5CYMA

Hiv-1 reverse transcriptase complexed with 4-iodopyrazole
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
556
structure length
546
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNDKLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Rapid experimental SAD phasing and hot spot identification with halogenated fragments
doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase
total genus 151
structure length 546
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5cymA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cymA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cymA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cymA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5cymA05
1DLOB 4AHUA 5L9XA 1RTHB 3FQKA 1W0HA 3QETA 3IG1B 1U49A 1EXQA 3TAEA 1TK5A 4IG0B 1OS5A 3NAIA 2B5JB 1KVBA 1K1QA 1FK9A 3CQ8A 2FVPA 1GX6A 3KLHA 3OYJA 3QIPA 3ZCMA 2WK4A 4IDKB 1NOZA 4TSXA 4KAZA 4RW4B 2RDJA 2F8EX 1UWBB 4J9SA 4ID5A 2VG5B 1T94A 4IOBA 3I5BA 3O4NA 2Y1JA 3DM2A 4CIGA 4ED3A 2XY8A 3QINA 3H2LA 2QKBA 4NLRA 2VWKA 3OYIA 1T03B 5CY4A 3V1OA 3QEXA 3NH1A 4QWCA 3VQEA 4AHSA 4AHVA 1D9DA 1C1BB 1W9HA 3MR3A 3SI6A 4B9TA 1C2PA 2AJQA 2G8IA 3OYLA 3HSTB 3VQ5A 4FJJA 2HHQA 3GILA 3V81B 1U48A 2FVQA 4Y3CA 4DSKA 3AV9A 4TXSA 4TY8A 1C1CB 4W5QA 4N76A 4DFJA 2HNDA 3RAQA 4E7JA 3BQ1A 3Q8RB 4M3ZA 3ZT0A 3QEWA 1T3NA 3OLBA 5K14A 5DQHA 4KHRA 4Z4FA 3OY9A 3I5CA 5EDWA 4DU1A 1I3AA 4RW6B 1KVAA 2HHXA 3MEDA 1RDDA 4KI6A 1J9AA 3PW5A 4F4WA 3AVCA 5KFBA 4CHYA 2GUIA 1TKDA 4O44B 4Q43A 2YNFB 5HRPA 2QXFA 1S0NA 1JLBA 4ZVFA 4JV2A 4J9LA 4FLUA 4O3RA 1LWCB 3G6YA 4NLQA 1JKHA 1JLAB 2W9CA 1N5YB 2D0AA 4FXDA 1RTJA 2OZMA 2AGQA 2FVSA 2D41A 4CF0A 1LV5A 3LWMA 3T19A 1HQEA 1VSIA 4ZPCA 3OYGA 4DL6A 2UUWA 2XWYA 1FK9B 4URGA 1ZETA 5KT5A 1J53A 3KLHB 2WRMA 3NF7A 5E41A 3QIPB 4IBNA 2O4IA 4DTPA 4ECSA 4KAIA 1QS4A 4CJEA 1ZBHA 3O3HA 3VQAA 3SUNA 1ZBIA 1X1PA 4GW6A 4B9LA 4WE1A 4ID5B 1XR6A 2DFFA 2B43A 1ZTWA 4Q45A 2AGOA 2QE5A 3DM2B 2KZMA 3WNFA 1KLMB 3OYFA 5DG8A 2P5GA 4FJMA 3I8DA 2IC3A 5HRNA 4C8LA 2UVVA 4IRKA 4O3SA 1JLGB 4KE5A 5J1EB 5F9NA 4B9SA 4Q44A 1TAUA 4Z4EA 2P1JA 2G8HA 3KIOA 4MFBA 4MKBA 4BDPA 4F3TA 2OPSA 3QLHB 1S1XA 1EP4B 4KO0A 2F96A 4FCYA 3VQSA 1K6YA 3WNEA 1ZBUA 3SV4A 4R0EA 5HROA 4Z4GA 5KFLA 2DPJA 4JRPA 4KFBA 3QNNA 4EO8A 4B8CA 1SH3A 1S0OA 3ZSZA 4N56A 3S3MA 1D5AA 3G6VA 4WFZA 2HNDB 4LSNA 4LQ3A 1LWEB 4ECWA 4MK8A 3D45A 1WSGA 4DQSA 2IM1A 3O3FA 1QE1A 3OYBA 3PO4A 2HHSA 3LP0A 2OPPA 4Y2AA 1U45A 3IRXA 3B6PA 5K14B 1S0MA 4CECA 4EBEA 5J2NA 3ASMA 1LAWA 4PQUB 3KKSA 3MEDB 3VA0A 4DTNA 4E7KA 4IH7A 2E6LA 3ITHA 5J2PA 4GC6A 2W42A 3OS0A 3LAKA 3T5KA 1NKEA 1HNVB 3D5MA 1JLBB 2XI3A 4C8MA 4MK9A 4ECQA 4ZPBA 2B4JA 1TV6A 3VQ9A 1J54A 1N4LA 3EPIA 2W9CB 3SUPA 1RTJB 4HUFA 4F3OA 1WN7A 4KHQA 3HJFA 2GV9A 1IKYA 2YV0X 5FRMA 1S1WA 3NHGA 1U4BA 4WFYA 4B9NA 1I39A 1HQEB 1XC9A 4NLTA 4FW1A 5KFGA 1UA1A 4DFMA 4W5RA 1A5XA 3T5HA 4LQ9A 1Q9YA 3FQLA 4NLDA 2ILZA 4EP5A 2YKMA 5DMRA 3PV8A 1TKXB 1VSFA 4IRDA 3DRRB 1T05A 4Y34A 4WE1B 3NH0A 3KJVB 1XWLA 2DPIA 3DLRA 1HJRA 2IC3B 3CJ2A 4B9VA 3OYHA 4H4MA 3U3GA 3O4QA 5D3GA 5I42A 3FSIA 4IH6A 1S1UA 3DLBA 4CK1A 4XIUA 3AVFA 3LDSA 3CFPA 3V1RA 4FVMA 1EETA 3KLFA 2PZSA 3GQCA 3E01A 4MFBB 1S1XB 2OPSB 4FJ5A 4KO0B 1SUQB 3NL0A 4WYWA 3H40A 4NRTA 1JIHA 1RT2A 2ZQBA 4O5BA 2RPIA 3KD5E 3T5LA 2JEIA 3LAMA 3EYZA 5KFHA 1DTTA 5HROB 5KT7A 2P5OA 5DG9A 5HP1A 4F2SA 3NF9A 3NDKA 2ETJA 1NJZA 4NLUA 5KG7A 4CIFA 4NCBA 4CF9A 1TKZA 2E9TA 4RG8A 1ZBFA 5HRRA 2OH2A 5KGXA 1NNDA 3CYMA 1ZBLA 1CZ9A 2C22A 3LP0B 4IFYA 1L5UA 4DMNA 3SPYA 5T14A 3IRXB 1BQNB 2E9RX 4WYLA 3DLKB 2R2TA 4CE9A 4C8KA 2LSNA 4RNOA 4J2BA 4BE0A 4DU4A 3MR6A 1ASVA 1NJXA 5C24A 4CHZA 1XR5A 4BACA 1QAJA 3KK3B 3HP9A 3ITHB 5J2PB 4AH9A 4KB7A 5F9LA 3I5AA 2EC0A 4FJ8A 3HPHA 4ZVHA 4CERA 4L8RB 2RKIB 1D0EA 4ZTJA 3AA3A 4FJKA 1HPZB 1RT4A 1TV6B 2R2SA 2IAJB 4HTUA 4FK2A 4M3XA 2AX0A 4O4RA 3DOLA 2HW3A 2HNYA 2C28A 3KLVA 2KFNA 5HLFA 3V9SA 4CJPA 3V6DA 3P83D 4DTRA 3BSOA 1FXXA 4IRCA 3CFOA 4JLHA 3KK2A 3BJYA 2P51A 1Q8IA 2DFHA 1S1VA 4ED0A 4E7HA 5HBMB 2YKMB 3RR7A 2X78A 3NFAA 4Y1DA 2FBYA 3KK1B 1T05B 4KTZA 3QO9B 1JLEB 1S5JA 1RBVA 2R8IA 3ZSRA 4ID1A 4BE2A 3M8PA 2J6TA 2GC8A 4CJUA 2XRIA 1MU2B 4ZTFA 3D28A 3MEGA 4H4MB 3L3VA 1NOYA 1RDBA 5I42B 1TKTA 1RDAA 4EBCA 3Q8SB 1N6QA 2XY6A 1TQLA 4HCBA 1EETB 1KTQA 3KLFB 3S9HA 3UIQA 4FJLA 3P1GA 3E01B 3QGIA 4DWIA 4K4UA 2W8LA 1HARA 2IS3A 3WNGA 4MK7A 3H5XA 2B6AA 4CJ4A 4WFXA 1RT2B 2IDOA 2QKKA 2IOCA 1DTTB 2UVUA 4CGDA 5HP1B 1JLFA 4UQGA 4FM0A 2X6SA 3ZT1A 3M8QA 2HHWA 4YMEA 3PW0A 2J6UA 1NHVA 4K4VA 4WXOA 2HNZB 4EYIB 4YR0A 4AHRA 3EZ5A 1RTDA 3VN5A 5JS1A 1JLQB 3OHBA 3DYAA 5KFPA 4J9QA 3ZSXA 3IS9B 3LZIA 5FDLB 5CYMA 3NKYA 4CJWA 4W5OA 4URQU 4R8UA 5FROA 4CFDA 1RT7A 1VSDA 4HCCA 5C24B 4U6PA 4KKOA 1VSMA 4DU3A 2R2RA 2FJVA 3IGNA 4OKEA 2BQUA 5EU7A 4FLXA 5EWEA 3SQ2A 2OPRA 1NJWA 1CSJA 1BISA 3KLIB 1ZTTA 3AO3A 4FZYA 2ZE2A 5F8LA 1D8YA 4FZZA 4K4WA 2YHBA 2HHTA 1RT4B 1RBUA 1JXEA 4CEOA 1QSYA 3RRGA 4NCGB 2JEGA 2FBTA 4ECVA 3LP1A 5KG3A 4KHSA 4ECUA 4PWDA 3AO2A 3PX0A 3L2WA 2AGPA 4CJRA 1HYSB 1NK0A 5KG0A 4CGIA 1HRHA 1RTIB 2XO7A 3CJ4A 3KK2B 3KLEA 2HHUA 1C0UA 3SFUA 3M9MB 5JUMA 5KFQA 4MH8A 4E0DA 3VQBA 1EX4A 1IKVA 3FDSA 3DMJA 4DQRA 3TQ1A 3H5UA 1XI1A 1RBRA 3QIDA 2C2DA 3MECA 4O0IA 4I7FB 4CEFA 3M8PB 4CF2A 3KMQA 3NGZA 3BGRA 3V9ZA 1LW0B 3HVRA 4EEYA 2KTQA 3RMBA 1N6QB 2OPQA 5EUHA 2G8FA 3PW4A 2R7YA 1S6QB 1SH2A 1VSLA 2R8JA 3WNHA 4DQQA 2AX1A 3ISND 1TVRA 4ICLB 3E51A 3CWJA 5CYQA 4M3YA 4HUGA 4CJQA 4DQPA 4EYHB 2AQ4A 2B6AB 3O3GA 3DI6A 3RWUA 3TAMA 4RNFA 4JS5A 4M3WA 1L3SA 3HK2A 3N6NA 3MEEA 4E7LA 3GIMA 3M8QB 3C6UB 5DGAA 1VSEA 2ZD1B 2R2UA 4M94A 2GIQA 1QSSA 1DTQB 3OVNA 4M41A 3OYKA 4M3TA 3CVKA 3V6HA 5KFZA 1RTDB 1B9DA 2BQ3A 1K1SA 3M9OB 3DYAB 2DTUA 4JUZA 2EX3A 4ZP8A 1C0MA 4F2RA 2HVHA 5CYMB 1SV5A 3OSPA 3HKWA 4K4YA 4JRQA 1IM4A 4Z4CA 4OGCA 4K4SA 1FKPA 4KKOB 3LPUA 3CJ0A 3HVWA 4ZMMA 3I0SA 3CG7A 4DF8A 3HPGA 4BDYA 1S9EA 3ULDA 4WXWA 5KFSA 3B6OA 4CHQA 4LH4A 1C0TA 4G1QA 1BIUA 4NLXA 1RYRA 2J6SA 2I1RA 4M3UA 4X2BA 2FLPA 4OLAA 3LP1B 2V4QA 3AA2A 4PWDB 3M8RA 2XHBA 3MFIA 1U09A 3DRSA 4B3OA 3NH2A 4LH5A 1RT1A 3PR4A 4F4XA 4ED1A 3KLEB 1S97A 3NF8A 4DS5A 4KPYA 1BQMA 1C0UB 4NCAA 1A5WA 2D0BA 3OJSA 2RF2A 4NRUA 1NK8A 4CGGA 5KI6A 1RYSA 4ZP6A 4ECXA 3HO1A 3U6FA 2YHAA 4DFKA 3KMSA 3MECB 1WNEA 1U04A 3VQQA 3PHEA 4DL3A 2D7SA 4H54A 3BGRB 2YNHA 2IA6A 5KFCA 4IG3A 2OPQB 4EBDA 4Q8EA 4XPCA 4NYZA 2D3ZA 2HVIA 2BGGA 2KW4A 3VQ8A 4Q8FA 3NE6A 4FJ7A 4LSLA 5C42A 4TY8B 5J2QA 3SQ0A 5KFAA 2XGQA 1ASUA 2W9BA 1SKRA 5KGWA 1NK5A 1KHWA 4BWJA 2DY4A 3THVA 1KHVA 3TAMB 4K4XA 4CEEA 2ILYA 2JC1A 3TABA 4RW8A 4QWEA 3VQCA 3G86A 2AWZA 3ICLA 5F8JA 3CDUA 3RTVA 3MEEB 4MIAA 3RR8A 5KT3A 4FLVA 4ED8A 4FJ9A 3LPTA 3CDEA 2UVRA 3S3OA 4KRFA 2HB5A 4ZVGA 1IKWA 4EP4A 2X74A 1SV5B 3QEVA 1VSKA 5KFRA 1WSHA 1FKPB 1TAQA 3ISNC 3G10A 3RB4A 4CJVA 5KG6A 4TYBA 3OL6A 3CJ5A 1JKHB 3HT3A 3T3FA 3SFGA 3N6MA 1RT5A 1IKXA 1MMLA 3JYTA 4IR9A 3RB0A 4DEZA 2FJWA 3UQSA 3CM6A 3OYEA 4DL5A 4FBTA 1SH0A 1S9EB 2E4LA 4E19A 4YNQA 1HYVA 3C6TA 1REVA 3CIZA 3AVLA 4RUCA 4FK4A 4E7IA 4G1QB 3KD1E 5CZ2A 4CJ5A 2V9WA 4NLSA 1RT6A 3H08A 4CJTA 3LP3A 2BANA 4K8ZA 3ZSVA 3KHGA 2IBKA 4FS2A 3RBEA 2Z1HA 2VG6A 4B3OB 2X6NA 4CEZA 4EZ9A 4J2DA 3OJUA 1BQMB 2D3UA 4M95A 2FBVA 1JXBA 4CK2A 1S49A 2R8KA 3TI0A 3UDLA 5SZTA 1BCOA 2RF2B 2JEJA 3HM9A 2KZZA 4J9MA 3I0RA 4ZHRA 2BRKA 4BE1A 1B9FA 3QIOA 4E89A 4J2EA 2WONA 4RNNA 3L2UA 2OYQA 1GOAA 2YNHB 4O3NA 1NK4A 5L1KA 4IG3B 2G8UA 4IQXA 4KTWA 4DG1A 4KFBB 1QHTA 4LSLB 5C42B 4RNHA 4YR2A 1Z26A 4MQ3A 2W9BB 4ZPDA 4DSFA 4IFVA 3TANA 2JLEA 1NK6A 4N47A 4LSNB 5KFTA 1G15A 1D9FA 1QE1B 4CHOA 4YFUA 2OPPB 5KT2A 3C95A 1RT3A 3HPOA 4Z0UA 4QPXA 1RDCA 5J2NB 3KNAA 4IR1A 1F21A 4OLBA 4F4YA 3OYNA 4FM2A 3TAQA 2E9ZA 4CHPA 3OYDA 3V4IA 3H4DA 3NMAA 2IM2A 4CGFA 3AVKA 5KFWA 4DSEA 4YQWA 4F4KA 4H8KA 2D0CA 4Q0BA 3H5SA 3CO9A 3DDKA 2R8GA 4B9MA 3PX6A 3NGIA 4O4GA 4DLEA 5L1LA 5KFFA 1NHUA 4H4OA 2Q3SA 1CLQA 1GOBA 2RN2A 4NYNA 4CJKA 4J9PA 1IKXB 4Y1CA 1WNSA 4HUEA 3JYTB 1IKYB 1QSLA 3IG1A 3EZUA 4ZVEA 1S1WB 4LD0A 1SL0A 1JL1A 3BSNA 4DS4A 1QQCA 4O3OA 3ZT3A 3C6TB 4XPEA 1REVB 3L2VA 3TAPA 3MTKA 2BQRA 3PR5B 3G6XA 5KFYA 1W25A 1VK0A 2VA3A 4IKAA 4J9OA 2ZKUA 3OLAA 2IJNA 1BHLA 3MAQA 3VQ6A 1UWBA 1VRUA 2VG5A 3NBPA 2VG6B 3T5JA 4J9RA 5F8NA 2UVWA 5D3GB 1IO2A 4FLTA 1QAIA 1S1UB 3SZ2A 3OL8A 2Z1IA 2F8TA 3F9KA 4KSEB 4ZHRB 4TN2A 1IH7A 4DF4A 1KFDA 2G8WA 3BR9A 4CCHA 4DSJA 3FFIA 4I2PA 3PVXA 1CXQA 5KRSA 2WONB 4EZ6A 2KQ2A 5KFJA 2CJQA 4CEAA 1LWFA 4DL4A 3G0ZA 3OL7A 3NGDA 5KG2A 1TL1A 2VWJA 4C8NA 3AA5X 1GX5A 4LY7A 1HQUA 1R0AA 2GIRA 5DK5A 4R5PA 3LP2A 4DG1B 5C25A 4YR3A 3T1AA 4O3QA 4AHTA 4FK0A 1X9SA 4QCLA 4OGEA 4W5NA 5CZ1A 4NLPA 1NKCA 2C2RA 4IFVB 2XCPA 1TKZB 4DTOA 2PY5A 4FZXC 1HMVA 3RBDA 4DTUA 1BL3A 2Z1GA 2VG7A 4IFYB 3KHRA 3NCIA 3BQ2A 4I9LA 3BQ0A 4Y2CA 1TL3A 4DLGA 4RW6A 4B9UA 1T8EA 3UR0A 1WAJA 1RDRA 4U7CA 3CDWA 3V4IB 1S9FA 2ASDA 3OS2A 2ASJA 3VQ7A 5F8IA 2G8KA 5KRTA 2V4RA 3MXMA 2YNFA 2W9AA 5DLFA 4O4GB 1JXLA 2YKNA 3H5YA 4H4OB 2YNGA 3ZSOA 1Z4UA 4OL8A 4NYFA 1RILA 1N5YA 3ZT4A 3TWHA 5HRSA 2A1SA 3HYFA 4O0JA 1KLNA 2O4GA 3QZ7A 3K5NA 3SV3A 3KHLA 4FLWA 3DOLB 2HNYB 2HWIA 3IN5A 4CF1A 3HP6A 1BIZA 3ALYA 4ECRA 5HLFB 3V6DB 4XO0A 4PA1A 4TYAA 1RBTA 3PX4A 4WZQA 5F8GA 4OPJA 3AA4A 4J9NA 1S1VB 1VRTA 5I3UA 4OJRA 3SQ4A 1VRUB 3AO1A 3LANA 3L8BA 1YT3A 3TVKA 3NBPB 4URSA 4QOZB 4O55A 3DOKA 5DLGA 1WAFA 3SI8A 3V1QA 3QERA 1KLMA 4DQIA 1HNIA 3MEGB 4CFBA 1X9MA 3MFHA 1TKTB 1JLGA 3CM5A 2BR0A 2EHGA 5J1EA 1JL2A 1RA6A 1BI4A 3OYAA 4PUOA 1UOCA 4FBUA 3K58A 4I2PB 3FFIB 3QLHA 1EP4A 3NAHA 4CJFA 4J2AA 3S3NA 1LWFB 3Q8PB 3PO5A 3KOAA 1TL1B 1S48A 3U3YA 3TR8A 3MR2A 1NJYA 1SL1A 1HQUB 1R0AB 4K4ZA 1JLFB 2V0NA 1Z25A 4R5PB 3LP2B 5C25B 2IMWP 1X9WA 4TQSA 4MIBA 1YVFA 3RRHA 4CFAA 1XR7A 1LWEA 1HMVB 4FM1A 2VG7B 4RW7A 4ZP9A 2ATLA 3D0PA 1TL3B 4PQUA 4R8UB 3HVTA 1RT7B 2DFEA 3L2QA 4RZRA 1HYZA 3QEPA 4K50A 1KSPA 3IAYA 4BDZA 3AO4A 1T7PA 4OVLA 4YP3A 4KB1A 1HNVA 2OPRB 3K59A 4M42A 3KTQA 2FBXA 3TAFA 2HHVA 4NLGA 2YKNB 2IJFA 3BDPA 4F50A 5C5JA 2YNGB 2ZE2B 1TK0A 2XY5A 2ITGA 3GYNA 3HHKA 3RMDA 4TY9A 1C6VA 3PJXA 2D5RA 5KFVA 4KHWA 2QV6A 5T7BA 1RAJA 2YNIA 3V9WA 5FRNA 2OZSA 4KHNA 4TLRA 3K5LA 4K4TA 2JEFA 2XGPA 2Y1IA 3H59A 4KHMA 1IG9A 1WLJA 1VRTB 1IKVB 5I3UB 1TKXA 3DMJB 5L1JA 5KG1A 3DRRA 1S9GA 5KT6A 4FJXA 4M3RA 4QAGA 3TARA 3KJVA 4OKJA 4Z4IA 3K57A 3DOKB 4CGJA 4QW9A 5J2MA 3GIKA 2IM3A 5KFMA 1HNIB 3F73A 4ELTA 3QZ8A 2F8SA 4DL2A 4DSIA 2HAIA 2FVCA 3Q8QB 5KG4A 4FJNA 1BI4B 4E1NA 4PUOB 1KRPA 1I6JA 3AVHA 1TVRB 4FLZA 1SUQA 3OYCA 5CYQB 4CESA 3JSMA 1RA7A 4TQRA 3C94A 1QTMA 3ZSQA 3KKRA 3DI6B 3DLGA 4F8RA 3AVAA 3N6LA 4KBIA 4DTSA 4AILC 3A2FA 4CHNA 1CZBA 4Q5VA 2ATQA 1D1UA 1RBSA 2WB4A 4I9QA 1CXUA 2PYLA 4ECYA 4RU9A 4Z4HA 1NKBA 4RW7B 1BQNA 4WZMA 4HHTA 3DLKA 2OA8A 3V6JA 3HVTB 3SPZA 3FRZA 3DLEA 1S10A 2WHOA 4NLVA 4N41A 2BRLA 1WSFA 3MR5A 4O3PA 1JX4A 4IH5A 3KK3A 4KV8A 1S1TA 4CEBA 2FLNA 3I0SB 3AO5A 4BWMA 4HKQA 1B92A 3VQ4A 3QNOA 2RKIA 1YVUA 2HWHA 2FVRA 4ED6A 4IKFA 1N56A 3NGYA 1HPZA 1C0TB 1BGXT 3V9XA 4EO6A 5EWFA 2IAJA 1NK7A 3NAEA 4FS1A 5JS2A 3AVJA 4HYKA 1RNHA 1JLCA 3AVBA 3GIIA 4NLWA 2CKWA 3LWLA 3TAGA 4QW8A 3DRSB 1KVCA 3MXIA 2XCAA 4FLYA 2YNIB 1RT1B 3GV7B 4ZP7A 4CGHA 2O5DA 4ED7A 4CJLA 3UPFA 2HMIA 3QYYA 1A5VA 4K8XA 5HBMA 3NF6A 1RCHA 5KFNA 3PW7A 2ALZA 4KTQA 3QGGA 3CFRA 3SQ1A 3SUOA 2W7PA 3KK1A 1S9GB 4E1MA 3QO9A 1JLEA 1Q9XA 3BSAA 1KCFA 3PY8A 5J2MB 1LW2A 1MU2A 1S6PA 2W8KA 3LZJA 3QESA 5SWMA 2BDPA 4ELUA 4NLOA 1SKSA 4G3IA 5DGBA 4RW9A 4QWBA 3V6KA 3HXMA 4FJIA 4KHYA 1C1AA 4I2QA 1KFSA 2XC9A 2WOMA 5J2QB 4CK3A 5L1IA 1LAVA 3JSMB 5KTQA 3M9NB 2C2EA 4OKKA 4JS4A 3H4BA 3SYZA 4JV1A 3DLGB 1ZYQA 4ZPAA 2UUTA 4RUAA 3OS1A 4RNMA 4W5TA 4DTMA 3OL9A 3H98A 1L3TA 4RW8B 1TK8A 5JXSA 3KLGA 2I5JA 2BE2A 4F4ZA 4NLYA 4CEQA 2HNZA 2G8VA 2Z1JA 3OYMA 2W7OA 4AHCA 1XHZA 1JLQA 3IS9A 5FDLA 1L3UA 5KFXA 1FKOA 1IKWB 4KI4A 2KFZA 4FJGA 1J5OA 1YTAA 3RB3A 1SL2A 1WSIA 1U47A 3DLEB 2E6MA 3QEIA 2QK9A 3DRPA 3ZSYA 5KG5A 4PY5A 3K5OA 4KV8B 2VA2A 1DLOA 1S1TB 3LALA 1RTHA 1UA0A 1RT5B 4J9KA 3HL8A 1O1WA 4IG0A 5KFDA 5KFIA 3ZT2A 5KFEA 3PJWA 2XY7A 3KLIA 2B5JA 3SUQA 3RB6A 4N5SA 1VSHA 2WCXA 3M8SA 4CF8A 4IDKA 3L3UA 5KFKA 4FJHA 1RT6B 4MKAA 1N48A 4NCGA 3MF5A 2BANB 4M45A 4RW4A 3V9UA 5KFUA 3K5MA 1JLCB 4CJ3A 1HYSA 3VQDA 4C8OA 1YTUA 2NUBA 1RTIA 3VA3A 3SJJA 4KB0A 5F8HA 1ASWA 5DQIA 1TP7A 4QWDA 3RMCA 2IGIA 4ELVA 4CJSA 3ZSWA 1T03A 2HMIB 4ECZA 5KFOA 1EKEA 3K2PA 3OHAA 2WTFA 3I0RB 1VSJA 4GC7A 4DTXA 4KHUA 4CEDA 3PZPA 1S4FA 3AVGA 4I7FA 3RMAA 3KHHA 2PYJA 1C1BA 1LW2B 2FLLA 1SKWA 1S6PB 5EWGA 3QGHA 1LW0A 1WSEA 4E3SA 5KT4A 1QUVA 1S6QA 4OPKA 5DQGA 4GVMA 4RW9B 3AVNA 3V81A 2IM0A 5DG7A 1WSJA 3EY1A 4I2QB 4ICLA 1C1CA 2WOMB 1GOCA 4FYDA 1ITGA 2FC0A 3P5JA 3PUFA 3AVMA 4FW2A 4KREA 4ECTA 3HVAA 2XI2A 2JGUA 4B8AB 3SNNA 2ASLA 5F8MA 3RAXA 3MXJA 1Y97A 1RT3B 3PW2A 3VQPA 1BCMA 3KLGB 2I5JB 2BE2B 3C6UA 2RDIA 2A1RA 2ZD1A 4CFCA 3SCXA 3BREA 1DTQA 4NZ0A 4DTJA 1UAXA 1L3VA 4DFPA 4CIEA 3EPGA 3IGVA 2R8HA 4DSLA 4QWAA 3OSNA 4DL7A 3BSCA 4ED2A 1FKOB 4O44A 4JV0A 3AVIA 4Q0BB 3GV8B 2AU0A 4GMJB 4HVJA 1J5OB 3L2RA 3CJ3A 2JC0A 1XHXA 3DLHA 1TGOA 4B08A 2GBZA 1LWCA 2FJXA 3GIJA 3DRPB 3GV5B 1NK9A 1JLAA
chains in the Genus database with same CATH superfamily
2N7CA 2VD3A 3ZZUA 2RDDA 2OTJS 3IG1B 2O8EB 1U49A 1TK5A 3R9PA 1OS5A 2HEKA 5DO2A 4LF9J 1KVBA 3VF4A 4F4AA 1YJ7A 1YWXA 1VQ9S 2UXBK 5HQMA 4M8LA 5LJWA 1ZBTA 3FSXA 2J9DE 2FHKA 3JQKA 4PXBA 4AQYF 4E2FB 1WC1A 1R89A 1UWBB 5HJXA 4IOBA 4B3SK 4JKGA 3RJMB 4CIGA 3NNAA 4BC3A 4ED3A 1KTVA 3BGLA 3H2LA 2DY1A 2QKBA 4DV4F 2VWKA 4B1WB 1ATNA 2Y9HA 1TUGB 4QWCA 4Y65A 1G99A 1AFIA 3R8YA 4MLHA 3TZWA 5IWAJ 3MUVP 3GFYA 1VHIA 1C2PA 3TUIC 3L7OA 1FJ7A 1YJTA 2ZH9A 2ZVSA 4FJJA 1HNXJ 3O08A 3GILA 2BKNA 5KPZA 4DV5K 3V81B 1CS4A 3W5ZA 4DSKA 3HOSA 1YKWA 1Z1ZA 4TXSA 2PBDA 4W5QA 4NPOA 4CRJA 4DFJA 4NEYA 2ZBQA 3BQ1A 1M1KT 3OLBA 1IBMF 1RP5A 4H03B 1EQYA 3OY9A 2KJWA 4C4WA 1KVAA 1FFSB 3MEDA 2XYGB 3RG6A 3PYGA 3Q7BA 3CQYA 3AVCA 1RAAB 4GVBA 2JL9A 1IM6A 1KOOA 4WBFA 4O44B 3BO3A 3KWIA 4EMDA 1S7IA 2AYEA 4L74A 2CGJA 3HI0A 1N5YB 4FXDA 2AGQA 4WQ5C 3ILJA 1VSIA 3ENWA 1QVGR 4BCAA 2XWYA 2FHMA 2VH7A 2ZOGA 3ATVA 4OZLA 1YZ7A 4CBXA 4DTPA 2QLBB 2GV1A 1S99A 2KXHA 2LECA 3GP9A 4ZLJA 2CGLA 5LSRA 2AJ0A 4J8FA 4DV6F 1ZPWX 4B9LA 1UTAA 2YKAA 2VYPA 1UVLA 1XR6A 2HGMA 2DFFA 2AGOA 4JKGB 2N3OA 2W25A 2KZMA 1JCEA 3I8DA 1AFJA 3VTHA 3CCRS 4LF6K 3AGRA 1NH8A 2NXCA 3DGVA 4O3SA 2WW8A 1RHJB 4ZCKA 5J1EB 4H0YB 4QS9A 3IKMA 5F9NA 3HFZB 1TAUA 2OI2A 4OI1A 4O8KA 2G8HA 1HW8A 1ZZNA 4JI7J 2X1BA 1MMNA 4F3TA 2OPSA 4KO0A 2F96A 3R8EA 2HGLA 3W66A 1K6YA 3ZEUA 2KG1A 4CI6A 1CS4B 4CNYA 3FZLA 1N5VA 4WFZA 4LQ3A 3D45A 2IM1A 1QE1A 1Q82T 3LP0A 3O8MA 2OPPA 2KKZA 3BPDA 5B8HA 3M32B 2EFQA 4PWUA 2DR9A 4EBEA 5J2NA 2W24A 3ASMA 4OJGA 3MEDB 4MTPA 4E7KA 5AQVA 3D9BA 2E6LA 3LW5C 4GVBB 3QT6A 2P9UA 5C7PA 3OS0A 4K0KJ 3MCSA 2HURA 1NKEA 2DB1A 1X4GA 1NGGA 3E66A 4BRIA 4C8MA 2J5AA 4MK9A 1NU0A 4ECQA 3MZIA 1KDNA 3ZO7A 2B4JA 1BC6A 4OV1A 1J54A 1N4LA 3EPIA 4NMLA 3HD1A 1DAXA 3LH2S 2YV0X 3KJFB 4WFYA 1VQ8S 2RJZA 2VU5A 2Q0UA 2JLFA 4NLTA 3PTWA 2HVDA 5AQZA 4ALZA 3T5HA 4CI0B 1NHKL 5A2QO 4B3MF 4EP5A 2EPIA 1H7WA 5ELZA 4DV7K 3W61A 4CT8A 4NEZA 4IRDA 4FF4A 1T05A 4Y34A 3MPWA 2BOPA 1XWLA 3FZKA 1HJRA 5EXWA 1NG9A 2F9DA 3KJQB 4H4MA 4IH6A 1S1UA 4HI2A 2OP5A 3PYEA 1X4BA 4AQYJ 3IC1A 1EETA 2Z8QA 4DR4K 2PZSA 4LFBK 2OPSB 3GIRA 4KO0B 4DV4J 3G25A 3H40A 2DCUB 3KFWX 3KD5E 3T5LA 3B82A 2YH1A 3ZEUB 5KFHA 5KT7A 3VAKA 4R79A 3U1MA 5K8PA 3EXYA 4F2SA 3CETA 3KXDA 4HI1A 1ZOTA 3H20A 2CVIA 2CQDA 5KG7A 3W2WA 3G96A 4NCBA 4GKJF 1HW9A 5HRRA 5LM7E 3LP0B 4IFYA 1NDCA 4DMNA 5T14A 2R2TA 3BKFA 3CCJS 4DU4A 1ASVA 3SIPB 1XR5A 1YBAA 1X4FA 3I32A 4N8OA 1PO6A 2P9KA 2DHHA 1IBMJ 2YHWA 2OFGX 4L8RB 3DFEA 2GUPA 1WTBA 2QLFB 3O9QA 2P9PA 2Y1LB 3TTDA 4FK2A 4M3XA 2AX0A 3HX9A 1FNXH 3VZIA 5M2PA 3V9SA 1V6HA 2UV8A 1PGZA 1FXXA 2KXNB 3ILOA 1T9WA 2YHXA 4JLHA 1W2IA 1YJ9N 3THXB 5M1OA 3BJYA 2P51A 4H5WA 1Q8IA 3AB2B 4ED0A 2DFHA 3TUPA 3RR7A 2X78A 2QWQA 1T05B 4ANCA 3KG1A 1O0PA 1QVFM 1H2TZ 2GC8A 4DUYK 3MM6A 4H4MB 1RDBA 2ZC4A 2VB6A 4EBCA 3Q8SB 1SJ4P 2VHGA 2XY6A 2ZBRA 2HHPA 4DV6J 2PE8A 2YHYA 2UUAK 3WT0A 1EETB 2XMKA 2ROEA 4X65F 3QGIA 4DR7F 2IS3A 1BA0A 4C8ZA 3P38A 5L38A 4UY8O 1VQPS 5RUBA 4MK7A 3FRYA 4K59A 4CP5A 5LMNF 4CGDA 1U1MA 3DLLL 4FM0A 2X6SA 4LR8A 2HHWA 2R7QA 1NAQA 4YMEA 2J8SA 2J9DA 3W2WB 4AL5A 3HF5A 2M2BA 2HNZB 4AHRA 1EKRA 4WQ4C 2CJAA 2HBZB 4CNZA 2Q6CA 3ZSXA 3CGIA 3LZIA 2R4FA 5CYMA 2YKQA 4R8UA 3M4XA 5FROA 1Y4ZB 3PACA 2RB7A 2DNOA 3AA8A 1VQ4S 4EK2A 3GE1A 5AZJA 1AUSL 5D6GA 5LJVA 3IGNA 4V1Ak 3E9OA 5EWEA 2C2OB 3RU0A 3KLIB 1ZTTA 3FMBA 1N8RO 4FZZA 5F8LA 5G4DA 1D8YA 2P9PB 2HHTA 1MROA 2MQNA 2W2OP 2NS1B 4KGKA 1N33F 5F0XA 2EFPA 1QSYA 3RRGA 4NCGB 2JEGA 2FBTA 4ECVA 2I0XA 2E1AA 1VK8A 1RLCL 3L2WA 4CJRA 1HYSB 5KG0A 4QS7A 1VQOS 3ZTQA 1JCFA 1PYTA 2FZCB 2CJKA 1RTIB 2FF6A 2CQGA 2XO7A 3CJ4A 4WU3A 4K5SA 8AT1B 4MH8A 3HOTA 2RD5C 3FDSA 3PIPL 4IO9L 2V8VA 3OVBA 3TQ1A 4JP8A 4JHDB 1XI1A 1RBRA 2D1KA 3O9TA 3BZKA 3VESA 3MM6B 5MAOA 3RMBA 2OPQA 5KAKA 3M30B 4MKVA 3JAMY 5C2CA 3O5BA 3O44A 3OFGA 4DQQA 2Z56B 1UWAA 5CXTA 3E51A 2KM8B 1PYSB 1EWRA 3WC2A 3A8JA 1GFWB 2AEMA 2CDRB 4LF2A 5A0YB 1L3SA 2KXFA 4ILHA 1SKUB 3GIMA 1IR0A 3SCJE 4C6AA 2R2UA 4M94A 2GIQA 3OR2B 1DTQB 1QSSA 1QZ6A 5BN8A 2HRYA 3FMWA 3IA0A 3I6PA 5LOQA 3W8GA 4JUZA 2RU3A 1ZC6A 2MJUA 5CYMB 2KT5A 4RCHA 5BPNA 3FNNA 4YOXA 1IM4A 4Z4CA 1FKPA 5ETSA 2HFUA 2EKYA 4GKJJ 3CJ0A 5AZJB 1H2VZ 3HVWA 4ZA1A 4ZMMA 3I0SA 2HBMA 1WEYA 4ZVQB 5CD4A 3SBGA 4IZ9A 3HPGA 2OTJN 1NRKA 2XSJA 3ULDA 4WXWA 2CADA 3J7YU 4Y2MA 2XZDB 1C0TA 4UOHA 1BIUA 3QSIA 5B0EA 1HL6A 1YJVA 1VQ9N 2HFVA 1S79A 1EIYB 4NXNF 4OLAA 3N4PA 1R3NA 1MG7A 3NH2A 4NXMF 4RUHA 1RT1A 3PR4A 4DCPB 2WVCA 4FWLA 4G1IA 3UDEA 3QMQA 4DR1K 5B0FA 4NRUA 2ZZNA 3AXMA 5AQYA 1OPZA 3D6TB 2VBXA 4ECXA 1W7WA 3HO1A 1GLEG 2DH8A 5IT0A 4RLEA 3AFGA 4KGVB 3UD4P 2UXDK 4DL3A 1RCOB 2D7SA 3AQOA 1NBEB 4OIXA 5KFCA 1UEUA 4IG3A 2HYIB 2OPQB 2CWKA 4EBDA 5AQRA 1WF1A 2ASMA 4TLQA 2OD4A 3IM8A 4Y00A 2WVBA 5D77A 2X7IA 3VQ8A 2AD9A 4LSLA 1FDBA 4JI2K 5J2QA 1T9VA 5D0EA 3SQ0A 4U96A 1ASUA 2V67A 5I3PA 3H0PA 1KHWA 1NNEA 2F1FA 2GELA 2GX9A 2ILYA 3FUYA 4ZN1A 3OFEA 5F8JA 3RTVA 2PEHA 2MKKA 4X65J 4FLVA 4DR7J 2PIIA 1UZDA 3BR8A 4PHTX 3LPTA 5LL6d 1RHKB 1Y5IB 2ZC3A 3GFHA 3TX8A 4EP4A 3HHNB 2X74A 5LMNJ 3BEXA 3AQPA 1VC5A 1FFGB 4A47A 4FWKA 1FKPB 3CIPA 3G10A 3RB4A 4CJVA 2IVYA 1NGAA 1RT5A 5CD4H 3HHLA 2MLYA 4HEA9 3BGUA 2EI5A 3UQSA 5K9FA 4JI8F 1KC8O 2XSJB 4IEIA 3FZBA 1HYVA 4CZIA 3AVLA 3BBFA 2AP1A 1H74A 2GGPA 1RT6A 4CJTA 4K8ZA 3KHGA 1LK7A 2V2KA 2VG6A 3VAJA 1N5QA 2P6TA 1RTZA 2ZDOA 3IMQJ 3MOJB 4IYQA 1U1QA 4N7TA 3VENA 1JXBA 4CK2A 1N33J 1S49A 2R8KA 3CCRN 2CDQA 3HM9A 2JOQA 4J9MA 3I0RA 3KG0A 2BRKA 4XAKA 4WKRA 2MSSA 2PGCA 4UZBA 2MHNA 4E89A 3WQTA 3ZTSA 3L2UA 3H2VE 4FWPA 5HVFA 1E4GT 4UY8T 3BYRA 4IG3B 2KHCA 2BJEA 5DDQC 2M3DA 2G8UA 1TL5A 1FT8A 1OVYA 4LSLB 1Q8LA 4ZPDA 1N32K 3R5JB 3HSJA 3CXCM 5T7LA 4Z0UA 1FWPA 1RDCA 3KNAA 2RILA 2HAFA 1WHYA 4DHVA 1W2BM 2MKIA 2E9ZA 3EE9A 2NZ4A 2JFKA 3R27A 4DV7J 3CJKA 4F0HA 3NMAA 3BKUA 2ADBA 5KFWA 3KWGA 2D0CA 4Q0BA 3PG9A 2YI1A 3TW0A 3PX6A 4DLEA 4OYMA 5D4PA 2DYAA 1NHUA 4H4OA 4X4OA 3A1YG 1N8RT 4JI1K 1XNRF 2ZBCA 4LF8F 4CJKA 3UKUA 2COLA 2NYHA 2M5YA 3R7BB 2V51B 3BEGB 4OMFG 1HFEL 1QSLA 4ZVEA 5D4LA 1PYOB 2FJDB 3CT9A 3BSNA 2W6LA 1NM1A 2HFZA 4CO0A 1QQCA 1VQ8N 1H73A 4O3OA 1JNRB 3PR5B 5A8KA 2ZZTA 2HIQA 1VC6A 4IKAA 3C19A 5C2DA 3C6AA 5CZXA 3GJRB 3MAQA 1UMJA 3VQ6A 2MZSA 1M1GA 2I6WA 3WXJA 3NBPA 2VG6B 2MKYA 3TU5A 4USHA 3OD2A 3J7YI 1YGYA 1MLAA 5FLXU 2UVWA 5D3GB 4NXNJ 1QAIA 3SZ2A 3MX5A 1URNA 1GMUA 2F8TA 3AY9A 2VASA 5B0DA 1KFDA 1HNWK 4NXMJ 1ZM4A 5DRKA 1U26A 2UUBF 2ZHAA 4Y2KA 5LMUF 3B4DA 2AA4A 4MYUA 2NXJA 3AA5X 3R9LA 2DNNA 1EB0A 2RMLA 2W4PA 3RGIA 3LP2A 4AHTA 2V2VA 1WUAA 3AJ2A 4W5NA 4NLPA 1NKCA 4WFAL 4KT0C 2KT3A 3EWGA 2BUNA 1TKZB 2BE7D 3P49B 5T7LB 3KHRA 4JB8B 4BREA 4ERDA 3HULA 4ILLA 4OQJA 4KJIA 3P5TL 4DLGA 2DXDA 4RW6A 2VCPA 4YOVA 3UR0A 3CCJN 4IOAQ 2GWJA 2A10A 3CDWA 2JLGA 2J0XA 1S9FA 1YBTA 2L3MA 1NGEA 3VQ7A 2GX8A 5KRTA 2Q3PA 3WBZA 1IXKA 4DV1F 1Q5VA 2CPXA 5EN1A 2L9NA 5BR8K 1MN7A 2YKNA 4H4OB 3CF5Q 3H1VX 3ZSOA 4OL8A 3MM7A 4KH5A 2QA4S 3UCGA 3HYFA 2O4GA 3K5NA 3SV3A 4FLWA 3DOLB 2RS2A 2HWIA 3IN5A 4JI4F 4CF1A 3D1OA 3IWLA 3ALYA 3H42A 5HLFB 4QIFA 3V6DB 3OUYA 1GXLA 2A6MA 2EWHA 3HZEA 4ZVRB 3WHIA 3EKUA 1WBBA 1VRTA 5I3UA 3I33A 2IA0A 4BRGA 1SI9A 3SQ4A 3LANA 1LOTB 4JI8J 3NBPB 4URSA 2NRTA 4QOZB 5AQMA 2E66A 2UZAA 4A8XA 1KLMA 1HNIA 2XHWA 2E2QA 2A5XA 2IRXA 4UW2A 3T6JA 3IWXA 2ZF5O 1EWQA 2BR0A 3GCXP 1MSWD 1AYEA 3GU0A 4PUOA 1JJCB 3PEHA 1LXNA 3QLHA 1YDLA 1EP4A 2O8DB 4NLBA 1CG2A 4C3KA 1VQPN 4CQ1A 4GKKF 3MR2A 1NJYA 4IO1A 1N36F 2RUSA 4I64A 4K4ZA 4FN5A 5B0BA 3LP2B 5IC6B 3V5RA 1YVFA 2N3LA 5G0RA 3IFRA 5H9EK 3DXMA 3THTA 4B3RF 3HVTA 2UXCK 3R5DA 3P96A 2VBWA 2RHSB 5AZIA 2DFEA 3CJ9A 2MJNA 3IR7B 1VHFA 4OHVA 4WTOB 3EEQA 3SCKE 1VQ4N 3CD5A 1ITPA 1QAYA 2G2OA 2Y8WA 3QEPA 3RVCA 4PG6A 4BDZA 3W5YA 4H5VA 2DNMA 1T7PA 1P90A 4M42A 1KC8T 2W4CA 4NLGA 2YKNB 3AOAA 4BRDA 5C5JA 1DFDA 4BC2A 4YORA 1U02A 3MM7B 1E4FT 2PFDA 3VVUA 4WK3A 3L0QA 3RMDA 4YN3B 3EGVA 1C6VA 2XMAA 2VOOA 2JWKA 4WIIA 4LF4F 2P6SA 1CJVA 2GA7A 1RAJA 2YNIA 3OUYB 5D4OA 1X5OA 1XNRJ 1VQON 4LF8J 5H1SQ 3PEJA 3NGSA 4H4KA 1ZH5A 5GVQA 1VRTB 5I3UB 4JK7A 1IR2A 2CQ2A 3DRRA 3MDFA 4LFAF 4OKJA 1RHRB 1A6LA 4EFAC 3HSCA 3KKFA 1HNIB 2E7XA 1X5SA 5FLXY 5EX0A 3D6HB 1OVQA 1V3SA 3Q23A 2B56A 4X62F 1HWJA 4NL5A 3CCVN 4CO2A 4PUOB 3PCOB 1FJEB 1TVRB 2HF3A 1SUQA 1HNZK 3LF0A 5CYQB 4CESA 2MKJA 3DHXA 3H8YA 2ZH5A 3JSMA 3IO1A 4A8QA 1UVMA 4M5KA 1IQTA 3I8BA 3KKRA 3RW7A 4E98A 2CWXA 4BRKA 3DXBA 1YI2S 3QAUA 4KBIA 4NASA 1D1UA 1RBSA 2UUBJ 4I9QA 2DXFA 5LMUJ 4GNIA 4RU9A 3TX0A 1BE4A 2P9IA 5HMYA 2YWKA 3CD6S 3DLKA 2GMHA 1EAYC 3DXMB 3X1LB 3RAMA 3HVTB 5AQKA 3FRZA 2XMVA 4NLVA 5AZIB 2B8QA 5IQQA 4DR1J 3MR5A 4RTFD 2DR6A 3PSIA 4KV8A 2MZJA 4BWMA 4USKA 4DV2F 2UXDJ 3WZ0A 3H3NO 2QLXA 4PAAA 2RKIA 1SJFA 4AXIA 2NXNA 4IKFA 2B9EA 4K2XA 2UU9F 3GFXA 1BGXT 1XQIA 2HBLA 1QDUB 4KHPF 3CCZA 1VQ7S 1Q16B 4DV1J 3AT1B 1JLCA 3GIIA 2MLXA 2CPDA 3EXCX 1CJVB 1U24A 1KVCA 2E1CA 1MWYA 1UFKA 4FLYA 2YNIB 3EVOA 1VRQC 4DR6K 2DVIA 4J91A 3ENHA 3NF6A 3GJSB 4ILMA 1RCHA 5KFNA 4KTQA 3KK1A 4JI4J 1I51B 3DCAA 3BSAA 1Q9XA 4DCJB 2AV5A 3FBCA 1HKBA 1LW2A 3UKRA 4UF4A 1MU2A 4KH0B 1S6PA 2W8KA 3LZJA 1KAYA 3MPDA 2HPUA 4NLOA 3D2EA 2CQ1A 1H6KX 3FLCO 2BX6A 4QWBA 2CIMA 3CJ8A 4KHYA 1AB8A 1HWKA 2MQPA 2WOMA 2EFOA 3NNCA 3JSMB 2C2EA 2C42A 4OKKA 4PR6A 2ALYB 1VBZA 1RLDA 2I38A 1JJ2R 4JS4A 4KY3A 3SYZA 2UUTA 4K5RA 2KJVA 3SEOA 2I5JA 1RBAA 5GAEU 1FRMA 4HLBA 2G8VA 8RUCA 1I3OB 3KK7A 4AHCA 1XHZA 1JLQA 2P9IB 3IS9A 2WFBA 1IKWB 2KFZA 4GKKJ 3BO4A 1Y11A 3W64A 1SL2A 3QEIA 2QK9A 4J9VA 5H9FK 1DBDA 3DRPA 3UNYA 2HBQB 1TMMA 1SVDA 4KV8B 1DLOA 1PC4A 2GVZB 2JWLA 3Q8VA 4M1KA 1RWXB 3HL8A 1WEZA 3ZETA 3ENBA 5KFDA 4B3RJ 1GH8A 3VEXA 1VSHA 4ED5A 5CHCB 2Q1NA 5BPMA 1N48A 1F3VA 4L76A 2V63A 4M45A 2ZJQQ 4RW4A 2DITA 3TJ9A 3V9UA 1JLCB 2ZBPA 3VQDA 4PPZA 2NCKL 4C8OA 2NUBA 2VJVA 3ZZYA 3VA3A 4PG5A 4PPDA 1ASWA 1OMSA 5DQIA 1REGX 4UY85 2O8FA 4CJSA 1T6CA 1P6TA 3M6VA 2FZKB 4K42A 5AE3A 5KFOA 4FWMA 5CR4A 3K2PA 2JWNA 3OHAA 4J7CA 5F3ZA 2VDIA 4LF4J 1S4FA 1ZA2B 5D8HB 1C1BA 1LW2B 2AEJA 1S6PB 5EWGA 3Q8UA 3DDNA 2G2ZA 1PKUA 3AA9A 1NB7A 5JVHQ 4A8FA 3Q83A 4LFAJ 4ZCLA 2IM0A 5K20B 1WSJA 1DQ9A 2OSQA 4CH1A 4YOTA 4K2JA 2WOMB 1GOCA 2FC0A 4QJVA 4O0NA 3AVMA 4KREA 2W2PP 2FSJA 2ASLA 5F8MA 3MXJA 2QWLA 4X62J 2M70A 3VEVA 3PW2A 2O67A 4UT4A 3PYDA 2I5JB 4OFZA 2ZD1A 3BREA 1VQSA 2HWTA 3FGUA 3IFEA 4P2FA 4QWAA 4FVCA 4WK1A 2HZCA 1KONA 2BXJA 1SPBP 3PM9A 4GVEA 4GMJB 4BG9A 2AU0A 5BJRA 3CJ3A 2J0WA 3D67A 3AHPA 1KXPA 4LF7F 2VV5A 3M6XA 4XH5A 2W2QP 3DRPB 1DQAA 2HKEA 1DLOB 1E6VA 3FQKA 2XSFA 1PILA 4ZN3A 4CZKA 2DPNA 1EXQA 3ZETB 3R6MA 4LRBA 3NAIA 3S01A 2FDNA 4M7XA 2BJ8A 3KLHA 3QIPA 2RT3A 4MAKA 2H4WB 4OHXA 4RW4B 3U1LA 5IT9Y 2I2YA 4DV2J 5L8RC 1G4CA 2X1GA 4NZ6A 5HANA 4DR2F 3K5PA 2UU9J 3QRQA 2XY8A 3QINA 2DEIA 2O8FB 4KHPJ 3PLAA 1IV0A 2MZTA 1X4HA 3VGLA 3NH1A 3VQEA 4AHSA 3MM5A 3H1QA 2KKHA 1C1BB 4X64F 3MR3A 3SI6A 3Q89A 3CC4S 5CQGA 4PXEA 4FZVA 2AJQA 1RGVA 2G8IA 1FEEA 3OYLA 3HSTB 2HHQA 1U8SA 1F5CA 2FVQA 4Y3CA 4XDDA 2G1DA 3DXSX 4IOCL 3O1LA 2PSZA 3MWPA 2HNDA 3A3PB 2D69A 3RAQA 1PBAA 3FGVA 3W9IA 1TUUA 3P4UB 3KYLA 3C7NB 4M3ZA 1RU2A 3QEWA 2GFFA 2ADCA 5K14A 3QWPA 1OY9A 5EDWA 2C2KB 3NGUA 2MQQA 1T9XA 1YITS 2HHXA 4BC4A 5E3PA 2J4RA 1J9AA 3PW5A 2IIHA 3OHRA 1VBXA 4FL9A 1TKDA 2GUIA 4LREA 4Q43A 2QXFA 1S0NA 1Q4RA 4JV2A 3F44A 5M1PA 2J8AA 5HMWA 4FLUA 3C0BA 5GAEI 3R3TA 2W9CA 2QA4N 1X3MA 4CF0A 3MUMP 1JJ4A 3LWMA 2R7VA 2JSXA 3T19A 1GLLO 3IAS9 2HQIA 1ICEB 3J80Y 3VV2B 4QU7A 5HQLA 3KLHB 5E41A 1QVGM 3QIPB 2AKWB 4IBNA 1VLOA 4CJEA 5B7WA 1QS4A 1V4SA 2F5GA 3ILLA 4JN4A 4O8UA 4MMOA 3MM9A 2DNZA 1PAUB 2NXUA 4WE1A 4D3GA 4FJMA 5DG8A 2OTLS 3BDEA 2JDJA 4KE5A 1FXLA 2J7KA 3MM5B 4I4BA 4EWTA 1PJ6A 1E6YA 4L3QA 1RACB 2DO0A 2P1JA 1BXNA 2Z2ZA 2QEXS 4FCYA 3VQSA 4YB6A 4J90A 4DV0F 2YWWA 4Q7AA 4C0BA 4R0EA 5HROA 5IM0A 2DO4A 2B0GA 4FSVA 3AOBA 2JRSA 2B3TB 4WCEQ 3PIOL 2DPJA 3QNNA 2P5VA 1BLUA 1S0OA 3ZSZA 1CJUB 4N56A 3AGKA 1D5AA 2CH6A 2HNDB 3F5TA 1LWEB 4M5NA 3O3FA 2KFYA 2V69A 1U45A 5I4MA 5K14B 1S0MA 4KQZA 3AJDA 2WC9A 1LAWA 2D3OR 3AAPA 2F9TA 2WSFC 1B99A 3KKSA 3DWLA 5FPMA 1IJFB 1Q53A 4DTNA 1RBOB 3G9CA 3MMAA 1YTYA 3CCSS 3MPVA 4PQAA 3TNVA 3CE8A 4BRQA 3T5KA 4W90B 4LVOP 3IAM9 3T1HF 4ZPBA 1TV6A 1F2GA 3VQ9A 1NXIA 1C4AA 2W9CB 4HUFA 1WN7A 2GV9A 2IBOA 4HACA 4USWA 1FI4A 4H0OA 1M1HA 1XJWB 1WOQA 2E5LK 2G1HA 5KFGA 4OYWA 4LF7J 4DFMA 1A5XA 1NPRA 3P4IA 4LQ9A 2K06A 3A3OB 2ILZA 5AXMA 2F4VF 4ISEA 2VC0A 3MM9B 3PV8A 3J81Y 4WE1B 3I9V9 3A5LC 2XO6A 1FDNA 4EGLA 5C2FA 2J9CA 5MLCV 1YJWS 4BRCA 2AP6A 1X3NA 4DV3F 2WSEC 4LBPA 3CJ2A 4WFBQ 3U3GA 3VAGA 4G1PA 5I42A 3J81j 3FSIA 3DLBA 3VEYA 2DH7A 2H65B 3AVFA 2MY7A 4JI5K 1E6YB 3BZCA 1DKGD 4NYPA 4DR2J 1FX2A 4IFEA 5GINA 5HO4A 4WTYA 4LC9B 3C6HA 2RPIA 3GE9A 1BY9A 3EYZA 1DTTA 5HROB 3EKSA 2HS0A 1ZBSA 2RVJA 3NF9A 3NDKA 3P6YC 4FNHA 4X64J 1NJZA 2ZDPA 4CF9A 3HHLC 2E9TA 1ZBFA 1XQSC 2V8HA 1U6BA 3DRYA 3SPYA 2Z0GA 3CCWA 1VBYA 2BA9A 4N77A 4CO3A 2O1PA 5C24A 4UQTA 2DRAA 3J7AN 4CHZA 2M8HA 3JXOA 4JD2A 4RUBA 4BACA 1R8AA 2PEBA 3KK3B 3CC7N 1CZAN 3AAWB 4AM7A 4F67A 2XLKA 2OEMA 4C98A 4LRCA 4IJNA 2BACA 4UOFA 1PAEX 1OH6A 3L6QA 5BR9A 1DQ8A 3MCAB 2B9YA 4FWSA 5AQPA 3IMXA 1TV6B 3AD9C 2A40A 3TSPA 3ULEA 1IN0A 3M2UA 3EZOA 1YIJS 2HW3A 1VQ7N 2P9LA 3GG0A 3UCUP 3R1XA 1DGKN 3GYGA 3CFOA 1KEKA 3B4MA 3THYA 1UPMB 1YHQS 1S1VA 4QIVA 4E7HA 1FRLA 3NFAA 4Y1DA 2FBYA 4FOEA 4KTZA 3QO9B 1JLEB 1A7GE 3CULA 3T7ZA 3GJQB 2HK3A 2C2ZB 3M8PA 4YDDB 4ZTFA 3MEGA 2I7PA 1J5EK 1NOYA 5I42B 1TKTA 1RDAA 4DN9A 1N6QA 1KQKA 2LA6A 1TQLA 1S5ZA 1OJ4A 1OY6A 3CMAS 4HCBA 2XZTB 1KTQA 3O1WA 3UIQA 3JQMA 3I56S 3P1GA 2QWMA 4V19S 4K4UA 2W8LA 1HARA 4LF9K 1FCAA 1HI8A 1U2VA 3H5XA 2B6AA 4EFHA 3G82A 2IDOA 2QKKA 5IXUA 1DTTB 2LEAA 3WEEB 3SDEA 4UQGA 3C16A 1MWKA 2WAQD 5IV3A 3PW0A 2FTRA 4PG4A 3NWGA 2PD1A 3HSZA 4NB4A 4WXOA 2IVPA 3FBFA 3VN5A 3QFHA 5JS1A 4F04B 1AZSA 3WDOA 4DV0J 4CJWA 4W5OA 5LJ3Y 3M6WA 4CFDA 1RT7A 1VSDA 5C24B 1OQ6A 4LMZA 3HD2A 1VSMA 4PL7A 1M5PC 2R2RA 1TELA 5IWAK 4OKEA 5E3QA 3SQ2A 4E8UA 1NJWA 2WBRA 3FR0A 3B8HA 1WKKA 3R7SB 3E3XA 1NSQA 1HNXK 2FHJD 4K4WA 3CJ7A 2EVZA 1JXEA 3ULEB 4A2BA 3S1TA 2HSEB 2P9SA 1H3DA 3LP1A 1FRJA 1XMQF 4ECUA 2A3ZA 2P9LB 3PX0A 2KYXA 3AO2A 4DI6A 5FJ4A 2H9ZA 3W7BA 2YWGA 4C0HA 1UJ4A 3T1HJ 2G0IA 3CJTA 1KQFB 3A5NC 2NRXA 2HHUA 3THYB 2RE2A 3QQCD 4H5NA 2H4YB 3VQBA 1EX4A 1IKVA 3DC2A 3VWSA 3TR5A 2WW4A 1NSKL 3QIDA 3MECA 4CEFA 4GV3A 2M4MA 3M8PB 4CF2A 1D4XA 2NREA 3KMQA 1T0TV 1RAGB 4RKUC 4JOUA 3NGZA 2YX7A 5I9EB 1LW0B 1WHWA 3HVRA 2YJEA 5IT4A 2BYCA 2MSTA 1S76D 1N6QB 2F4VJ 3PW4A 4F25A 1D8ZA 3QFPA 2LU1A 2VPWB 2H5JB 3ISND 4HDGA 4ICLB 3CWJA 1O6XA 4DV3J 4A46A 4M3YA 4DQPA 1U2VB 2G0JA 2AQ4A 2B6AB 3K17A 3G82B 1QD1A 2NRWA 3DI6A 1P9QC 5JLFA 1S12A 3V4MA 4RNFA 2JHEA 1WSRA 2QWNA 3C16B 5DGAA 2FGOA 3D0HE 3CMES 3GJTB 1RFQA 3OVNA 2RHKA 3OYKA 1Q78A 3CVKA 4CH0S 1K1SA 1AZSB 1VCTA 2HS4A 1OH7A 2EX3A 4ZP8A 1C0MA 2R7WA 1SV5A 4KH4A 4OGCA 1NGCA 4Y0FA 4K4SA 2K8GA 1GTHA 3IP0A 2V5HG 4ZKAA 3GR1A 5DM7Q 4JI7K 2FYXA 1FO1A 3IBWA 2O01C 5DDPC 3TWZA 2HSTA 4DF8A 1P1TA 2Q31A 1GAOA 1FKAF 1NZAA 5AXKA 1U1NA 2CPEA 1WKLA 4HHHA 3LDNA 4G1QA 3MCNA 3GBTA 4NLXA 2RNEA 2EBEA 4GMKA 5M1FA 2P9SB 3H2UB 3OBWA 3TA1A 2FLPA 1VISA 3LP1B 2HK2A 3UN5A 2XHBA 1U09A 1FHTA 1OYDA 2EC2A 4A61A 3THWA 4I67A 4DS5A 4CLUA 3EZWA 3IRWP 4A8YA 3GDQA 2MQMA 3NWRA 4X4SA 3BS9A 3E1YA 2EK6A 4IJAA 2RF2A 2CZ4A 4CGGA 2E5GA 2YHAA 3R2DJ 3MECB 4FWQA 4K0KK 5E26A 1WNEA 4HR2A 3VQQA 4DUZF 1VFJA 2YNHA 5AQXA 2X1AA 3CC4N 5HMXA 3NMRA 1URRA 2VQFF 1Z2LA 2E5JA 3QT8A 4Q8EA 4XPCA 2P9GA 4NYZA 2D3ZA 4BRPA 1UETA 1TUVA 2HVIA 4P7TA 4WYBA 1IG8A 3MI7X 3LPYA 2BGGA 3R5AA 3ENQA 2KW4A 4FJ7A 4DHYA 1DT9A 5C42A 4TY8B 5KFAA 3S7RA 3CUNA 2JZ5A 1WSVA 1YJNS 2CQCA 4BWJA 4DL0C 3GLJA 4FPBA 1B0TA 2MQOA 1PSDA 4QWEA 3VQCA 3CHWA 3O2IA 2QFJA 3HFVA 2CG4A 4UZCA 4WP8A 3CQXA 3CPEA 2ASYA 4ED8A 2XG8A 3CDEA 1FXRA 2KT2A 4RO0A 1KWMA 1M0SA 2G13A 3TTFA 1SV5B 4QR2A 2RQCA 2KHOA 5B08A 4AQYK 3MURP 3SQGA 5JJBA 3ISNC 4H4KC 3CCES 5KG6A 2ZWOA 2OKQA 1JKHB 3HT3A 3T3FA 3SFGA 1SXLA 1IKXA 1MMLA 1F9EB 3CM6A 4DV4K 5A8WA 1FW6A 4FBTA 4YNQA 5IQ6A 3DOMA 4E7IA 4G1QB 3KD1E 2I8EA 5CZ2A 4NLSA 3H08A 3S6EA 3LP3A 5ETPA 2KB2A 2LU2A 4YOEA 3BBBA 4FS2A 3RBEA 4IDHA 1IWGA 1N88A 2X6NA 3THWB 2DIVA 4LFCF 2D3UA 5LSOA 3MX2A 1MWMA 2OTLN 3QMLA 1JCGA 3OBIA 3UDLA 1U6FA 2HLUA 2CQHA 2RF2B 2FZGB 1XMQJ 3M5RA 3A5OC 3G6ES 1V4TA 4IOXA 1IBMK 4BE1A 3QIOA 4RNNA 1GOAA 3POTA 2MEWA 2FD2A 2YNHB 4O3NA 5L1KA 4OHZA 1RE1B 3RBZA 1RAEB 2HMPA 3QRPA 4FOIA 3M2VA 4Z2XA 1S4EA 4OX8A 1T9TA 1Q7YO 1HIYA 4FPIA 4KFBB 3HJVA 5C42B 4OLOA 4RNHA 1BWFO 1Z26A 5DM6Q 4PXCA 4OI6A 1NK6A 3IBCB 4N47A 4LSNB 5KFTA 2A0FB 2VUGA 1G15A 5AE2A 1CJTA 3K7RA 4CBUA 4YFUA 3GSIA 1RT3A 3HPOA 3EE8A 3IUCA 2BV3A 5U47A 4F4YA 4FM2A 1UJ6A 3OYDA 3O6WA 3UWTA 2IM2A 1FVQA 3F41A 2FLOA 4F3QA 4F4KA 1PJ5A 1R6VA 3THPA 3CO9A 1PBUA 2R8GA 3CCSN 2RRBA 4O4GA 4ID8A 5L1LA 2K3KA 3OFHA 3M3ZA 4TNOA 5KFFA 4DV6K 3SQGB 3WXLA 3KDNA 2VQEF 4NYNA 1KN6A 4H5TA 1HR0F 4H0PA 4J9PA 1ZAVA 3LA0A 2C3PA 3OQ2A 1WC4A 1IKXB 5GMDA 4HUEA 1IKYB 3IG1A 3EZUA 1S1WB 1SL0A 4LD0A 1JL1A 2HBRB 3A8IA 1WB9A 2CNKB 3G71S 2IFXA 3LOUA 1RKJA 3NEKA 3DOMB 2BQRA 4F26A 5E2QA 3WQPA 1SJRA 3AY0A 1VK0A 3NY0A 1I94F 3OLAA 2IJNA 1BHLA 3HLUA 3CJCA 4AM6A 1UWBA 2FY8A 4A5AA 4RJVA 1WACA 4PYAA 3NGRA 1H98A 3ET6B 1QTNB 4KH1B 1IO2A 4FLTA 2FQQB 2J7WA 3OL8A 2Z1IA 3D6RA 2QM1A 1SB6A 1T3VA 2D4WA 1GT8A 3RZAA 1IH7A 3TQEA 4FPAA 4CCHA 3BR9A 2G8WA 2PC6A 2Z4PA 5J1PA 2XYPB 4EZ6A 2DNRA 3POTB 5KFJA 2R3VA 3WX4A 1LWFA 4DL4A 2P9CA 3D66A 3NP5A 3NGDA 2OJ3A 5KG2A 1CVJA 4C8NA 5M2UA 3M2VB 1Y64A 3R1LA 4OJ1A 4F9OA 2V8PA 3IBFB 1SIZA 3OT9A 2U1AA 4YR3A 1K8KA 3T1AA 4OGEA 5CZ1A 1LOUA 4HL9A 4DUZJ 3QBWA 2XCPA 1VI7A 3ZC4A 1HMVA 1TYQB 1IJJA 2VQFJ 2VG7A 3GONA 3D68A 3NCIA 1X4AA 4BG8A 4I9LA 3BQ0A 3Q8YA 2ZHBA 2YCHA 2EG1A 1IBCB 1HI1A 3B6BA 1F6TA 1KVJA 3OS2A 3Q2SC 2ZZMA 3LM2A 5GIPA 5CCMA 3PIPQ 3QB0A 1EX8A 2VGMA 1AW0A 4O4GB 4B3MK 4KBOA 3F56A 4DPWA 3KHYA 2RSQA 4QPTA 5E3AA 1GLBG 4QYZK 1RILA 3P39A 1N5YA 1EZZB 5HRSA 2A1SA 1KLNA 2Y1RI 2E29A 2PT0A 2HNYB 2IVNA 1YIJN 3HP6A 2M88A 3FSYA 2LCWA 3ZLJA 4ECRA 3NOGA 4XO0A 4PA1A 3PX4A 4WZQA 2BM1A 4OPJA 2E1ZA 1EKSA 2YX4A 1YHQN 3AO1A 3BY5A 3SBTA 3DOKA 5DLGA 1A0OB 4Z7YA 4DPYA 2DR5A 4DQIA 3CF5L 1RHMB 3W2VA 1PIEA 4FXVA 3W8PA 4OYOA 6FD1A 2EHGA 4GKJK 5J1EA 5JMVA 2DIUA 4USJC 1RA6A 1CPZA 3CMAN 3MPUB 5BXIA 4LFCJ 2R7OA 3I56N 3KUHA 2VGNA 1LWFB 1VIXA 3KOAA 1S48A 3U3YA 5EVZA 1LWXA 3MXHP 1SL1A 1JLFB 3F0NA 1VQ5S 1YK9A 1K8KB 3FBBA 4PEOA 4RWTA 2NPIA 4F0MA 1X31C 1XR7A 3HI9A 1HMVB 4QIEA 2F40A 4FM1A 2VG7B 2OIHA 4B1ZA 4ZP9A 3M32A 3D0PA 2HGNA 3D3BJ 3SLCA 4RZRA 4ANDA 5K8MA 3AO4A 3TSUA 3OA9A 4M5DA 3TVYA 1WTFA 1OIAA 2X51A 2OPRB 3KTQA 3CCMN 1IBLF 3TJ8A 1OSDA 3KDOA 3BDPA 2OEKA 4F50A 2ZE2B 2A6OA 1P9YA 2NRZA 2HRUA 1WUUA 2CNOB 2XY5A 1FESA 2ITGA 4CBWA 3HHKA 2DGTA 4TY9A 4AD6A 5AFUA 2QV6A 4CJ7A 2JX2A 2IHR1 5T7BA 1UEKA 2AIRB 2QMXA 2VQEJ 4P9SA 4KHNA 3K5LA 5HQ8A 1HR0J 4X65K 3ONQA 4DR7K 4YHHK 1WLJA 3DMJB 1RWOB 1YVNA 5KG1A 3G4SS 4FJXA 5JLHA 3DOKB 4QW9A 5J2MA 1NPKA 1XEZA 5LMNK 2HBJA 3F73A 4PXDA 4ELTA 3W2VB 2LDYA 5JVGL 5LT5A 4DR5F 1BU6O 2CQIA 3QZ8A 1I94J 2F8SA 4DL2A 4X4PA 3EVWA 1KVIA 2YPZA 1QJHA 2VWBA 5A2QY 3A8YA 1F3FA 4BR5A 1Q7YT 3RYLA 1KRPA 4PYDA 2HLTA 4TU9A 3AVHA 4FLZA 3T1YF 1SQFA 2E5IA 5BPLA 3C94A 4CD1A 2CXEA 3D2FB 4F8RA 4MO4A 3AVAA 4DTSA 4AILC 3CC2S 3A2FA 4Q5VA 1CZBA 2ZH8A 1G7CB 5GIOA 3O9UA 3CMEN 2PYLA 3LL3A 2Z30B 4Z4HA 3FEXB 2I9SA 2FPHX 2DNYA 4ZVTB 4WZMA 2C3MA 1N33K 1JB0C 5AQWA 2OMOA 3K2YA 1JK9B 3N01A 4DX6A 4N41A 1PJ7A 6FDRA 4O3PA 1JX4A 2JFDA 1S1TA 4CEBA 4FWNA 3CDAA 3AO5A 4ER8A 4M5DB 4HKQA 1ELOA 1U2FA 2E1PA 2NZCA 1YVUA 2HWHA 2FVRA 4ZVUB 4ED6A 1N56A 2I7NA 2NLWA 4OZ5A 3BO2A 3A3NB 1VQ6S 4A4JA 4O23A 1NK7A 2DBBA 3AVJA 1FE0A 4C3MA 5AFUH 1VK3A 3AVBA 4NLWA 2CKWA 3LWLA 4OZ2A 3ZZ0A 4QW8A 5I3QA 3DRSB 1U2RA 4BQLA 4JEPA 2SXLA 3UD5A 2O5DA 3THXA 4JKFA 1P1LA 5AQTA 3QYYA 1A5VA 5FPEA 4K8XA 1HBUB 3PW7A 3CFRA 3SUOA 3A12A 2AZ3A 1U1OA 2M52A 5J2MB 1R8CA 4G6VB 1SAZA 1UZHA 4A5BA 4C3LA 2DGUA 2YPYA 5SWMA 4DOZA 5IS2A 1Q86O 2XTJP 5DGBA 4BBYA 2XLIA 2NYIA 4OI0A 4FJIA 5ETNA 1X4DA 3T69A 1NDKA 5KTQA 3NOCA 1LAVA 1T11A 3M2RB 3W9JA 2DGSA 3H4BA 1YJNN 1UVNA 4ENOA 4RUAA 1JJ2M 4DCOB 4W5TA 4DTMA 4LJMA 4RW8B 1ROFA 1QQMA 3OW2M 3PXGa 1YLXA 4P2MA 4RWXA 3DJCA 1VQKS 4NLYA 2HNZA 1WEXA 2DGOA 5HI7A 2XMTA 3ENVA 3FC9A 1KNZA 4FP9A 1ZM9A 5ADXA 1L3UA 2GO9A 1MA9B 2ZNYA 4YY3F 3CD0A 1J5OA 4NXNK 2AJFE 2ATCB 1WSIA 5CYJA 2VZ9A 5A6PA 1U47A 1Q5YA 2E6MA 2VPYB 2MKSA 3BF4A 3D1HA 1XNQF 1H1VA 5KG5A 4PY5A 5A76A 3K5OA 1GXUA 4NXMK 1WG1A 4RBVA 3CCEN 1S1TB 3LALA 3QICA 2A6AA 2MY8A 4JI3F 1FJCA 2HS3A 1QHAA 2PDAA 1O1WA 5KFEA 3PJWA 3KLIA 2XZWA 3SUQA 3RB6A 4JK9A 1XERA 2YWFA 4HHJA 4CF8A 2J7UA 1HHSA 4FJHA 4USTA 4NCGA 2NZTA 2BANB 4CW7B 3A8EA 1RWUA 4EAHD 1HYSA 3LGMA 2RQKA 4M5GA 4H0XB 1IBLJ 2AYBA 1NEEA 4PKHA 4ILJA 1RTIA 5F8HA 3SSQA 4QWDA 2PO4A 3WXKA 1S72S 2P9NB 3I4HX 4OHYA 3JS6A 4OX9F 3C14A 2MZQA 4JHDA 4A8MP 3IXQA 4BRMA 3MMBA 2KU7A 2N4CA 3RMAA 2PYJA 1YG0A 3G6EN 4JI0F 3HRGA 2FLLA 3QGHA 5GADU 1PCAA 4A62A 1FEHA 4E3SA 3M30A 2DKOB 4JKAA 4C97A 4OPKA 5DQGA 2R7RA 1C1CA 4YHHF 4FYDA 3PUFA 4FW2A 1N34F 4DR5J 1QQNA 2ZOMA 3HVAA 1Y7PA 3KNGA 4USUA 4B8AB 4LSZB 5A0YA 2LFVA 1XK8A 2RDIA 3N5FA 4BVPA 4MIWA 3OR2A 1DTQA 3T1YJ 4JI8K 4DFPA 3M8ZA 4CIEA 1YJUA 3AH6A 1OKJA 1WOPA 3AVIA 3GV8B 2XQCA 1J5OB 1N52B 3MTJA 5C2GA 2N4DA 1G2EA 1NGIA 3RSEA 4X66F 2Q6BA 2VODA 4B08A 2GBZA 1LWCA 4B1YB 3GV5B 2DNPA 1O8BA 2NRRA 2LVWA 3CCLS 1HBOB 5L9XA 4OV6A 4DQ8A 4C9DA 2W4DA 1W0HA 3QETA 2XNQA 2QGFB 2PMWA 3CQ8A 1FK9A 2YXLA 2E1RA 4DX8H 3ZCMA 2KH9A 1NOZA 4TSXA 5EOYA 3G71N 1DARA 1YBUA 2RAQA 2MB0B 4KAZA 1WC5A 2ZWPA 4WF9L 3R6GB 1DHMA 5K8OA 2G2YA 2RDJA 2W40A 3VMFB 4J9SA 2VG5B 1T9YA 2GQQA 3I5BA 2HVZA 1K44A 2Y1JA 4B3TF 2L41A 2B9WA 3CD7A 4ZS6A 3GWCA 1Q8KA 2W2NP 4NLRA 9ATCB 3MN6A 3OYIA 5CY4A 2DCLA 3V1OA 3QEXA 2Q36A 3MK6A 1LNQA 3C14B 1GMWD 2CZ9A 3MMBB 4NYOA 1D9DA 1W9HA 2DXEA 4AL6A 2VIHA 2HIYA 4JNEA 3C66A 5DDOC 2JH3A 4B3MJ 1HLWA 3OXGA 2AZ1A 3U4LA 4QYZJ 3CMQA 1U48A 3AV9A 3SMZA 1C1CB 3MEKA 4N8NA 4E7JA 2MMYA 1XNRK 4LF8K 3F9MA 3HMJG 4KHRA 4I56A 2VICA 3I5CA 1I3AA 4OPHA 4YOYA 2OEJA 1RDDA 3EO3A 3HKZD 1BOTO 5KFBA 1HI0P 1FJGF 3D6FB 4CHYA 3B8AX 3FCHA 2YNFB 4CLPA 5HRPA 3CEDA 3UVJA 1JLBA 2XS7A 4YDXA 4J9LA 3RSEB 1LWCB 2ASOA 3NVKA 2D0AA 1RTJA 2NSBA 2D41A 4BR7A 2L48A 4YY3J 4EU0A 3E9LA 4J9UE 3O5TB 4DL6A 3T9ZA 1FK9B 4URGA 1ZETA 5KT5A 4BHQA 2VFTA 2ZUAA 3U8XA 4RU2A 1CC7A 1W26A 1XNQJ 1NSPA 4KAIA 2F8HA 2UUBK 2CPHA 3SUNA 5LMUK 2P8IA 3QRRA 4JI3J 4DB3A 2BKOA 5HVHA 4GW6A 2E1MC 2F65A 2QLWA 1ZTWA 1QAXA 4LBHA 2QE5A 4HTIA 4PRFA 1FX4A 3WNFA 3OYFA 2P5GA 1IR1A 4BR9A 4FKXA 1JLGB 2Z2LA 3OVAA 1Q86T 4ISFA 3TO8A 2KRRA 5CABA 4ILGB 4Z4EA 1RHUB 5TKWA 1U1KA 1U2CA 3D7EO 4BDPA 4MT1A 1S1XA 4X4UA 2IVOA 4NOHA 1DURA 2HQGA 4OX9J 1S57A 4Z4GA 2O8BB 1SBRA 2B4UA 3VPZA 4DV1K 4EO8A 3AB4B 1NJIO 4V19J 1B7YB 4J37A 3G6VA 4ECWA 4MK8A 1IBKF 5GADI 3PO4A 1KS2A 2HHSA 2H5IB 3VAMA 4M63A 3IRXA 2DNKA 4PQUB 5HATA 1ZAWA 4JI4K 4I6AA 4YHHJ 1R31A 3I55S 4IH7A 2ZNZA 5T41A 1N34J 3ITHA 5J2PA 4GC6A 3LAKA 3MN7A 2X1FA 3HFKA 1HNVB 3D5MA 3UVJB 1M5KC 1BD6A 1JLBB 4WCEL 3Q24A 2QA2A 3QAEA 4LUBA 1VBKA 2QA4G 1RTJB 4KHQA 2O8CB 3OBYA 1YUWA 1JQGA 3CCUS 2WUSA 2QXLA 1U4BA 3BKTA 1I39A 1DY3A 1XC9A 2J76E 2ZBIA 4JYAF 4X66J 4W5RA 4A57A 4L72B 1Q9YA 3FQLA 4NLDA 1TR0A 5DMRA 1NGBA 1TKXB 3GB0A 1VSFA 3M1FA 5D78A 1FA0A 4I6YA 3AJ1A 3NH0A 3KJVB 3MWBA 3G4SN 4GKKK 1N36K 1Z6RA 3H7HB 1S6OA 3OYHA 3O4QA 5D3GA 5AQGA 2BMBA 2XWXA 4BRFA 5GMEA 1VS3A 2F63A 4CK1A 4ZIVA 4XIUA 3OTOF 3M8WA 3LDSA 3V1RA 1RADB 1IWAA 1WG5A 4Q2MA 2PI4A 3KLFA 4B3TJ 1RZMA 1S1XB 1NGHA 3UNGC 4B3RK 3NL0A 1JWWA 4CM2A 1JIHA 2ZQBA 4O5BA 3ZZRA 5A8RA 3LAMA 3BGFA 5DG9A 4IO8A 2R7TA 5HP1A 4AL7A 2ETJA 1GMVA 1WC3A 4CZCA 1HKGA 3CC2N 1TKZA 1UW4A 4RG8A 3P8BB 4ZJLA 5KGXA 1ZBLA 1CZ9A 3NRBA 2C22A 1F5BA 3GL1A 3IRXB 1BQNB 2E9RX 1MN9A 4CE9A 5IFMA 3UFCX 5THWA 3ZTRA 4FYYB 4RNOA 4J2BA 1NJXA 4LF4K 1HBMA 4OZJA 1NPPA 5DZ7A 1U6ZA 2CA9A 1H7XA 3ITHB 5J2PB 2HQCA 3ZZTA 5AJ3F 3HSGA 2EC0A 2FF3B 3RW6A 3HPHA 1T9UA 4CERA 4CLTA 5HJYA 5BRFA 4FJKA 4ZDNA 4LFAK 1HPZB 1RT4A 2AHOB 2C2NA 3TZXA 2IAJB 2DR8A 2NUHA 1VQ6N 4O4RA 1AXQA 2J0SD 5LSLA 4QS8A 1FJGJ 3DOLA 3TTCA 3UI3A 3Q86A 3KLVA 4WIQA 1SC3B 4EI2A 5HLFA 2ZH2A 1NH7A 3V6DA 3P83D 4C1NI 4X62K 1GLJO 1LCUA 1R8PA 3AD7C 3KK2A 1Q0NA 1TU0B 5C0YA 4A2AA 3N28A 5HBMB 3IM9A 1A9NB 4OPAA 2R8IA 4ID1A 4DKWA 2XMUA 4BE2A 2KL8A 2J6TA 4CJUA 2XRIA 1P27B 3L3VA 2CPFA 3MM8A 4OX7A 1D09B 1K73O 4WP3A 4QR0A 4QOTA 3KLFB 2ZHOA 4FJLA 4XEIA 4DWIA 2B4PA 2O8DA 4CJ4A 2A1BA 4CWBA 4FPRA 4WFXA 4JI6F 5A8RB 2DY9A 1GQEA 3DGPA 2HHHF 5HP1B 4QIWD 1PC5A 1T3OA 4FNIA 1NCLA 4DV2K 1B3TA 2B4OA 4EYIB 4LF5F 1V3ZA 2KDOA 1VQKN 1EQ0A 2UU9K 3DYAA 2P9EA 5KFPA 4J9QA 3U7JA 1J2VA 1VQLS 5FDLB 1MNEA 4KHPK 2R7XA 2VFRA 1U1LA 4U7BA 5BRHA 3VGKA 2MTLA 1SZ2A 4QR1A 4U6PA 1HBMB 4B02A 4OHWA 3K0JA 4DU3A 2FJVA 1IBKJ 2A18A 3NNHA 2XHCA 3W65A 3L7UA 5EU7A 4FLXA 3G8SA 1FNOA 3WXIA 1CSJA 4M5JA 4CDIA 1EO1A 3DKDA 3ZNUA 3VR1A 3AO3A 2YHBA 1L3KA 3FEYB 4OJ3A 1RT4B 1KOHA 1FE4A 4JBCA 4CEOA 5AQFA 1KQSM 5KPTA 5KG3A 5HL7Q 4KHSA 4PWDA 2MHEA 4U7UD 4BQZA 1FNMA 1HRHA 3LUYA 4IOCQ 2E2PA 1HA1A 3KK2B 3KLEA 2KN4A 3SFUA 5JUMA 2GO8A 4ITSA 1LQ9A 1UW9A 2AMCB 4E0DA 4S0MA 3D54A 1YX2A 4KPCA 4PL8A 1BDGA 1S72N 3JTPA 4DQRA 2QYCA 2CUYA 4F0KA 3H5UA 3LDPA 2C2DA 4I7FB 4JYAJ 2JVRA 3MCOA 1SQKA 3V9ZA 3BGRA 2GW8A 3MM8B 4DR3F 4EEYA 5HMZA 5EUHA 2FC8A 5BYQA 1S6QB 1SH2A 1VSLA 2R8JA 2EXUA 3WNHA 2VPXB 1TVRA 1NJIT 2ABYA 5CYQA 3TA0A 4X4QA 2CGKA 4CJQA 3J7AP 4EYHB 5K8NA 2NUUG 1S0VA 2YJFA 4A8SA 4PWWA 3OTOJ 3RWUA 3DGPB 2ROGA 4JS5A 1MW7A 4M3WA 2BJ7A 3N6NA 4E7LA 1VSEA 3C6UB 1DZ5A 4YB1P 1HHTP 5KFZA 2UUCF 1B9DA 2BQ3A 4EHUA 4WWSA 3M9OB 3HBTA 2FHJA 3DYAB 1WBDA 4F2RA 2HVHA 3D0IE 3OSPA 3HKWA 3D4JA 4X4NA 4JRQA 1NM2A 4GY2B 1VHXA 3X3UA 2IIRA 2QG9B 4K43A 4DX7A 3LPUA 4AFFA 2BBEA 1X7VA 1YXQA 2DHXA 3CCLN 1KD1T 3CERA 3CJ1A 4BDYA 3M05A 4XH4A 3J7ZT 1JMTA 1S9EA 4GV9A 2BJ3A 1RHQB 5KFSA 3OXLA 3B6OA 2A2DA 1OYEA 1FRHA 5HSPA 3A8KA 1HWLA 1OH8A 3GTYX 2J6SA 4NMXA 4M3UA 4HVZA 3PSFA 4X2BA 2V4QA 5AJ3J 3ZZOA 1YRUA 4PWDB 2V2ZA 4KYZA 1GXTA 2HZAA 4B3OA 3PIOQ 1HWUA 3TZZA 4CZLA 3UE5A 4ED1A 4JV5F 3KLEB 3NF8A 2GCFA 4KPYA 1BQMA 1NO8A 2E88A 5DM7L 2E2NA 2D0BA 1NK8A 4FF2A 1IQZA 5KI6A 3U6FA 3RBXA 1U04A 4KRWA 4QU6A 3BGRB 1SS6A 2IA6A 5M1NA 1XMOF 3OPKA 5GADP 1HQ2A 1CC8A 3PFOA 2U2FA 2LXUA 4X4TA 3UB5A 3UN3A 4PKIA 3NE6A 4Q8FA 3SBMA 2IMOA 2E8AA 2XGQA 2AJ4A 2W9BA 3KG4A 1LEOA 4LF7K 1NK5A 3TZYA 1RISA 1FFWB 3TEGA 3HDSA 3THVA 2IY5B 1KHVA 1VQNS 4K4XA 4CEEA 3A0IX 2ZFHA 5KT3A 2FGCA 4IXCA 4C0OC 3S3OA 1AT1B 2ZM6F 3FK4A 3M6GA 4KRFA 4UOCA 2HB5A 4JI6J 3AXKA 4U7UK 1IKWA 1QM9A 2C3OA 4C2MA 3QEVA 2HHHJ 5KFRA 3PRDA 1KVKA 3QFWA 4EIAA 1WSHA 4UTGA 5H1SV 2WZ1A 3OTDA 2RU9A 3MN9A 4LF5J 4DR2K 2ACYA 2GVZA 4Q2LA 3JYTA 4IR9A 6AT1B 3RB0A 4DEZA 5ITHA 1FRIA 3OYEA 2G9OA 3N5BA 1S9EB 2E4LA 5ETRA 1RGIA 3C6TA 1OY8A 1REVA 2VC1A 3QJJA 4CJ5A 1RWNB 4X64K 2DISA 4K25A 1D9AA 3K89A 4U8YA 3ZSVA 2IBKA 3O6QA 2Z1HA 4B3OB 1HKAA 4CEZA 1CQNA 2VPZB 4EZ9A 2XLJA 4J2DA 4HT7A 2OHDA 3HM8A 1BQMB 3Q7CA 3VZHA 2LMIA 5IC4B 2LQ8A 5SZTA 4A59A 1BCOA 1K73T 1MWZA 3JAMU 1APSA 2HFNA 5LXYA 2UXBF 4BRAA 5C12A 2UP1A 4YOWA 4PZVA 3LM9A 1R0CB 3TUJC 1B9FA 4NWBA 3ZX2A 1NK4A 4BRNA 3BF3A 2HVEA 4P72A 4B3SF 3R3LA 3WIUA 4A48A 1EARA 4IQXA 3GG1A 4KTWA 4TU8A 2F3JA 2GQCA 4MQ3A 2W9BB 4DSFA 4YS2A 4DR3J 1D9FA 2KI2A 2E5HA 1QE1B 2OPPB 3ENAA 4QPXA 5J2NB 3ZXWA 2FB0A 5CZVA 4OLBA 3OYNA 3EGZA 3LDLA 1YSJA 1R27B 1TFWA 3CPWR 4CHPA 3V4IA 3H4DA 4CGFA 2KLAA 3AVKA 3PKMA 4DV5F 3I55N 1F5AA 2P9UB 2AEFA 2FSKA 4H8KA 2Q1LA 3CCQS 3DDKA 1N36J 4ZVPB 5J1NA 4B9MA 3L3CA 4W4MA 1Q1KA 1VMBA 2Q3SA 2RN2A 5DM6L 1B7FA 4JKCA 1U0HA 1QUPA 3L95X 2UUCJ 4U67L 5JICA 4Y1CA 1WNSA 1NUEA 3JYTB 4AE5A 3CCUN 2DH9A 4ZCMA 3D7SB 2H5EA 1YJRA 1H72C 4EHTA 2QO3A 3C6TB 1REVB 1FXDA 1RI7A 5HN0A 3J7YP 2HFSA 3G6XA 5KFYA 1W25A 5E3RA 2VA3A 2JVOA 3W62A 4J9OA 1K8AO 1Y00A 3T9NA 4M5IA 1ZAXA 1UKUA 4DV0K 4HH1A 3T5JA 3P45B 1Y9OA