5CZVA

Crystal structure of notch3 nrr in complex with 20350 fab
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
243
structure length
225
Chain Sequence
b'ACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurogenic locus notch homolog protein 3
publication title Characterization of activating mutations of NOTCH3 in T-cell acute lymphoblastic leukemia and anti-leukemic activity of NOTCH3 inhibitory antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 61
structure length 225
sequence length 243
ec nomenclature
pdb deposition date 2015-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5czvA02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5czvA01
3L95X 5CZXA 4ZLPA 5CZVA 2OO4A 3ETOA
chains in the Genus database with same CATH superfamily
4NL5A 3A8JA 4R8UB 5FLXU 2ALYB 4J90A 4QR1A 1X9SA 4X64J 2MLXA 5H9UA 2OMLA 1H7XA 1SBRA 4DOZA 3Q8VA 2RUGA 3H25A 3OT9A 4B3MC 2D1RA 2EKNA 4UY85 2Z0GA 2Z51A 5IC6B 2EK1A 4ZJZA 2EBEA 1R0AB 2CXEA 1HYSB 4DZDA 4ECVA 4DV0J 5I3UA 2VG7B 5GMKa 1HMVA 2QJ3A 1LXNA 4ZVHA 4BWJA 3M2UA 1RAEB 2WHOA 5AJ3F 1WDTA 1X0FA 4KRWA 1NJZA 3RAQA 3JAMY 3G9CA 2KO1A 2AT1B 1MD9A 3CQ2A 1D3WA 4K0KJ 2C3OA 3LAXA 3R9LA 2K2PA 5KG1A 5KFSA 1CG2A 1LEOA 1VS3A 1AZSA 4B3TJ 4RJVA 2JZ5A 4DU8A 3RB0A 4WE1B 3VZIA 2F5GA 2VU5A 2ZWOA 3UN2A 1NK8A 2DTJA 4JI2C 1WD6A 2R2UA 4GKJC 4I2PA 1ZM9A 4H4KA 3K8VA 4ED7A 3P8BB 1R89A 3J7ZT 2XMWA 2IBOA 1NEEA 3EERA 4ECQA 4R25A 1PG3A 4NCBA 5KFAA 3MM8B 2VFTA 2A1BA 2VJVA 1VQOS 2HGLA 3I4HX 1S0NA 1FNXH 4GC7A 4YB7A 5L39A 2J6TA 2VD3A 1IM6A 3T3FA 3UQSA 2CJ9A 2VF3A 2XM3A 3GJRB 3C2PA 4RU9A 4ZP8A 3LP0A 3NGUA 3S6EA 1H2TZ 3KLFA 3CCUS 2JC0A 3JSMA 2HIYA 2GJIA 3B7WA 3JQKA 3HHNB 2YKMA 1VRQC 1U6ZA 2XMUA 4EO6A 2ZE2A 4RW9A 1HWKA 1Q81T 4X4SA 1QAXA 3TYTA 2ZUAA 2KYZA 2V2KA 2RQKA 3GIKA 5C2GA 4ED8A 5KT4A 3VAHA 2V9KA 4B3RF 3S8SA 3FC9A 2VQFJ 5LMUF 3O8WA 3IBCB 2VL1A 4ELTA 1IJEB 5JVHQ 2AW0A 2C28A 2I1RA 1ZPVA 5DDPC 3C6UA 4R0EA 1UKUA 4MFBA 1VQSA 4K4SA 5I3UB 1HMVB 1VCTA 2D3ZA 3M2UB 1WC1A 2VQEF 2CPJA 2BOAA 5DGAA 2P2FA 1TKTA 4CO0A 2NCLA 2NR0A 3ETMA 4HACA 2JLEA 5AXKA 1JB0C 3DYAA 2ILYA 2OSRA 1XQIA 1YDLA 2PFFB 4O0NA 1ZAWA 1R0BG 1B7FA 5CZXA 2BABA 4IR9A 1AZSB 2C3MA 3AB4B 1NAQA 2F8MA 3UI3A 3GMGA 3V6HA 1KOHA 3UNYA 4KYZA 1FKOA 4P2MA 1TKDA 1S4FA 3SIPB 4HR2A 2AX1A 4OYOA 1X5PA 1UWDA 4JI0C 4I2PB 3CDUA 1JLGA 5AJ3J 3VTIA 4WYWA 3I6PA 3CJ4A 1WF1A 3MCMA 2RDJA 1DBDA 1BXNA 1XJWB 1U2RA 2DNZA 5ETKA 2RQMA 4GO7X 2UZAA 2Z8QA 4WFAQ 3NKYA 1S6PA 4HLBA 4M5GA 2UXDC 5DV9A 4JI6F 4MIWA 2DR9A 4LF2A 3LP0B 3MAHA 1B3TA 4DFJA 3I4PA 4MT1A 3KLFB 4NDNA 3JSMB 1VI7A 2KHCA 4NXMJ 2MZRA 2YKMB 3D6HB 1XK8A 3PBKA 2XC9A 4J9KA 4IQMA 2ZE2B 3OD2A 4YP3A 4RW9B 2BW7A 1KVKA 3PG9A 5GTDA 1EHWA 3KTQA 3DN9A 4C2MA 3GFYA 5KG7A 3ZZZA 2ZH4A 2HZCA 1T5DX 1F5CA 5KAKA 1EARA 4I6AA 4JI3F 2M0GB 3CC7S 1YZ6A 2J76E 1CS4A 3VGVA 2VJUA 1NK9A 2GA7A 2PT7G 5J1PA 1FEEA 5HMXA 2OBVA 3ZFVA 2HSEB 4F4KA 3C6UB 1OYDA 4MFBB 2JNVA 1UKKA 2E5HA 4NMLA 1NB2A 1IKXA 4OZ0A 5K5MA 1TKTB 1W2BR 4HACB 3DYAB 3A8IA 3EVMA 4B3RJ 2HZAA 1KVIA 5LMUJ 5D0HA 4QOTA 5F9LA 1WWHA 1E6VA 1U1NA 4CLZA 3QMQA 5HBMA 4ZN1A 1GPMA 3J81D 2F9JA 2IVYA 5BSMA 5A2QD 3A3PB 2HFZA 2LCWA 1FKOB 1K1QA 4PEOA 5MAOA 1KHWA 1RADB 3UDVA 5AXLA 5BR8F 1WC0A 2L9NA 2VQEJ 3M30A 1JLGB 2MZTA 3PKYA 2IAJA 5KFEA 2JLGA 4I4BA 1YI2S 2ACMA 2VICA 3AHPA 3HF5A 2RU3A 2QFJA 2VIHA 5J2PA 1U4BA 2CDRB 1ZAXA 3FZBA 1RAAB 2B6AA 2Q6CA 3ZZRA 1S6PB 4NLDA 1YHQS 1RTDA 4GVBA 3OUYA 4OJ3A 4Y2AA 3H0PA 2FY1A 2HURA 1LWFA 1SIWB 3LUSA 2DHXA 4FYYB 4MH4A 1RG9A 1X5OA 4CI0B 4RNMA 5B0AA 4JV5F 2Q43A 5IC4B 3ISZA 4DV2F 1YWXA 4CTAA 4X4TA 1VQ6S 2ROPA 2H1YA 4LSZB 1AT1B 1EQMA 4WJBA 1S1TA 1NRKA 2W2NP 5LT5A 1U1RA 1HWIA 3QIPA 4OX9J 2GQQA 5CYMA 2Y3YA 2EFPA 3BH7B 5DZ6A 2V4RA 2BQ3A 3F56A 3A4IA 4PXBA 4F2RA 4DR4J 3I07A 4JI4F 2VBZA 2HWTA 3GJTB 2IMOA 2QMWA 2PIIA 3C6TA 4DL6A 3BGUA 3IA0A 2G9OA 3DXSX 1EKRA 1N8RT 1C0UA 1TELA 2E5IA 4KBIA 1CS4B 1FNMA 2AV5A 2HFNA 4ALZA 1NSAA 3CUNA 2YVSA 2LU1A 2GMJA 5IT9D 3DRRA 1VQ4S 3EPGA 4IOCQ 2DKOB 4UF4A 1PGZA 4DL7A 1LV5A 2OHDA 3TAMA 2A6OA 1IKXB 3QFWA 4Z37A 2R2SA 1MN7A 1OIAA 1S72S 2YPZA 3RR7A 2PMHA 4RWWA 2W4PA 4ED5A 3K5LA 2XMVA 5DQGA 1BUXA 1E6VB 4A8YA 3QT8A 1TFWA 1IQTA 4DG1A 4DG8A 5HBMB 4CLSA 1UVNA 5H9EK 3JQMA 2FLLA 4J9VA 2F1FA 2P2CB 2LMIA 2HS3A 2VBWA 3PJWA 4LSLA 1VR6A 3N6LA 5KFLA 1QSSA 3M30B 1KFDA 4YHHF 2IAJB 2ATWA 1D0EA 5BYSA 2P20A 4ZVFA 4HT5A 5J2PB 2X3DA 3SCIE 2HHQA 2B6AB 4RLEA 4DUYF 4NLXA 1U45A 2X7IA 2FTRA 1F3VA 1RTDB 3BBBA 4GVBB 1M1HA 2ZKUA 3OUYB 4Y2IA 2JOQA 3X1LB 3CDAA 5SZTA 1LWFB 2CPZA 4PUOA 2UUCC 3HD2A 4F02A 2EGTA 5BR8J 1TMJA 4ZIWA 4BLGA 5D4NA 4CTAB 1P1TA 2MKSA 3QAUA 1S1TB 2UVUA 1FNOA 1F9FA 3QIPB 4C98A 3P5BP 5E41A 5IQQA 3DCAA 4C0BA 5CYMB 2W9BA 3H2UB 3I55S 3SZ2A 1L3UA 3CJSA 4TNOA 4OX7A 2GW8A 1CQNA 4IG3A 2NXCA 1UJ4A 4JV5J 2GZOA 4M8LA 4JYAF 3C6TB 2ZJRQ 4DV2J 3H5UA 2FHMA 3TP2A 4L3KA 1C0UB 2OMOA 3OJSA 2VOOA 1MXAA 5KG6A 2UUAF 1BQXA 3DRRB 4Q43A 4DSIA 1DARA 3GFXA 2EFVA 2QLWA 2K7JA 4ZP9A 1FKPA 2GFFA 4PZVA 1VRUA 2MY7A 3TAMB 3LANA 1HHTP 2M5OA 2X1GA 4JI4J 2JVRA 2XCPA 4KHRA 3GCXP 1HNZF 4UOHA 5IV4A 4OJHA 4C8YA 2FLOA 2W4DA 3G87A 3TR5A 2DHMA 4DG1B 4P2SA 5D0RA 1AXQA 1P4EA 2XY5A 3NP5A 3NEKA 4G1IA 3TZZA 2CVEA 3K89A 4LSLB 2E9RX 2YTCA 1FRMA 1RDRA 4U95A 3UZ0A 1S0MA 1N5VA 2VBXA 5LOQA 3TJ8A 1W2IA 1VLOA 4NPOA 5AXMA 2VV5A 3H40A 1WEZA 3R2DJ 1XMQC 2DCLA 3IAM9 2YWFA 6AT1B 2DYAA 5BJRA 3GIJA 4F0KA 2YWWA 2CFXA 2H9ZA 5KOWA 4FYDA 2P2JA 4PUGA 4PUOB 4AXIA 3RG2A 2E5LC 4WYLA 4OHWA 2M4MA 4YHHJ 4LF4C 2W01A 1ZB9A 4X4NA 5DDQC 2ACYA 4ED2A 1S57A 2FC9A 3EM1A 4DUYJ 4ANEA 4FF2A 1IQZA 2W9BB 3V6KA 1U24A 3IRWP 1Q0NA 1ZM3A 1SXLA 4X4OA 2XGPA 2G13A 1FVSA 3I9ZA 3VF0B 2WB4A 4DS4A 4IG3B 4WWSA 3W9IA 1WC6A 2YKAA 4OI0A 2HAFA 5LSOA 2XS5A 4KPYA 5EGYA 3E8OA 2NXEA 3V4IA 3CT9A 4YMEA 2AX0A 2W2MP 1R8CA 1TP7A 4Y65A 4LF1A 3VAFA 2ZOFA 3CEDA 5CD4H 5BURA 2BR0A 3PY8A 1FKPB 2GAHC 1VRUB 4PXCA 1X4EA 2Y1RI 3JS9A 1XR7A 4W4MA 1FWLA 4XK8C 4PWUA 4A48A 3LGMA 3DI6A 3D1OA 4JYAJ 2HWIA 1OPZA 2BKOA 1EZZB 3TZYA 2YWHA 1E6YA 2R4FA 4MIAA 2V68A 2UUAJ 3W9HA 4WXWA 2CQHA 1DQ9A 3CGIA 1V6HA 5HMYA 1ELOA 3O44A 3KG0A 4JI7J 1EGAA 2ZM6F 1IJFB 2PMWA 1HNZJ 2HS0A 1DY3A 2IY5B 1FESA 4HPVA 2DH9A 4GVLA 3WBZA 1OJ4A 4B3TC 3CTRA 3T9ZA 2DR5A 1GAOA 4IRKA 3EE3A 4JP8A 4LF8F 4A8OA 1LOUA 3A25A 1JLBA 2IM2A 4F2SA 4ECRA 5KTQA 1SV5A 3DHVA 2V5HG 4DR2F 3IR6B 2CQ1A 5IZHA 2P5VA 4RNNA 4QPXA 4PCQA 3T5JA 4DR6F 2MQLA 3VAIA 4M5HA 3B4MA 4UQTA 2YX4A 4NCAA 3QZ7A 2PEHA 2XCAA 2Y1IA 3VGUA 1F9HA 1LK5A 5ADZA 2YPYA 4TN2A 3HT3A 2WVCA 1FKAF 2AEMA 1QTNB 4DX5A 4FVCA 5C7PA 1LWEA 1NPRA 5KFHA 2XI3A 4RW8A 3CW8X 3FSYA 5D78A 4IR1A 3HVWA 4K2XA 2FC8A 4RM2A 2HQDA 2D74B 3Q2TC 2QMXA 2N7CA 1OPIA 3V4IB 3CJ2A 4QIVA 1HR0F 3ZZ0A 4P7TA 1IB8A 4DFPA 4OYZA 2MTLA 1GQEA 2D41A 2VPWB 2YKNA 3FBFA 1U8SA 2ZDPA 2B9YA 3BDPA 4YY3C 2CQIA 3OQ2A 4I6WA 3FBEA 1S1VA 2V2ZA 1WELA 3W5ZA 1JLFA 3DI6B 2GQCA 4ZVTB 3W5YA 4NLWA 3CMQA 1RLDA 1NHKL 2E9TA 1E6YB 3PHEA 5GAEI 4ZS6A 3HJFA 3MAQA 1UVJA 2DR8A 4G37A 3GIRA 2DH7A 4NXNF 2Q6BA 2FZKB 4URSA 3QIDA 2FVQA 3PX0A 2V6AA 2ZH8A 3AF5A 1LQ9A 3HHKA 3Q8RB 2HNYA 1MXCA 1HI1A 2P02A 4DV7F 3CCES 2CQDA 1U1LA 2PDAA 4L3NA 1ZM4A 2DNPA 4L2ZA 3BEGB 5K8PA 3MEEA 3VAKA 3CDWA 4G1QA 1TMMA 5KYTA 3OW2R 1BC6A 2R7UA 3I0SA 1LW2A 1KD1T 2OIHA 1WHVA 4USVA 3NCRA 2VC0A 3T1HF 1JLBB 5CABA 1SJ4P 1NLKL 1SV5B 1UVKA 2J6UA 1NPPA 5D4LA 4PWWA 4A4JA 2ZM6J 3K5MA 1QVFR 1WOSA 2W2PP 4QYZK 3TEHB 1MMLA 4RM3A 1ZZFA 4YS2A 4R5PA 1RCOB 3VNRA 1X4GA 3OJUA 1H98A 2CPXA 2KZMA 1RAFB 2ZH7A 2VDIA 3FEZA 5KG4A 4H4OA 5KFUA 1O9TA 2ZH3A 2XHWA 2BJ3A 4LF8J 1MU2A 4HHJA 2HLTA 2IJFA 4DUTA 4FTFA 1JJHA 2AZ1A 3C66A 3VNSA 3GJQB 2H4YB 1NDPA 3ONQA 1LWEB 2VHGA 4RW8B 3MCOA 4X4UA 2Q66A 5D0GA 8ATCB 2VSQA 4DR2J 3EGZA 4NXMC 1S99A 2L08A 3EDRB 4J9NA 3OTOF 4G3IA 1RB0A 2B4VA 2RUSA 4ZPTR 4DR6J 3BH6B 5ETNA 2HHUA 1HD1A 1YZ7A 4ZVOB 4OI4A 2YKNB 3CWJA 1U09A 5K85A 2ZH9A 3P3DA 3D1QA 5E2QA 3UFCX 3C16A 5ETOA 3PIOQ 3C3LA 5I4MA 1TQLA 2BM1A 3UN5A 3MEGA 3HVAA 1ULRA 2R7VA 1S1VB 1NBEB 1U8WA 3VQTA 4H54A 4JI8F 2CYYA 1JLFB 3MMAA 2YNFA 3MM5A 1BA3A 4ZOSA 2V2QA 5I42A 2B7CB 1Q82T 2V9WA 1CULA 3LALA 3BV8A 4CP5A 4QIGA 3D0HE 4C11B 4DSJA 3OTBA 2L9DA 4F3MA 4K7QA 2HNYB 4IH7A 4B3RC 1JJCB 4X4QA 2OPLA 1NKEA 4A46A 4B3SF 1N34C 3THVA 4LIWA 3IBWA 2E8EA 1ITPA 3MEEB 3NGKA 4LBPA 1RT7A 4G1QB 3LAMA 2O5DA 2WB1D 1F5BA 3I0SB 1LW2B 3THPA 2YQ0A 4WFNQ 3CO0P 2VZEA 1TH5A 3FBCA 2CUYA 4J7CA 2LEAA 4CIOA 5A1GA 2BJ7A 3EGVA 3FUYA 4HYKA 4RW4A 4DV7J 1CBKA 1X9WA 2ZOMA 3ISND 4R5PB 3V5RA 2ASBA 3HT0A 2C2EA 2ZH1A 1RAHB 3OL9A 1K47A 2CPIA 2YX7A 4WZQA 1PJ6A 4H4OB 4C3KA 5IS2A 3Q89A 4ECZA 3D9BA 1MU2B 4MH8A 5BXIA 2V50A 1JXEA 3U1MA 1FVQA 3T1HJ 4XX2A 4Q2LA 3DFEA 1XR5A 4ZP7A 5EWGA 2C22A 4USTA 2VFSA 3G71S 2RE1A 2M7SA 4OX9C 3CCTA 4KJIA 1NNDA 2NQPA 2LXUA 1VIXA 1KKGA 5G0RA 4ZPAA 5EDWA 1OS5A 2RU9A 3G6ES 4DR4C 3C16B 2HVZA 4HT7A 3OFEA 4ZLNA 3MEGB 3TZXA 2XMJA 2GJFA 5HVHA 1KOOA 1Y4ZB 1ROFA 3SDEA 5HANA 3NLCA 1VDHA 3MMAB 2E7WA 2YNFB 3OTOJ 3MM5B 1WC5A 3PTWA 4DR5F 3R7NB 1NKCA 5I42B 3RR8A 3NOCA 1FDDA 2CNNB 1I5OB 2YNHA 2BE2A 2VG6A 3DLJA 1CULB 2JL9A 5BYQA 2XULA 5KFGA 3DRXA 1MDBA 4CRJA 2ROEA 1LK7A 3DAYA 3UDEA 1B99A 1I94C 4RVNA 4HVZA 6FDRA 2Y0BB 3ZNUA 5IM0A 3MPWA 1HNWF 2E5JA 3L8CA 2F3JA 4JI8J 3QQCD 2OPLB 2QMUB 3C14A 2LP4A 4DLEA 2AZ3A 1XR6A 1ZA1B 1RT7B 1IR1A 2C2MB 1TAUA 3QT5A 4A8KA 2EKYA 1NK4A 2RIJA 1I6JA 1X4DA 1KNZA 3EXCX 2GGPA 5E3RA 2HVIA 3GPCA 1VQKS 2W9CA 2ZBCA 1ZM2A 1GFWB 4AQYC 3VNQA 1VQNS 3C15A 3EMTA 4RW4B 1MROA 2GJ2A 3B8HA 2QLXA 1RT6A 1PYTA 4B3SJ 3OBIA 9RUBA 1JLAA 1NO8A 3D68A 2E1PA 2DT9A 3IFEA 1KDNA 3TO8A 5CYJA 4YR3A 2KT2A 3SO4A 3GV8B 3DLHA 1FDBA 2DPIA 2ONFA 5BR8C 2A3JA 2YWKA 3WQPA 2OELA 2KN4A 1GMWD 5LSLA 4URQU 2FVPA 4DN9A 5HQLA 2MKHA 3SYZA 3D66A 3GYNA 4UOCA 2HK2A 4WK1A 2JFDA 3MM7A 1XNRC 4NX9A 2D27A 1WDDA 3W60A 4IH6A 5G0RB 4ZJOA 2EFOA 3CQ3A 1Y5NB 2F8HA 2PN2A 3OVBA 3VVUA 1NMEB 1XNQF 3RW7A 1IN0A 3KLVA 4B3OA 1XMOC 2HQIA 1PIEA 4PWDA 1T9UA 1F3FA 4HI1A 3SDEB 3PNIA 4ZVQB 2C2DA 3UDCA 1JKHA 3H98A 2XZTB 4ATNA 3IGVA 3HHLD 1W26A 2FJAB 1D9FA 2D69A 2YNHB 2BE2B 2VG6B 1KP6A 2D7VA 3IAS9 1TK5A 2MEWA 4DL3A 3NL0A 1JLEA 2CNKB 3I32A 1PBAA 3T6JA 2R8GA 2JFKA 3BGRA 2B5JA 3AODA 3KNGA 1UAWA 3MAAA 1H2VZ 5IM0B 4I56A 1DURA 5L1LA 3N9UC 3C14B 2MJNA 3W2WA 1QY7A 1WHWA 5DGBA 1UTAA 4DR5J 2OI2A 3VAGA 4KGXB 5CCLA 3US5A 1O6XA 3KG1A 1REVA 3H7HB 2BE7D 1QAYA 3AQPA 4PPDA 5E3QA 5G4DA 4DCOB 2GGPB 2RVJA 3PEHA 2UXCJ 4NLPA 4ED3A 1M5PC 2W9CB 3MPUB 2GNKA 4Q5VA 4LF7F 3AY0A 4LF6F 3PV8A 2JVOA 2LQBA 3C15B 1GMWA 3FRZA 1MROB 3DDKA 4NCGA 1V3RA 2V94A 4B9VA 2F4FA 4CYUA 3M9OB 1N5SA 4EK2A 1JLAB 1RA7A 4M95A 1UVIA 1MWZA 2M88A 4OV6A 3MHYA 2CJXB 3LQVA 2CJAA 4A8MP 2ZNYA 4FXDA 3FSXA 3QJPA 3B78A 3AJDA 2GCFA 2OSQA 3QGIA 3ZZTA 2MY8A 1RCXB 1UL3A 1Y3JA 2BKNA 4WIQA 3OLAA 1KKHA 3BBCA 4Y2KA 1O93A 1UA1A 3MM7B 1S9GA 1NCLA 4F25A 1ULTA 3CJKA 1YVFA 4WPAA 3WDOA 2KZFA 3M9MB 5HL7Q 3FKBA 4PROC 2MZSA 3T9NA 1X60A 3QAEA 1LCIA 4B3OB 2NUUG 4PWDB 4JB8B 4DDFA 5KFKA 2I6WA 1JKHB 4M5LA 3R7BB 3GG1A 3WIVA 1IBKJ 3FDSA 2DXEA 3LOUA 4A8FA 2DNLA 5DDOC 4NI2A 3PCOB 3CJ0A 5K20B 4GMKA 4L4QA 3RBDA 1J5OA 1JLEB 4DSEA 3RRGA 1RWUA 1IR2A 4FUQA 3BGRB 2B5JB 2RJZA 4DR1F 2ZNZA 1XNQJ 4I68A 2KH9A 3P49B 3G8TA 3MAAB 4ZLLA 3QGPA 1VC5A 4ZP6A 2H4WB 1SH3A 5KT5A 2DNGA 2DRBA 3W2WB 1RGVA 1FWPA 2UUAC 1VMBA 3BSCA 2FZGB 2ZC4A 1SL0A 1M0SA 4R1MA 4I1TA 2HHSA 3CB4A 5HMZA 1REVB 4TQRA 4OLOA 2KDNA 5GAGU 2EW9A 4NLYA 1SC3B 2FZCB 2HRYA 2XO7A 4JI7C 5HP1A 2POKA 3A4TA 2DB1A 1I51B 1HNZC 2CA9A 2NZCA 4IRDA 2JJ4D 4NCGB 2DRDA 4P52A 2LEPA 4CYUB 3R5GA 2HMIA 3TJAA 3ENQA 2XHCA 3R3TA 2V4JA 4PG6A 2MLZA 4RPFA 5B0CA 1U2FA 1RHUB 2XMMA 2LDIA 3KNAA 3JAMU 4AYBD 1P7LA 5CD4A 4F36A 1N33J 3NWRA 4OI6A 4LF7J 2YKOA 3PROC 3M4XA 2Z2ZA 1S9GB 1V5VA 2GX8A 3CC4S 1U6FA 3CJKB 3G6YA 3GQCA 3IR5B 3F0NA 3HHLB 3P45B 2F4VF 2RHQB 3CE8A 4Q0BA 3AOBA 1IVZA 2KZ0A 2HEKA 1HW9A 3MR2A 2UU9C 1N56A 2HHVA 3DRPA 2R7WA 2DVIA 1IKYA 3M32A 1R0CB 3P96A 4Z2XA 3DM2A 2HBYB 3OV7A 1TAQA 4DCSA 1A7GE 4NASA 4C8LA 4CQ1A 2XSFA 2WSEC 5U47A 1TL3A 4NI2B 2RDIA 2W1BA 1J5OB 4BDPA 1N32C 2V8GA 3OFGA 2V8HA 4ILMA 2COLA 3KMQA 4ELVA 3PR4A 3U02A 2GO8A 5HATA 1UCNA 3DHWC 4ANCA 3CDEA 1RTJA 4AD6A 3RYLA 3KJVA 2N3OA 4IR7A 1M5SA 4F4ZA 2ZZTA 1XC9A 3ZZPA 2IYIA 1CQMA 4HDHA 5LSRA 4K59A 2O66A 5L9NA 5GAGI 3LWMA 2UVWA 4G1PA 4Y28C 4LFAF 1M90T 5HP1B 3HX9A 4DR1J 3I82A 1IBLC 3J80U 3LAKA 2YX1A 1VBXA 1Q16B 2KJWA 3KHHA 4NLVA 1VOMA 2CADA 2FGOA 4YN3B 3SXLA 3CQ1A 1FX4A 1DLOA 2D9OA 1I3OB 3ZO7A 5DJBA 3CO9A 2DIVA 1OYEA 4ITSA 3BGFA 4OZ1A 4RWXA 1H3DA 1VHIA 2HMIB 3WC2A 1CLFA 4CO5A 2V4JB 2EC2A 1UWAA 2KI2A 1FA0A 1L3SA 2WVBA 3C19A 1T95A 1S5ZA 2DBBA 2KU7A 4LREA 5LMNF 2E7VA 3BKUA 3GTYX 4DV6C 1SKSA 4L74A 1S6OA 1U6BA 3PJXA 4CLYA 2QLBB 4WU3A 4DV5J 2Z56B 2ASLA 5KFZA 3VVTA 2A10A 1M5HA 5KFQA 2UVVA 3X3UA 4EATA 4KB7A 2IRYA 4ZJLA 4KQZA 2B9WA 2M8HA 2QZ8A 4NEYA 2M9KA 4I6YA 4PQUA 1Q4RA 4W92B 4LF8C 2HLUA 1F5AA 3Q0AA 3KOAA 2HG4A 1BQNA 4WK3A 3KLIA 4Q0BB 3BR9A 2HVHA 1VGYA 2ZZNA 3DRPB 1IKYB 3M32B 2R7XA 2PMZD 4DV4F 2LQ9A 3DM2B 2OEKA 5F0UA 2AYEA 2CNLB 4PG8A 3HFKA 5KFRA 4O3PA 4DI6A 2UUBF 2OPQA 4R0JA 2V63A 1TL3B 2DD8S 3OL7A 3K0JA 4OYIA 4I7FA 1F9EB 4DUZF 4D3GA 3IR7B 2DGVA 2F4VJ 2WSFC 4LFCC 4CH7A 3J81Y 3HZEA 5A2QY 4Z7YA 4HKQA 1RTJB 3W65A 4OYMA 5I3PA 5F8MA 3NS6A 3G4SS 1SJ1A 3KJVB 2XMTA 1WHYA 1WTBA 3ENWA 4Q8FA 4HH0A 4EEYA 5L9XA 4CDIA 2UUWA 1IBMF 3ILJA 5F8HA 2M70A 2JEIA 3D0GE 3FGVA 3L7PA 5SUHA 4FN5A 5AT1B 1DLOB 3KDOA 3QATA 1TU0B 4UQGA 1M6XC 3FQKA 2HHXA 1RBLA 4DV3C 4NA1A 2C3UA 3CULA 2IRXA 1DTTA 1K8AT 4ID5A 3DRYA 2QVXX 2E5GA 3MMBA 3M2RA 1HQ2A 1O0PA 1FFSB 2HRTA 2Z2LA 5KFPA 3QRRA 5EN1A 1RAIB 1PYOB 4WV3A 3R6LB 2QA2A 2F63A 4CNYA 3HFVA 4P6QA 3CPWR 4LFBC 3NS7B 4QWCA 1GH8A 2ASJA 3UE2A 2B4UA 2VODA 5KFNA 4ISBA 3Q83A 2DXFA 2C3PA 3M8PA 1GEHA 2H54B 3LNVA 2B9XA 4Q7AA 1FXRA 4P72A 2JNJA 4KHPF 2GHWA 3PW2A 4L76A 1YTYA 1AW0A 3EXYA 4YB1P 4XPCA 1CJUA 4TPSB 3OFHA 3OVSA 3PFOA 2EK6A 4PQUB 1NZAA 1YKWA 1BQNB 3QWPA 3KLIB 5LMNJ 3TUIC 3EPIA 2XZDB 2ZJPQ 3NOGA 2PGCA 1WI8A 1Y0HA 1B0PA 4YOEA 1NB7A 5B08A 3HJVA 2Y1LB 4QW9A 2JX2A 1T9YA 1YLXA 4RU2A 2ZH6A 3H2LA 4X62F 1GNKA 4DL4A 1SQGA 1LNQA 1RABB 2HBZB 2OPQB 1GMUA 4UUWA 4DN0A 4DQIA 4I7FB 4IDKA 4BHQA 3UR0A 1HPZA 1MWQA 2B8PA 1K0VA 2KL8A 1RZMA 2QE5A 1YK9A 3ZTOA 4ZCKA 4KGZB 2IM1A 5DG8A 3S1TA 3JTPA 3IC1A 3PYDA 3TVYA 4M5DA 4ECTA 3VGSA 2UXBF 1J27A 1R3NA 4JI1F 2IMWP 4B3MF 4ZPCA 1AFIA 3SFGA 1AUSL 3GP9A 1TUVA 4FVMA 3IO1A 4G65A 2UUBJ 2HQCA 1RLCL 5KFYA 5KG0A 4WF9Q 3H5YA 4WP9A 4DUZJ 2E44A 2KFZA 3FEXB 4B17A 2H5IB 2FJBB 2WVEA 3G82A 5GMEA 5D15A 1VC6A 2YWEA 1N54B 5A8WA 4RUHA 1KVJA 2BJ9A 2VH7A 1NHUA 3PW4A 4C0HA 3QNWB 1X4HA 5T8TA 2YNIA 1MWYA 1KEKA 3UD3P 1Q79A 3GR1A 4XTTA 1DTTB 3VHQA 4ID5B 3HO1A 3MMBB 1EX8A 3M2RB 3IPLA 4MTPA 3R5BA 2JEFA 1EKSA 1FEHA 4JI2F 4GKJF 1IBMJ 2J9CA 3HLUA 4WU2A 3OL8A 2LLZA 3CJ8A 1URRA 3VCDA 1TKXA 4GKKC 3ULHA 3GIMA 4ZHRA 4N8NA 3FZ2A 1R8PA 3M8PB 4B3SC 1S1XA 1UWBA 3G96A 3IEUA 1BHNA 2HYIB 5H9FK 1CJUB 3H90A 5LJ5Y 3PO4A 1NHVA 4D56A 2ZEJA 4RO0A 3CJTA 2LKZA 2Y9HA 3BYRA 1VLAA 2H3EB 2NXUA 4Q44A 2C1EB 4KH0B 2QVYX 3BGLA 3RB6A 1HARA 1EJ7L 2LYVA 2MQNA 2ZUGA 4LSNA 3EUNA 1G6BA 3PDNA 2LVWA 1H38A 2JMPA 4K8RA 4JOUA 3NNAA 2AGQA 2R7RA 2R8JA 4IDKB 1R8AA 1BY9A 1HWLA 1DRZA 5F8NA 1HPZB 4FYXB 3FRYA 3SFUA 3JTNA 3CD5A 3M6UA 1QM4A 3UD5A 2Z30B 3O2EA 3BM7A 4M5DB 4DXLA 4X4VA 4FP9A 5E5NA 2W25A 2GS8A 4X62J 1M1KT 1RTHA 2R3VA 3VGTA 2AJ0A 1YITS 1QSLA 3VAJA 4CLPA 2NXJA 3R44A 4Q45A 5F8LA 1YJTA 2E0GA 4U8VA 4NZ0A 3TJ9A 2E8FA 3MXHP 3CMES 1C0TB 1HBUA 2WOMA 4DL0C 2YH1A 3G82B 3RB4A 4MTNA 3AXKA 3EICA 5A8WB 1UPPA 4DR5C 2UXBJ 3D28A 3KMSA 2DH8A 4JI1J 1NK5A 2YNIB 4B3MJ 2XNQA 3GPAA 4HH1A 3A9UA 1RYSA 1JLCA 3B54A 2E1MC 4USMA 2DGUA 4CLFA 4UOFA 2I5JA 4DSLA 2W24A 2C2KB 4PRFA 2IM0A 2UXCC 3RBEA 4CLLA 4JI0F 4C3LA 2QO3A 1R8BA 1GTEA 2E29A 1UETA 2HHTA 2CDQA 2FGCA 4U96A 3TVKA 1BGXT 2KXFA 1TKXB 5IV3A 4ZHRB 2PI5A 1YJRA 5F8JA 4J9OA 1RT4A 1S1XB 1UWBB 2ZD1A 4KHMA 1OY8A 1VQ9S 5KFBA 1UP1A 3HSDA 4K4XA 1RY2A 1QLNA 4RVOA 2DGTA 4B9TA 4M5KA 2BOPA 3NI2A 3UOWA 4FXVA 2F7VA 2ZHBA 4RW7A 1OY9A 2B43A 1VQMS 4JI2J 4GKJJ 3CXCR 3CF5Q 2F65A 3DKDA 4HHUA 4CM0A 3NWGA 1VJQA 5F3ZA 2WBRA 1RAOA 1SC6A 2V34A 3M6WA 4ES3A 4DV1J 4LR8A 2E1RA 4LF5F 4FS1A 1N4LA 3G6XA 2I2YA 4LSNB 3J80Y 4OZNA 4DCPB 2BRLA 4UW2A 5A6WA 4K4TA 1U02A 4ZIVA 2C42A 3R1HA 2G2OA 5L8RC 3ITHA 2RF2A 3D67A 2OAUA 1WHXA 3CIZA 4RBTA 2AJ2A 4XAKA 4OI2A 4F3QA 2IDEA 3BGOP 5FD1A 2AYMA 3A3NB 1FD2A 1WORA 1IBKC 1U1KA 1RTHB 3K5PA 1FHTA 1Q86T 1GK8A 1UVLA 3D54A 2MB0B 1PA4A 1FX2A 1UJ5A 1YJVA 3T41A 1XNQC 3NG8A 3CCSS 1RWPB 3PX6A 1WF0A 2CU6A 3GR0A 1HQUA 2ZBIA 1HBUB 2BBEA 4B02A 2WOMB 3J7Z5 4L75A 5IWAC 2BKPA 2FHJD 3RZAA 1TUGB 4UZBA 4NLOA 3TAPA 5FDLA 1HWUA 4DQRA 1B0TA 1JLCB 3DNCA 3I5CA 2J0XA 4RZRA 1T9XA 3HSZA 2I5JB 1VYAA 2IBKA 1ACMB 1SKUB 4TU7A 4ZCIA 1IKWA 2UP1A 2CQPA 2ASYA 5J2MA 5ETPA 2P9EA 4TU9A 2OH2A 1GX5A 3EVOA 3CW2C 4QR2A 1F1BB 1URNA 3RRHA 1WOPA 1U1PA 2AEFA 4DX8H 1QDUB 1RT4B 4C8MA 1HKAA 3CCQS 2ZD1B 3PM9A 2V0NA 3ILOA 2CZ4A 5EX0A 2LEBA 4DJBA 2QSWA 1L3VA 4LVOP 4WIIA 1U48A 4RW7B 1VEHA 3SV3A 3V6JA 1N33C 2EG1A 4QR0A 4LF7C 2HVDA 2I0XA 3GG0A 5JUMA 2UUTA 2WAQD 1UEKA 2OPRA 2E9ZA 4PXDA 2CG4A 5B0FA 2NYHA 2M2BA 1WC4A 3ITHB 2RF2B 3RW6A 2WVDA 4OJ1A 1PKUA 3PRBA 5M2PA 2MMYA 2CJQA 3H59A 2NZ4A 2MPUA 4DCTA 2MSTA 2B7BB 2JEGA 1LQLA 2FHJA 4LF5J 3D0IE 4NOHA 3KHRA 4QWDA 4OMFG 2XB2D 1K44A 5ETQA 2D1CA 2BJ8A 3F44A 2ZHOA 1EP4A 1HQUB 3HSJA 3K8WA 4HDGA 1SUQA 4IFYA 4AE5A 3R9XA 2FLPA 2Q3PA 2ASDA 4JBCA 3M8WA 1CSJA 5FDLB 3ISNC 4P9SA 4IH5A 3BQ2A 3D7SB 3NGDA 2Z57B 1NZ8A 3K59A 3OXFA 1Z2ZA 2HFUA 1IKWB 3V81A 3U1NA 3QGGA 4EYHB 5J2MB 4M5JA 2J0QD 3KG4A 5F0WA 5A1IA 1TTHB 3D4JA 1S59A 5K8MA 2OPPA 4YR2A 1A9NB 4RLFA 1S6UA 1GX6A 4F4AA 1FRXA 2EPIA 4AFFA 2MXYA 2AMCB 3GKUA 1G7CB 4FBUA 1RK8A 3LGHA 2R7QA 4PR6A 3RRKA 1P27B 1ML8A 3NYQA 1YQHA 2UUCF 4ELUA 4DQSA 5DLFA 5A19A 2JWNA 5AE1A 5J1NA 4TLRA 4B9NA 4JI6J 2PROA 2QLFB 4ZA1A 4DV5C 2E8CA 1KS2A 2XY6A 1AYEA 4O3NA 5KFTA 1U1OA 1REGX 2JC1A 2U2FA 4HHHA 5DETA 3K58A 3G86A 2XO6A 4V1Ak 3IGNA 5E3CA 2WW8A 4L73A 1C1BB 4MIBA 2DPLA 2IVMA 2OPRB 3GYGA 1ZYQA 4ERDA 3ETOA 4KTQA 2L9WA 1BQMA 4K2JA 4OL8A 1S48A 2BA9A 1PBUA 2FJWA 4O23A 4OJGA 2C2NA 1FO1A 4EBEA 2ZWPA 4DR3F 2WZ1A 5DS7A 1Q5YA 3W7BA 4U9RA 4K4WA 4NA2A 5HVGA 2RS8A 1NH8A 5DQIA 4OFZA 2VPZB 1FXLA 3QT6A 2CWXA 2VASA 4JI3J 2P9CA 3E7XA 1F0XA 2GIFA 2MQPA 3K57A 3FCWA 2F4VC 2F40A 4E0DA 4BWMA 1IR0A 1EP4B 5AE2A 5HN0A 3RTVA 3OSPA 1SUQB 4IFYB 3A8KA 4DX7A 4USHA 4WFYA 1XWLA 4C8OA 4X65F 3QYYA 3DXBA 3R27A 2WP0C 3HVTA 2PO4A 4TYAA 4NA3A 3ICLA 4K0BA 1FD8A 4Y2CA 1TK0A 4I64A 5B0BA 3R97A 4D4GA 2R7SA 4EUVA 4F8RA 1NY8A 2BM0A 2CAJA 4OHVA 3V81B 1Q5VA 1Y7PA 1LW0A 1GXTA 1RT2A 1AMUA 3UD4P 2V8DA 2YQ1A 2OPPB 4ECYA 1MMNA 2ZBPA 2YKQA 2FJEB 3TQIA 5D3GA 2G1DA 5LCIA 4N41A 3TUFA 4FYVB 3FJ2A 2BACA 2MSSA 4RKUC 4IUFA 2DHHA 1X4CA 2HPUA 4W98A 4MK7A 3Q8QB 3SQOP 3TX8A 2BMBA 4KY3A 2E5LF 2HNDA 1EQ0A 2Y8WA 2FPHX 2BYCA 4KO0A 4F67A 3GLJA 4LF4F 1JOSA 1FI4A 1R31A 2Z2MA 4C8NA 3TI0A 4ED4A 2IYGA 2AEJA 1QWIA 4HEA9 2LDYA 2K8GA 3DMJA 2ADBA 3HHLC 4OZ5A 4USJC 2FB0A 2CPDA 1BQMB 1YRTA 1T03A 2Y8YA 1DZ5A 2J5AA 2DK2A 5LMNC 4PYAA 5KG5A 5K8NA 4ZVRB 3CJ5A 1WJ9A 1RTIA 3L09A 4UOGA 2LECA 3MR7A 5D4PA 3TWZA 2QEXS 4WP8A 2C2RA 1UMJA 4C0OC 4RNHA 1XTZA 4GC6A 3EJMA 1Q8BA 2CPHA 3D2WA 4PHTA 1OO0B 2EWHA 2EBGA 1V3SA 1U47A 4RBVA 4JUZA 3B4DA 1RACB 2HQFA 2KXHA 4DR3J 4LQ3A 5L1JA 3UDLA 5GAHU 1MLAA 1FRHA 4IKAA 3PVXA 2PSZA 1F2HA 4TXSA 2D28C 1X7VA 3GB0A 3UCZP 3IWXA 2H5JB 5KFJA 2UUBC 4BS2A 3IP0A 3HVTB 3CNQP 1RTZA 2MQOA 3AQOA 1M6XA 1V60A 4DUZC 5K8FA 1JXVA 2L48A 5BSRA 5BSVA 4E8UA 4U7UD 3ETCA 3K2YA 2RHSB 2RD5C 1LW0B 1RT2B 4A8WA 1WSVA 2QA4S 4TQSA 5IT0A 5HSPA 2RILA 4LRFA 1V26A 4U7CA 1SJ3P 3TZWA 2DR6A 3UX3A 5D3GB 1HBMA 2AYAA 2D1QA 4OV1A 3DLLQ 4X65J 2BXJA 2K3KA 2ZC3A 4UT4A 4UY8T 1S1UA 3FCEA 5LM7E 4RW6A 4Y3CA 3RAXA 2HNDB 3OTCA 1NJYA 4QU6A 1DHMA 4KO0B 2R8KA 2M8DB 4I0WA 1R27B 1HWJA 1NSPA 4AT1B 3M8RA 4L7IA 3ILLA 3DMJB 1IWAA 2BE9B 5KFIA 3MF5A 4ZJQA 4CNZA 1QAIA 3RBXA 2YH0A 1T03B 4EI2A 3KLEA 4KT0C 1SIZA 3MUMP 1Q8KA 1RUSA 4OYWA 2J8SA 4DX6A 2E5LJ 1RTIB 3AA8A 1TV6A 4CO2A 2YY3A 4LF4J 4ILRA 4DBQA 2X3GA 4A8SA 1RISA 4X64C 2WCXA 3CCLS 2V69A 2P2BA 5M2RA 3NCPA 1RKIA 3NCQA 2CNOB 3TOQA 4FF1A 3BQ0A 4HTJA 4YY3F 4RX6A 4J9PA 2MKIA 4DPTA 5GAEU 2BW2A 3LGXA 2BUNA 4DV0C 5BSTA 2RT3A 3BO4A 3WHIA 3SBMA 5GAHI 2FLNA 3DLPX 3FEYB 1PJ5A 2W8LA 2MYFA 4X62C 2BVZA 1ZZNA 2G0CA 2HHHF 4K0KC 1S97A 5D4OA 4NLUA 3FCHA 2P2MA 1OY6A 1K0TA 2V8VA 1H74A 2FIUA 3M05A 4DQPA 4LF9F 2HVEA 2DGSA 2V7BA 3UW1A 2X51A 1QTMA 3O1LA 1RJJA 2R2RA 4R0MA 3DLKA 1H2UX 2K3IA 2L3MA 4BSZA 3BSNA 2H48B 2DNMA 1MMDA 2UXBC 4JI1C 3PESA 3TUJC 1HD0A 1HBMB 4GXQA 2EXUA 3PO5A 4YB6A 2I8EA 1KWMA 1S1UB 1PSDA 4RW6B 5EWEA 4OZLA 2AQ4A 3R7SB 5LXRA 4OYAA 4P71A 3W64A 2G4BA 4MKBA 2QW0X 3AB2B 3MPDA 2RQ4A 5DG9A 3MECA 2RRAA 3PR5B 3I31A 4P10A 3N01A 2LA4A 4FF4A 2XSJA 4B9UA 4YEAA 4O3OA 3DLEA 3I08A 3IM9A 2I38A 3LGNA 4C6AA 3KLEB 3K6RA 3IM8A 1OSCA 1TK8A 1NH7A 4NXMF 1TV6B 4LRBA 2A2DA 4DV1C 4Q2MA 2Y1JA 4OHYA 1YJWS 1NUEA 3OXGA 4KC5A 4E98A 2CJKA 3FFIA 2VQFC 3DOKA 3GV7B 5CXTA 2JSXA 4RNFA 2DR7A 5KFFA 5KFOA 1F6TA 4X66F 1WF3A 3L95X 4C11A 2QYGA 1JQGA 3DU6A 2XLJA 4NMXA 1L2FA 3BB5A 2DY1A 3E3XA 3HM9A 4USIA 2MMAB 1HA1A 4A8QA 3KJQB 1TR0A 1U0HA 2GMHA 4B9MA 2FQQB 3E7WA 1AB8A 4OZJA 3DLGA 2RRBA 3AJ2A 2HFVA 1D8YA 2DNKA 4J9SA 4YY3J 4WBFA 1SL2A 3A13A 4ED0A 1PO6A 4PZPA 5KOXA 1C1CA 3HMJG 2VC1A 3DLKB 4DR7F 5T8SA 3KLGA 3HVRA 1X8DA 1N34F 2G2YA 2RAQA 3WZ0A 1RP5A 4YFUA 4NLSA 5KFCA 3HCXA 2ZJQQ 2MGZA 3BKTA 3BO2A 3SI8A 1N6QA 2HHHJ 4C8ZA 2CKWA 2KT3A 4U5YD 4KTTA 3N4WA 3JSBA 3MOJB 2Y4OA 2ZITA 4YUDA 2B8QA 3D1HA 4LF9J 4NRUA 1K0RA 3J81j 1ZTWA 2J7KA 2Y0SD 4H4MA 3PKMA 2QGFB 1OSDA 4G36A 1P6TA 5HQMA 1GXLA 1X31C 3KK2A 2KHDA 3PACA 5A0YA 2FJVA 1H6KX 3SMZA 1RQ0A 2NS1B 3MECB 1IM4A 1QE1A 4LR7A 5H9EJ 2J9DA 3JTOA 2AYBA 2Y4NA 3L7OA 3LO3A 2WBMA 2XSJB 1QAJA 3H2TA 1NYEA 1HLWA 3DGVA 3CW9A 2GIRA 3DLEB 3E2EA 4LIRA 4J37A 4PAAA 3G7SA 1JJ4A 3LP1A 3CJ3A 1K1SA 2KJVA 4QWBA 1RU2A 4K5SA 4OX9F 2HHWA 5F8GA 3RBZA 1YJ7A 3P4UB 1OQ3A 3ZC4A 3FFIB 1HHSA 3DOKB 1T0TV 1UVMA 2CQGA 4ZPDA 1BMQB 1T8EA 4DR4F 2YWBA 4ED1A 1Y5LB 2NYIA 4ECXA 1HR0J 1SI9A 4CM2A 1ZB8A 2HFOA 1CC7A 2HIQA 4K5RA 1K9MT 4RR5A 3BYPA 3LH2S 2DNRA 3ZTSA 2R7OA 2AU0A 4W90B 4LF5C 1CJKA 1T9VA 1U0HB 2QA4G 1TFYA 3I9V9 2LXIA 3C5EA 3MM9A 3ET6A 5LMUC 3DLGB 4WXOA 3ZZOA 5HMWA 2BRKA 4ES1A 4JV1A 1I94F 3HHEA 2J7WA 2AGOA 3QBCA 2GHPA 5E7OB 4J9QA 1T3NA 1C1CB 2BJOA 4X66J 1N5TA 1WC3A 4P7VA 2AGPA 3KLGB 4D57A 2VFRA 3FCVA 4NXNJ 5J1EA 5I3QA 1IBCB 2OGUA 2VQEC 3Q24A 4KTVA 3TUPA 1N5YA 3CDBA 3LF0A 5KG3A 3T5KA 4ECUA 1EB0A 2YNGA 2XEXA 2MGZB 2AYGA 3DHXA 1N6QB 4X84A 1MDFA 2O3DA 4WTOB 5THWA 2D1SA 4EZ9A 3HDSA 4PXEA 2DGXA 2YKPA 5M2UA 3A1YG 3PXGa 4H4MB 1DJ0A 4AQYF 3CCVS 4DR7J 3BPSP 4ECWA 1C4CA 1QM9A 1DTQA 3KK2B 3NGRA 5A0YB 5HQ8A 3I5AA 4N7TA 1N34J 4C9DA 3PEJA 1UW4A 3FK4A 4QQBA 2OEJA 2FVRA 2NPFA 1QE1B 2M5YA 3T5HA 4RL1A 5KT6A 3M6VA 3FMWA 1NSQA 1S7HA 4M5NA 3CVKA 2HS4A 5ETLA 1G4CA 2XGQA 4JI6C 3LP1B 1T9WA 3BN7A 1BLUA 2JHEA 3G2XA 2IRUA 4QIWD 2DPJA 1HFEL 4DPOA 2Z58B 4OI1A 3W2VA 1RWKB 1JXLA 1XNRF 1ZBTA 1LFWA 4D3HA 5J2QA 1FFWB 1P1LA 4JV0A 4PG4A 1RBAA 5AE3A 2MQQA 1CJVA 2IM3A 8RUCA 4LRCA 2MCQA 1XMOF 2HZVA 3DLBA 4PABA 3W61A 3LPYA 5DQHA 4TU8A 7AT1B 5FIIA 4WKRA 2RRNA 3EVWA 4ZCMA 5EX3A 4NLTA 3U7JA 2QL7B 3BQ1A 1CJKB 1WACA 4HI2A 2M5HA 1NDCA 3WIUA 1FUGA 4JI3C 4AL6A 3WX4A 4OYCA 3MM9B 5F8IA 5F3TA 3ET6B 5DO2A 3L3CA 2DGQA 5K9FA 1JK9B 1SL1A 2XYPB 1JX4A 4O44A 4CWBA 4OI3A 4OX8A 3SSRA 2AF6A 4DPYA 1Y5IB 4XO0A 1V25A 4FZVA 4RLQA 1DQAA 4KFBA 5H1SV 1SC1B 4IO9Q 5J1EB 2ZZMA 4N8OA 3MUVP 1RSCA 1ZTTA 3GSIA 4WTYA 1N48A 1N5YB 1NK7A 2HRUA 4ZVGA 1ZAVA 2IJNA 2YNGB 3CIMA 1KQKA 1FJEB 4FDFA 4DCUA 1P9QC 1YRXA 2XLKA 1Q95G 2RMLA 1VK3A 2HBQB 2VA3A 1I94J 3J81U 3EGNA 4P74A 5A2QU 2OUGA 1U1QA 3FSIA 5ETVA 3Q8PB 4FXWA 1DTQB 4RMNA 4PG7A 3TR3A 2U1AA 2LXFA 3BREA 1R7IA 3H42A 2KYXA 3KDNA 2XMKA 2MKJA 2VPYB 2ZVSA 2CQ3A 3IMLA 3CD7A 1B70B 1FTCA 2J9EA 4U8YA 5B0DA 5DG7A 4AQYJ 3AD8C 3DGPA 4JV5C 3W2VB 5L1KA 2R8IA 1BD6A 3QO9A 4M1KA 4DV2C 4OX6A 3V2UC 5MLCV 5J2QB 1AUDA 5EUHA 3JYTA 5FLXY 3CD0A 3PFEA 5HROA 2BJDA 4WP3A 2CJYB 3PHTA 1CVJA 1CJVB 3O6QA 3ELHA 1PILA 1FERA 4K4YA 1WKKA 2EC0A 3QLHA 2G1HA 1KR4A 1WH9A 3K5NA 2SXLA 4JI4C 1WNEA 3VQSA 4EMDA 4P75A 1XNRJ 3KUHA 1N0VC 4GRSA 2J7UA 3H4DA 2QTWA 4LT6A 3EZOA 4PYDA 4ZVPB 4J9MA 2VB6A 5IT9U 2HKEA 1GXUA 4O44B 2XYGB 3T1AA 4DR3C 1XMOJ 2A2CA 2ZBQA 2PEBA 4GO5X 1SCJB 1HW8A 4NWBA 1DQ8A 3CCMS 3KUGA 1IUJA 2LQ5A 4KFBB 4IYQA 4KGKA 1YBTA 2YWCA 4N77A 4ZDNA 2WD9A 2LQJA 3TDEA 2OJ3A 3MTJA 2W9AA 3IS9A 4USKA 1Q7YT 4OHXA 1HNWJ 1HQEA 4F0MA 4ZVSB 1XIQA 3K17A 4QPTA 4RNOA 4RBUA 4QJVA 4JI7F 5DLGA 1L3TA 5K8OA 3TUZC 4LRAA 4TLQA 5LXYA 4OZ3A 4X65C 2DEIA 4YHHC 2Y27A 2WRMA 2FUG9 1X9MA 4TY9A 3A3OB 5BYRA 1WG5A 3K5OA 5ETRA 1M5VC 5KT2A 4KR0B 3LWLA 4IFVA 4ICLA 4DUYC 2QV6A 3WX8A 4N56A 3M9NB 2RKIA 2ZVIA 3JAMD 4B9SA 3HHLA 4NEZA 4O4RA 1MG7A 1X5SA 2ZFHA 3UWTA 4OXIA 4C48A 3NRBA 4ILLA 3DGPB 3T19A 3LPEA 1Y3KA 2J6SA 3QO9B 4CCHA 2IC3A 4FYWB 1IXKA 1XHJA 1FDNA 5E0OA 3JYTB 2H65B 5HROB 5KFVA 3EYZA 4NYOA 4EYIB 5E7QA 3IRXA 1MXBA 1SJQA 2XQCA 4ZN3A 4WZMA 3LW5C 1VBYA 3R6GB 4P73A 2CPEA 2UU9F 4ZPBA 3QLHB 4I9FA 3UCGA 3MTKA 3QJJA 4ZPVR 3MOZA 4QYZJ 2DY9A 2KM8C 3I0RA 4U7UK 1WKJA 3AOAA 3BSAA 5T41A 1A6LA 3KYLA 2QC3A 3ZTQA 3GSDA 4JYAC 3N6MA 1FTRA 1W25A 2EFNA 1NPKA 1N32F 2RH3A 2DIUA 3HKZD 4A8XA 4AL7A 5L46A 2P2QA 3MCNA 1S0OA 3ZZYA 4IG0A 1Y9OA 2XWXA 3R8YA 3LP2A 2ZBRA 2D3UA 5CAAA 1D9AA 2CRLA 3VAMA 4GXRA 1FXDA 4MYUA 2AHOB 2PE8A 2ZHAA 3LUYA 5CYQA 2BQRA 3PX4A 3IS9B 3I56S 3A9VA 1HQEB 1SVDA 5ETSA 3I5BA 3IMQJ 3BN4A 3PYFA 3RB3A 3TVZA 5HO4A 5JXSA 2ATCB 5CCMA 3IXQA 4ZK7M 5KT7A 1P9YA 3J80D 1IBLF 5IT4A 2JEJA 2W7PA 4G6VB 1CC8A 1KN6A 2P8IA 2B3TB 3T1YF 4F26A 1SJFA 3TQEA 2X1AA 2P9GA 2H5EA 4YDDB 4LF6J 2HFSA 2QN6B 1FCAA 2PT0A 1RHQB 1Q7LB 4IFVB 4ICLB 2OLWA 3BSOA 3SCJE 3NAIA 2ILZA 2B9EA 2M52A 2RKIB 2B4OA 1U26A 4CO4A 4DV6F 2QRRA 2HQ3A 1AA1B 2C3YA 1R43A 3HFZB 1XBWA 3R5CA 3JQJA 2VPXB 1YJNS 3NGSA 3UCUP 3SQGA 3C46A 2IC3B 3W1YC 5HK4A 4XDCA 2FVSA 3EZ5A 3PW7A 5BSWA 1SKRA 4KH1B 3IRXB 1VLYA 1JNRB 3FBBA 4DL5A 1PJ7A 2RSQA 1QUPA 3CJRA 4DPUA 5CZVA 2XBPA 3H4BA 4QCLA 4WKYA 3UR3C 4ER8A 5T7LA 4USUA 4DHVA 2GVDA 3I0RB 3VR1A 2EEYA 1S12A 1KQGB 1UFLA 2JH3A 4RUAA 3BJYA 4V19X 3SSSA 3BS9A 2YQ3A 4RUCA 5ETMA 3OHAA 2XS7A 1FDAA 2VDHA 2FD2A 2VZ9A 1L5UA 3G8QA 2W7OA 2O1PA 2YXLA 4LFCF 5KEIA 4IG0B 1S9EA 1NK0A 3H20A 3LP2B 2UU9J 4NE9C 2WSCC 4WFBQ 2DNQA 1IKVA 3VV2B 2DYJA 4IQXA 1VJWA 3O5TB 1LWXA 5CYQB 4Y2MA 3BZQA 4N76A 4J91A 2BH1X 4K4UA 4LMZA 2XTJP 4TY8A 4DF4A 1N32J 2MQMA 2CPYA 5FJ4A 6FD1A 5LL6d 5DDRC 1MNEA 2AKWB 4FKXA 5HLFA 1HNIA 1N36F 1FJGF 1RAGB 4C3MA 2EG2A 1XS3A 4LQ9A 1TL5A 3M8QA 4AL5A 2RDDA 4KIAA 1U25A 1MKYA 4DV3F 2ZM6C 3JSRA 2DITA 3BBFA 5CA5A 2HHHC 2B4PA 2CPFA 1UEVA 2NPIA 3NGTA 3GE9A 4KE5A 4C8KA 3MI7X 3BKFA 1YX2A 2N7YA 2BQUA 4LF9C 2OD4A 3F73A 2ZOGA 1J5EF 4LFBF 1S10A 1IBLJ 3R2CJ 3HD1A 1D1UA 1Q8LA 4DF8A 3N5BA 1XERA 3SQGB 1T05A 2AJ1A 3E01A 3R9WA 4DR2C 3T1YJ 3MPVA 1VQLS 1FJCA 3K7RA 3OLBA 1RA6A 4DR6C 2OFHX 3H2VE 2FYXA 2QLJB 2OP5A 1WOOA 2VOPA 3M1VA 2FY8A 4DL2A 4O3QA 4DV6J 5KT3A 1APSA 3EQ6A 5T7LB 1R6YA 5KYVA 2IIHA 3TARA 2GVDB 2LU2A 4LE5A 4B9LA 2BZ2A 5IXUA 1RU1A 4L6V3 1C4AA 1G2EA 4K50A 5KFDA 3HI9A 2DNHA 5HJXA 1G3OA 1VIOA 4J5OA 1X4AA 3HSGA 1H0HB 3NPDA 1RT1A 3MUTP 1HR0C 4DPXA 4BC9A 1HI0P 3KXDA 3EWGA 1TUWA 2CQBA 1S9EB 2XZWA 2APOA 3H8YA 3GJSB 2RS2A 2KT5A 3OTEA 1CJTA 3D6TB 1IKVB 2GV1A 2XI2A 2HQGA 1RWXB 5A8RA 1UA0A 4CLWA 7FDRA 2V67A 4JI5F 1HNXF 2HWHA 3LTOA 3S82A 3ILIA 3Q2SC 1WUUA 4TY8B 4ZVEA 2O01C 4ED6A 5KFMA 2W7AA 3FQLA 4CH1A 1UZDA 4MJKA 2IDLA 4X66C 4LFCJ 1VRTA 1XRCA 1TZ0A 4USWA 5HLFB 1HNIB 4NXNC 3SV4A 1PAUB 1WCJA 3M8QB 4EO8A 3W66A 2ZDOA 2IHR1 4ECSA 4LFAJ 2GC8A 4MYTA 3MR3A 2CG8A 2KDOA 1Z2LA 4DV7C 2J0SD 4U6PA 2I9SA 4ANDA 1VHFA 3MMJA 2MZ1A 4O4GA 3ADAC 5HVFA 3OPKA 5D6GA 2BJEA 1Q1KA 4KPCA 1KBRA 2QFIA 3QPIA 2XLIA 4WCEQ 1NJIT 4DR7C 4ZLPA 2MLYA 1N36J 2NSCA 1FJGJ 3T1HC 4GKKF 1Z4UA 3D5MA 5IT9Y 1T05B 3E01B 1H7WA 3U27A 4DV3J 3JB9k 2E7GA 4I67A 2GQ2A 1B64A 3Q8YA 2W8KA 2IA0A 1KTQA 4F0HA 3V6DA 3GILA 2VUGA 4V19J 3KK1A 1TL1A 4K4VA 3AT1B 3M8SA 1JMTA 3M1VB 1YJUA 2DNYA 1YJ9S 2NXNA 1BWEA 4F50A 3N5FA 5C42A 3TANA 1J5EJ 1PC5A 4LFBJ 3NMRA 5C25A 1F60B 3G8SA 2KTQA 4I69A 1UEUA 2XY7A 2ROGA 3RU0A 3QWUA 1HBOA 5AXNA 3OTOC 1N52B 2KVQE 4DV4J 4GS5A 2DO4A 1RT1B 2D7SA 2HAIA 4NZ6A 3NBPA 1R8HA 1QSYA 3M7VA 4LBHA 2E66A 4KKOA 3POTA 1CJTB 4NLQA 2MZQA 5F41A 2D3OR 1ZS6A 1C0TA 5A8RB 1D8ZA 3S01A 4JI8C 2N4CA 2BX6A 2A6MA 1D09B 1USPA 1PC4A 1CEZA 4MAKA 1RE1B 1OQ6A 3H5SA 2DGOA 2EVZA 1T11A 2PN6A 1VRTB 1KC8T 5KFWA 4ZKAA 3P5TL 4BCAA 3F41A 3GONA 1FE4A 3ZTPA 1X5TA 1SJRA 1R6VA 3HP6A 1KONA 3RGIA 4MK9A 4FF3A 4FS2A 1RBOB 2AWZA 4JI5J 1HNXJ 2EFGA 2KG1A 1N88A 1NDLA 3CSKA 1S77D 2UXCF 2DHAA 7FD1A 4O4GB 2C2OB 1DAXA 1O90A 1QJHA 1T7PA 4MK8A 1NU4A 2JLFA 1EAYC 1MW7A 2HK3A 1QUVA 3HZGA 1S9FA 4QZVB 3AF6A 1KQFB 3GFHA 4ZMMA 2D9PA 3TEGA 5DM6Q 4LVNP 3TX0A 2ZKTA 4J9UE 2AP6A 1ICEB 1FRKA 4ZLJA 5IQ6A 2ALZA 1VQYA 1KQSR 3HULA 1U2CA 2JDJA 1P8GA 2A0FB 3RUBL 3V6DB 3TNVA 3D3BJ 1YSJA 4H4KC 3KK1B 4DWIA 2W2QP 1VQ8S 3HK2A 4KHPJ 4LUBA 1TL1B 3D6MB 2E1AA 1C2PA 3KJFB 4P2FA 2XR1A 5C42B 3AOCA 5C25B 4GKKJ 2RQCA 3AH6A 1S4EA 1SH0A 2CJBA 1SQFA 4J9RA 2UVRA 3CC2S 3CCWA 4X4RA 1H72C 3UPFA 1RAJA 1HBOB 5DM7Q 4URGA 3OSNA 1T9TA 2N4DA 5EHHA 1WSRA 2CWKA 3QFHA 3MFIA 3IN5A 2N3LA 2V8PA 2AD9A 4P2XA 2CY1A 2VFUA 5D8HB 3NBPB 3VALA 2HGMA 3QRQA 4EGLA 3UO0A 1X4FA 3MZIA 4KKOB 3POTB 4KV8A 2YWGA 2AIRB 2BANA 2DHGA 4RUBA 3QJLA 4PKDB 1VQ5S 1VBKA 4YR0A 2MJUA 1IBKF 2B56A 3J7AN 4K4ZA 3LNOA 1USPB 1WEYA 4LRDA 1RWWB 3N6NA 2LFVA 3EX7B 3FCCA 4CO1A 5T14A 2MDAA 1U0SA 1EIYB 2R9LA 3MEDA 4X2BA 4J9LA 3NXZA 3UN3A 2MHEA 3S7RA 1WF2A 2CQ2A 5IWAF 2AJ4A 4UUXA 3W62A 1KTVA 4Y6IA 4FUTA 1HNWC 1FJ7A 1FRLA 4XDDA 2CQCA 1N5QA 4EZ6A 3FMBA 1SC4B 5K14A 3CCRS 3CJEA 2G0JA 3UX2A 4ZITA 3MWBA 4TVAB 3TA2A 1VC0A 1Y00A 2VKRA 3AD9C 2UXDF 3QZ8A 3R1LA 2F9DA 4FNIA 2W4CA 3KKFA 5E3AA 4PQAA 4FKYA 3PRVA 3PW0A 2HW3A 3CCJS 3JSYA 2XYHB 2LA6A 3T6BA 2GAGC 3FVYA 1S6QA 2PFDA 3MR5A 1QVGR 3D6FB 5IOLA 2PI4A 4MKYA 3N0VA 2X1FA 1NM2A 1ZOTA 3KFWX 1Q53A 1RXOB 1MSWD 2EFQA 4PPZA 1N33F 3PYGA 1ZA2B 2KFYA 4ES2A 2QX0A 3U1LA 1F2GA 4O3SA 4ODJA 1NSKL 2DO0A 4NRTA 4DSKA 3PRDA 1RT6B 1WI6A 4DZ6A 2ZH2A 5E33A 2HHPA 2O67A 3W8GA 1RT5A 2DHSA 1V3ZA 3QSYB 2K7KA 4DSFA 4OQJA 2B51A 1FT8A 1SB6A 1DFDA 4ETXA 3NAHA 1S0VA 1RWOB 1SKWA 4UTGA 3IWLA 3TA0A 4KV8B 3OR1A 4C4WA 2LQ8A 1BE4A 2BANB 1N0UA 4PUHA 1M5OC 1V5IB 2PA8D 3RAMA 2QSFA 1LFPA 1SH2A 2AJFE 2QYCA 4AXJA 3CCZA 3OR2A 4CLUA 1RHRB 4DCVA 1RHKB 1B7YB 2CVIA 1KHVA 2J9DE 3CJQA 3AA9A 3L9ZA 4FNHA 3ENVA 3MEDB 1HBNA 4EFAC 4NOZA 1FF2A 3MR6A 1FFGB 2WONA 5C24A 1G1XA 2CQ4A 1VQPS 1ZPWX 2QIFA 1WTFA 5A8KA 4C7QA 3E51A 4N47A 4DQQA 3O2IA 3MMCA 3A8EA 2RB7A 2C2ZB 5K14B 1GTHA 1S7IA 3MGJA 3EGWB 9ATCB 3RV2A 4QU7A 5HJYA 1YBUA 3GFZA 5BSUA 1X0PA 3DOMA 2BDPA 4HTIA 4JV2A 4QIFA 1FK9A 1QD1A 2GIQA 3KHGA 5IWAJ 2ZH5A 1VQ7S 1RKJA 3TRGA 3R5DA 4JI0J 1NXIA 2V4QA 1T5HX 1S6QB 4LF6C 2L41A 1KLNA 2K1RA 4ZCLA 4I2QA 3CMAS 2FHKA 2Q79A 2GHVC 2WVFA 1C1BA 2VG5A 3ZNJ1 4DU7A 5KFXA 1ZH5A 4OHZA 4IRCA 2UXDJ 2GVZA 3QT7A 4M5IA 4DV5F 2FVCA 1LWCA 2DXDA 1OMSA 3CD6S 4KGVB 4CO3A 1UW9A 2A18A 3THTA 5HI7A 4F7VA 3UEBA 2NREA 1GMVA 3UNGC 1NJXA 1RT5B 3MPYA 5JRHA 2ABYA 5B0EA 1IWGA 4QYRA 1LKZA 2MQ8A 4TYBA 2OD6A 3IWNC 2HBRB 1S49A 3QSIA 1D9DA 5DRKA 3IG1A 5GMDA 1VK8A 3Q8SB 5J2NA 3ZXWA 3EDQB 4QW8A 2G0IA 3NYRA 4DFMA 2M3DA 1U49A 4NZ7A 3OR1B 4C97A 4UZCA 2J0WA 2EI5A 2FDNA 4DS5A 1CPZA 3MD3A 3ZTRA 3OR2B 2Z2YB 3ENAA 4X4PA 5CH7B 3IBFB 3MM6A 2VA2A 1RWNB 1H73A 1TVRA 3A26A 5GVQA 2CZ9A 1XN9A 1M1GA 1T02A 1HBNB 4YB5A 3GV5B 3R5AA 4MMOA 2FJXA 4CLKA 4AUKA 5E3PA 2E7XA 1RI7A 2VBYA 2WONB 2FJDB 5C24B 4DR1C 3DOLA 4EU0A 5A8KB 1YBAA 1T94A 2N82B 2HNZA 5CHCB 1NKBA 1RYRA 1JJ2R 3MMCB 1RT3A 2IPOB 1WEXA 3J7YU 3DDNA 3I87A 3GWCA 5IFIA 1HH2P 1OWXA 4DFKA 4DEZA 5D0EA 2MKYA 4NYZA 3KJNB 2DEJA 4M63A 2B0GA 2WTFA 2OTJS 3DOMB 3GIIA 5C5JA 3H5XA 4F4YA 2MM9A 1FK9B 2Q1LA 1A0OB 1Y11A 4M94A 5BUQA 3SEOA 1U7LA 1Q8IA 2R2TA 3HHDA 4CT8A 4N5SA 2XWYA 1HNVA 1RHMB 2K1RB 4I2QB 3PYEA 3KLHA 1YG0A 3P6YC 1YIJS 1B0VA 1SPBP 2VG5B 2NUHA 3NS5A 2E1CA 1NDKA 3R5JB 1NJWA 2GVZB 4Y00A 3KWMA 3W8PA 4XPEA 3GZ7A 1LWCB 4DMZA 2DNNA 3M2VA 3MURP 2JRSA 3M8YA 1AROP 4ZPWR 4NLGA 2IVFB 3T1YC 2KZZA 2KG0A 3J7A1 3JXOA 4Y34A 3MD1A 3BDEA 2GO9A 4LBIA 3BF4A 5IFMA 2DGWA 1JLQA 2DJWA 3NMAA 3N54B 3C8YA 2KM8B 4S0MA 1XMBA 2CQ0A 4F4WA 2OPSA 2GMLA 1YGYA 1KLMA 1L3KA 1V9OA 4D4IA 3IG1B 1WKLA 3AFGA 4KGMA 3GCWP 5J2NB 5JVGQ 4EBDA 4QWEA 2ADCA 2QL8A 4KAIA 4IO1A 2UV8A 2PA3A 3D3CJ 3TW0A 1I1GA 3QGHA 1K73T 4F04B 4B08A 3BR8A 5L38A 4NYPA 5H9FJ 2CXCA 3VZHA 3AAWB 3KK3A 3Q86A 3KUEA 3I96A 5JMNA 3GU0A 2KRBA 2MHNA 2KB2A 1U1MA 4BC7A 3B82A 3MM6B 2KKHA 1J2VA 1TVRB 2KFNA 2KXNB 2QL5B 3PIPQ 4PUIA 5A76A 2NSBA 2WW4A 3M8ZA 2RNEA 1RWVB 3DOLB 1PU1A 1TKZA 1Z1ZA 3LA0A 1M5KC 4WFXA 3HXMA 2YBVA 2HNZB 2D1TA 1S1WA 2WK4A 1RT3B 1NK6A 4OIXA 2OFGX 4MKVA 4U67Q 5B7WA 1XMQF 4CT9A 3J7YI 3Q8UA 3KXWA 4DCJB 1ZETA 2IFXA 2XMAA 2HJGA 1VFJA 3MDFA 5HAOA 1TL4A 4WS9A 4NLRA 1HIYA 1WG1A 4M5MA 2DRAA 2BV3A 5EWFA 4LFAC 3DU5A 2XS2A 3OL6A 1O8BA 2OKQA 1WG4A 3OFFA 1FRIA 2J8AA 5RUBA 1S76D 4FPIA 4EWTA 3MFHA 1P4EC 1HNVB 3QRPA 3PJ9A 2UV8G 3KLHB 3PZPA 2VKZG 2QG9B 3DDIA 2NCKL 2OEMA 3DRSA 2VFVA 1TL7A 2XNRA 3SCKE 3BO3A 1X4BA 1JNZB 1PAEX 1N36C 1FJGC 1XEZA 4A47A 3M2VB 2UUCJ 4CZCA 4MKAA 4ETZA 5B09A 1HL6A 1S79A 4HL9A 1JLQB 1RWMB 1VBZA 3IEVA 1SQEA 1EETA 5ETTA 3EZUA 2OPSB 4EBCA 4CH0S 5CQGA 1KLMB 5KG2A 3AJ1A 3N2QA 2IJRA 5BUSA 1J5EC 3Q22A 4DPWA 5D77A 3AD7C 4Q8EA 4FBTA 3UVJA 3RG6A 4ZVUB 2R42A 1FWKA 3VWSA 1Y10A 2H51B 3HKWA 1PYSB 1BWVA 1KFSA 1UPMB 2QVZX 4QBUA 4X64F 1YRUA 4F4XA 2W2OP 4DV4C 3Q23A 3KK3B 3OVAA 3M6XA 2VONA 1Q78A 2V2VA 8AT1B 1UFWA 3A12A 3W3SA 1VISA 4DV0F 4LR9A 2AJQA 5GADU 5A6PA 2QL9B 2FHOB 3W63A 2IA6A 1XRBA 4OZ2A 1KSPA 4ENOA 4R8UA 3HPOA 3L4BC 4L72B 1TKZB 4R1LA 2BJ1A 1PG5B 1O5JA 4K0KF 4O3RA 1S1WB 1W7WA 3V4MA 1N2FA 4CLTA 4WFZA 1HHQA 3MEKA 3O3LA 4B3TF 1R0AA 3N79A 2PC6A 2XG8A 3FNNA 2MKKA 1HYSA 5FLXD 4DG9A 2MKCA 2MZJA 5B0GA 2VG7A 4F3OA 3T5LA 4I9GA 4PG5A 3KHLA 2NLWA 5L1IA 1B4SA 3SSQA 1IBMC 2P6TA 1UFKA 3TQ1A 4JM1A 1FE0A 2QT7A 3NNCA 2KRRA 4JI5C 1HNXC 4O0IA 2G2ZA 4YDXA 4QIEA 2R8HA 4TKTA 1MN9A 1HI8A 4OYBA 3N28A 1XMQJ 1JWWA 1PCAA 1FRJA 5ITHA 3DRSB 1KRPA 1TL7B 4WE1A 4OYXA 4XIUA 1T3OA 3OXLA 4QWAA 5C2CA 3DC2A 3SCLE 2F8EX 3OHBA 1PG4A 2CIMA 3AXMA 3MM8A 4YQWA 2DNOA 3G6VA 4Z7CA 4DLGA 1RHJB 2K06A 3OTDA 4OLPA 1EETB 4KHPC 4IOAQ 3WC0A 5LJ3Y 5JJBA 1FLOA 4IOBA 2HGNA 3RJMB 3MCSA 1XRAA 3B6BA 3UVJB 2ERRA 3W9JA 4Y0FA 3TAQA 4DV1F 1AFJA 2D3O1 3L7UA 2DCUB 4OYPA 3PW5A 2OTLS 3W5XA 1O92A 3BPDA 2Z4PA 3GYXB 4IZ6A 2R7TA 2VQFF 1O51A 4FPRA 2QA1A 2OO4A 3TA1A 3NNHA 4ID8A 2ATLA 2CZVC 1LXJA 2P6SA 1UZHA 1GT8A 2X1BA 3NY0A 5DZ7A 2BEFA 2DISA 1UJ6A 4E2FB 5GADI 1JIHA 4BBYA 2PD1A 2KVIA 3ZZUA 5F9NA 4KSEB 4LJMA 2YCBA
chains in the Genus database with same CATH topology
4NL5A 1RK8A 4FBUA 3H4BA 4DLEA 2R7QA 1XR6A 4R8UB 4QCLA 4PR6A 4WKYA 3UR3C 4QR1A 3RRKA 1X9SA 1P27B 5T7LA 1ML8A 5H9UA 1RT7B 4DHVA 1YQHA 2UUCF 3NYQA 4ELUA 2OMLA 1H7XA 3I0RB 1SBRA 3VR1A 4DOZA 4DQSA 5DLFA 5A19A 1TAUA 2JWNA 5AE1A 5J1NA 2RUGA 4A8KA 4TLRA 3H25A 2EKYA 2D1RA 4B3MC 4UY85 1KQGB 4B9NA 2PROA 4DV5C 4ZA1A 1NK4A 2RIJA 1I6JA 2E8CA 1X4DA 2Z0GA 1KNZA 1KS2A 1UFLA 2EK1A 2XY6A 3EXCX 4O3NA 2GGPA 2JH3A 5E3RA 4RUAA 3BJYA 4ZJZA 2EBEA 1R0AB 3SSSA 4V19X 5KFTA 2HVIA 3BS9A 2YQ3A 1U1OA 1HYSB 1VQKS 3GPCA 4RUCA 2W9CA 2JC1A 4ECVA 2U2FA 2ZBCA 3OHAA 2XS7A 5DETA 3K58A 1ZM2A 5I3UA 2VG7B 3G86A 1FDAA 3IGNA 5E3CA 2WW8A 2FD2A 5GMKa 1C1BB 1HMVA 2VZ9A 1L5UA 1LXNA 4ZVHA 4BWJA 1VQNS 3G8QA 3VNQA 2W7OA 4MIBA 3M2UA 4RW4B 2DPLA 2IVMA 2WHOA 1MROA 2GJ2A 5AJ3F 2O1PA 3B8HA 4LFCF 2OPRB 1X0FA 5KEIA 4IG0B 4KRWA 2QLXA 1ZYQA 1S9EA 3ETOA 1NK0A 4KTQA 4ERDA 4AQYC 1NJZA 2L9WA 1BQMA 1RT6A 3H20A 3RAQA 4OL8A 1S48A 2BA9A 3LP2B 2FJWA 3OBIA 3JAMY 1JLAA 3G9CA 2WSCC 1NO8A 4WFBQ 2KO1A 2DNQA 4O23A 1IKVA 2DT9A 3IFEA 3TO8A 1MD9A 5CYJA 4YR3A 1D3WA 4OJGA 2DYJA 2C3OA 1FO1A 4EBEA 3LAXA 4DR3F 2KT2A 4IQXA 2K2PA 3SO4A 5DS7A 5KG1A 3W7BA 1VJWA 3GV8B 3O5TB 5CYQB 4Y2MA 3DLHA 3BZQA 5KFSA 4N76A 1CG2A 4U9RA 2BH1X 4K4UA 4K4WA 1VS3A 1FDBA 4LMZA 4NA2A 2DPIA 2ONFA 5BR8C 2RS8A 2A3JA 1NH8A 2YWKA 2JZ5A 2KN4A 5LSLA 4URQU 4TY8A 5DQIA 3RB0A 4DF4A 4DN9A 2FVPA 4WE1B 4OFZA 3VZIA 2VPZB 2MQMA 1FXLA 2CPYA 5FJ4A 1NK8A 2MKHA 3SYZA 3GYNA 4J9PA 2DTJA 6FD1A 5LL6d 1WD6A 2R2UA 4JI2C 4GKJC 4UOCA 4I2PA 5DDRC 1ZM9A 1MNEA 4H4KA 2VASA 3K8VA 4WK1A 2JFDA 3MM7A 2P9CA 4ED7A 3E7XA 1F0XA 2MQPA 1XNRC 1R89A 4NX9A 5HLFA 3K57A 3J7ZT 2XMWA 2IBOA 1HNIA 1N36F 2D27A 1NEEA 1FJGF 3EERA 4ECQA 4R25A 2F4VC 1PG3A 4C3MA 2EG2A 2F40A 4IH6A 5KFAA 4NCBA 4LQ9A 1TL5A 2VFTA 3M8QA 3MM8B 2A1BA 1VQOS 4AL5A 5G0RB 4E0DA 2HGLA 4KIAA 3I4HX 2EFOA 1U25A 4BWMA 1S0NA 1FNXH 1MKYA 4GC7A 1IR0A 1Y5NB 4YB7A 2F8HA 1EP4B 4DV3F 5AE2A 2PN2A 2ZM6C 3JSRA 5L39A 2J6TA 5HN0A 2VD3A 3RTVA 2DITA 5CA5A 3OSPA 1SUQB 4IFYB 3OVBA 1XNQF 2HHHC 3T3FA 2B4PA 3UQSA 2CPFA 3RW7A 2CJ9A 1IN0A 3KLVA 4B3OA 1XMOC 1UEVA 4USHA 2NPIA 4WFYA 1XWLA 4C8OA 3C2PA 2HQIA 3GE9A 4KE5A 4RU9A 4ZP8A 4X65F 4C8KA 3QYYA 3DXBA 4PWDA 3MI7X 3R27A 3LP0A 4HI1A 3SDEB 3PNIA 2N7YA 2BQUA 2WP0C 4LF9C 2C2DA 2OD4A 3HVTA 3UDCA 3S6EA 1H2TZ 1JKHA 2PO4A 3H98A 4TYAA 3F73A 2ZOGA 3KLFA 1J5EF 4NA3A 3ICLA 4K0BA 1FD8A 4LFBF 4ATNA 4Y2CA 1TK0A 3IGVA 3CCUS 2JC0A 3HHLD 1S10A 4I64A 5B0BA 2FJAB 3JSMA 1D9FA 1D1UA 4D4GA 2GJIA 2R7SA 2YNHB 4EUVA 2BE2B 2VG6B 4F8RA 2BM0A 4OHVA 3B7WA 3V81B 1Q8LA 4DF8A 3IAS9 2D7VA 1TK5A 3HHNB 1Y7PA 2YKMA 3N5BA 1XERA 4DL3A 3NL0A 1JLEA 1LW0A 3SQGB 1GXTA 1T05A 2AJ1A 1RT2A 3E01A 3R9WA 4DR2C 1AMUA 3I32A 3UD4P 1U6ZA 2XMUA 3MPVA 3T6JA 4EO6A 2V8DA 2R8GA 2JFKA 2OPPB 2ZE2A 3BGRA 1MMNA 4ECYA 2B5JA 1VQLS 4RW9A 1HWKA 1FJCA 1Q81T 3K7RA 3OLBA 4X4SA 3KNGA 1RA6A 2YKQA 4DR6C 2FJEB 1QAXA 2OFHX 3TYTA 1UAWA 3H2VE 3TQIA 5D3GA 2G1DA 1H2VZ 2KYZA 2OP5A 5IM0B 2V2KA 4I56A 4N41A 2RQKA 3TUFA 1DURA 2VOPA 3GIKA 3M1VA 3FJ2A 5L1LA 3N9UC 2MJNA 3W2WA 1QY7A 1WHWA 2BACA 4ED8A 2MSSA 5DGBA 4DL2A 4O3QA 4RKUC 4IUFA 3VAGA 5KT4A 5CCLA 5KT3A 3VAHA 1APSA 1X4CA 3US5A 3EQ6A 2HPUA 2V9KA 5T7LB 4B3RF 3S8SA 1R6YA 4MK7A 3Q8QB 5KYVA 3TARA 3KG1A 2LU2A 1REVA 3TX8A 4LE5A 4B9LA 2BZ2A 5IXUA 5LMUF 1QAYA 2E5LF 2HNDA 3AQPA 3O8WA 4PPDA 2FPHX 4L6V3 5E3QA 1C4AA 2VL1A 2BYCA 5G4DA 4ELTA 1G2EA 4K50A 5KFDA 1IJEB 3HI9A 4KO0A 4F67A 4LF4F 5JVHQ 2DNHA 1JOSA 1R31A 2AW0A 2GGPB 2Z2MA 4C8NA 2RVJA 1G3OA 3TI0A 3PEHA 1VIOA 4J5OA 1X4AA 2C28A 2I1RA 4NLPA 2IYGA 1ZPVA 5DDPC 3C6UA 4R0EA 2W9CB 4ED3A 2GNKA 1UKUA 4MFBA 1H0HB 1VQSA 5I3UB 4Q5VA 1RT1A 4K4SA 3MUTP 1QWIA 4HEA9 4LF7F 3NPDA 1HR0C 2LDYA 3AY0A 4LF6F 2K8GA 3DMJA 1HMVB 4BC9A 3PV8A 2ADBA 1HI0P 2JVOA 2LQBA 2D3ZA 3HHLC 3M2UB 4OZ5A 3FRZA 2VQEF 1MROB 3DDKA 2CPJA 4USJC 4NCGA 2FB0A 1V3RA 2CQBA 1S9EB 2XZWA 2V94A 5DGAA 4B9VA 2APOA 2CPDA 3H8YA 1BQMB 2RS2A 3M9OB 1TKTA 1YRTA 4CO0A 1N5SA 2KT5A 3OTEA 1T03A 2NR0A 1DZ5A 2JLEA 5AXKA 1JLAB 1RA7A 2DK2A 2J5AA 4M95A 5LMNC 1JB0C 3DYAA 2ILYA 1UVIA 1MWZA 2M88A 5KG5A 2OSRA 5K8NA 1IKVB 2GV1A 2XI2A 3MHYA 3CJ5A 3LQVA 2CJAA 2PFFB 4A8MP 1RTIA 5A8RA 2ZNYA 3L09A 1UA0A 1ZAWA 2LECA 4FXDA 3FSXA 5D4PA 7FDRA 3QJPA 1B7FA 5CZXA 1HNXF 3B78A 4JI5F 2BABA 4IR9A 2QEXS 2HWHA 2C3MA 3AB4B 1NAQA 2F8MA 3S82A 2GCFA 3UI3A 2OSQA 3GMGA 3Q2SC 3V6HA 1KOHA 2C2RA 1FKOA 4TY8B 4ZVEA 1TKDA 1S4FA 3QGIA 3ZZTA 2O01C 4ED6A 2MY8A 5KFMA 1Y3JA 1UL3A 2AX1A 1X5PA 2W7AA 1UMJA 3FQLA 4CH1A 3OLAA 4JI0C 4C0OC 4I2PB 4MJKA 3CDUA 4X66C 4Y2KA 1O93A 1UA1A 4RNHA 1JLGA 1XTZA 3VTIA 3MM7B 4WYWA 3I6PA 3CJ4A 1VRTA 1S9GA 4GC6A 1XRCA 1Q8BA 1TZ0A 1WF1A 2CPHA 4F25A 5HLFB 3D2WA 2RDJA 1HNIB 4PHTA 4NXNC 1DBDA 1ULTA 1OO0B 3SV4A 2EWHA 1U2RA 3CJKA 1YVFA 2EBGA 2DNZA 3WDOA 2KZFA 3M9MB 2RQMA 3M8QB 1V3SA 1U47A 4GO7X 4RBVA 4EO8A 5HL7Q 2ZDOA 4JUZA 2IHR1 3B4DA 4ECSA 2UZAA 2GC8A 2Z8QA 2KXHA 4MYTA 4LQ3A 4WFAQ 4PROC 2MZSA 3MR3A 5L1JA 3NKYA 1S6PA 3UDLA 2KDOA 5GAHU 3T9NA 1Z2LA 4DV7C 2J0SD 1FRHA 4HLBA 4IKAA 4U6PA 2I9SA 3QAEA 3PVXA 2UXDC 1LCIA 5DV9A 1VHFA 2PSZA 4B3OB 4JI6F 4TXSA 3MMJA 4MIWA 2D28C 2DR9A 1X7VA 2NUUG 2MZ1A 4PWDB 3GB0A 3UCZP 3IWXA 3LP0B 4DDFA 4O4GA 3MAHA 5KFKA 4DFJA 3OPKA 5KFJA 2UUBC 5D6GA 4BS2A 2BJEA 3HVTB 3I4PA 1Q1KA 1JKHB 3KLFB 2MQOA 3QPIA 3AQOA 2XLIA 3GG1A 4WCEQ 1NJIT 4DUZC 5K8FA 2L48A 4NDNA 5BSRA 5BSVA 4DR7C 4ZLPA 3FDSA 3JSMB 3LOUA 2NSCA 4A8FA 2DNLA 5DDOC 4E8UA 1VI7A 2KHCA 3ETCA 4GKKF 3T1HC 3K2YA 1Z4UA 2MZRA 2RD5C 2YKMB 4L4QA 3CJ0A 3D5MA 4GMKA 5IT9Y 3RBDA 1J5OA 1XK8A 1JLEB 1LW0B 3PBKA 1T05B 4DSEA 1RT2B 1H7WA 3E01B 3RRGA 2XC9A 4A8WA 1RWUA 3U27A 4J9KA 2QA4S 4IQMA 1N2FA 4TQSA 5IT0A 4FUQA 3JB9k 2ZE2B 2RILA 3BGRB 2E7GA 1V26A 2B5JB 2RJZA 4YP3A 4RW9B 4I67A 4U7CA 4DR1F 2GQ2A 1SJ3P 1B64A 2ZNZA 4I68A 2KH9A 2W8KA 3P49B 3G8TA 5GTDA 2IA0A 1KTQA 5D3GB 3V6DA 1HBMA 3GILA 2AYAA 3KTQA 2VUGA 3DN9A 3QGPA 4C2MA 1VC5A 4OV1A 3DLLQ 4V19J 3GFYA 5KG7A 2D1QA 3KK1A 4ZP6A 2BXJA 1TL1A 3ZZZA 2K3KA 2ZC3A 4K4VA 1SH3A 2ZH4A 5KT5A 3M8SA 1JMTA 3M1VB 5F8NA 2DNGA 2HZCA 1YJUA 2DNYA 1YJ9S 1T5DX 2DRBA 1F5CA 3W2WB 1RGVA 5KAKA 4UY8T 1BWEA 4F50A 3N5FA 1S1UA 5C42A 3TANA 3FCEA 1PC5A 2UUAC 1VMBA 3NMRA 4RW6A 4Y3CA