5CZMA

Crystal structure of a mutated catalytic domain of human mmp12 in complex with rxp470
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
159
Chain Sequence
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYAYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Zinc-Metalloproteinase Inhibitors: Evaluation of the Complex Role Played by the Zinc-Binding Group on Potency and Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5czmA00
2I47A 2CKIA 5D1SA 1ROSA 1PWPA 5L79A 4ILWD 1ZS0A 2OY2A 3HBVP 1GXDA 4XCTA 2J0TA 4AXQA 4DV8A 2SRTA 966CA 1I73A 3KMEA 3DPFA 1OMJA 3F16A 3TS4A 3WV1A 5CZMA 2ERQA 1K7GA 3G42A 4JQGA 1L6JA 3N2UA 4G9LA 3TSKA 4EFSA 3F17A 1Y8JA 1IAGA 1RMZA 2EROA 2OW1A 1MMPA 1UTTA 1HV5A 4JA1A 3OHLA 2ERPA 2OI0A 1IABA 1YP1A 1CXVA 2Z2DA 4JPAA 4FU4A 1XURA 1GE6A 3VI1A 2J83A 1AF0A 5I12A 4AYKA 3U1RA 3ZUKA 4JIJA 4CTHA 3RTTA 1B3DA 3LEAA 2JNPA 3K7LA 3HY9A 3P24A 1JH1A 1G49A 3LJGA 3LUMA 5B5OA 1R1JA 2WO8A 2MZHA 1ATLA 1EUBA 4GWNA 5CUHA 4L6TA 1HFSA 1XFZA 1C8TA 2OXUA 456CA 5D3CA 4GR0A 2O3EA 3N2VA 4XM6A 1SMPA 3GBOA 1R54A 2FV9A 4GUYA 1SU3A 1BZSA 1FBLA 1OS2A 1JIZA 1GKDA 1YCMA 4AIGA 1OO9A 1HFCA 3BA0A 2W14A 3KRYA 1UEAA 4GF1A 3LUNA 4IN9A 3LILA 3AIGA 1ZTQA 3I7GA 4H3XA 3LIKA 2OVZA 1BIWA 2X7MA 4HX3A 3KWVC 1KUIA 4ON1A 1GE7A 1QICA 1G05A 1CGLA 1OM8A 2FV5A 5I4OA 4Q1LA 4DF9A 1H71P 5D7WA 1CGEA 1ZVXA 2MZEA 1MMRA 1C3IA 5I2ZA 2HU6A 4WF6A 3NX7A 4H84A 3AYUA 4XM8A 3EDZA 1FM1A 1R1HA 4A7BA 1SLMA 4DD8A 4I35A 5LABA 3EDGA 3E8RA 2E3XA 1A85A 4L19A 3DPEA 2W13A 1QIAA 2JT5A 3EDIA 5JMYA 1PWVA 1MMQA 5BOTA 4GR3A 1UMSA 4H30A 1DTHA 1BSWA 3KEJA 1KBCA 2K9CA 4XM7A 2N8RA 2WO9A 4A3WA 1BUVM 1Y93A 1ZXVA 3LQBA 4H49A 2OXZA 3DNGA 1O0QA 1ZP5A 4J4MA 1KUHA 3AYKA 1CGFA 1I76A 1XFUA 3O64A 1GO7P 3ZVSA 4L63A 1J7NA 3KEKA 2USNA 1D5JA 2PJTA 2E2DA 5D1TA 1WNIA 1KUFA 3HB2P 2DDYA 2OVXA 1PWQA 5B5PA 2WOAA 4H1QA 1JKYA 2W15A 1XFXA 3LKAA 1R1IA 1SATA 3O2XA 2D1NA 2D1OA 1CIZA 1JIWP 3HBUP 1D8MA 3V96B 1XFVA 1EB6A 1KAPP 4PKRA 1BUDA 1AYKA 2XS3A 3B8ZA 1R55A 1Z3JA 3F18A 3VTGA 4IUWA 3B2ZA 4I03A 1BQQM 1KUKA 4PKSA 1OM6A 2JT6A 3LJTA 2JIHA 1CAQA 3I7IA 4PKWA 1C7KA 4FXYP 4H2EA 3DSLA 3EWJA 2DDFA 3KECA 4WK7A 2X3BA 1PWUA 4FXQA 5BOYA 3TT4A 3TVCA 1IAEA 4AUOA 3EHXA 2A8HA 2K2GA 5I3MA 1OM7A 3LIRA 3HY7A 4PKUA 2MZIA 3P1VA 3KMCA 1G4KA 1G12A 3OHOA 3F15A 1JJ9A 1MMBA 1JK3A 1DMTA 2XS4A 1YOUA 2DW0A 1D8FA 3ELMA 2OW0A 2MLSA 3MA2A 4GR8A 3HYGA 3UVCA 1OS9A 5BPAA 3WV3A 1AKLA 1XUDA 3EHYA 1SRPA 1UTZA 2OXWA 2W12A 1GE5A 2MLRA 1CQRA 1Q3AA 1RM8A 2AIGP 2CLTA 2O36A 4H82A 1GKCA 1ZXCA 2TCLA 1YQYA 1BKCI 1BM6A 5I43A 3RTSA 3L0TA 3LMCA 1K7IA 2X3CA 3F19A 1IAAA 4HMAA 1A86A 1JAQA 2V4BA 4PKTA 1MNCA 2KRJA 2POJA 4PKVA 1JANA 2Y6CA 1BKCE 3DL1A 3EDHA 3HDBA 4R3VA 3SHIA 1S4BP 5L7FA 3G5CA 2DW2A 1B8YA 1BQOA 3KHIA 1D7XA 4H76A 5H8XA 3WV2A 3ZXHA 3B92A 4GWMA 1KUGA 1QIBA 3LJZA 3LK8A 1HY7A 1ASTA 5D2BA 2Y6DA 5D1UA 1QJIA 4XBHA 1Y0VA 830CA 4FVLA 2YIGA 3LQ0A 4DPEA 2QPJA 4QKZA 1QUAA 1JAOA 1USNA 2DW1A 1CK7A 1IADA 5I0LA 2OY4A 3LE9A 2YB9A 1SLNA 3CKIA 3Q2GA 1HOVA 1BKCA 1GO8P 1K7QA 2RJPA 4ZR5A 1HTDA 4GQLA 3K7NA 2L0RA 4WKEA 2RJQA 4WKIA 2JSDA 4WZVA 4G0DA 1UMTA 3DWBA 1XUCA 2OW2A 1ND1A 1IACA 3LGPA 2X3AA 2W0DA 2AYKA 2OZRA 1FLSA 1JAPA 1XFWA 4JP4A 5CXAA 1G9KA 3L0VA 1I1IP 4PKQA 4IJOA 1O0TA 3F1AA 3Q2HA 3HDAP 1PWWA 1EAKA 1QJJA 1XFYA 2OW9A 3USNA
chains in the Genus database with same CATH superfamily
2I47A 2CKIA 5D1SA 1ROSA 1PWPA 5L79A 4ILWD 1ZS0A 2OY2A 3HBVP 1GXDA 4XCTA 2J0TA 4AXQA 4DV8A 2SRTA 966CA 1I73A 3KMEA 3DPFA 1OMJA 3F16A 3TS4A 3WV1A 5CZMA 2ERQA 1K7GA 3G42A 4JQGA 1L6JA 3N2UA 4G9LA 3TSKA 4EFSA 3F17A 1Y8JA 1IAGA 1RMZA 2EROA 2OW1A 1MMPA 1UTTA 1HV5A 4JA1A 3OHLA 2ERPA 2OI0A 1IABA 1YP1A 1CXVA 2Z2DA 4JPAA 4FU4A 1XURA 1GE6A 3VI1A 2J83A 1AF0A 5I12A 4AYKA 3U1RA 1XM5A 3ZUKA 4JIJA 4CTHA 3RTTA 1B3DA 3LEAA 2JNPA 3K7LA 3HY9A 3P24A 1JH1A 1G49A 3LJGA 3LUMA 5B5OA 1R1JA 2WO8A 2MZHA 1ATLA 1EUBA 4GWNA 5CUHA 4L6TA 1HFSA 1XFZA 1C8TA 2OXUA 456CA 5D3CA 4GR0A 2O3EA 3N2VA 4XM6A 3DTKA 1SMPA 3GBOA 1R54A 2FV9A 4GUYA 1SU3A 1BZSA 1FBLA 1OS2A 1JIZA 1GKDA 1YCMA 4AIGA 1OO9A 1HFCA 3BA0A 2W14A 3KRYA 1UEAA 4GF1A 3LUNA 4IN9A 3LILA 3AIGA 1ZTQA 3I7GA 4H3XA 3LIKA 2OVZA 1BIWA 2X7MA 4HX3A 3KWVC 1KUIA 4ON1A 1GE7A 1QICA 1G05A 1CGLA 1OM8A 2FV5A 5I4OA 4Q1LA 4DF9A 1H71P 5D7WA 1CGEA 1ZVXA 2MZEA 1MMRA 1C3IA 5I2ZA 1TVIA 2HU6A 4WF6A 3NX7A 4H84A 3AYUA 4XM8A 2YUFA 3EDZA 1FM1A 1R1HA 4A7BA 1SLMA 4DD8A 4I35A 5LABA 3EDGA 3E8RA 2E3XA 1A85A 4L19A 3DPEA 2W13A 1QIAA 2JT5A 3EDIA 5JMYA 1PWVA 1MMQA 5BOTA 4GR3A 1UMSA 4H30A 1DTHA 1BSWA 3KEJA 1KBCA 2K9CA 4XM7A 2N8RA 2WO9A 4A3WA 1BUVM 1Y93A 1ZXVA 3LQBA 4H49A 2OXZA 3DNGA 1O0QA 1ZP5A 4J4MA 1KUHA 3AYKA 1CGFA 1I76A 1XFUA 3O64A 1GO7P 3ZVSA 4L63A 1J7NA 3KEKA 2USNA 1D5JA 2PJTA 2E2DA 5D1TA 1WNIA 1KUFA 3HB2P 2DDYA 2OVXA 1PWQA 5B5PA 2WOAA 4H1QA 1JKYA 2W15A 1XFXA 3LKAA 1R1IA 1SATA 3O2XA 2D1NA 2D1OA 1CIZA 1JIWP 3HBUP 1D8MA 3V96B 1XFVA 1EB6A 1KAPP 4PKRA 1BUDA 1AYKA 3B8ZA 2XS3A 1R55A 1Z3JA 3F18A 3VTGA 4IUWA 3B2ZA 4I03A 1BQQM 1KUKA 4PKSA 1OM6A 4L7AA 2JT6A 3LJTA 2JIHA 1CAQA 3I7IA 4PKWA 1C7KA 4FXYP 4H2EA 3DSLA 3EWJA 2DDFA 3KECA 4WK7A 2X3BA 1PWUA 4FXQA 5BOYA 3TT4A 3TVCA 1IAEA 4AUOA 3EHXA 2A8HA 2K2GA 1XAXA 5I3MA 1OM7A 3LIRA 3HY7A 4PKUA 2MZIA 3P1VA 3KMCA 1G4KA 1G12A 3DTEA 3OHOA 3F15A 1JJ9A 1MMBA 1JK3A 1DMTA 2XS4A 1YOUA 2DW0A 1D8FA 3ELMA 2OW0A 2MLSA 3MA2A 4GR8A 3HYGA 3UVCA 1OS9A 5BPAA 3WV3A 1AKLA 1XUDA 3EHYA 1SRPA 1UTZA 2OXWA 2W12A 1GE5A 2MLRA 1CQRA 1Q3AA 1RM8A 2AIGP 2CLTA 2O36A 4H82A 1GKCA 1ZXCA 2TCLA 1YQYA 1BKCI 1BM6A 5I43A 3RTSA 3L0TA 3LMCA 1K7IA 2X3CA 3F19A 1IAAA 4HMAA 1A86A 1JAQA 2V4BA 4PKTA 1MNCA 2KRJA 2POJA 4PKVA 1JANA 2Y6CA 1BKCE 3DL1A 3EDHA 3HDBA 4R3VA 3SHIA 1S4BP 1OZ9A 5L7FA 3G5CA 2DW2A 1B8YA 1BQOA 3KHIA 1D7XA 4H76A 5H8XA 3WV2A 3ZXHA 3B92A 4GWMA 1KUGA 1QIBA 3LJZA 3LK8A 1HY7A 1ASTA 5D2BA 2Y6DA 5D1UA 1QJIA 4XBHA 1Y0VA 830CA 4FVLA 2YIGA 3LQ0A 4DPEA 2QPJA 4QKZA 1QUAA 1JAOA 1USNA 2DW1A 1CK7A 1IADA 5I0LA 2OY4A 3LE9A 2YB9A 1SLNA 3CKIA 3Q2GA 1HOVA 1BKCA 1GO8P 1K7QA 2RJPA 4ZR5A 1HTDA 4GQLA 3K7NA 2L0RA 4WKEA 2RJQA 4WKIA 2JSDA 4WZVA 4G0DA 1UMTA 3DWBA 1XUCA 2OW2A 1ND1A 1IACA 3LGPA 2X3AA 3DTIA 2W0DA 2AYKA 2OZRA 1FLSA 1JAPA 1XFWA 4JP4A 5CXAA 1G9KA 3L0VA 1I1IP 4PKQA 4IJOA 1O0TA 3F1AA 3Q2HA 3HDAP 1PWWA 1EAKA 1QJJA 1XFYA 2OW9A 3USNA
chains in the Genus database with same CATH topology
2I47A 2CKIA 5D1SA 1ROSA 1PWPA 5L79A 4ILWD 1ZS0A 2OY2A 3HBVP 1GXDA 4XCTA 2J0TA 4AXQA 4DV8A 2SRTA 966CA 1I73A 3KMEA 3DPFA 1OMJA 3F16A 3TS4A 3WV1A 5CZMA 2ERQA 1K7GA 3G42A 4JQGA 1L6JA 3N2UA 4G9LA 3TSKA 4EFSA 3F17A 1Y8JA 1IAGA 1RMZA 2EROA 2OW1A 1MMPA 1UTTA 1HV5A 4JA1A 3OHLA 2ERPA 2OI0A 1IABA 1YP1A 1CXVA 2Z2DA 4JPAA 4FU4A 1XURA 1GE6A 3VI1A 2J83A 1AF0A 5I12A 4AYKA 3U1RA 3ZUKA 4JIJA 4CTHA 3RTTA 1B3DA 3LEAA 2JNPA 3K7LA 3HY9A 3P24A 1JH1A 1G49A 3LJGA 3LUMA 5B5OA 1R1JA 2WO8A 2MZHA 1ATLA 1EUBA 4GWNA 5CUHA 4L6TA 1HFSA 1XFZA 1C8TA 2OXUA 456CA 5D3CA 4GR0A 2O3EA 3N2VA 4XM6A 3DTKA 1SMPA 3GBOA 1R54A 2FV9A 4GUYA 1SU3A 1BZSA 1FBLA 1OS2A 1JIZA 1GKDA 1YCMA 4AIGA 1OO9A 1HFCA 3BA0A 2W14A 3KRYA 1UEAA 4GF1A 3LUNA 4IN9A 3LILA 3AIGA 1ZTQA 3I7GA 4H3XA 3LIKA 2OVZA 1BIWA 2X7MA 4HX3A 3KWVC 1KUIA 4ON1A 1GE7A 1QICA 1G05A 1CGLA 1OM8A 2FV5A 5I4OA 4Q1LA 4DF9A 1H71P 5D7WA 1CGEA 1ZVXA 2MZEA 1MMRA 1C3IA 5I2ZA 2HU6A 4WF6A 3NX7A 4H84A 3AYUA 4XM8A 2YUFA 3EDZA 1FM1A 1R1HA 4A7BA 1SLMA 4DD8A 4I35A 5LABA 3EDGA 3E8RA 2E3XA 1A85A 4L19A 3DPEA 2W13A 1QIAA 2JT5A 3EDIA 5JMYA 1PWVA 1MMQA 5BOTA 4GR3A 1UMSA 4H30A 1DTHA 1BSWA 3KEJA 1KBCA 2K9CA 4XM7A 2N8RA 2WO9A 4A3WA 1BUVM 1Y93A 1ZXVA 3LQBA 4H49A 2OXZA 3DNGA 1O0QA 1ZP5A 4J4MA 1KUHA 3AYKA 1CGFA 1I76A 1XFUA 3O64A 1GO7P 3ZVSA 4L63A 1J7NA 3KEKA 2USNA 1D5JA 2PJTA 2E2DA 5D1TA 1WNIA 1KUFA 3HB2P 2DDYA 2OVXA 1PWQA 5B5PA 2WOAA 4H1QA 1JKYA 2W15A 1XFXA 3LKAA 1R1IA 1SATA 3O2XA 2D1NA 2D1OA 1CIZA 1JIWP 3HBUP 1D8MA 3V96B 1XFVA 1EB6A 1KAPP 4PKRA 1BUDA 1AYKA 2XS3A 3B8ZA 1R55A 1Z3JA 3F18A 3VTGA 4IUWA 3B2ZA 4I03A 1BQQM 1KUKA 4PKSA 1OM6A 4L7AA 2JT6A 3LJTA 2JIHA 1CAQA 3I7IA 4PKWA 1C7KA 4FXYP 4H2EA 3DSLA 3EWJA 2DDFA 3KECA 4WK7A 2X3BA 1PWUA 4FXQA 5BOYA 3TT4A 3TVCA 1IAEA 4AUOA 3EHXA 2A8HA 2K2GA 5I3MA 1OM7A 3LIRA 3HY7A 4PKUA 2MZIA 3P1VA 3KMCA 1G4KA 1G12A 3DTEA 3OHOA 3F15A 1JJ9A 1MMBA 1JK3A 1DMTA 2XS4A 1YOUA 2DW0A 1D8FA 3ELMA 2OW0A 2MLSA 3MA2A 4GR8A 3HYGA 3UVCA 1OS9A 5BPAA 3WV3A 1AKLA 1XUDA 3EHYA 1SRPA 1UTZA 2OXWA 2W12A 1GE5A 2MLRA 1CQRA 1Q3AA 1RM8A 2AIGP 2CLTA 2O36A 4H82A 1GKCA 1ZXCA 2TCLA 1YQYA 1BKCI 1BM6A 5I43A 3RTSA 3L0TA 3LMCA 1K7IA 2X3CA 3F19A 1IAAA 4HMAA 1A86A 1JAQA 2V4BA 4PKTA 1MNCA 2KRJA 2POJA 4PKVA 1JANA 2Y6CA 1BKCE 3DL1A 3EDHA 3HDBA 4R3VA 3SHIA 1S4BP 5L7FA 3G5CA 2DW2A 1B8YA 1BQOA 3KHIA 1D7XA 4H76A 5H8XA 3WV2A 3ZXHA 3B92A 4GWMA 1KUGA 1QIBA 3LJZA 3LK8A 1HY7A 1ASTA 5D2BA 2Y6DA 5D1UA 1QJIA 4XBHA 1Y0VA 830CA 4FVLA 2YIGA 3LQ0A 4DPEA 2QPJA 4QKZA 1QUAA 1JAOA 1USNA 2DW1A 1CK7A 1IADA 5I0LA 2OY4A 3LE9A 2YB9A 1SLNA 3CKIA 3Q2GA 1HOVA 1BKCA 1GO8P 1K7QA 2RJPA 4ZR5A 1HTDA 4GQLA 3K7NA 2L0RA 4WKEA 2RJQA 4WKIA 2JSDA 4WZVA 4G0DA 1UMTA 3DWBA 1XUCA 2OW2A 1ND1A 1IACA 3LGPA 2X3AA 3DTIA 2W0DA 2AYKA 2OZRA 1FLSA 1JAPA 1XFWA 4JP4A 5CXAA 1G9KA 3L0VA 1I1IP 4PKQA 4IJOA 1O0TA 3F1AA 3Q2HA 3HDAP 1PWWA 1EAKA 1QJJA 1XFYA 2OW9A 3USNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I47 A;  2CKI A;  5D1S A;  1ROS A;  1PWP A;  5L79 A;  4ILW D;  1ZS0 A;  2OY2 A;  3HBV P;  1GXD A;  4XCT A;  2J0T A;  4AXQ A;  4DV8 A;  2SRT A;  966C A;  1I73 A;  3KME A;  3DPF A;  1OMJ A;  3F16 A;  3TS4 A;  3WV1 A;  5CZM A;  2ERQ A;  1K7G A;  3G42 A;  4JQG A;  1L6J A;  3N2U A;  4G9L A;  3TSK A;  4EFS A;  3F17 A;  1Y8J A;  1IAG A;  1RMZ A;  2ERO A;  2OW1 A;  1MMP A;  1UTT A;  1HV5 A;  4JA1 A;  3OHL A;  2ERP A;  2OI0 A;  1IAB A;  1YP1 A;  1CXV A;  2Z2D A;  4JPA A;  4FU4 A;  1XUR A;  1GE6 A;  3VI1 A;  2J83 A;  1AF0 A;  5I12 A;  4AYK A;  3U1R A;  3ZUK A;  4JIJ A;  4CTH A;  3RTT A;  1B3D A;  3LEA A;  2JNP A;  3K7L A;  3HY9 A;  3P24 A;  1JH1 A;  1G49 A;  3LJG A;  3LUM A;  5B5O A;  1R1J A;  2WO8 A;  2MZH A;  1ATL A;  1EUB A;  4GWN A;  5CUH A;  4L6T A;  1HFS A;  1XFZ A;  1C8T A;  2OXU A;  456C A;  5D3C A;  4GR0 A;  2O3E A;  3N2V A;  4XM6 A;  1SMP A;  3GBO A;  1R54 A;  2FV9 A;  4GUY A;  1SU3 A;  1BZS A;  1FBL A;  1OS2 A;  1JIZ A;  1GKD A;  1YCM A;  4AIG A;  1OO9 A;  1HFC A;  3BA0 A;  2W14 A;  3KRY A;  1UEA A;  4GF1 A;  3LUN A;  4IN9 A;  3LIL A;  3AIG A;  1ZTQ A;  3I7G A;  4H3X A;  3LIK A;  2OVZ A;  1BIW A;  2X7M A;  4HX3 A;  3KWV C;  1KUI A;  4ON1 A;  1GE7 A;  1QIC A;  1G05 A;  1CGL A;  1OM8 A;  2FV5 A;  5I4O A;  4Q1L A;  4DF9 A;  1H71 P;  5D7W A;  1CGE A;  1ZVX A;  2MZE A;  1MMR A;  1C3I A;  5I2Z A;  2HU6 A;  4WF6 A;  3NX7 A;  4H84 A;  3AYU A;  4XM8 A;  3EDZ A;  1FM1 A;  1R1H A;  4A7B A;  1SLM A;  4DD8 A;  4I35 A;  5LAB A;  3EDG A;  3E8R A;  2E3X A;  1A85 A;  4L19 A;  3DPE A;  2W13 A;  1QIA A;  2JT5 A;  3EDI A;  5JMY A;  1PWV A;  1MMQ A;  5BOT A;  4GR3 A;  1UMS A;  4H30 A;  1DTH A;  1BSW A;  3KEJ A;  1KBC A;  2K9C A;  4XM7 A;  2N8R A;  2WO9 A;  4A3W A;  1BUV M;  1Y93 A;  1ZXV A;  3LQB A;  4H49 A;  2OXZ A;  3DNG A;  1O0Q A;  1ZP5 A;  4J4M A;  1KUH A;  3AYK A;  1CGF A;  1I76 A;  1XFU A;  3O64 A;  1GO7 P;  3ZVS A;  4L63 A;  1J7N A;  3KEK A;  2USN A;  1D5J A;  2PJT A;  2E2D A;  5D1T A;  1WNI A;  1KUF A;  3HB2 P;  2DDY A;  2OVX A;  1PWQ A;  5B5P A;  2WOA A;  4H1Q A;  1JKY A;  2W15 A;  1XFX A;  3LKA A;  1R1I A;  1SAT A;  3O2X A;  2D1N A;  2D1O A;  1CIZ A;  1JIW P;  3HBU P;  1D8M A;  3V96 B;  1XFV A;  1EB6 A;  1KAP P;  4PKR A;  1BUD A;  1AYK A;  2XS3 A;  3B8Z A;  1R55 A;  1Z3J A;  3F18 A;  3VTG A;  4IUW A;  3B2Z A;  4I03 A;  1BQQ M;  1KUK A;  4PKS A;  1OM6 A;  2JT6 A;  3LJT A;  2JIH A;  1CAQ A;  3I7I A;  4PKW A;  1C7K A;  4FXY P;  4H2E A;  3DSL A;  3EWJ A;  2DDF A;  3KEC A;  4WK7 A;  2X3B A;  1PWU A;  4FXQ A;  5BOY A;  3TT4 A;  3TVC A;  1IAE A;  4AUO A;  3EHX A;  2A8H A;  2K2G A;  5I3M A;  1OM7 A;  3LIR A;  3HY7 A;  4PKU A;  2MZI A;  3P1V A;  3KMC A;  1G4K A;  1G12 A;  3OHO A;  3F15 A;  1JJ9 A;  1MMB A;  1JK3 A;  1DMT A;  2XS4 A;  1YOU A;  2DW0 A;  1D8F A;  3ELM A;  2OW0 A;  2MLS A;  3MA2 A;  4GR8 A;  3HYG A;  3UVC A;  1OS9 A;  5BPA A;  3WV3 A;  1AKL A;  1XUD A;  3EHY A;  1SRP A;  1UTZ A;  2OXW A;  2W12 A;  1GE5 A;  2MLR A;  1CQR A;  1Q3A A;  1RM8 A;  2AIG P;  2CLT A;  2O36 A;  4H82 A;  1GKC A;  1ZXC A;  2TCL A;  1YQY A;  1BKC I;  1BM6 A;  5I43 A;  3RTS A;  3L0T A;  3LMC A;  1K7I A;  2X3C A;  3F19 A;  1IAA A;  4HMA A;  1A86 A;  1JAQ A;  2V4B A;  4PKT A;  1MNC A;  2KRJ A;  2POJ A;  4PKV A;  1JAN A;  2Y6C A;  1BKC E;  3DL1 A;  3EDH A;  3HDB A;  4R3V A;  3SHI A;  1S4B P;  5L7F A;  3G5C A;  2DW2 A;  1B8Y A;  1BQO A;  3KHI A;  1D7X A;  4H76 A;  5H8X A;  3WV2 A;  3ZXH A;  3B92 A;  4GWM A;  1KUG A;  1QIB A;  3LJZ A;  3LK8 A;  1HY7 A;  1AST A;  5D2B A;  2Y6D A;  5D1U A;  1QJI A;  4XBH A;  1Y0V A;  830C A;  4FVL A;  2YIG A;  3LQ0 A;  4DPE A;  2QPJ A;  4QKZ A;  1QUA A;  1JAO A;  1USN A;  2DW1 A;  1CK7 A;  1IAD A;  5I0L A;  2OY4 A;  3LE9 A;  2YB9 A;  1SLN A;  3CKI A;  3Q2G A;  1HOV A;  1BKC A;  1GO8 P;  1K7Q A;  2RJP A;  4ZR5 A;  1HTD A;  4GQL A;  3K7N A;  2L0R A;  4WKE A;  2RJQ A;  4WKI A;  2JSD A;  4WZV A;  4G0D A;  1UMT A;  3DWB A;  1XUC A;  2OW2 A;  1ND1 A;  1IAC A;  3LGP A;  2X3A A;  2W0D A;  2AYK A;  2OZR A;  1FLS A;  1JAP A;  1XFW A;  4JP4 A;  5CXA A;  1G9K A;  3L0V A;  1I1I P;  4PKQ A;  4IJO A;  1O0T A;  3F1A A;  3Q2H A;  3HDA P;  1PWW A;  1EAK A;  1QJJ A;  1XFY A;  2OW9 A;  3USN A; 
#chains in the Genus database with same CATH topology
 2I47 A;  2CKI A;  5D1S A;  1ROS A;  1PWP A;  5L79 A;  4ILW D;  1ZS0 A;  2OY2 A;  3HBV P;  1GXD A;  4XCT A;  2J0T A;  4AXQ A;  4DV8 A;  2SRT A;  966C A;  1I73 A;  3KME A;  3DPF A;  1OMJ A;  3F16 A;  3TS4 A;  3WV1 A;  5CZM A;  2ERQ A;  1K7G A;  3G42 A;  4JQG A;  1L6J A;  3N2U A;  4G9L A;  3TSK A;  4EFS A;  3F17 A;  1Y8J A;  1IAG A;  1RMZ A;  2ERO A;  2OW1 A;  1MMP A;  1UTT A;  1HV5 A;  4JA1 A;  3OHL A;  2ERP A;  2OI0 A;  1IAB A;  1YP1 A;  1CXV A;  2Z2D A;  4JPA A;  4FU4 A;  1XUR A;  1GE6 A;  3VI1 A;  2J83 A;  1AF0 A;  5I12 A;  4AYK A;  3U1R A;  1XM5 A;  3ZUK A;  4JIJ A;  4CTH A;  3RTT A;  1B3D A;  3LEA A;  2JNP A;  3K7L A;  3HY9 A;  3P24 A;  1JH1 A;  1G49 A;  3LJG A;  3LUM A;  5B5O A;  1R1J A;  2WO8 A;  2MZH A;  1ATL A;  1EUB A;  4GWN A;  5CUH A;  4L6T A;  1HFS A;  1XFZ A;  1C8T A;  2OXU A;  456C A;  5D3C A;  4GR0 A;  2O3E A;  3N2V A;  4XM6 A;  3DTK A;  1SMP A;  3GBO A;  1R54 A;  2FV9 A;  4GUY A;  1SU3 A;  1BZS A;  1FBL A;  1OS2 A;  1JIZ A;  1GKD A;  1YCM A;  4AIG A;  1OO9 A;  1HFC A;  3BA0 A;  2W14 A;  3KRY A;  1UEA A;  4GF1 A;  3LUN A;  4IN9 A;  3LIL A;  3AIG A;  1ZTQ A;  3I7G A;  4H3X A;  3LIK A;  2OVZ A;  1BIW A;  2X7M A;  4HX3 A;  3KWV C;  1KUI A;  4ON1 A;  1GE7 A;  1QIC A;  1G05 A;  1CGL A;  1OM8 A;  2FV5 A;  5I4O A;  4Q1L A;  4DF9 A;  1H71 P;  5D7W A;  1CGE A;  1ZVX A;  2MZE A;  1MMR A;  1C3I A;  5I2Z A;  1TVI A;  2HU6 A;  4WF6 A;  3NX7 A;  4H84 A;  3AYU A;  4XM8 A;  2YUF A;  3EDZ A;  1FM1 A;  1R1H A;  4A7B A;  1SLM A;  4DD8 A;  4I35 A;  5LAB A;  3EDG A;  3E8R A;  2E3X A;  1A85 A;  4L19 A;  3DPE A;  2W13 A;  1QIA A;  2JT5 A;  3EDI A;  5JMY A;  1PWV A;  1MMQ A;  5BOT A;  4GR3 A;  1UMS A;  4H30 A;  1DTH A;  1BSW A;  3KEJ A;  1KBC A;  2K9C A;  4XM7 A;  2N8R A;  2WO9 A;  4A3W A;  1BUV M;  1Y93 A;  1ZXV A;  3LQB A;  4H49 A;  2OXZ A;  3DNG A;  1O0Q A;  1ZP5 A;  4J4M A;  1KUH A;  3AYK A;  1CGF A;  1I76 A;  1XFU A;  3O64 A;  1GO7 P;  3ZVS A;  4L63 A;  1J7N A;  3KEK A;  2USN A;  1D5J A;  2PJT A;  2E2D A;  5D1T A;  1WNI A;  1KUF A;  3HB2 P;  2DDY A;  2OVX A;  1PWQ A;  5B5P A;  2WOA A;  4H1Q A;  1JKY A;  2W15 A;  1XFX A;  3LKA A;  1R1I A;  1SAT A;  3O2X A;  2D1N A;  2D1O A;  1CIZ A;  1JIW P;  3HBU P;  1D8M A;  3V96 B;  1XFV A;  1EB6 A;  1KAP P;  4PKR A;  1BUD A;  1AYK A;  3B8Z A;  2XS3 A;  1R55 A;  1Z3J A;  3F18 A;  3VTG A;  4IUW A;  3B2Z A;  4I03 A;  1BQQ M;  1KUK A;  4PKS A;  1OM6 A;  4L7A A;  2JT6 A;  3LJT A;  2JIH A;  1CAQ A;  3I7I A;  4PKW A;  1C7K A;  4FXY P;  4H2E A;  3DSL A;  3EWJ A;  2DDF A;  3KEC A;  4WK7 A;  2X3B A;  1PWU A;  4FXQ A;  5BOY A;  3TT4 A;  3TVC A;  1IAE A;  4AUO A;  3EHX A;  2A8H A;  2K2G A;  1XAX A;  5I3M A;  1OM7 A;  3LIR A;  3HY7 A;  4PKU A;  2MZI A;  3P1V A;  3KMC A;  1G4K A;  1G12 A;  3DTE A;  3OHO A;  3F15 A;  1JJ9 A;  1MMB A;  1JK3 A;  1DMT A;  2XS4 A;  1YOU A;  2DW0 A;  1D8F A;  3ELM A;  2OW0 A;  2MLS A;  3MA2 A;  4GR8 A;  3HYG A;  3UVC A;  1OS9 A;  5BPA A;  3WV3 A;  1AKL A;  1XUD A;  3EHY A;  1SRP A;  1UTZ A;  2OXW A;  2W12 A;  1GE5 A;  2MLR A;  1CQR A;  1Q3A A;  1RM8 A;  2AIG P;  2CLT A;  2O36 A;  4H82 A;  1GKC A;  1ZXC A;  2TCL A;  1YQY A;  1BKC I;  1BM6 A;  5I43 A;  3RTS A;  3L0T A;  3LMC A;  1K7I A;  2X3C A;  3F19 A;  1IAA A;  4HMA A;  1A86 A;  1JAQ A;  2V4B A;  4PKT A;  1MNC A;  2KRJ A;  2POJ A;  4PKV A;  1JAN A;  2Y6C A;  1BKC E;  3DL1 A;  3EDH A;  3HDB A;  4R3V A;  3SHI A;  1S4B P;  1OZ9 A;  5L7F A;  3G5C A;  2DW2 A;  1B8Y A;  1BQO A;  3KHI A;  1D7X A;  4H76 A;  5H8X A;  3WV2 A;  3ZXH A;  3B92 A;  4GWM A;  1KUG A;  1QIB A;  3LJZ A;  3LK8 A;  1HY7 A;  1AST A;  5D2B A;  2Y6D A;  5D1U A;  1QJI A;  4XBH A;  1Y0V A;  830C A;  4FVL A;  2YIG A;  3LQ0 A;  4DPE A;  2QPJ A;  4QKZ A;  1QUA A;  1JAO A;  1USN A;  2DW1 A;  1CK7 A;  1IAD A;  5I0L A;  2OY4 A;  3LE9 A;  2YB9 A;  1SLN A;  3CKI A;  3Q2G A;  1HOV A;  1BKC A;  1GO8 P;  1K7Q A;  2RJP A;  4ZR5 A;  1HTD A;  4GQL A;  3K7N A;  2L0R A;  4WKE A;  2RJQ A;  4WKI A;  2JSD A;  4WZV A;  4G0D A;  1UMT A;  3DWB A;  1XUC A;  2OW2 A;  1ND1 A;  1IAC A;  3LGP A;  2X3A A;  3DTI A;  2W0D A;  2AYK A;  2OZR A;  1FLS A;  1JAP A;  1XFW A;  4JP4 A;  5CXA A;  1G9K A;  3L0V A;  1I1I P;  4PKQ A;  4IJO A;  1O0T A;  3F1A A;  3Q2H A;  3HDA P;  1PWW A;  1EAK A;  1QJJ A;  1XFY A;  2OW9 A;  3USN A; 
#chains in the Genus database with same CATH homology
 2I47 A;  2CKI A;  5D1S A;  1ROS A;  1PWP A;  5L79 A;  4ILW D;  1ZS0 A;  2OY2 A;  3HBV P;  1GXD A;  4XCT A;  2J0T A;  4AXQ A;  4DV8 A;  2SRT A;  966C A;  1I73 A;  3KME A;  3DPF A;  1OMJ A;  3F16 A;  3TS4 A;  3WV1 A;  5CZM A;  2ERQ A;  1K7G A;  3G42 A;  4JQG A;  1L6J A;  3N2U A;  4G9L A;  3TSK A;  4EFS A;  3F17 A;  1Y8J A;  1IAG A;  1RMZ A;  2ERO A;  2OW1 A;  1MMP A;  1UTT A;  1HV5 A;  4JA1 A;  3OHL A;  2ERP A;  2OI0 A;  1IAB A;  1YP1 A;  1CXV A;  2Z2D A;  4JPA A;  4FU4 A;  1XUR A;  1GE6 A;  3VI1 A;  2J83 A;  1AF0 A;  5I12 A;  4AYK A;  3U1R A;  3ZUK A;  4JIJ A;  4CTH A;  3RTT A;  1B3D A;  3LEA A;  2JNP A;  3K7L A;  3HY9 A;  3P24 A;  1JH1 A;  1G49 A;  3LJG A;  3LUM A;  5B5O A;  1R1J A;  2WO8 A;  2MZH A;  1ATL A;  1EUB A;  4GWN A;  5CUH A;  4L6T A;  1HFS A;  1XFZ A;  1C8T A;  2OXU A;  456C A;  5D3C A;  4GR0 A;  2O3E A;  3N2V A;  4XM6 A;  3DTK A;  1SMP A;  3GBO A;  1R54 A;  2FV9 A;  4GUY A;  1SU3 A;  1BZS A;  1FBL A;  1OS2 A;  1JIZ A;  1GKD A;  1YCM A;  4AIG A;  1OO9 A;  1HFC A;  3BA0 A;  2W14 A;  3KRY A;  1UEA A;  4GF1 A;  3LUN A;  4IN9 A;  3LIL A;  3AIG A;  1ZTQ A;  3I7G A;  4H3X A;  3LIK A;  2OVZ A;  1BIW A;  2X7M A;  4HX3 A;  3KWV C;  1KUI A;  4ON1 A;  1GE7 A;  1QIC A;  1G05 A;  1CGL A;  1OM8 A;  2FV5 A;  5I4O A;  4Q1L A;  4DF9 A;  1H71 P;  5D7W A;  1CGE A;  1ZVX A;  2MZE A;  1MMR A;  1C3I A;  5I2Z A;  2HU6 A;  4WF6 A;  3NX7 A;  4H84 A;  3AYU A;  4XM8 A;  2YUF A;  3EDZ A;  1FM1 A;  1R1H A;  4A7B A;  1SLM A;  4DD8 A;  4I35 A;  5LAB A;  3EDG A;  3E8R A;  2E3X A;  1A85 A;  4L19 A;  3DPE A;  2W13 A;  1QIA A;  2JT5 A;  3EDI A;  5JMY A;  1PWV A;  1MMQ A;  5BOT A;  4GR3 A;  1UMS A;  4H30 A;  1DTH A;  1BSW A;  3KEJ A;  1KBC A;  2K9C A;  4XM7 A;  2N8R A;  2WO9 A;  4A3W A;  1BUV M;  1Y93 A;  1ZXV A;  3LQB A;  4H49 A;  2OXZ A;  3DNG A;  1O0Q A;  1ZP5 A;  4J4M A;  1KUH A;  3AYK A;  1CGF A;  1I76 A;  1XFU A;  3O64 A;  1GO7 P;  3ZVS A;  4L63 A;  1J7N A;  3KEK A;  2USN A;  1D5J A;  2PJT A;  2E2D A;  5D1T A;  1WNI A;  1KUF A;  3HB2 P;  2DDY A;  2OVX A;  1PWQ A;  5B5P A;  2WOA A;  4H1Q A;  1JKY A;  2W15 A;  1XFX A;  3LKA A;  1R1I A;  1SAT A;  3O2X A;  2D1N A;  2D1O A;  1CIZ A;  1JIW P;  3HBU P;  1D8M A;  3V96 B;  1XFV A;  1EB6 A;  1KAP P;  4PKR A;  1BUD A;  1AYK A;  2XS3 A;  3B8Z A;  1R55 A;  1Z3J A;  3F18 A;  3VTG A;  4IUW A;  3B2Z A;  4I03 A;  1BQQ M;  1KUK A;  4PKS A;  1OM6 A;  4L7A A;  2JT6 A;  3LJT A;  2JIH A;  1CAQ A;  3I7I A;  4PKW A;  1C7K A;  4FXY P;  4H2E A;  3DSL A;  3EWJ A;  2DDF A;  3KEC A;  4WK7 A;  2X3B A;  1PWU A;  4FXQ A;  5BOY A;  3TT4 A;  3TVC A;  1IAE A;  4AUO A;  3EHX A;  2A8H A;  2K2G A;  5I3M A;  1OM7 A;  3LIR A;  3HY7 A;  4PKU A;  2MZI A;  3P1V A;  3KMC A;  1G4K A;  1G12 A;  3DTE A;  3OHO A;  3F15 A;  1JJ9 A;  1MMB A;  1JK3 A;  1DMT A;  2XS4 A;  1YOU A;  2DW0 A;  1D8F A;  3ELM A;  2OW0 A;  2MLS A;  3MA2 A;  4GR8 A;  3HYG A;  3UVC A;  1OS9 A;  5BPA A;  3WV3 A;  1AKL A;  1XUD A;  3EHY A;  1SRP A;  1UTZ A;  2OXW A;  2W12 A;  1GE5 A;  2MLR A;  1CQR A;  1Q3A A;  1RM8 A;  2AIG P;  2CLT A;  2O36 A;  4H82 A;  1GKC A;  1ZXC A;  2TCL A;  1YQY A;  1BKC I;  1BM6 A;  5I43 A;  3RTS A;  3L0T A;  3LMC A;  1K7I A;  2X3C A;  3F19 A;  1IAA A;  4HMA A;  1A86 A;  1JAQ A;  2V4B A;  4PKT A;  1MNC A;  2KRJ A;  2POJ A;  4PKV A;  1JAN A;  2Y6C A;  1BKC E;  3DL1 A;  3EDH A;  3HDB A;  4R3V A;  3SHI A;  1S4B P;  5L7F A;  3G5C A;  2DW2 A;  1B8Y A;  1BQO A;  3KHI A;  1D7X A;  4H76 A;  5H8X A;  3WV2 A;  3ZXH A;  3B92 A;  4GWM A;  1KUG A;  1QIB A;  3LJZ A;  3LK8 A;  1HY7 A;  1AST A;  5D2B A;  2Y6D A;  5D1U A;  1QJI A;  4XBH A;  1Y0V A;  830C A;  4FVL A;  2YIG A;  3LQ0 A;  4DPE A;  2QPJ A;  4QKZ A;  1QUA A;  1JAO A;  1USN A;  2DW1 A;  1CK7 A;  1IAD A;  5I0L A;  2OY4 A;  3LE9 A;  2YB9 A;  1SLN A;  3CKI A;  3Q2G A;  1HOV A;  1BKC A;  1GO8 P;  1K7Q A;  2RJP A;  4ZR5 A;  1HTD A;  4GQL A;  3K7N A;  2L0R A;  4WKE A;  2RJQ A;  4WKI A;  2JSD A;  4WZV A;  4G0D A;  1UMT A;  3DWB A;  1XUC A;  2OW2 A;  1ND1 A;  1IAC A;  3LGP A;  2X3A A;  3DTI A;  2W0D A;  2AYK A;  2OZR A;  1FLS A;  1JAP A;  1XFW A;  4JP4 A;  5CXA A;  1G9K A;  3L0V A;  1I1I P;  4PKQ A;  4IJO A;  1O0T A;  3F1A A;  3Q2H A;  3HDA P;  1PWW A;  1EAK A;  1QJJ A;  1XFY A;  2OW9 A;  3USN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...