NA 3P39A 2XMVA 3CCES 2L9DA 4CESA 4BREA 4AD6A 3P45B 2E5JA 5IFMA 2D5RA 3V6JA 4EGLA 5IT4A 3UI3A 3M1VB 2FVCA 3HL8A 4OHVA 4CF8A 1SC1B 4FLWA 5M2RA 2QRRA 3OL7A 5GAGP 4JI5F 1S12A 3M30B 1FERA 3DI6A 3KD1E 4FDFA 2H65B 1X8DA 2E5IA 5ETKA 1NSPA 3LDPA 1WSEA 2AEMA 2NZCA 5T14A 1TL5A 3L0QA 1B9FA 2C28A 4JV5F 7FDRA 4MKAA 3U02A 1KC8O 4U7UD 4AM6A 4Y2KA 1VC6A 2RD5C 1SVDA 3H98A 3TARA 2COLA 4FPIA 3Q22A 2YPYA 1RAFB 2XHBA 1U8WA 4LF7J 3IBFB 3PUFA 4LVNP 3D0GE 4CF0A 1IH7A 3EKSA 4XH5A 3OFFA 3ET6A 2R7RA 1GLLO 1H38A 4AH9A 3OYIA 1UA1A 1UEVA 5IV3A 2AJFE 2XY6A 1UA0A 4IJAA 2WB4A 4FF2A 3OYMA 3QEPA 4BG8A 2FIUA 2VG5A 4ZPBA 1ZBHA 1NGFA 1RAEB 2KTQA 2FVSA 1G7CB 3HMJG 3D7EO 2HK2A 3V6KA 1QQOA 3UWTA 2P9PA 3M2UA 2WONB 3CCLN 1CLQA 1S72S 1XNQJ 3G71N 4JRQA 4FJKA 3AD8C 2LECA 2KYZA 1ITGA 2ZZNA 2CRLA 3OTOJ 2ZJQL 3MF5A 3D2WA 1CZBA 3KZBA 3GU0A 2HB5A 4Z94A 3PR4A 2V63A 4FLXA 5HLFB 2KHOA 3RRHA 4Q0BA 3THWB 4FWRA 4LFBK 5IS2A 5A0YB 4DU1A 4E7KA 4Y1DA 3A13A 4O44A 2QJ3A 2IRUA 3VQCA 3QGIA 1BMQB 4RW4B 3MHYA 3VEZA 4LSLA 3I9V9 2NXJA 1LOTB 4DG1A 2ABYA 2GIQA 4F9OA 1AB8A 2HVZA 3KLIA 4ALZA 4G9ZA 4WFAL 2IY5B 3KG0A 1VSJA 2UXCJ 2QLFB 4XDCA 2V94A 1IQTA 3C46A 5H9FK 4B3MJ 3P96A 2J9EA 2V5HG 2HBKA 3MDFA 1VYAA 4JP8A 4B9LA 4LH5A 3A3PB 3DRSA 4PCQA 5T7BA 2KDOA 2BMBA 3GG1A 5AQQA 3BPSP 4PPDA 2ZD1B 2AP1A 3LAKA 4WFYA 3DLKB 4LF8J 3MN5A 4FW1A 5CE3A 3RAMA 4F3TA 2J0XA 4ZS6A 3QETA 5KFUA 3NHGA 4GW6A 2AP6A 4LH4A 1C0UB 3MOZA 5B08A 2XMTA 2ZH3A 2K1RA 3MMBA 3W5XA 1RDCA 3H0PA 2HWTA 5E3CA 1LFWA 2K7KA 4DI6A 4E1NA 4Z4CA 2FJDB 2W40A 4KY3A 2EBGA 2DY4A 3W61A 5KG3A 1L3SA 3ATUA 2XGPA 4JEPA 5A8KB 3VA0A 3QGHA 3DOKB 3S7RA 4H5TA 5FROA 3P38A 1P9QC 3VGUA 4DR5F 2AQ4A 4OI0A 3VN5A 2I5JA 2OTLN 2FJAB 1TKTB 2M8DB 3VQAA 2BANA 1RU1A 1PBUA 2ZBCA 4DR6J 4CZFA 4M3RA 4FKYA 4K2XA 2UU9K 1UFKA 4I2QA 2FD2A 5IQ6A 1NK4A 1SJQA 4RCHA 2DIVA 1Q8IA 1HLWA 3ZTRA 4Y65A 5FLXU 4DQSA 4ZTFA 1T05B 3R6LB 2NRTA 1YIJN 3OQ2A 3WXMB 2E7WA 3K0SA 4P2FA 4FJXA 1BY9A 2HHHF 2XULA 2C3OA 3T1YJ 4GC7A 3PIOQ 3TA1A 5I42A 3DN9A 1N48A 2UXBJ 1VSEA 4WQ4C 2QG9B 3HHNB 1O0PA 1N56A 5KI6A 4DTSA 1R3NA 4IOCL 4KH1B 4CLTA 2ZKTA 3K2YA 3S3MA 1HNZJ 3T5LA 2F7VA 1KSPA 1HNIB 4JKDA 1HWIA 4ZVRB 1N8RT 3ELHA 3ZZRA 2OZSA 3SMZA 5HBMB 2O8CB 3HFZB 4I1TA 2CQ0A 3G6XA 1R59O 2E2PA 1WORA 1NJXA 2NUHA 2LA4A 1X5OA 5J2NA 4OPJA 5IM0A 2ZJRL 2HQ3A 2HHXA 4RJVA 1ATNA 1F3VA 3FBEA 1TL1B 3I55S 1BHNA 1WSFA 1DJ0A 3X1LB 4NA2A 1SQFA 3H5UA 4JI0J 1X9JA 2RVJA 2H4WB 3ZYYX 4KRWA 1S1VA 4PG8A 5KFRA 1JQGA 3SV4A 1JLGA 3KK1B 5K14B 2ZM6J 1VQ5S 2WZ1A 2YKOA 4B08A 3HULA 3WZ0A 4LF5K 3RSEA 5M1PA 4NLTA 3V9WA 2X1GA 1HYSA 4ZLPA 4QIEA 4E0DA 3KJVA 1VBYA 3F56A 4ZIWA 4DV1K 1UVNA 3OYEA 3RMDA 3DGPA 2VBYA 3IXQA 1Y00A 3D67A 3AVAA 3TX0A 3D1OA 3MMVA 2IJFA 1XMOK 2FUG9 4K4UA 1VS3A 4M5JA 1QVFR 1V3RA 2VASA 2VKRA 4P2XA 1Z2ZA 4ER8A 1UEKA 5KT6A 3SDEA 4CVNE 2DGWA 4CERA 2H3EB 4HI1A 4DSLA 4RBVA 3D54A 4NCBA 1PG5B 1V5IB 3UDVA 3FEZA 2YTCA 2NLXA 1HBNB 4EBEA 1NK8A 5C5JA 5HMYA 1DAXA 3H20A 4BR0A 4A8QA 3PG9A 5AQTA 1KVCA 2K2PA 4X2BA 3W8PA 4CF2A 3D68A 3IM8A 2VIHA 3JAMY 4X64J 5KRSA 1N54B 3UD4P 4E1MA 2Z56B 2LEAA 3SCLE 5TKWA 3LDQA 1NK0A 1N0UA 2GWJA 4OPAA 3U9ZA 3IAS9 1O6XA 5K14A 4FM2A 4CIEA 4ENOA 3RVCA 2BOAA 2Z2MA 3MM6B 3F41A 2UUBK 3DRRA 1VBXA 3V4IB 1RT3A 4WWSA 2GX8A 2E9RX 4DTMA 2ZZMA 4CIFA 3SYZA 4B17A 4KHRA 1P8GA 3PLAA 4LBIA 1WC3A 2XY7A 4S0MA 2V4JB 2OYQA 2V68A 4MIWA 3O9QA 3CWJA 3DGPB 2HNYB 5JVHQ 1FWKA 1WBDA 5CYMB 1NJIT 5FPMA 4ED6A 1X3MA 1C0TB 2H4YB 3AGRA 3QINA 4LRCA 3BGOP 3PYEA 2KQ2A 3CJAA 2ZJQQ 1PYOB 4CBWA 3EJMA 2WFBA 2JL9A 4JI3F 3OFEA 4CLYA 1ZZNA 2R2TA 3AOBA 3ENQA 3GSDA 2CWKA 5GAHP 4QWDA 5A8WB 4ZN3A 2BBEA 1I94F 3R5AA 5KFEA 3JYTB 4NWBA 1UP1A 3CJTA 3MDQA 3MEEB 2D1CA 3GR1A 2MZ1A 3LALA 5CH7B 3L2WA 5E41A 1VRTB 3CQXA 1N4LA 2QWPA 4ILHA 4KHMA 4CJWA 4I9QA 4DTRA 2OLWA 3M2VA 2C3PA 1X4HA 2WVBA 3AAWB 4F25A 1RADB 3TU5A 2AWZA 3K5PA 5JUMA 1Y5NB 3T41A 2NQPA 3H42A 1ZPWX 3MCSA 1VSDA 4LFAF 3VQ5A 3ZZYA 4BC2A 3ULEB 4KI4A 2DGOA 3TR8A 1BISA 2F9WA 4GKJJ 3H5SA 4KH4A 1KVKA 4Q2MA 4F2SA 4USIA 3CMEN 4NOHA 1H98A 3AA8A 5JLFA 3PZPA 2KZZA 2AU0A 3LH2S 2RKIB 1K6YA 1N5VA 5EY4A 3HD1A 3UQSA 4RW6A 1VK0A 3IUCA 4PXDA 4Z0UA 4JI7J 5I3UB 1S1WB 3OFGA 3HSJA 3AAQA 5GADP 3CERA 1RBRA 1RT5B 3CIMA 4K4YA 1MMNA 2O8BA 4F3QA 4OYMA 2E1CA 2CXEA 1EJ7L 3AA4A 2HNZA 1SQGA 4AHTA 4EEYA 4OI6A 1QJHA 1X9MA 4DPUA 4BRHA 2ZHOA 4NL5A 4FYWB 2FJXA 2NXNA 3RB3A 3HHEA 1XN9A 3MMCA 1Y3KA 1IVZA 1B7FA 4HI2A 3SAHA 2DTJA 4CZHA 3SI6A 4IFEA 2W4DA 4CHZA 2G13A 2PT0A 1IBMF 5A2QY 1CXUA 4RW4A 3MTJA 4YMEA 3MK6A 1KR4A 4A5BA 3PO4A 4FS2A 1HFEL 5GAEU 3SEOA 3NGRA 4JI4F 4CEQA 1NHKL 4X4UA 2D3O1 4USWA 3O1WA 4TY8A 1ZTWA 2GJFA 2UVVA 2VCPA 2N4DA 4NLOA 1PC4A 3VAMA 1T9XA 3CEDA 4ECQA 4NZ0A 4DUYK 2CA9A 5SWMA 2NS1B 2W9BB 3JSRA 3VEYA 4B1ZA 2KVQE 4IQMA 4MAKA 3M2VB 4I2PA 3IS9B 2RRNA 4I7FA 3SQGB 3BF4A 4I64A 2CQGA 2J8AA 3IN5A 4AXJA 4BR7A 4I6WA 3NH1A 2D7SA 3P5TL 3MR7A 2R2SA 5TKYA 1U7LA 3DOMA 3NOCA 3NL0A 4KBOA 4KYZA 4CLLA 4JI5K 3FC9A 3R8YA 3H1VX 5AQUA 3QFPA 3C14B 1Q5YA 3C16A 2WK4A 5AR0A 4OLPA 1U1PA 4BACA 3G87A 4PWDA 4A57A 3TRGA 2RRBA 3I56N 2HZVA 1SC4B 2BW2A 3BH6B 1R89A 1QZ6A 2M3DA 2MPUA 4CH1A 2KRBA 4B3RK 4KB0A 5BJRA 3D3CJ 5ETTA 4ZJLA 3VGSA 3MMCB 2V69A 2P5VA 3L6QA 3R1XA 5DK5A 4AQYK 2CG8A 1AT1B 1Q53A 1KQFB 3A1YG 4LF4F 1MROA 4WYWA 2KFNA 1CSJA 2GWKA 4CJRA 2W7OA 1JLFB 3C94A 3CC4N 4TY8B 2A6AA 3CJ8A 1XQIA 4IDHA 1HNZK 3VVTA 3OTDA 3SUPA 3BEXA 3UDEA 3M30A 2Q36A 1PO6A 3K17A 3VGLA 4RL1A 4H4OA 2OANA 2W41A 1Q79A 5L1KA 3DAWA 1NH7A 5CA5A 3FFIB 3TYTA 4O3OA 2P9EA 4JUZA 4F4KA 2IVOA 4DR5J 3HKZD 2ZVIA 4M7YA 2ASLA 5AFUA 1Y0HA 3ZTQA 4DR1J 5J1EA 5AXLA 5T7LB 3CD5A 4KE5A 3O4QA 2ETJA 2FSNA 3PSFA 3GIRA 4PUOB 3R1HA 2CGLA 3MXJA 1U2VA 2HLTA 3CI5A 4H0VB 1Q5VA 3ISND 5JMNA 5BXIA 4UT4A 2QKBA 1DQAA 5I42B 2H54B 1RBAA 4Q45A 2I38A 2B8PA 4F3OA 1WHWA 2MHNA 1I94K 1OPIA 5GMEA 1IBKF 1H7XA 1QUVA 1GLBG 4WQ5A 4I4BA 3CMES 2UXBF 1CLFA 1TELA 4YOWA 1FEHA 2AX1A 4DR4K 4DZ6A 2ZOFA 1BQMA 3C6TB 1WOSA 4QIGA 2ZUGA 3CFOA 1HWJA 1EX4A 4GY2B 5AQOA 3Q8UA 5BN9A 4ED5A 2GBZA 3V9XA 1N32J 2OI2A 2B43A 2CFXA 3L4BC 4J9LA 5E33A 1ZM4A 4O3PA 3WIUA 1BUXA 3C6AA 3BZQA 1S9EB 3J80Y 1T7PA 3VQDA 5GAGU 5AQYA 5LL6Z 2EG1A 3ILLA 4BRDA 1QSLA 5D0EA 5C42A 1T02A 3QZ8A 4J2DA 1NJIO 1E4GT 4DUZF 1M5VC 4GV3A 5AQNA 1LAWA 4F4YA 4OV6A 1NXIA 3KJVB 4O4GB 2AEFA 3AO2A 4EZ6A 2MKKA 5L9XA 3LGNA 1MNEA 5CY4A 2C2KB 2IM2A 1P9YA 3DM2A 2YHBA 3D2FB 1N6QB 4B3MF 3W9IA 3ZT2A 5KFZA 5ADZA 1YUWA 3G8QA 1CQMA 4ZP8A 2E5HA 3EXYA 1EWRA 4M3TA 3D4JA 3ILIA 1JK9B 4JKAA 2VBXA 3PRVA 1C2PA 2O1PA 4TQSA 4X62F 2DR6A 3PCOB 1H7WA 5DMRA 3OBYA 4DV7J 3A8YA 1XR7A 3I96A 1Q9XA 2GQ2A 3MMBB 1RDWX 4DPWA 4FWOA 3ICLA 4K4VA 4H5RA 5IWAK 3V81A 1ZBFA 1O5JA 3WXKA 3G4SN 4CO2A 4CWBA 4X65K 1WDTA 2YH0A 2D69A 5CZVA 1O1WA 4H03B 2XHCA 2FHKA 1YJ9S 4YY3K 2UUTA 1UPMB 1P1LA 3BQ0A 2C2DA 5CYMA 1NU4A 2KXHA 4ZVTB 3Q7CA 4IBNA 1S1TA 2GIFA 4GV6A 1S99A 3BS9A 4TLQA 4DHVA 4BC4A 4EIAA 1S5ZA 4JK9A 4ECZA 5K9FA 5D0GA 2FPHX 3VR1A 1C0MA 2N3OA 3FSYA 5C42B 1QDUB 3KLGA 4MKVA 5MLCQ 5J2PB 5H1SV 4NLUA 2PO4A 1QAJA 2QO3A 1NHUA 1S9GA 1TR0A 3I32A 3MM8A 2O5DA 4XPEA 3PO5A 2QLXA 3UW1A 1X0PA 4ZVFA 3E2EA 4WFNL 4WYBA 3DLGB 1JLAB 2R7VA 5B0DA 2HOEA 3Q8QB 1D09B 2X74A 2VA2A 5KFDA 2CG4A 3IWNC 3NP5A 3BF1A 3M8QB 1U1MA 2D0PA 4AHVA 4NEYA 4W5QA 4X4RA 3BN4A 2V2ZA 2L48A 3JS6A 3K5MA 2CQCA 4K0KF 3O3GA 2BDPA 1JLBA 1IG9A 3DU6A 3UN3A 4K4WA 1LXNA 3FLCO 3D9BA 4PUOA 4IR9A 1VSLA 1SKWA 1M5HA 1F5BA 3TZWA 3OYLA 2DITA 2ASJA 3TEGA 1YDLA 1YITN 3AVHA 2E66A 3K5LA 4B8CA 1KWMA 4IQXA 1FK9B 5LMUF 4KJIA 2O8BB 2MDAA 2OPRA 2B6AB 4ECUA 2DNLA 1PAEX 5IT9Y 1WKKA 1N5QA 1Y11A 3ISNC 2BX6A 3FZBA 1UFLA 3SNNA 3G10A 5CYQB 4LFCK 1VISA 3OTEA 3CC4S 2I0XA 5L46A 4A2AA 1D0EA 4K43A 3CCLS 4M5GA 1MWZA 1ZXOA 1HQ2A 4ED8A 1P8ZA 4L3QA 3CCVN 3DC2A 4LC9B 4P10A 4WJBA 3CCQS 4UY85 4JI1K 4X62K 4KHPJ 1U1RA 4B1YB 2X1BA 3MCMA 4C9DA 4JI2J 4BQZA 3H45C 1T3OA 1BI4B 1VHFA 3SCKE 2AJQA 1CJUB 1TKTA 4X84A 2YNHA 3QYYA 1VLOA 3Q23A 5IOLA 1XHZA 3CC2N 4CHYA 1LW0B 1IM6A 3CYMA 4TU8A 3RUBL 2B4JA 4C1NI 4OZLA 3PIPQ 1X4FA 4U8VA 4QWAA 1RFQA 2GVZB 2UVRA 3ENHA 4OJGA 2P5GA 5FRNA 4K42A 4DMZA 1S3XA 4FLYA 2DK2A 1PC5A 2K3IA 4A8MP 5E3RA 2YX7A 3ZZZA 1YT3A 1RT3B 2A5XA 2LEPA 1SV5B 1CJVA 1NJYA 1C1CB 1JLEB 4BRCA 3SV3A 2UUAJ 2A3ZA 1J5EK 2RB7A 5DM7Q 3NWGA 1Q1KA 3NBPB 3G82A 3QJLA 2FDNA 2XO7A 3ET6B 2IYGA 4ZCKA 3CGIA 1EQYA 3QIPA 4QW9A 3WUHA 2KXFA 3H2UB 2VC1A 3N6MA 3QT8A 3LPEA 3T7ZA 1PKUA 2RUSA 1C4AA 4ECVA 1R0AB 1BIZA 3L95X 4OJ1A 1GXLA 2M4MA 2A1RA 1N34K 3L4QA 2M9KA 2LQ8A 4BQLA 1KVAA 1ZPVA 4CQ1A 1TK0A 3THYB 2WVEA 2PI4A 1TKZB 1GLJO 3SQ0A 5KG0A 4ZPVR 1FKOB 2ZH4A 4FZVA 5DDQC 4ECSA 2H5IB 3QT5A 3IKMA 4B9UA 1NUEA 4ISFA 3FSXA 1CJKB 3KMQA 2J0QD 1IKWA 2OFGX 4CO3A 1V9OA 3L7OA 3BSNA 4BROA 2ROGA 2GGPA 1S9FA 5KPTA 3FBBA 4CM0A 4LF9J 2R8IA 1K8KB 1W2BM 4IZ9A 5M1FA 3IWLA 3W1YC 4DR1K 1XMQF 3J80O 4LF4J 1FX4A 3TEHB 4P52A 2KO1A 4J90A 3BKUA 4C8LA 1WD6A 4QWCA 1R8CA 4J37A 1B0VA 4B3SJ 3CUNA 5CAAA 4GVBB 3O9UA 4W92B 4P2MA 4TU9A 2F8HA 1NEEA 2A1BA 3KOAA 4FZXC 4RX6A 4RW6B 3MPUB 3BGLA 2IBOA 4C97A 4N8OA 2BV3A 3J7ZO 5LSRA 3Q89A 2HHHJ 2GC8A 1EX8A 5JLHA 1K1QA 3JSMA 1VDHA 1VAZA 3GE1A 2BE9B 2CQ3A 2WRMA 1FCAA 2PFFB 5G0RB 2LA6A 4I6MB 4GRSA 1J54A 4MLEA 1YJWN 3WHIA 2GNKA 5BPLA 1FNMA 1JLBB 3E51A 3CCMN 2F9DA 3HT3A 3TVKA 5C10A 4NCAA 2OUGA 4CLUA 3ZO7A 2UVWA 3LP1A 4KHPF 4YDUA 3HFVA 3FZFA 3EPIA 4JS4A 4KBIA 1NK7A 5JVGL 1GH8A 4OYXA 1OH5A 4CLZA 2GGPB 3GV5B 4PR6A 2VG7A 3WQTA 4USTA 4FWMA 3QEVA 1JLCA 2MYFA 2ZM6F 1YJVA 2AHOB 2BJ8A 3AVLA 2DGVA 2A40A 3IS9A 4NLYA 1F9HA 4DR5K 1K8KA 2QMWA 3QATA 4LRAA 3OR2A 3O4WA 2BKNA 4BE2A 1P27B 1WEZA 2MLXA 3CE8A 4LIRA 2NRWA 1RABB 2HQCA 2ZJRQ 2OD6A 3GYXB 4KO0B 2J6SA 4B9NA 2VA3A 3GFHA 2ZGZA 5L8RC 2B3TB 2M5YA 3NS6A 5DGBA 3MWBA 1BWEA 3W2VB 4K41A 1K47A 3MEGA 1HQEB 1AUSL 2A10A 4DEZA 5J2MA 1XR5A 2F1FA 1UVLA 2DRAA 1VQOS 2IC3B 4KHPK 1JX4A 2CQBA 3GLJA 2CGKA 3S1TA 5F8NA 4R0JA 1FXDA 3C95A 2UUBF 5K8MA 3HI0A 1KAXA 1GLFO 2F9JA 4I68A 2FJWA 1VQ4N 2Z2LA 3KFWX 4G1QA 3QZ7A 3D7SB 4DV0K 2GAGC 1UTAA 3BDEA 4LY7A 1IBKK 4BLGA 4F26A 4FWPA 1S1VB 3OYHA 3GE9A 3DXMB 1KD1T 3H4DA 2FLOA 4MO5A 5FPNA 2D0OA 1T9YA 3AO1A 1SUQA 1TL7A 5A0YA 4PQUA 1PYTA 3UB5A 3HF5A 4Z4IA 5BRDA 1IWAA 1S76D 1T0TV 2E44A 1VRUB 2UXDK 2JC1A 2P6TA 3CG7A 2AMCB 4H0PA 3KLGB 2J9DE 3RZAA 4USJC 3H5XA 2P9IA 3W63A 4DR1F 1VQ6S 3SIPB 4DV7K 4DV6F 1RT7A 3Q8VA 3DMJA 1HBUA 4YDDB 3QWUA 4O23A 2K3KA 4IH6A 2B56A 4A4JA 3O3LA 5F8JA 2BKPA 5FJ4A 2AJ2A 2O8FA 2V8HA 2MGZA 4CGIA 4YOYA 2JEJA 3TA0A 3M2RB 2BRLA 1NH8A 1K0TA 2BM0A 3G9CA 4TLRA 2A2DA 2E4LA 3SMSA 2HHPA 3KLFA 1S6QA 2VF3A 1LWEA 1XEZA 1YX2A 4YUDA 1F5CA 4FBTA 2DNOA 5HMZA 2RS2A 2CPEA 3J80U 4R8UB 2VUGA 4OI4A 3V5RA 3TVZA 3LQVA 4DF8A 2FQQB 2IS3A 4DG1B 1CS4A 3NS7B 2DD8S 3H5YA 3NF9A 5M1NA 1NAQA 4DSIA 2GHWA 3DHWC 3J7Z5 1ZBUA 1VC5A 3L7PA 4AHRA 3VF4A 2L3MA 1RTIB 3UR0A 2XYGB 3SBMA 5C2DA 2GCFA 1HW9A 1RAAB 3W7BA 1C0GA 2QKKA 3H59A 1EO1A 5A76A 4NXMJ 1QS4A 1S9EA 3T19A 3MURP 3QLHB 2BABA 2RQCA 2KL8A 4ZPDA 2HAIA 4YOVA 4TKTA 4XK8C 3NNHA 3QAEA 5CYQA 3OLAA 1CULB 1WC5A 2VPZB 5I3PA 2A6OA 1QZ5A 4EBCA 1OH7A 4CGJA 2PMWA 1U4BA 4Z4EA 1Y5IB 2FBXA 1U48A 1QHTA 2WBNA 3FJ2A 3KKSA 4KPYA 4A46A 4JAXA 2W2MP 1WUAA 3EKUA 1HWKA 3BO3A 1QSYA 5HJYA 3WNFA 4ZTJA 2OHDA 4DCPB 4KI6A 2XBPA 1U24A 4Z4FA 4D3HA 2EWHA 1F9EB 5AZIA 3ZT3A 3VHQA 4DL0C 2CJAA 3HOTA 2IVPA 2HFZA 3GJTB 3KWGA 4BC3A 5SUHA 3NMRA 1CPZA 3HI9A 3VTIA 3OR2B 1DTQA 2ZBPA 4AHSA 3PW2A 1M5OC 1CC7A 3D28A 1LKZA 1T03B 2R2RA 4WF9L 3D0HE 2WSEC 1JIHA 1MW7A 3RAXA 1S1WA 4OX8A 3R5GA 5AQWA 2CKWA 3UKUA 1N52B 2HFOA 1OS5A 2F4VK 4J9RA 3OBWA 1U25A 5AJ3K 5IWAF 1K0VA 4JKFA 4KFBA 1R7IA 1YGYA 3O8WA 4FWSA 1U0SA 4DPXA 5ETMA 2OTLS 4WTOB 3J7YU 3MCPA 3HVTB 3DGVA 3H8YA 4M5MA 5E3QA 4K5SA 1W7AA 1GXTA 3UE2A 1ZAXA 1SB6A 2V7YA 2ZBRA 3RB4A 1N34F 5B0EA 1EXQA 1URNA 2XNRA 4DFJA 1Q7YT 1IKXB 2MZTA 4Z7CA 4RWTA 1WOPA 2W8LA 3TAPA 1RCXB 2MQ8A 5EGYA 4J2EA 1FVSA 1PAUB 5F9NA 4PG4A 2GHVC 4UTGA 1OWXA 1JL2A 1WAJA 3SSRA 4P72A 1Y3JA 1RT2B 1C1BB 4FP9A 4O4GA 2P5OA 1OH8A 4RU9A 1IWGA 2GMHA 1HHQA 3GJSB 4UQTA 2VQFF 3EWGA 3UD3P 1HNWK 3NGIA 2W24A 2HQGA 1FXLA 1SKRA 4I67A 4HUFA 4DX8H 4IFYA 1FDDA 2PZSA 2VGNA 2J8SA 3VGMA 4QR1A 1BD6A 2OZMA 2XY8A 4CJ4A 2GO8A 3ZTPA 2BJ3A 1Q86T 2P9GA 4XEIA 2HVEA 4B3SK 3SQGA 1NOZA 3LAMA 4FO0A 4KRFA 2HFSA 4UOGA 4ITSA 3NCPA 1PYSB 3RR7A 5HBMA 5HRSA 2PFDA 3B4MA 4LBHA 3DRRB 2HNDB 3HO1A 2ILYA 2VC0A 4EMDA 3MXIA 1AROP 3W9HA 1XQSC 1FDNA 2WC9A 2DRDA 1DEJA 3BUZB 3PFEA 4DZDA 3CD7A 5KOXA 2JLFA 3CIZA 4CEFA 1DARA 1APSA 3MECA 4CLKA 4F8RA 3BYRA 3VQ8A 4P7VA 1WEYA 1JJ2M 2WW8A 1WC1A 3VEWA 4OYPA 1YJ7A 1NU0A 4CGGA 3KVGA 2P9NA 4DU7A 1KAZA 1SPBP 1DLOB 3LL3A 1RTJA 4LQ3A 4J9UE 5DJBA 1QQMA 4EAHD 3V9UA 2YQ1A 4FJHA 3A3OB 4FJ5A 1M1HA 1XBWA 4WK3A 1B0TA 4EHTA 1VQMN 1X9WA 2HS4A 5D77A 5KFAA 3MEEA 4DSJA 3EZOA 5H9FJ 2YNHB 5ADXH 3MPWA 1FDAA 2DH7A 1XNRK 2G0CA 2R8KA 4R0EA 1WELA 5L9NA 1YJ9N 1SH2A 1VR6A 2A2CA 1BLUA 1H2UX 2X7IA 1Z2LA 4B9SA 1VRUA 4YB1P 3HDSA 3MUVP 2J6TA 4HEA9 3W66A 2J5AA 2L08A 3HTVA 4AL6A 5AQHA 2WBMA 4PZVA 3OHBA 3NGDA 1U8SA 5HROB 3OD2A 3HP6A 3J7ZT 2JVRA 5FDLB 3IRWP 4NYNA 2RQMA 4K4TA 2HGMA 3Q24A 3AA2A 3M8YA 2VU5A 3KG1A 4OVLA 3J81Y 4ED4A 3DFEA 3ETMA 3PRDA 1T9VA 1VRTA 2DYAA 1X1PA 1XNQK 1SJ1A 1OVYA 3AODA 4Y00A 4DB3A 3QEXA 4X62J 2F7TA 2I1RA 4H5NA 4YDXA 1RT1B 2I7PA 1BXNA 2XQCA 2ZOGA 2FBTA 4RG8A 3D66A 2E1AA 3U1NA 4LF5F 3FZMA 2E1ZA 2NUUG 1NGEA 3QRQA 2VPWB 1KBRA 2UUBJ 3MZIA 3AD9C 4E8UA 5BPNA 1B64A 2MZQA 3GONA 4PEOA 4FF3A 5AE2A 4V19J 1LW2A 1XMQJ 5AXKA 5F0XA 2HKEA 1S10A 2ZJPL 1VFJA 5HO4A 1RAOA 2QA4S 2JGUA 3M2RA 4NLXA 2YKAA 4FJ8A 1FESA 3I4HX 1UL3A 2E8AA 1WSIA 3L9ZA 3LGHA 1CQNA 4J9PA 1RNHA 1CULA 2CPZA 1VQYA 1BI4A 5THWA 2RRAA 3OSPA 1DZ5A 4LR9A 1XWLA 2HIYA 3IR5B 1SS6A 4MYUA 4R8UA 5BR8K 1RKJA 1TUGB 1S1UA 2F5GA 1VQ9S 4JI1J 2P2CB 3NVMA 3X3UA 1NKBA 5E2QA 2W4PA 1BQXA 3KLHB 1KC8T 3TJAA 1VHXA 4ZP6A 3C15B 2MKHA 3SCJE 4IRDA 3K8WA 4LSNB 4DU8A 4K2JA 5ETOA 2DNMA 4ZJOA 5AZJA 1KNZA 5HANA 3CJ3A 5L1JA 3FR0A 4HUGA 2CNOB 2QL9B 4HLBA 1NSKL 1VQMS 4O5BA 3ITHB 4FF4A 4YQWA 1HNXJ 1JCGA 4EUVA 5EUHA 4E98A 1DGKN 3I0RB 1UPPA 4RBTA 4ECTA 3H2LA 4PL8A 1YQHA 3V4IA 1B92A 1SZ2A 4NYPA 3DU5A 2GS8A 3AXMA 2RIJA 3TJ9A 2PFUA 5EWGA 2G4BA 2NNWA 3DRPB 1JXVA 1FRMA 2E5LF 1UCNA 4ILGB 1A6LA 1WF0A 1K73T 3THPA 5MLCV 3DKDA 4QU6A 3TQEA 4DFMA 4Y3CA 2BQUA 4CF9A 3JAMO 3IG1B 1UMJA 2VD3A 3N6LA 2XLIA 4GO7X 4KB1A 5AQPA 4KIAA 5IZHA 2ZJPQ 3BGFA 3CCQN 3TVYA 3IGVA 3PEJA 3QIDA 3D3BJ 4NLQA 2F8TA 1REGX 3NCQA 5HLFA 4ED3A 5KFLA 2D9OA 3K9JA 1RAHB 1HW8A 1RHJB 3KUHA 1VIOA 3DDNA 2BEFA 1GMUA 1HYZA 2DXFA 2Y3YA 3MPDA 4LF4K 2C2MB 4ZIVA 3AVCA 1RILA 4DR2F 4K4XA 4PL7A 2FYXA 2VFRA 2PA8D 4M5IA 2B0GA 3NNCA 1XR6A 2PEBA 1X4DA 3PEHA 4ID8A 4YOEA 4Y2AA 4TY9A 3H40A 1IXKA 2HZCA 3S41A 1NDLA 5ETRA 1T6DA 2KG0A 2CQHA 1SKSA 2KT5A 2ZM6K 2BQ3A 2EVZA 4HUEA 2Q6CA 3LWLA 4NMLA 1T3NA 2G8FA 1SC6A 5HAOA 4CHOA 4C3KA 2DJWA 3E3XA 4HTLA 4IYQA 2C22A 5CZ1A 1KEKA 2HSTA 4NI2B 4V19S 4LQ9A 1J9AA 1C6VA 2XS5A 3QO9A 2N7CA 4CZEA 3M1VA 3O9SA 2DISA 3CJRA 1TK8A 2HNZB 5C0YA 4F4WA 2PEHA 1IKXA 3M4XA 2D1KA 1QY7A 2P9NB 4OGEA 5BRHA 3J81U 2NZTA 1C0FA 1JKHA 2IM0A 1YHQS 3CCWA 1KOHA 3E66A 3PV8A 3D6TB 4UOFA 1HJRA 4JI1F 2UXBK 4B8AB 2GELA 1GK8A 3AOAA 3ONQA 2KXNB 1H74A 2UXCK 2FSKA 2DRBA 2IA0A 3EDQB 3SUOA 2HS3A 5CZ2A 1A7GE 1C1BA 1D9FA 3VF6A 1TV6B 2B4PA 3EUNA 4PKDB 1IKYA 2G8HA 4DTUA 2HG4A 3QSIA 4LIWA 1HUXA 4ZCLA 4M42A 4RO0A 4KHSA 2A3JA 2HHVA 5KFTA 4HHHA 4RW9A 2UYTA 4JI6J 2RHKA 4NB4A 2BH1A 2IVMA 5EWEA 4CO0A 3V9ZA 3FBFA 3QJPA 2EFNA 3CJ4A 1NO8A 1Q82T 3U4LA 3IRXA 1WKJA 1C0UA 2WTUA 3QBWA 5F8MA 2B7CB 2DPIA 3EEQA 1CG2A 4CJUA 2QA4N 2BVZA 1D9DA 4LRDA 3BKTA 1HPMA 4CI6A 5HRPA 1JNZB 3VPZA 2FLNA 2E5LJ 4YR2A 3THVA 1GX5A 3TI0A 3WXLA 2JEFA 1SCJB 3P3DA 1VC0A 5A8KA 2QWRA 3H7HB 2YKNB 1FRLA 1SH3A 2E5LK 4L3KA 2MHEA 1KS2A 1FKOA 1U49A 1OY6A 2G1HA 4EBDA 3HJFA 4DMNA 3CMAN 2CQDA 1IG8A 2E2QA 3BREA 3MM8B 2WONA 4BY9C 2JJ4D 2RE1A 5LMNJ 4N41A 3VGKA 5F1XA 1DLOA 2VL1A 3IO1A 4OI3A 5KFBA 3LP1B 2NSBA 3A8KA 2GHPA 4CK3A 4QQBA 3QRRA 3F73A 3RRKA 3F5TA 3QGPA 4JI6K 4F50A 5BYSA 4F4XA 4H4KC 1VQPS 4R25A 4BGAA 2F9TA 1VQNS 1I51B 1JJ2R 4G1IA 5BR8J 3HM9A 3KLEB 2EI5A 3CXCR 2C2RA 1B9DA 2QLJB 3A2FA 4XTTA 1ZOTA 2D3ZA 1R27B 2Z58B 4GVMA 5KFGA 4U7CA 4IEIA 2QC3A 1T44A 1WNEA 3RMBA 1J2VA 3RMCA 4ZCMA 2YX6A 1F5AA 5E3PA 3UKUB 2V6AA 1HPZA 3L09A 5IM0B 3RTVA 5CABA 3GFXA 3CCZA 5IC6B 4CFBA 1NLVA 1OIAA 3E1YA 4ZKAA 1NNEA 4CHQA 1Y64A 2CVEA 3AB4B 2ITGA 2ALYB 2DY1A 2N82B 3BO2A 4C11B 4V1Ak 2ZVSA 1G99A 3C6TA 1UOCA 4A8WA 2FLPA 4JOUA 2XM3A 3GIMA 3N5FA 3VTHA 5ADXA 1FD8A 1YSJA 1S0VA 5HJXA 4USMA 1CZ9A 2BTFA 4CHNA 4DX6A 5GAHI 1KLMA 2CPXA 2JNJA 3P4IA 2DHXA 1QQNA 3MR6A 5ETNA 2LLZA 2E6MA 2YHWA 3ALYA 3NGKA 1YG0A 2VB6A 4OKKA 5EDWA 3PYFA 3I6PA 3JQMA 1PSDA 4PG5A 3K89A 2Z2ZA 2CPYA 3AJ1A 5F0UA 1TUVA 3MM9A 2WOMA 1L3VA 4QYZK 3QIOA 1RT2A 4FJIA 2BR0A 2DKOB 3MR2A 1P1TA 2DBBA 3HD2A 4DU3A 3DDKA 4BC5A 4BWJA 4DF4A 1E3MA 2FC0A 3LZJA 1X4GA 2FVPA 2DXEA 3RBXA 1E6VB 5HSPA 3MEDB 3KLHA 1A5VA 4A59A 4DQIA 2EEYA 2ERRA 3CMAS 4O3QA 4RNFA 3NCIA 2UV8G 4B1WB 4K8RA 2G0JA 2Q0UA 5DQIA 4PKHA 3S9HA 4ILMA 1WEXA 5AZJB 3QIPB 4FJNA 4FWLA 4YB6A 2X51A 4JI2K 4DSEA 3ZT4A 1J6ZA 4FJLA 1SJRA 3KUGA 4WKRA 5D8HB 1GLAG 3SUNA 2B5JA 3DLLL 3V1QA 3OLBA 1GAOA 1I39A 5IT9O 5D4PA 3MECB 4WIQA 4FLZA 4O8KA 3VALA 4Y2CA 1VQKS 1RLCL 3SK3A 2DNKA 3OHAA 1JXBA 1F6TA 1YVNA 3LPYA 1N5TA 4OZJA 2GVDB 5KG5A 1RDAA 1DHMA 4ZVHA 1TL3B 3ZSVA 3ZSYA 5ETPA 3J7AN 3SMPA 3OVSA 1OJ4A 4CJ5A 5LJ5Y 3SBTA 2AZ1A 3D2EA 4X65J 1LCUA 3CJQA 4Q8EA 2E6LA 4LMZA 3DXKB 1U6BA 3EX7B 3DLEB 2P9SA 2E7VA 1HX1A 4CIGA 4J2AA 5F9LA 4X64K 4PQUB 2MQNA 3POTA 3HHDA 4NLGA 2VPXB 4DV4J 4IOXA 2JFDA 3CJBA 1JCEA 1M5PC 3VQ4A 1EZZB 1HBMB 1YHQN 3IAYA 4NXMF 3BQ2A 5HI7A 4Y2IA 1U2FA 4OQJA 2V8VA 1S6OA 4RWXA 5D3GB 1FFSB 1X7VA 1L3TA 4GKKF 3EVWA 3VWSA 3F2KA 4JHDA 4MK9A 3U1LA 3NF8A 4AUKA 3BM7A 1YKWA 1K1SA 4IH5A 2ZC3A 3B78A 1YJTA 3NAIA 3ZZ0A 2W1BA 2ZNYA 4ZCIA 2NPFA 2IM3A 5AE3A 5L1LA 2XMMA 3UNYA 3QWPA 1PJ5A 4IG3B 1XTZA 3B54A 1RDUA 1XERA 4RWWA 1KTVA 2V52B 4IDKB 1FVQA 1WF1A 3FQKA 4UZCA 1RBLA 3L2UA 4JI4K 1SH0A 4USUA 4ZP9A 4DQPA 1RACB 4RNHA 2NPIA 3JTNA 4D3GA 3LO3A 4O3SA 1Q82O 1ZH5A 3VQTA 4W90B 3TQ1A 3LM2A 1TU0B 3TJ8A 2P9KA 2Y1RI 1XC9A 3TUIC 4AM7A 5BRFA 4JI8F 2X1AA 3BEGB 1Q95G 1IO2A 2ZUAA 3CCVS 2ZH1A 2H1YA 2D0AA 1YBUA 4MKBA 1GLEG 2VQEJ 3AAPA 5KT5A 1JWWA 5IWAJ 3S8SA 4HHTA 1I94J 5FPEA 3I5CA 3R7NB 5KFHA 3PX4A 1HHTP 1O13A 2YWFA 1IKWB 5AJ3F 4DX5A 2EBEA 1Q81T 4W5RA 2VZ9A 2VWKA 3MD3A 2JLEA 2R7QA 3TZZA 5D3GA 3NDKA 1FFWB 1FE4A 4QR0A 4YOXA 1MWKA 1ULRA 4Q5VA 3BZCA 3VQSA 1F60B 4RW8A 3RB0A 1YRXA 1DTQB 2DGXA 5FPDA 1HKAA 2YNFA 3IAM9 1ATSA 3MM7B 4FVMA 4MTPA 3CFPA 3TPQA 2NRRA 1T03A 4IO9L 3T5KA 4WE1A 4OL8A 2A0FB 4X4TA 2E7XA 2MKJA 1RA7A 1WOQA 1OVQA 5HVFA 4F67A 2DHAA 1W0HA 1NK9A 3CQ8A 4DS4A 1WWHA 1NM2A 4IDKA 3K8VA 3CW2C 4G65A 1FFGB 4LFCF 3TAMB 3PSIA 4F3MA 1R8BA 3BBBA 3GJQB 4X65F 3DLRA 4M5KA 3ID6A 1IJFB 2ZEJA 4BC9A 3M9MB 4HR2A 2KLAA 2ZD1A 1DQ8A 1MA9B 2G9OA 4W4MA 2ASMA 4EZ9A 5DM7L 1N32K 1DURA 2XSFA 1FDBA 2ZBQA 1BOTO 2W42A 4FLUA 1GMWD 1QVGM 4FM0A 1NBWA 3CJ2A 4KGZB 1P6TA 4TYBA 3NNAA 4YN3B 1BA0A 2FHJD 1UJ5A 2CPDA 3AB2B 5C2GA 4DUYF 1SL1A 3MXHP 2IIHA 4YORA 4BR4A 1U0HB 4JI0F 3HVRA 2A6MA 3MGJA 2WW4A 3HHLA 1ZBSA 4E19A 2QMXA 4EHUA 3DLEA 3UNGC 2CJ9A 3UN5A 5KAKA 4QPTA 3QQCD 1G1XA 3T5HA 4M95A 1HYVA 3SQ1A 2OA8A 3RRGA 2YWKA 3HXMA 2QL5B 3RBDA 2H3GX 2R2UA 2LU1A 3ZETA 3EN9A 4Y6IA 4ANEA 4A8SA 3ULEA 4IFYB 3FVYA 1NK6A 1EARA 1RDRA 1WTFA 2FC8A 4MO4A 1KVIA 1UJ4A 2XMAA 2K06A 1EQMA 1T05A 1DBDA 2QTDA 5EVZA 3DMJB 2MQPA 4FYDA 3AVGA 2PD1A 1SJ4P 3IA0A 4OFZA 3DOMB 4NLDA 5FD1A 3H3OB 4YB5A 3SFUA 2CYYA 1FNXH 4A8FA 3PJXA 2MQOA 3NGUA 3JXOA 2DT9A 1NZAA 3GZ7A 4MT1A 1U02A 1HWLA 1ZBLA 4MK7A 2K7JA 4IH7A 4LSNA 1BU6O 4G1QB 5CYJA 1TL1A 2R7WA 2RDIA 5AQGA 3BGUA 4OYAA 2XS7A 1NZ8A 5BR9A 2VFTA 1T95A 3CXCM 3P8BB 3A8IA 4FK2A 3THYA 1RDDA 4DV0F 2ACMA 3ZEUB 3VZIA 3KWIA 1FKPA 4NLPA 2MY8A 3CJ5A 3VAFA 1NMDA 1TQLA 2KB2A 5AJ3J 2YBVA 2AGQA 1YI2N 4CLSA 2XNQA 2OD4A 3CVKA 2HPUA 4DR7J 3LP0B 4WBFA 1VQPN 4KT0C 4DHYA 4W98A 1WJ9A 2RNEA 5LJWA 4OX9F 5A8RB 2R7XA 1QE1B 3B8AX 2H9ZA 1RKIA 5AZIB 1HYSB 1VI7A 1U1KA 3QAUA 3M9NB 3ZSQA 3UKRB 2ATLA 4CCHA 4LSLB 1KCFA 3OVNA 2XI3A 3HPGA 2KN4A 2ZBIA 5JJBA 2DPNA 4N7TA 1Y97A 3MAAA 4QU7A 1XNRF 3KLFB 3HYFA 4M5NA 2NXCA 2M52A 2PGCA 4DU4A 1K8AO 4N56A 3D6MB 4ED0A 1YWXA 2Q2RA 3EVOA 2CZ9A 3DWLA 3C6HA 2RF2A 2QL7B 3A8JA 4KAZA 2M70A 1HBNA 2L9WA 2EG2A 1WSVA 4WFXA 4CJEA 4KHQA 4A8YA 2GVDA 3PJ9A 4DTXA 1RTHB 1N32F 3L3CA 1O51A 1BHLA 4AL5A 3D5MA 3TAQA 5AT1B 2X6NA 2HQDA 3OA9A 4I56A 1VK3A 2IBKA 3L2VA 1W25A 3WX4A 3FQLA 5LMNF 2OSRA 4GKJF 1TL4A 4OIXA 2V4QA 5IT9U 5HN0A 2PSZA 1Q8BA 1D3WA 1ZM3A 1X4CA 2XI2A 1HARA 5HP1B 4J9SA 3CCJN 4DR2K 2M88A 4BC7A 2V4JA 3QPIA 1KXPA 4DPTA 4JI7F 2VKZG 2YWWA 2W9AA 5JMVA 4ZMMA 5DO2A 1SAZA 3W9JA 3CDBA 4XO0A 2Z1JA 5KFCA 3CPWR 2HNYA 4FVUA 2W2QP 1V5VA 4KC5A 2LSNA 3TTFA 1A5XA 5C2CA 1HQUA 2QT7A 1SC3B 2QWLA 3AJ2A 2MEWA 2BJ1A 3VZHA 4WFBQ 1D5AA 1JKHB 3OW2M 3QFHA 3HHLB 2GO9A 2XEXA 4B9TA 3ILJA 3MI7X 3KK2A 3UO0A 3RBEA 1X4AA 4CD3A 2G8VA 1BL3A 1RGIA 2BUNA 4MFBA 1TV6A 1TK5A 2OMLA 1VQLS 1S6QB 3TWZA 1OO0B 5DRKA 1JB0C 4NLBA 3N5BA 4CZCA 4AQYF 3HVWA 3OS1A 4OJHA 1UETA 4C4WA 1GOAA 1HWUA 3MCAB 4HDHA 2BJ9A 4OYWA 2XZDB 5LY3A 4IOCQ 2A42A 4JYAK 3HX9A 1CC8A 5KFOA 4A8KA 1UJ6A 4M63A 2F4VF 3ETOA 4ED2A 5AQVA 5DETA 2E9TA 4QWBA 2RILA 4C8ZA 2VH7A 1YI2S 4CZIA 1PIEA 2AGPA 5J1PA 1R0AA 4EYIB 2WSCC 1K44A 3IG1A 5KFNA 4B3RF 5GAHU 2NYHA 3F0NA 1EAYC 3I4PA 1IR2A 2F8EX 2UU9F 3MEDA 3QT7A 3AARA 4XH4A 2JFKA 1MU2B 1WUUA 4KGMA 3CM5A 3IC1A 5KFJA 3THTA 1YVUA 1RZMA 2YX4A 2J7KA 2ZKUA 5HOOA 2NCKL 3KK2B 2ASOA 2HHUA 2P51A 1IBMK 3RMAA 3T1YK 5HRNA 5D15A 1TFWA 3W0LA 2V2QA 2CNLB 2HAFA 4WTYA 1Q8KA 2EFOA 1IR0A 1RISA 2ZHBA 4W5OA 3VAHA 1HIYA 3E01B 3CJKB 2PYJA 4PY5A 4BHQA 2HGNA 1N5YB 4B1UB 3HSTB 1IJEB 5IC4B 5GINA 4KKOA 4NEZA 3G2XA 4YB7A 3G82B 5KFWA 3A8EA 3FMBA 3LOUA 2F3JA 3M8ZA 4P71A 3MMJA 3EL2A 2FJEB 1HR0F 1JMTA 2Q3SA 2FZKB 3N4WA 2J6UA 5LMNK 2EFGA 3KHYA 3VQPA 2FGOA 3VF0B 2KT3A 2EWSA 4DFKA 2RF2B 1S48A 2SXLA 4M3XA 1UAXA 3KNAA 1LK5A 2CQIA 3QLHA 2E29A 4K5RA 3H25A 4LF6F 2AJ0A 2AA4A 3M8RA 2C42A 4WFAQ 2Y8WA 1Q4RA 5A2QO 4PWDB 4ETZA 4MJKA 2H48B 1FRHA 3LP3A 1ZA1B 1I1GA 5KFMA 4JI4J 4OYIA 5GAEP 2MJNA 2BJ7A 2P9PB 4JI8K 1QQCA 2DHHA 3I8DA 4M8LA 3QNNA 1VOMA 2YKNA 3JTOA 4XIUA 4ISGA 3KIOA 4DQQA 4H4MA 2I6WA 2OTJN 4YOTA 3W64A 2PDAA 2MZJA 1JLFA 4CJFA 3D45A 2RDDA 1RBTA 2AYGA 1WSRA 2VQFK 4Q0BB 2IDLA 1QVFM 4Y1CA 3U27A 2AGOA 4DUYJ 2E88A 1TP7A 5KG7A 4NASA 1EIYB 4QS9A 1IV0A 2XG8A 1FXRA 4ECXA 4IUFA 2GMLA 4YHHF 3H3NO 3HRGA 3I0SB 2KZMA 1QVGR 1W7WA 1YJWS 3KWMA 2DGUA 4U95A 2J9DA 2RJZA 3CCSS 1T6CA 4BE1A 1VSFA 2WVCA 4C8OA 1U2VB 1UW4A 2V9WA 4M3YA 4E3SA 2Y1JA 3VQ7A 5BR8F 1XK8A 5KFIA 4BRPA 2Q66A 3DYAB 4ETXA 2XSJA 5ETVA 3I0RA 4CBXA 1T11A 3GCXP 3UR3C 3CCMS 3N28A 2WHOA 3EZWA 3QICA 4OX7A 1VJWA 1BQMB 1MWYA 1HNWF 2IIRA 4DV4K 1RT1A 4CJKA 3RAQA 3AY9A 2HQIA 3FCWA 2KVIA 2VQEF 1B3TA 1KHVA 2W7AA 3NG8A 4OV1A 1XMOF 3G96A 4DCOB 3MR3A 4XAKA 3VMFB 2OTJS 2XMUA 5ETSA 4IXCA 2PN6A 4GKJK 1RWVB 3CCSN 4JD2B 4RR5A 1QAYA 1N36K 1GNKA 2MKSA 4DX7A 1WSGA 2HBZB 1PJ6A 3R7BB 2V8PA 4X4QA 1M1KO 4DV0J 2A1SA 1NDKA 1HHSA 2KH9A 2RHSB 1U1NA 3ZSOA 2X6SA 2CQ4A 2W2NP 2AF6A 3GV8B 3I5AA 1RA6A 5BPMA 1D8YA 1WBBA 3M6GA 2O8DA 3TW0A 1RTZA 4U7BA 3J7A1 1CZAN 2AZ3A 1H2VZ 1M1KT 4ICLA 3U9DA 3ZT0A 2GTDA 4ELUA 2WUSA 4IKFA 3IM9A 4JV1A 3LPTA 3GFYA 1ZBTA 3CDEA 3DYAA 1HI8A 1RT7B 3UD5A 4NLSA 4KTWA 2XCPA 4ILJA 2KRRA