5CZVA

Crystal structure of notch3 nrr in complex with 20350 fab
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
243
structure length
225
Chain Sequence
ACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of activating mutations of NOTCH3 in T-cell acute lymphoblastic leukemia and anti-leukemic activity of NOTCH3 inhibitory antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Neurogenic locus notch homolog protein 3
total genus 61
structure length 225
sequence length 243
ec nomenclature
pdb deposition date 2015-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5czvA02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5czvA01
2OO4A 5CZXA 3ETOA 3L95X 4ZLPA 5CZVA
chains in the Genus database with same CATH superfamily
3GYNA 1Q8IA 1QAYA 2QFIA 4TY8A 1RHMB 4F67A 1TKDA 3E7WA 3CCZA 3T5HA 4DV6J 4LFCF 1N88A 3T1HC 2F7VA 4LSZB 5ETOA 2W7OA 2BX6A 3GQCA 4MMOA 3A9VA 2PA8D 2GGPB 2QMXA 4Z37A 3HVRA 4HHHA 2YPYA 4RW6A 4BC7A 1LFPA 1MWQA 3BO3A 1OPIA 5A8KA 1C0TA 1NEEA 4M5NA 4JUZA 2E8CA 1D9AA 1MU2B 4QW8A 4DF4A 1VRUA 3UNYA 2FC8A 3Q8RB 2ZEJA 4USUA 1QAIA 2HSEB 1Y11A 5D0HA 2WVCA 4K0KF 3M30A 5BSUA 2BANB 4KAIA 4CLZA 1YJVA 2CU6A 2E8EA 2UUAC 4KKOB 1NDKA 3NCRA 2XQCA 4B3TC 4M5HA 2ERRA 1U1QA 3DHXA 3HSZA 3L4BC 1S0NA 2KM8B 3D9BA 1LCIA 3A1YG 1JLQA 1U24A 5L38A 5L9NA 1A7GE 3T1YC 4E2FB 4PWDB 3R5AA 5J2NB 3NWGA 4C2MA 4M5JA 5B08A 1HQEA 1VLOA 1WC4A 2YTCA 2IDEA 4NE9C 3BO4A 3SV4A 4DL7A 4ISBA 4EATA 2KT2A 2V8GA 2WAQD 2ZVIA 1PIEA 1SIWB 3B82A 1KVJA 1LK5A 2QA1A 3ILOA 4K2JA 5E41A 3NXZA 4L6V3 2V67A 4XPCA 1BQMB 4DR2F 4JV0A 4NA3A 4KH1B 1CJUA 3N6MA 4LJMA 1IUJA 4RZRA 4I2PB 4H4OB 4LRDA 4DZ6A 4I9GA 3TDEA 3NMAA 3RW7A 4ZLLA 5KFPA 3HXMA 1D0EA 3C3LA 4WIIA 4EEYA 4Y6IA 5F3ZA 2FD2A 2CNNB 3U1NA 4RM3A 4OI2A 4PQAA 3M2VB 4UOGA 4DV0C 3PG9A 4DPXA 4GVBA 3MURP 3E2EA 3MWBA 2J0SD 4B9LA 5L1KA 5BSWA 1FRMA 1N32C 1H73A 2MYFA 3J7Z5 3LP1A 2Z2YB 1U1KA 3IFEA 3BKTA 3MD3A 4LBIA 1WG5A 1KOHA 3DMJB 4YFUA 3M1VA 4OIXA 4U67Q 3CMAS 5L1IA 2ZOFA 4WYWA 4K8RA 1SJ4P 4B3RJ 3UW1A 3LGNA 4C98A 2ZWPA 4OV6A 3W60A 4DR3F 5A76A 1P9YA 4X64F 1LWCA 3B4DA 2VBZA 4KO0B 3UX3A 4P73A 1VJQA 2KFNA 2UUBC 3CCTA 4I6WA 3HKZD 5EDWA 4JI7C 2N7CA 4YDDB 3TZZA 5HL7Q 1EP4B 2YWFA 4CTAB 3U27A 2XMKA 4FXWA 1AZSA 2XO6A 2HHTA 3OTBA 2HAFA 3GMGA 1JLEA 2W7AA 3D6HB 1RSCA 2VSQA 3CMQA 3PY8A 2Y8WA 3EQ6A 2RKIA 8ATCB 3QIDA 4IG3A 4O3SA 5B7WA 4JV5C 4DUZC 3NEKA 5IT9Y 1SB6A 4KFBA 4RMNA 3KHHA 4P71A 1VQNS 4USJC 5KG1A 1RCXB 4LT6A 1XERA 2YNHB 3GSDA 3ISZA 2QL7B 3MAAB 2FJEB 2G1DA 2OPQB 3DLGB 3VHQA 3QT8A 5B0FA 1VQKS 3ZZRA 4MYTA 3LQVA 2KFZA 1GX5A 3CE8A 2XS2A 1R3NA 3PFEA 4K50A 3TAQA 4UT4A 3BDEA 2YQ1A 2H51B 3D68A 2R7WA 1WUUA 5LMNJ 3EVWA 2LA6A 2VZEA 1SC6A 2HFVA 1J5EC 1USPB 5DO2A 2UU9F 3T1HF 4GKJC 2HWTA 1Q78A 5HVFA 1IKYA 3BR9A 4OZ5A 4DR3C 3P5BP 1HW9A 2AKWB 4LVOP 2XS5A 2WZ1A 1DQAA 3ICLA 3CGIA 4LBPA 3Q89A 3M8YA 4LF8F 1V26A 3OXGA 4IQMA 4IQXA 3O44A 3QNWB 4WP9A 3WIUA 2KDNA 4QIFA 1VQPS 2MY8A 3GFXA 2DR9A 2D1CA 1FKAF 4X4VA 3OJUA 3W61A 2QJ3A 2ATLA 3QMQA 5ETRA 2AEMA 3UR3C 2MHEA 2CPDA 3IEUA 3RZAA 2XZWA 1WI6A 5B0DA 1PBUA 1Z2LA 2DXDA 2P6TA 3GG0A 3ZNJ1 1SC3B 3KLIA 1FRKA 1YBAA 4NXNC 4UOCA 1S1VB 1PC4A 3GFHA 4IFVA 3I08A 5KFKA 5IS2A 1N36F 2V8VA 5F8JA 4OJ1A 2QRRA 3K5OA 4KY3A 4O0IA 1QAXA 5DV9A 4DFPA 2HHWA 5C2CA 3N6NA 2CQPA 3MCOA 1HWIA 2CQ2A 2FVCA 2RQ4A 3E8OA 3H2TA 2VH7A 2QL5B 4CM2A 3FFIB 2B56A 3EVMA 1W25A 2B0GA 1J5EF 5E3RA 2M3DA 2UZAA 1IR2A 1O5JA 2DNQA 3GJSB 4DR2C 3GPAA 4ANEA 1RU1A 1AUSL 2IBOA 4YN3B 2M2BA 1R8CA 2HK2A 2I5JB 4KTTA 4RVOA 4J91A 4DR4C 2O66A 1K1SA 4PYDA 2EFPA 2ZM6J 2MQOA 4DV1J 1UVNA 3CC7S 1QAJA 1I51B 4ZN1A 1IJFB 1IBKF 2GNKA 3W64A 2FHJD 1N6QB 1NJZA 1RUSA 1TMJA 1NJIT 4DR7F 3V2UC 1OSCA 2U1AA 2D69A 1RT7A 4RW4A 2XI2A 4P2MA 5J2PB 3HJFA 2BKNA 5A0YA 4MT1A 3QPIA 1ELOA 2YNGB 3IG1B 1WD6A 4NA2A 4WZQA 4TNOA 2OEKA 2UUCJ 4QU6A 3KDNA 1LKZA 1B99A 1S4EA 4DEZA 4V19J 3ITHB 3J7A1 3AD7C 5J2QA 2CQGA 5FDLA 4EWTA 4LSLA 3CDAA 1YJUA 5J1PA 4C97A 1BQMA 4OJ3A 2V94A 4R0EA 1DRZA 4WFYA 4N8NA 2ZHOA 2GAGC 4RL1A 2OFHX 4Y3CA 4ED3A 1VIOA 1PC5A 2YY3A 5KT6A 1FESA 1TMMA 2ZVSA 3DOMB 2Y1IA 3DRSA 3WIVA 4OHXA 5AE1A 2H3EB 1B3TA 2X1AA 4X65J 4JI4C 3D67A 3HVTB 1VBXA 3M8SA 1FKPA 2LMIA 1MW7A 2FGCA 3HHLA 1C0UA 1Q95G 2YPZA 3CJ2A 3OFHA 3VR1A 4CI0B 2HHPA 3DC2A 4L72B 4U95A 4LRBA 3MTJA 4ILMA 1RWPB 1XTZA 3K5NA 4USVA 1JLFA 3HSJA 5D8HB 1WEXA 1XMOC 1CJTB 2J7UA 3JTOA 2FQQB 3OBIA 1TL1A 5CYJA 3SSSA 3LP2A 5H1SV 1B64A 4RNFA 2R2RA 2RS2A 2LQBA 2MCQA 4P7TA 1TVRA 4ELTA 1SL0A 1TUGB 2N82B 3TEHB 1FI4A 4RR5A 1PJ6A 3L09A 3WQPA 4DV7J 4F4YA 1LW0A 3FCWA 4YY3C 3QJJA 4CO0A 1HQUA 2JLFA 5D0RA 3EGVA 5EGYA 5H9EK 2Y1LB 2P9CA 1DLOA 1KSPA 3HHNB 4DR7J 5GAHU 4WP8A 1RTZA 1PO6A 4OX9J 5BR8C 3MMJA 3OTOF 4GKJF 2RQMA 2UU9C 2RUSA 1RT5A 4HH1A 4ZPBA 3PJWA 1K47A 2BABA 1SKWA 2L48A 2ZBIA 3VNSA 1M0SA 2Z51A 1RAAB 1B70B 4E0DA 2VONA 2OAUA 3K8VA 1J5OB 2VV5A 4DLEA 4C4WA 1RT3A 2F9JA 2NLWA 1VRTA 2MLZA 2QTWA 2RRNA 1RHJB 1CS4B 2YBVA 4KV8B 2DRDA 3BQ1A 2D27A 2CG8A 3GB0A 4F50A 1DARA 1X31C 4OXIA 3TYTA 2BUNA 2G4BA 2W25A 1S57A 3H7HB 3CCRS 2HRYA 3TJ8A 3IPLA 5KFWA 3PIOQ 2L9DA 3M9NB 3EPIA 1W26A 1RKIA 4QIVA 3ZC4A 3TA1A 4WF9Q 4FNIA 3A4TA 2ALYB 1T11A 4RKUC 4UUXA 2ZZMA 2QIFA 2LQJA 3R5BA 4ZVSB 1SH2A 3O2IA 4CM0A 3A4IA 2XSFA 3V6DA 2ONFA 4ZVTB 1U48A 5M2PA 3GIKA 1T9XA 3MXHP 3QBCA 2WONA 4KHPF 3UO0A 4IDKB 5JUMA 5IQ6A 1JLAA 4NX9A 1N2FA 1NSKL 3TVYA 4B3OB 2E0GA 3EDRB 1Q1KA 1Y4ZB 2BM0A 2F9DA 1KHVA 1VBKA 3GYXB 3NGKA 5I3PA 3M6UA 3THVA 5E7OB 3KK3B 1RT1A 4U7CA 4ZVGA 1DURA 2DGTA 3RYLA 1RB0A 4KHRA 3AJ2A 2WOMA 2F4FA 2GHVC 2QEXS 4LF6C 4C48A 2EVZA 3I82A 4DV5J 5CYQB 5HLFB 4R8UB 1FX2A 2X3DA 2CPIA 1S5ZA 3CSKA 1BD6A 1SV5B 1F9FA 1V6HA 1S9GA 3BN7A 3DLKA 1NBEB 3TWZA 1WF0A 4NI2A 4NLVA 2AF6A 2OI2A 3RB4A 2EFOA 2G13A 2VFRA 1WTBA 5FIIA 3UQSA 2EG1A 3KXDA 3L8CA 1JJHA 5CH7B 3M8QA 1VCTA 1Y7PA 4ZLJA 2O3DA 5L46A 1SC4B 3CO9A 5A2QU 3GCWP 4MKYA 3PROC 1O8BA 1Y3KA 2MKJA 1S1UA 4PPDA 3BH7B 4IFYB 5HMYA 5KT4A 5I3UA 4EBCA 4GKKC 2KDOA 3DRYA 1MXCA 3GV7B 4GO7X 4JI7J 3LUYA 3D7SB 3FKBA 1NKEA 1GQEA 2XYGB 1CULA 3NAIA 4C3KA 2O67A 2WVEA 2WVDA 4RLEA 3JQMA 2ZNZA 4WTYA 1WKLA 4NZ7A 4AQYC 1UFKA 3V5RA 4J9UE 2CQIA 1MWZA 1O9TA 3BH6B 2W24A 3Q24A 3MR6A 2NXCA 4DCPB 2FZKB 3DCAA 2VASA 3PACA 1HFEL 1YRXA 5MLCV 3M9OB 3PW2A 1VBYA 1RAJA 3AY0A 3NCPA 1KVKA 2CWXA 2KZ0A 5BSRA 1REVB 2CPFA 2VHGA 4HH0A 2HHHJ 4DU7A 1REGX 2MMYA 4YUDA 3MR5A 4N8OA 1FWKA 4C8MA 4LSNB 3X3UA 5CD4A 5G0RB 3RTVA 3KFWX 2OMLA 2XEXA 2YKMA 3GFYA 1XMOF 3CQ1A 2P2BA 1RG9A 3PW0A 4PQUA 4USWA 4RNMA 1KS2A 1R8HA 3CWJA 1G1XA 3FBBA 4LF7J 5BUQA 2XSJB 4JI8C 2EI5A 1HNWJ 5CAAA 1U1PA 1FK9A 4RW8A 3TZXA 2DHAA 4ILRA 4X4QA 4JI5J 1TQLA 4DV5F 2NYHA 3HKWA 2LQ8A 2QLXA 2D3OR 1NK9A 2YNFA 2DPLA 3DI6B 3BGRA 4C3MA 1IJEB 2ZWOA 3T1AA 1KTQA 4TY9A 2RRAA 1XNQF 4FN5A 4H4MA 3MEEB 2XS7A 3HHEA 4LF5F 3AT1B 1S6PA 1KDNA 1N5VA 4H4KA 2B5JA 4QW9A 3TR5A 4F7VA 1ZTTA 3C8YA 3OVSA 1O92A 3CJKB 4CO1A 4X64C 5L1JA 2FY8A 2RRBA 2V2ZA 1M5KC 3O1LA 2UUBF 2M70A 5DDOC 4U5YD 3HFVA 3BQ2A 2W2MP 1GXLA 2BKOA 3IA0A 1CS4A 3I0RB 4DU8A 4LR9A 2UXDJ 2VKRA 2IY5B 4PPZA 4XAKA 1KNZA 4ZVOB 3CCWA 3G6XA 3PR4A 3IMQJ 1B0VA 2HNDA 4W98A 2CY1A 3Q8YA 2HVHA 1XK8A 3LAKA 1SIZA 1RP5A 2AYAA 1HBUB 3QO9B 2PI5A 2HFUA 4BWJA 4KTVA 2Q3PA 1FEEA 2HZAA 3QFWA 1DBDA 3MEDB 5K8FA 1NO8A 4YP3A 3M2RA 4NZ0A 3W66A 4B3SF 3Q2SC 4B3TJ 1J27A 3AHPA 4USIA 1SQEA 4KR0B 2YNFB 4OLOA 4DFJA 1N36J 2C3YA 3VGTA 3NOCA 3W62A 4FUQA 3CT9A 4ZK7M 2QA4S 3T1YJ 2YVSA 3E3XA 2HIYA 4PWDA 3RRKA 1RTHA 2V8DA 1N54B 3MEEA 5K8MA 2OH2A 3MMCB 2ZM6C 4B3MC 3IBCB 3EGZA 4Z2XA 2HLUA 3AXKA 1H6KX 2NZCA 4JP8A 5GAEI 1T05B 4NXNJ 1YJTA 2M8HA 2Z56B 1LQ9A 3BKFA 3ET6B 1NK8A 4LF8J 3KJNB 4LFCJ 2LQ9A 4A46A 5E3AA 4PROC 3HFKA 3M9MB 1FNMA 1VQ5S 3I87A 1HNXC 1YIJS 2XHCA 2J7WA 3DFEA 3MEKA 4DR5F 5A2QD 1CJVB 3T5KA 5LSOA 1R8PA 5BYQA 3OFEA 3M32B 4KGZB 2DHXA 3KLEB 3JXOA 1QJHA 4LSNA 2ZUGA 1NNDA 4XDDA 3PX6A 4B9UA 3QWUA 3I5AA 4YDXA 4GC6A 4KFBB 1VEHA 2J9EA 4TQSA 3MZIA 1N32J 2IRUA 2W4PA 1D8YA 2JEIA 3KG1A 4X65C 4JI4J 3AB4B 1HBMA 1SH3A 2CVIA 2I8EA 5AXLA 3FQKA 4ECQA 2XWXA 1WTFA 3ADAC 1X0PA 2Q1LA 3KG0A 4DWIA 1QSYA 3PM9A 2WSEC 2V8HA 1RAFB 2W2QP 4MIBA 3RUBL 4AQYF 3JQJA 1XJWB 4DF8A 3KOAA 2JMPA 1RHUB 2IM2A 5A8RB 2HHQA 3RR7A 4F4WA 2V0NA 1PCAA 2VPZB 3ZO7A 1JLFB 2B9EA 3J81j 3I56S 5K8PA 1S1TA 1FCAA 2OPPB 4OYWA 3FBCA 3FEYB 5ETQA 5AJ3J 4Q8FA 4RNOA 2OD4A 4IO9Q 3QRQA 1SI9A 4Z7YA 1OPZA 2VJVA 1U49A 4NLSA 5DLFA 2NYIA 2PO4A 2WB1D 2ZBPA 3CQ3A 2KVIA 3FEZA 1T03B 4NLDA 3M2UA 2GHPA 2X51A 1EQMA 3QIPA 2AYBA 3PKMA 4AFFA 2ADCA 3MM5A 4IR9A 4FYXB 2CYYA 3NNHA 2UV8A 1WG4A 3ILIA 2WVFA 1VC5A 1XS3A 5T8TA 1RADB 1SXLA 1F3FA 4JI0F 4X4TA 3OLAA 3TANA 5D0GA 1FKOA 5LSLA 1I1GA 3IBFB 3W1YC 1L3SA 2NREA 3QO9A 4UOHA 4YS2A 4MIWA 1R7IA 4CLPA 4ZCIA 2CQHA 3MUTP 3PYFA 3U1MA 1VQ7S 1TKTB 1ZM3A 4IRCA 3HF5A 2AJ0A 3PYDA 2C1EB 4LF2A 3OLBA 1L3VA 1RKJA 4LFAJ 5IWAF 4N56A 3G82B 2BZ2A 4NL5A 5IV4A 2UXBC 4RUCA 1WHWA 5ETNA 4OI1A 3SO4A 3I96A 2AIRB 4DMZA 2DR5A 3LGXA 4BC9A 2QVYX 3G8SA 4NPOA 3W9IA 2BJ1A 2LEAA 1P27B 2XMJA 1T5HX 4I6AA 1RACB 1JLCA 1FRIA 1Y5LB 4KGMA 2EK6A 3CCES 2JEFA 1LQLA 2LDIA 3WZ0A 2OIHA 1IKYB 2OEMA 1V3RA 3I6PA 4QZVB 4QWCA 5KFUA 4OMFG 2BKPA 1NJWA 4DSLA 3LANA 1QSLA 4JI2J 1ZZFA 1YGYA 3JTPA 5B09A 5E3QA 1HL6A 2PGCA 5E2QA 5KT5A 1JJCB 5T14A 2YKOA 3AF5A 3RB3A 3D3CJ 5KFQA 5ETSA 2HBZB 2BMBA 1MN9A 2ZDOA 4QOTA 3QZ8A 1KC8T 1U26A 3CDEA 3KLGB 2CXEA 3LTOA 4DN0A 4TU7A 4DFMA 2C3OA 2H5EA 4LF6J 4LFBC 2PIIA 3QAEA 2E5LJ 2VC1A 5A1IA 4YB1P 3IWNC 4B3MF 2PE8A 3GIIA 4CNYA 2KJVA 3O5TB 3C5EA 2UVVA 5GAHI 2XO7A 3UDCA 3HPOA 3M8RA 4ODJA 3A8IA 3IS9A 4A4JA 3PR5B 3I32A 1UW4A 3V6HA 2WW8A 4MFBA 1XNRJ 2FYXA 1NK7A 3EGWB 3GR0A 3B4MA 4MH8A 4XIUA 1FKPB 3HHLB 3R5JB 3VAFA 1X5PA 2HFSA 4HKQA 3TZWA 3MEGB 3MOZA 2HFNA 2V9KA 2ZE2B 4ZPWR 1MROB 2CAJA 3E01B 5C24A 2ALZA 5GMEA 5F9LA 3HD2A 2FVSA 4EMDA 2E9RX 3U1LA 3P4UB 4NI2B 4DX8H 3R9XA 1ZPWX 3OXFA 4IH7A 4IFYA 5EX0A 1JXLA 5BJRA 2ZH8A 4CT9A 1N56A 5T8SA 4DX7A 2ASJA 2C28A 5IT9U 2E1CA 2GMJA 2XMMA 4HT7A 1K1QA 1S6QA 2JHEA 3G8QA 3GONA 4IR7A 1DQ8A 5KFGA 2RHQB 3GJTB 3DLKB 1RWKB 1FRXA 2QLWA 3LAMA 3N5BA 4TPSB 3HK2A 4LFBF 4I2QB 3CCSS 2PA3A 2IYGA 4DPYA 1YHQS 2CPZA 2FVPA 3R9WA 1UKUA 3D1QA 2OUGA 3QZ7A 1XWLA 5J2QB 3IM8A 2FJWA 2LFVA 2K1RB 2JRSA 4F25A 3I55S 1C4CA 1KWMA 1NK4A 2XMAA 3TX8A 1S1VA 3UD5A 2A1BA 1RWOB 2ZD1A 1OYEA 5HO4A 4K4WA 3B7WA 1KQFB 4OYPA 3IXQA 3SQGA 5A0YB 5CCLA 4LF9C 3NBPB 2NXNA 1N5SA 4M5MA 1K44A 1S7HA 1RLDA 1I6JA 2JZ5A 4KHPJ 5ETVA 5EX3A 5KFHA 2KM8C 2VODA 2AJQA 1YZ6A 2VL1A 3QAUA 2KHDA 5HSPA 2F4VF 2CJXB 1VQSA 5FLXY 2MB0B 1KQGB 5JMNA 3EZOA 1S6PB 3S8SA 4XX2A 2Y27A 2L9WA 5DS7A 4E98A 1X4DA 5HI7A 3MCMA 2W8KA 5DRKA 1NCLA 1O0PA 2VQEF 4LF7F 3NYQA 1HW8A 1ICEB 3IO1A 1JKHB 3RBZA 2RDJA 4CLUA 2HIQA 1FDBA 3I0SA 5KFIA 5F8NA 1JB0C 1WF2A 3SCJE 1KLMB 2GV1A 2GVZB 5BSVA 1NYEA 4FYWB 5DG7A 4K0KC 1BQNB 1S6OA 3TA2A 1TFWA 5C7PA 3MPVA 2DNPA 4O3PA 1X4GA 3QIPB 4CH1A 3N01A 4ZJLA 3Q8QB 2DRBA 3DOLB 4J9VA 4FF4A 4O3QA 2MTLA 4GVLA 4HI1A 2D7SA 2DRAA 4LR7A 1OWXA 5HBMA 3MR7A 2ZH1A 1D8ZA 4L75A 2XB2D 2NSBA 2YQ0A 3G9CA 4QU7A 3RBDA 1R6VA 1SQFA 2L41A 5LXYA 2C2NA 4PG4A 3GYGA 1JLEB 3HVWA 3RBXA 4DV0J 1KQSR 4M5KA 4MIAA 4JI8F 3BPSP 4FBUA 4ERDA 3RJMB 4WKRA 1WACA 2DHSA 5K14A 5A19A 2UXDF 2V68A 5F0WA 4ER8A 1NDPA 3D1HA 2JVRA 3DXBA 4JYAF 2OBVA 2NXJA 3BSCA 2A2CA 4QIWD 3VZHA 2BXJA 3FNNA 5D4LA 4ZPTR 5GADU 4EBDA 5K14B 2ZKUA 3MMAB 5GADI 4KKOA 4TU8A 2BQ3A 3LNOA 1JWWA 1NKCA 1SKRA 3LALA 3HO1A 4IH5A 3VAHA 1PYSB 2V7BA 2YH0A 1R0AB 5DETA 2RHSB 2ZC4A 4U9RA 1WOSA 2IM3A 5BSTA 1ZETA 4JI3J 4RLQA 5BXIA 1C1BB 3UCUP 1LNQA 5IC4B 1KQKA 1Z4UA 3A25A 1NZ8A 2FJDB 3C15A 5I4MA 4K4YA 2FLNA 3TO8A 4OL8A 3DDNA 1KRPA 5BYSA 4C7QA 2H54B 5DJBA 3DDKA 5GAEU 2V50A 4I56A 1FRLA 2IYIA 1HBOA 3UFCX 3HI9A 1CULB 1TU0B 1RAHB 2VFSA 3H42A 3PRDA 3CCLS 3OFGA 4PUOB 4DUYF 3FDSA 2EXUA 2H9ZA 2HNZA 4H4OA 4CLSA 1QD1A 4O4GB 1ZTWA 1U1RA 2Z58B 2YKAA 5GMDA 4NMLA 2NQPA 1OJ4A 2QLFB 4LF5J 1QUPA 1WHYA 2L3MA 4M8LA 2I5JA 2SXLA 4U7UK 3Q23A 1YI2S 1H0HB 4CP5A 2JLEA 3QLHA 2H4YB 3R6LB 4O44A 4OHWA 4A8KA 1CPZA 4CLWA 4PUGA 3BSNA 3V81A 2ADBA 1FDNA 5KFSA 4FZVA 4AL5A 2LU2A 1GT8A 2LU1A 3BGRB 3CNQP 5D4PA 5IZHA 4QYZJ 2RUGA 2Z8QA 2B4VA 2CJAA 2MHNA 5CYQA 2AYEA 4ICLB 3KYLA 4ED7A 5GVQA 4ZHRB 1NJXA 1QTMA 1ML8A 4NYPA 4PXDA 3HT0A 3CDWA 4DPWA 3LP1B 1HLWA 5BR8F 4N41A 1SPBP 1TFYA 2AD9A 2QW0X 2C2KB 2GQ2A 3IWLA 2ZD1B 3KKFA 1FTCA 4WYLA 2BQUA 3NS5A 1SQGA 2ROEA 2HHHC 1CJKA 4UZBA 3GZ7A 2IM1A 3BYRA 2CPEA 1GAOA 4HACA 2MQQA 3TARA 4GMKA 2HLTA 1E6YB 2I9SA 2HS3A 7FDRA 4ZVPB 3RG2A 3VGVA 3SSRA 1JQGA 1WOPA 1Y00A 2VDIA 2DGSA 3VAMA 2E5LF 2DKOB 1HI8A 4LRCA 2B7CB 2J0XA 3WC0A 4UOFA 1X9WA 4QR0A 3CJKA 1Q8BA 3TW0A 4HI2A 1IR0A 1S6QB 4JI5C 1PG3A 2ZNYA 7FD1A 3ENWA 4UZCA 2MQMA 1UA1A 4J90A 3D1OA 4HHUA 4LF4C 1HPZB 2MLYA 1UFLA 2K8GA 5B0AA 2ZJRQ 4DQRA 3VF0B 2V63A 2WBRA 4MKVA 4KGXB 2W9CB 1M1KT 1HQUB 3T19A 4F0HA 1LFWA 1U2CA 4M5LA 3JAMY 5HROB 3J7YU 4KBIA 2G0JA 3EVOA 3X1LB 2HBRB 1YRTA 1EKRA 3E01A 3M6VA 3ZZTA 2UXCC 1OY9A 2BOAA 2EEYA 2IJRA 4LQ9A 1MU2A 1CVJA 2GO8A 4DV2F 1WKJA 4YHHJ 1JXVA 3EZ5A 2FGOA 4MAKA 4QQBA 3CPWR 4AT1B 3DOMA 3MAAA 4YY3F 5HJXA 1RWMB 2FZCB 2POKA 1ZM9A 1SV5A 4DI6A 4DV1C 3RU0A 1HD1A 1S79A 4WV3A 3AOAA 2L9NA 1YITS 4NEZA 4C0HA 2LXFA 1AFJA 1ZAWA 2LVWA 4ETZA 3C2PA 4LFBJ 4CWBA 1OMSA 4KSEB 2RKIB 1IKVA 4IOBA 3J80D 1Q8KA 4IG0B 2NUUG 4P2XA 2E5LC 2ACMA 2J7KA 3FRYA 3IGVA 4DDFA 3JSRA 5CZXA 2RD5C 4JI0C 4Y2MA 3K5MA 4HDGA 1VJWA 4P2SA 4HHJA 4LREA 1EX8A 4OYMA 4J9QA 4K59A 2HBYB 4ZVEA 4DXLA 4ECXA 3A8EA 1DTTA 2BACA 2CFXA 2Q79A 2V4RA 3T6JA 5CHCB 2EGTA 1QE1B 1NXIA 2K7KA 2P5VA 2DY1A 4B3MJ 1NB2A 2GFFA 3LOUA 2GIFA 1DTQB 4ZP9A 5D0EA 2M5OA 3LAXA 3SFGA 5KG6A 5K8NA 3MM6A 5DZ7A 3KLFA 4FF1A 4J9NA 2GA7A 1H72C 2DNOA 4OX6A 3SDEA 2X7IA 3MECA 5EWEA 4DV6F 3PX4A 3BN4A 1QVGR 4J9RA 3E7XA 4CH7A 2APOA 1G4CA 2YWGA 3V81B 1M5VC 3MGJA 3JB9k 1ZBTA 3MM9B 2MJNA 4WK1A 1N0VC 3RRHA 2QE5A 4IH6A 2ZBQA 4KV8A 4NLPA 3GIJA 3KTQA 4G37A 1R43A 4PWWA 1N5QA 2O5DA 3QGPA 2Q6CA 1QM9A 3UD4P 4ZIVA 4ID5A 2WP0C 1UWBA 2D7VA 2ZFHA 1ZAVA 2HKEA 3NS6A 4WTOB 1F60B 2VDHA 3RAQA 4PRFA 3AD8C 3H2VE 3TI0A 1IXKA 3UNGC 3I9ZA 3L7OA 5DLGA 3G6ES 2ILYA 4KGKA 3VQSA 3KLHA 1IR1A 1T94A 5KFOA 2QL9B 1N6QA 1RTIB 4LRFA 1FHTA 3N54B 4FS1A 4I2PA 1JNZB 1I3OB 3PEHA 2E66A 3AOBA 4HTIA 4WIQA 4A8FA 3LPYA 4I7FA 2WD9A 3TJAA 3MR2A 2Y9HA 2BJ9A 2UU9J 5K9FA 3FEXB 1K0TA 3GPCA 1SJ3P 2YWCA 1S7IA 4DV0F 4Q7AA 1Y9OA 2KN4A 4Y00A 5JJBA 1ZB9A 2KTQA 5KG7A 1PG4A 2F8EX 2KXHA 2MZSA 3PJ9A 3N2QA 3KUHA 3MM8A 3KMSA 1NJYA 3MPUB 1JXEA 3ENQA 3T41A 5IT9D 1RBLA 1U25A 3IWXA 5EN1A 1Z1ZA 1NPPA 2EFVA 4DL5A 1DFDA 5JXSA 1GMWD 2JNJA 3FCEA 3R97A 3H90A 4TU9A 3RW6A 3HD1A 3P96A 4NWBA 4P52A 4CH0S 3HVTA 1CC7A 3QYYA 2HYIB 2XM3A 3IR6B 5T7LA 1USPA 3PHEA 3M30B 3HHDA 3C16A 3B54A 4YR0A 2QA2A 2HNYB 5F8GA 4RNNA 3JYTA 5DM7Q 4ILLA 4K0KJ 4BHQA 1HWKA 3LGMA 1BWVA 4QWAA 4X4UA 2W2OP 1NMEB 1VQ6S 5BYRA 5KFRA 2BV3A 2W9AA 3EPGA 5K20B 4ED2A 2A6MA 3U02A 3R7SB 3PO5A 4F3OA 3I4HX 2FHOB 1PSDA 1VDHA 3KK2A 3K2YA 1F0XA 3BR8A 2C2RA 3D54A 2P02A 2JC0A 5HVGA 3DNCA 2FIUA 1U0HA 4DV2C 4YB5A 2IVMA 3UI3A 3F73A 2R7OA 3G6VA 3OSPA 3UOWA 3LP2B 4PXCA 4NLRA 4DCTA 2LECA 2RIJA 4HACB 2X1FA 5KFFA 1GH8A 1TUWA 1XEZA 2IIHA 4ZCMA 1D9FA 4DV5C 4DV1F 1CSJA 4ENOA 1FNOA 2HS4A 3PTWA 4P75A 4QYZK 3FMBA 4DCJB 4NLQA 4ZCLA 4DPUA 1UA0A 3DAYA 1LOUA 2B8PA 5B0EA 3CCUS 4ZJOA 3FMWA 1FD8A 3L3CA 1ROFA 1DQ9A 1R27B 2CNOB 3A3OB 4AL7A 1U47A 4X66J 5J1EA 2VA2A 4PZPA 1WF3A 4ED1A 4I4BA 4WFZA 4ITSA 3MM8B 3H4DA 4FS2A 2OKQA 3UR0A 2JLGA 3RBEA 1NSAA 1YJ9S 4R8UA 2BA9A 1T02A 2YKQA 4PG6A 4X62J 2LA4A 3EM1A 2F65A 2O1PA 3UN5A 2NXEA 4RJVA 3M8ZA 4F4XA 4QJVA 1LWEA 4L74A 5HMZA 1Q86T 4OX8A 2N3LA 5IT0A 1CC8A 4ZOSA 1F5BA 2BYCA 2DTJA 1RISA 2EBEA 3S1TA 5I42A 4B3RF 5G4DA 1EGAA 3Q8SB 1YG0A 3M2VA 4CO4A 3D66A 1LK7A 1MWYA 4JI3F 1RT7B 2WRMA 3ZTRA 1W2BR 2UVWA 1XNRC 5AXKA 5CD4H 3H8YA 4N77A 3ZTPA 3AODA 2DO0A 2XI3A 1U1OA 5H9FJ 3RRGA 4ID8A 1S77D 1XIQA 3VWSA 3C15B 2OSQA 3R44A 2HK3A 1IKVB 1LWEB 2EC0A 2HQCA 4KHMA 5H9UA 1RWXB 1FWLA 4OYBA 1VGYA 1I5OB 1RT2A 1IKXB 2AP6A 1JLQB 3W5YA 3PZPA 4DPOA 2AGPA 4M95A 3IM9A 3MOJB 4FYDA 1M6XA 4LF7C 4X4RA 3MMBB 1YVFA 1RCOB 5LL6d 1JJ2R 4DUTA 1PA4A 1ZB8A 4PHTA 1B0PA 5THWA 3OR1A 1UEKA 1V3SA 2BJ8A 4KIAA 2DHGA 1O6XA 4G3IA 5HATA 1TELA 2AHOB 2E7VA 1UVMA 4JYAC 3MFIA 1YBUA 1NHVA 4ZJZA 3OTOC 1G7CB 2EBGA 2KYXA 3OV7A 2BW7A 2LXIA 2XULA 4G6VB 2JWNA 2E5JA 2LLZA 3D2WA 1XMQC 3BV8A 1M1HA 1BMQB 2AMCB 2CPHA 1T9TA 2COLA 4X66F 1X4HA 2W7PA 4ELVA 4FXVA 1S10A 3CD6S 2C42A 3HDSA 4ZPVR 3O6QA 3BS9A 3G6YA 2R4FA 1NKBA 5KT7A 4WZMA 3EE3A 4E8UA 4ES2A 5HJYA 2C2DA 2GJFA 3GU0A 5CYMB 2QSWA 1N34C 1PJ7A 3DLEB 5KG3A 2EWHA 3M8PA 4Q8EA 3G87A 2XNQA 2B51A 3GIRA 3MUMP 1UKKA 1NK5A 2G2OA 4OI6A 2FHKA 4DQQA 4A8YA 1Q82T 5ETKA 3CDBA 4NLUA 2IA6A 4FXDA 4L4QA 1TV6A 1YKWA 2ZBCA 2GIQA 4P10A 1LXNA 2N3OA 4KHPC 1TL3A 2OPRA 2XHWA 2YKNB 3AOCA 5DZ6A 3TUZC 2HMIB 1NZAA 1L3UA 3KNAA 3C16B 3CW2C 3EWGA 4ZVUB 3JYTB 4IZ6A 2KT3A 2QLBB 3MPWA 2UXCJ 1D3WA 1FF2A 4LBHA 3OFFA 4KB7A 4ZP7A 4HLBA 4HEA9 1RA6A 1C0UB 2KU7A 2OP5A 4MK8A 2Y0BB 4ZPCA 3KHRA 2DGVA 3ILLA 4YB6A 3BO2A 2Z57B 3L95X 4B9VA 2U2FA 2CWKA 1XRAA 2P2JA 1Y0HA 2CZ9A 1U2FA 1EAYC 4J37A 3U7JA 4NLXA 5A8KB 4JI1J 1LEOA 2ZJPQ 2E29A 1UJ6A 1XR7A 1UFWA 2MDAA 3EJMA 2GJIA 3NBPA 1RYRA 2MXYA 2HWHA 3DDIA 2J8AA 2G9OA 2X3GA 3R5CA 4OX7A 5CA5A 2ACYA 2YX7A 4O3OA 1UTAA 1VQOS 1HNXJ 1JLGA 1HKAA 2MJUA 4DQPA 1TKTA 2J9DA 3KG4A 2FY1A 3ZNUA 2HHHF 4O3RA 2FHJA 3HHLC 3DRPA 3M7VA 4NLYA 1UAWA 1IBLF 1C1CB 1ZM4A 2VFTA 5JVHQ 2FJVA 1A9NB 1N5TA 2IAJB 3A12A 2M52A 1L3KA 1RAEB 3BKUA 5ETLA 4CLKA 1WF1A 2MKHA 3DM2A 5HMXA 5HVHA 4RW4B 1HNVB 3PRBA 4CIOA 3G4SS 4KPYA 1WCJA 3TAMB 1A0OB 3OW2R 2OELA 4ED8A 5D4NA 1WC1A 5AT1B 2BJ3A 3LH2S 2J6UA 4Q0BB 3MAHA 4OHYA 1FT8A 2A6OA 4WBFA 1QM4A 1X5SA 1VIXA 2AEJA 2MPUA 4OQJA 3FRZA 2OTLS 1ZS6A 2LDYA 3VGUA 2KVQE 3NRBA 2HHUA 4PXEA 1S0VA 3I07A 1T95A 3EX7B 5LMNC 2RQKA 3K89A 1LWFA 2V34A 1FERA 3DRRA 3SDEB 2Q6BA 4OHVA 2BE2B 4DUZF 1MROA 4DV4C 2GIRA 3V4IB 2B7BB 5IXUA 1VRQC 2RU9A 4FVCA 1VRUB 5M2RA 2C22A 1YBTA 1U6BA 2YQ3A 2KL8A 1BQXA 3R7BB 1FWPA 1VLYA 2ROPA 4RW9B 3HT3A 4DR3J 3H5UA 5KFNA 5DG9A 2Q43A 4FYYB 4MFBB 2RS8A 4ZA1A 3SCLE 2DT9A 4P72A 1VQ8S 4L7IA 2ZITA 3R9LA 1LV5A 4JI1F 2DNKA 4FPRA 4I0WA 4DFKA 3QJLA 2DR6A 2CNKB 4FTFA 3CVKA 2VKZG 3QGGA 1OYDA 1LW2A 2HZVA 2D9PA 5ETMA 2H4WB 2CPYA 1URNA 3S82A 1DJ0A 1X4EA 3PYGA 4MKBA 2HNYA 3AF6A 2V2QA 2ZH9A 3CCMS 2NUHA 4LIWA 1CG2A 2E5IA 2VFUA 3FJ2A 5IC6B 3KLEA 2HZCA 2HS0A 1OS5A 3M4XA 5F0UA 1IKWA 1LW0B 3CJSA 3TNVA 3MUVP 1K8AT 4OZJA 1C1BA 2G0CA 2W9BB 2FDNA 2OHDA 3MCSA 4CO3A 2QV6A 2HW3A 1E6VA 4G1PA 1E6YA 1KD1T 3NLCA 4EBEA 2VZ9A 4P6QA 1FJ7A 5IFIA 1IBMC 1CJTA 4U6PA 3MDFA 3ZFVA 4BDPA 4F04B 4UUWA 3TX0A 2UXBJ 1RDRA 2DCUB 5J1NA 2VF3A 4J9OA 1VLAA 1A6LA 2W4CA 3O8WA 5IOLA 1UZDA 2BR0A 3IR7B 4AXIA 3NGRA 3K17A 3LW5C 1NSQA 4DR6C 4C8KA 1HHQA 1AW0A 1UP1A 2F8MA 1TK5A 2V4JB 3OPKA 2V6AA 2ZC3A 2HEKA 2UVUA 1ZH5A 3K8WA 4QIGA 4AYBD 1T3OA 2HBQB 1EKSA 2EFNA 4MK9A 2YWEA 3MMBA 3POTA 2NXUA 2RDDA 3FZBA 3ZZOA 2ZH4A 1HNZF 2Y4OA 2DITA 4LIRA 3GKUA 4BSZA 2LCWA 4KJIA 1FD2A 3AQPA 4KRWA 1M5OC 3NYRA 1RWUA 3BB5A 3GJRB 1XRCA 3SYZA 1AUDA 1NDCA 2YH1A 3BEGB 3H2UB 2HFOA 4K2XA 5GAGU 1HYSB 2E9TA 2YCBA 2NPFA 3AB2B 3PESA 1M5HA 1YQHA 1SJ1A 1RAGB 2GW8A 3QT5A 1ZM2A 1FKOB 1XMBA 3OL9A 2FTRA 4PAAA 5E33A 2BE7D 3FBFA 2RNEA 5HMWA 1X7VA 1FTRA 2JFDA 2PC6A 2CQ3A 4WFAQ 1IN0A 1AT1B 4TKTA 2BVZA 2LQ5A 4NXNF 2QGFB 1H7XA 5KG0A 2PT0A 2YNIB 3WHIA 2R2UA 1T5DX 3DKDA 4QWBA 2PN6A 3P5TL 2RSQA 2B6AB 1M90T 2ZZNA 3LF0A 3C14B 5F3TA 1S1WB 4HVZA 2P2CB 2V2VA 1S0MA 2XBPA 3N5FA 4PYAA 2CQ4A 1D1UA 1DTTB 1B7FA 3NGSA 1GEHA 4YOEA 4J9KA 3BBCA 5CZVA 5C24B 2WSCC 4IKAA 3MM7B 4NOHA 2FVQA 1DTQA 1NDLA 3KK1A 4EZ9A 1U0HB 3G96A 4IUFA 2XTJP 2VB6A 3PW4A 1P1TA 4DG8A 3AH6A 1P8GA 3R5DA 3ZZPA 1WC3A 2HNZB 3I5CA 4O23A 5F8LA 5E5NA 2YKPA 2K06A 4ZLPA 4JV5J 4K4ZA 4A8XA 5HBMB 4EI2A 2GC8A 3T9ZA 2XNRA 1FFSB 1ZA2B 2H48B 3POTB 4F3MA 2J6TA 3QRRA 4LFAF 4RM2A 5AE3A 1GMVA 3HM9A 4ECRA 3KK2B 2VFVA 3CB4A 5K5MA 2QG9B 5DDRC 2GS8A 4IR1A 1V25A 4CZCA 5J1EB 2E7GA 4X4NA 1SL2A 1Y10A 4OI3A 4IRDA 4LE5A 2MZQA 3H5XA 2OLWA 1QTNB 4A8MP 1T3NA 1PJ5A 4EU0A 1DY3A 2HVZA 3TUPA 5BSMA 1WJ9A 4TVAB 1NB7A 3A8JA 1TL5A 2KT5A 4NRUA 4TLQA 2VICA 2RT3A 2R8JA 4LF9J 3HMJG 1YK9A 3PFOA 3Q86A 4NMXA 5KFMA 2W9CA 4ED5A 1MNEA 4V1Ak 2KZMA 1U1NA 4KPCA 4Q43A 2HMIA 1P6TA 2QSFA 2ZH6A 4IRKA 4ZKAA 3MEGA 1S76D 4D56A 2B4PA 3WX4A 1FO1A 4FKXA 1RT2B 4ZJQA 4NDNA 2VPWB 2YWWA 3C19A 1H98A 3QGIA 2IRYA 3KWMA 1IKWB 1JNRB 5KT3A 1PBAA 5KT2A 3DLGA 4EYIB 1HNXF 1N34J 4ZN3A 3CW8X 2HPUA 3M8PB 5K8OA 2Z30B 2CQ0A 3LWMA 2MKCA 1YJRA 4QR2A 5T41A 1GNKA 1U7LA 5D77A 2HQ3A 6FDRA 4MK7A 4WXOA 5A1GA 4QYRA 1Z2ZA 4TY8B 3M6XA 4RUHA 3KK3A 4DOZA 2CXCA 2M9KA 4M1KA 4N7TA 4NYZA 1MMLA 1Y3JA 3WC2A 2YWBA 2XY6A 2Y1RI 4NLTA 2VQEC 3HSGA 3UDEA 3OVBA 1P4EC 1TP7A 2Y0SD 2X1GA 1WI8A 2ZZTA 3AJDA 4R1LA 1N33C 2XLIA 1T9VA 1FJGC 2JDJA 3H0PA 2BOPA 2BRKA 1S99A 1H7WA 2WW4A 4WK3A 2MKIA 3R2CJ 1TKXA 4DCVA 4ECWA 1SCJB 4OZNA 3TA0A 4CCHA 5JVGQ 4K4XA 3GWCA 4RPFA 4USHA 4DL4A 1NU4A 3QATA 2XMTA 2B3TB 3K7RA 2EKNA 3BJYA 4C8LA 3OT9A 3IBWA 3VZIA 2OSRA 4NEYA 4RWWA 3WBZA 3H4BA 2KI2A 3EGNA 2RJZA 1H74A 4PWUA 3M6WA 2WVBA 4X4PA 3Q22A 5D78A 1PAUB 2QA4G 2DB1A 4GKKJ 1VRTB 4RUAA 2HGNA 4EYHB 2RH3A 3RB0A 4C3LA 1FJEB 3S6EA 3GCXP 3PNIA 4OZ3A 2AJFE 1IM4A 4I6YA 3BGOP 2A10A 2PSZA 1KONA 2YX4A 4RUBA 4UQTA 4EFAC 5KFLA 4CDIA 2P2QA 1NH8A 4OZ0A 1HYSA 2GVDA 3ETCA 4ZVRB 4R25A 1NPKA 5M2UA 1RAIB 4XK8C 3OQ2A 3CC2S 4F36A 2ZOGA 3K5PA 4RBUA 1C4AA 2ZBRA 2GO9A 3TUIC 1VQMS 4CLYA 2CKWA 3OD2A 4JI5F 1YZ7A 2YXLA 3DGPB 4F0KA 1FVQA 2D1QA 3KJFB 1QVFR 4EO6A 4A47A 5KFVA 1H38A 2VOOA 3KLGA 1HQEB 2NS1B 4QCLA 4MH4A 2YX1A 2HAIA 4H54A 4WCEQ 4WU2A 1MXAA 2Y1JA 4RU2A 1Q0NA 2KO1A 3JSMA 1OSDA 3D4JA 2HURA 5D6GA 4USTA 1NHKL 1MMDA 4UQGA 2BE9B 3MHYA 4DV4J 1KTVA 1G2EA 1UJ5A 2CQDA 1MXBA 3C6TB 4DN9A 2E1AA 3OL7A 5DGAA 3EXCX 1ZYQA 3NNCA 2J76E 2J0WA 1EARA 3UWTA 3H5SA 3M05A 4RWXA 3EERA 4C0BA 1L3TA 3J7ZT 3CEDA 1YRUA 4ZITA 4DG9A 1VQLS 5JRHA 4DV3C 4OJGA 2CDRB 4DV3J 2HHSA 4DUZJ 2BJOA 1BLUA 2DEJA 3IS9B 1X5TA 3H98A 3S7RA 2QMWA 4TQRA 2NR0A 4AXJA 3VCDA 5HLFA 1F5CA 3DLEA 5C5JA 4PCQA 1B7YB 3GP9A 4Y2KA 1TH5A 1BC6A 3A8KA 1U4BA 2ZKTA 3KJVB 2YWHA 1IBLJ 1CJKB 3L9ZA 4OYIA 4KC5A 2PFFB 4R5PA 4B3OA 1X4BA 3NGUA 3QGHA 4R1MA 1XNQC 2D3ZA 3CD5A 2MQ8A 3O3LA 3TVKA 3MTKA 3UCZP 5J2PA 2DBBA 1J5EJ 5KOXA 4D57A 3V4IA 2G2ZA 7AT1B 1S12A 2WONB 2K7JA 3IAS9 4CLLA 3CTRA 3W2WA 1YJWS 1RY2A 4G36A 1S9FA 2RE1A 3CCJS 1HWJA 1GPMA 1S97A 1HPZA 5EHHA 2Q66A 1JLBA 1XMQJ 3QLHB 1N36C 2ASYA 2DH9A 3NGTA 1ZA1B 3FSIA 1RTDA 3R1HA 1WC5A 4MYUA 1Q5YA 4G1QB 3OSNA 4I67A 1KFDA 3TP2A 2BH1X 3C46A 2O01C 2DY9A 1H2UX 3EUNA 3FFIA 2ZH7A 1Q5VA 1IQTA 4ALZA 4X4OA 4S0MA 1UVLA 3GJQB 4M5DA 1RWWB 1T0TV 1T7PA 2F3JA 1KLNA 4LFCC 1RT3B 1EIYB 4B3SC 3B8HA 3R3TA 3MD1A 3BGFA 4J5OA 3SQGB 3OUYB 3J7AN 4QPTA 3LO3A 1HBNA 3TZYA 1I94F 2HVDA 1JK9B 3IRXB 3N4WA 4TXSA 1CQMA 3UE2A 4DSIA 2DNLA 3HZGA 2PMZD 5KFTA 2JEGA 3NNAA 3K6RA 4JI2F 4R0MA 4DR5J 1EETB 3N9UC 1YX2A 2MKSA 3PJXA 2DGOA 4CLTA 1TL4A 4LF4J 2D28C 1R6YA 1BY9A 1C2PA 1GXTA 1RYSA 2M8DB 1S1TB 2OPPA 3H20A 4DR2J 3PXGa 2YWKA 5KFBA 1SUQA 2QL8A 3B6BA 4ZPAA 2RQCA 2VG5B 3QRPA 1BWEA 1TTHB 3J81Y 1T9UA 1RBOB 2C2ZB 2WBMA 3N0VA 2UUWA 4ED4A 3Q8PB 2R7TA 3G2XA 2PEHA 3HHLD 4OI4A 3SSQA 3IC1A 4DPTA 2P8IA 4F3QA 3T1YF 3AFGA 5HP1A 2FB0A 3HLUA 3PHTA 1Q8LA 3NG8A 2CQBA 4Y2CA 4U7UD 3PRVA 2H5IB 3OJSA 2YKNA 4JV5F 2ATCB 2EPIA 1LXJA 4L73A 1SVDA 3CW9A 1WSRA 2XZTB 3HX9A 1SBRA 2CJ9A 3THPA 2VJUA 3IP0A 1VK3A 2W01A 3Q83A 4AUKA 4Q2LA 1AMUA 3TRGA 3GG1A 1KN6A 1IM6A 3EICA 3DN9A 2C3MA 3FUYA 2MLXA 5ETTA 2PT7G 1RXOB 5HK4A 1BQNA 4WPAA 4Y0FA 3TVZA 3D28A 2UP1A 5CYMA 4IG3B 2MEWA 2VPXB 3HZEA 4PG5A 2F4VJ 2RF2A 1K0VA 4YR3A 2XCAA 1SC1B 1EHWA 1XN9A 2VG7B 3CJ4A 1AZSB 4DL0C 2ZOMA 1GMUA 3MMAA 4OZLA 3SEOA 5IT4A 4BCAA 2FLLA 1N32F 3W63A 1AB8A 2HQDA 2R9LA 2NCKL 5LJ5Y 2XY5A 2XGPA 3LGHA 3CJ3A 3H40A 2M0GB 1F6TA 4DQSA 2QVZX 1RT4A 2HQGA 3ET6A 2DO4A 2EC2A 3I0SB 4O0NA 2OPSA 1NHUA 4Y28C 2AU0A 4K7QA 2J8SA 4IOAQ 3V6JA 1KBRA 2G0IA 1V5VA 4CO2A 3NOGA 1X8DA 3EXYA 3CQ2A 4CQ1A 4YHHC 3A26A 1ZOTA 5KFCA 3ZTQA 2DGUA 3Q8VA 2D3O1 1HNIB 1HBUA 2DNNA 4PEOA 5CXTA 1NH7A 1RBAA 3T6BA 1KEKA 2N7YA 1XQIA 1MKYA 1M6XC 2CQCA 2CVEA 2D9OA 2F5GA 5B0BA 4ZLNA 3T9NA 6AT1B 4URGA 3M2RB 4L2ZA 1VHFA 1UEUA 2VG6A 4UW2A 4B9TA 4RW8B 2BRLA 1RWVB 4K5RA 2VBXA 4WWSA 4I2QA 1U02A 3GV5B 3LP0A 2OJ3A 1HH2P 3CCVS 3IN5A 4AD6A 2IBKA 4KH0B 4RU9A 1HBNB 4ES1A 3UZ0A 2K1RA 2B5JB 3MFHA 4TN2A 1RHQB 3OR2B 2KXNB 2C3UA 2F8HA 2PMHA 4HL9A 2HG4A 1FE0A 4A48A 4DUYC 1I94C 2VQFJ 1S6UA 3CD0A 4EUVA 1NM2A 4RBVA 4DV2J 3GR1A 4N76A 4NXMJ 4F2SA 2QX0A 2NZ4A 1FFWB 1FJCA 5H9FK 1WH9A 2AGOA 2VUGA 3RV2A 4F4KA 1F3VA 3SZ2A 4DL6A 1XBWA 2J9DE 2KXFA 2V4JA 2E7WA 4O44B 1YTYA 4JV1A 5FJ4A 3IRWP 2EG2A 9ATCB 3VVUA 3CCQS 1TAUA 1MDBA 5KG4A 5HQLA 1IWGA 1F1BB 1T9YA 2CZVC 1N5YB 4RX6A 4GC7A 3NPDA 3IGNA 1OO0B 4KT0C 2XWYA 4DSJA 2YKMB 3C66A 3CJ5A 4X66C 1CLFA 4DV3F 3VAKA 4A8SA 1RK8A 4PUOA 1O90A 1FK9B 1RTJB 3NS7B 1F2GA 2OPLB 3JSYA 2LYVA 2Z2LA 4OJHA 1AXQA 2KRBA 2BQRA 3OL6A 4FBTA 1HWLA 2GAHC 1FXDA 2OPQA 3KDOA 4RW6B 2BJDA 4Y34A 3LNVA 1TL7A 4FVMA 2DEIA 1HIYA 1BUXA 2XCPA 3DLPX 3R6GB 3CIZA 5KFZA 4LR8A 2R8HA 2P2MA 1RZMA 1LW2B 1XR6A 1EETA 2W4DA 4LF1A 4LUBA 5E3CA 3ZZUA 2XLKA 5KYTA 1DLOB 3SV3A 2X1BA 1HNWF 2JJ4D 3EMTA 5HP1B 3BSOA 2DGWA 5SUHA 1T05A 1GK8A 2MQPA 1PILA 1VMBA 1SJRA 3T5LA 4RNHA 5E7QA 2R7RA 4MKAA 2CZ4A 2AX1A 4ZCKA 1QWIA 2D41A 2NSCA 2EK1A 3R2DJ 2B43A 2E1RA 3MF5A 2GX8A 3UX2A 1JIHA 3SCIE 2PFDA 5HROA 5I3UB 4NXMF 3F44A 2CG4A 4XTTA 5RUBA 3I4PA 3CJTA 2IDLA 2ZH5A 3THTA 1RHKB 1IBKC 2EFGA 4C8NA 1NY8A 4Q45A 1DHMA 3PV8A 4WS9A 5ETPA 5AE2A 2DH8A 2WOMB 5C42A 1Q4RA 5FLXU 2XZDB 3H5YA 4ATNA 3UD3P 4K4SA 1HD0A 1UMJA 1N4LA 4N47A 3W8GA 2GZOA 2H65B 2GMHA 4OYOA 4TLRA 4YEAA 4EGLA 5C25A 2LEBA 3T1HJ 2A2DA 2R7QA 4ZPDA 3KJQB 1VOMA 3ZTSA 5K85A 2XGQA 1IBLC 3DM2B 1X9SA 3QQCD 2OO4A 2CJYB 2VU5A 3NKYA 3UVJA 3TOQA 3CMES 4PG8A 2KFYA 2ZH3A 3HCXA 3MM5B 2DK2A 1V9OA 3CIMA 4YR2A 3IMLA 2VIHA 4D4IA 1HNWC 1GFWB 4ZS6A 4A8WA 3UCGA 1AFIA 2D1SA 4DR1C 3VAJA 3MI7X 3D3BJ 5KFYA 4Q5VA 4DX5A 2ZDPA 3LWLA 2CJQA 2F63A 3FK4A 4DCOB 2V5HG 3W5ZA 4URSA 2VPYB 5IV3A 1XC9A 2UUAJ 2Y3YA 2HHXA 4MTNA 4NCGB 4PUHA 1OQ6A 3DOKB 2OTJS 2KHCA 3ISND 3M2UB 5D15A 2VBWA 1H3DA 1U6FA 2CQ1A 4RW7A 5LMNF 1T8EA 3KHGA 1FEHA 2E44A 4ZIWA 3KLFB 3MM6B 1P9QC 4DX6A 2JVOA 3OHBA 3VAGA 4CYUB 1J5OA 3BGLA 2QYGA 2MQLA 4K4VA 4DSEA 4HTJA 2XR1A 2B4UA 4ZVHA 3UPFA 4GS5A 3PW5A 3C6TA 2WB4A 3DI6A 5EWGA 2D3UA 1UZHA 1HBMB 3KUGA 4P2FA 5G0RA 2UXDC 1WEYA 2EW9A 3KJVA 2MSSA 2FLPA 1TL3B 2OPRB 3R27A 1WDDA 3WX8A 1UVIA 2FJAB 4Q2MA 1L5UA 4JI1C 4C8OA 2F40A 3V4MA 4K0BA 2XSJA 1VHIA 2XMWA 3NWRA 5HANA 3W7BA 1WEZA 2HRTA 4TYAA 2E1PA 3P6YC 1RHRB 3NMRA 4BLGA 1YWXA 2IC3B 5B0CA 3DHVA 2IJFA 4P7VA 2BBEA 5FD1A 3BSAA 4ETXA 4F26A 5CQGA 1ITPA 3ETOA 4ANDA 1BA3A 3OHAA 1N33J 4C6AA 1YJ7A 1CJVA 2XG8A 3DGPA 4M94A 4L3KA 3IR5B 3VTIA 3LUSA 3DYAB 1S1XB 4PKDB 2FC9A 3SFUA 2KH9A 1HARA 3M32A 2V69A 4DS4A 3VVTA 2HQIA 1HI0P 3W3SA 2XY7A 1T9WA 2IVYA 2R3VA 3A3NB 5A6WA 3W2VA 1GXUA 2DH7A 4Z7CA 2MM9A 2JX2A 2OPLA 4I9FA 4CYUA 1U6ZA 4ZP8A 3M8QB 2VG5A 2HWIA 4JB8B 1M5PC 1LWXA 2UUAF 4B9MA 2RDIA 5EUHA 1L2FA 2QYCA 4XDCA 1VYAA 1Q53A 4L76A 1HQ2A 4B17A 3DOKA 2GJ2A 1S1WA 4RO0A 4ED0A 2DD8S 1PGZA 1IKXA 2J9CA 3MMCA 3NCQA 2IA0A 3G82A 2UV8G 3K57A 5DGBA 3DU5A 3R1LA 2GCFA 1HNZC 1TK8A 1MG7A 1ACMB 2E5GA 1U0SA 1G3OA 2DJWA 3DOLA 4TYBA 4FNHA 2IC3A 2ABYA 4WE1B 5L39A 4JI4F 3W8PA 5E0OA 4IOCQ 1AA1B 4LVNP 4WP3A 1X9MA 2WHOA 3LP0B 3QT6A 1SJFA 4J9MA 1R0CB 1RTJA 1Q81T 1ZAXA 1IWAA 2V8PA 4NRTA 4OZ2A 4DG1B 2KG0A 4IYQA 4UTGA 3FCVA 2AT1B 4QBUA 4WFNQ 2R8IA 1DAXA 3BQ0A 2J6SA 1S0OA 2DXFA 4RLFA 3AJ1A 1FDAA 4FKYA 1WORA 1F5AA 1XMQF 4GO5X 1SKSA 2FLOA 3ENVA 3ONQA 5AJ3F 5F8MA 5L9XA 2CUYA 3VQTA 2W1BA 5C42B 3MM7A 2FZGB 4V19X 1BHNA 1HI1A 4NOZA 4BBYA 2J5AA 2B9YA 2J0QD 2MY7A 3N6LA 2XC9A 4P9SA 2R2SA 5D3GB 5LCIA 4ECZA 1U1MA 4LF6F 2R8KA 3QSYB 3V6DB 3QFHA 3PEJA 5DQIA 1NK6A 2FJXA 4NCGA 1RT4B 2LXUA 5LJ3Y 4YMEA 4GKKF 5HQ8A 2IHR1 4QWEA 4OFZA 5A8RA 2XLJA 1VISA 4WFBQ 4HR2A 5ADZA 2ASLA 4PXBA 5H9EJ 4OHZA 1UPPA 1RT5B 4ES3A 2OPSB 3ZZYA 3W2WB 2XMUA 3KLIB 2DR8A 2RF2B 1MDFA 4NZ6A 2A0FB 3SCKE 2FJBB 2AJ4A 3K58A 4LQ3A 2D1TA 2DHHA 2IM0A 2WCXA 3ZZ0A 1S48A 3CJ0A 4DV7F 4CNZA 1RJJA 4Q44A 2QMUB 4JV2A 4LRAA 5KG2A 2W2PP 3F41A 1XNQJ 1VFJA 1HHSA 3BF4A 4M5GA 4DR4F 2XMVA 4LMZA 3UN3A 4CT8A 4LFAC 3PDNA 3EDQB 3IAM9 1OQ3A 3ULHA 5DDQC 2UXCF 4WE1A 4DR6F 4NLOA 3Q2TC 2QLJB 5D4OA 1TVRB 2VQFF 4MTPA 3PCOB 1MSWD 2JFKA 4GXRA 4JI0J 4RVNA 2DVIA 2I1RA 4OYCA 1X4CA 1WDTA 3RG6A 3FBEA 2D74B 2QO3A 1FX4A 4DSFA 4USKA 3OVAA 1K73T 2Z0GA 5C2GA 2DCLA 3FGVA 4Y65A 4NLWA 1B4SA 1RABB 2JH3A 4HT5A 4CRJA 5IWAJ 2RU3A 1RTHB 3W2VB 2DYAA 1NUEA 4I1TA 1U1LA 2PN2A 2IVFB 2BE2A 4FUTA 4DBQA 3RGIA 3BBFA 3AA9A 2DNMA 1DZ5A 4B3SJ 3TUFA 4K4TA 3PVXA 1HA1A 1RT6A 1S1XA 2OFGX 3DYAA 3ISNC 3AD9C 3FC9A 4YHHF 1M1GA 1REVA 4HDHA 2W9BA 4JBCA 4RBTA 4DJBA 4LSLB 5KTQA 3OR2A 2UUCC 1CQNA 4OYAA 1V60A 1UWAA 3GSIA 1TL7B 1X60A 2YNIA 2MMAB 5KFEA 2P9EA 5KEIA 4UY8T 4GRSA 4UY85 2DGQA 1TAQA 3KHLA 4OYZA 2HNDB 4A8OA 2YNHA 4F4ZA 2PDAA 1X4FA 3OUYA 2XYPB 4WXWA 2ZH2A 4J9LA 2RB7A 1N34F 4NCBA 2P2FA 4ZP6A 5BUSA 1MMNA 1VC0A 3PBKA 2DNYA 2VOPA 2GVZA 3R7NB 4C8YA 1ULRA 4DV6C 3QT7A 2DGXA 5GMKa 2AQ4A 5B0GA 3ETMA 5HN0A 3Q0AA 5DDPC 1RAOA 1NSPA 2QN6B 2WSFC 3OTCA 1JKHA 2R42A 3TAPA 3AXMA 1MD9A 4DL3A 2JSXA 1MN7A 1P1LA 1RE1B 3DMJA 3SIPB 4WKYA 5BURA 4QWDA 2AYMA 4B02A 2M7SA 4BWMA 4RW7B 2FUG9 3TQEA 3TQIA 3O2EA 1YSJA 2JNVA 3MPDA 4J7CA 2JEJA 1HR0C 1IBKJ 1Q79A 4W92B 5KG5A 2KZZA 2CPJA 1R8AA 5ITHA 3J80Y 2QT7A 2MSTA 3FCHA 3JTNA 9RUBA 2CIMA 3KLVA 3QWPA 1RTDB 3BREA 5LMUC 1KKGA 3H59A 1GMWA 3GLJA 1WELA 2AJ1A 5A6PA 2HGLA 3CJEA 1HWUA 5I3QA 1FNXH 1IBMF 2PI4A 2RILA 5SZTA 1VC6A 2AV5A 4DR7C 4GVBB 2DIVA 2CJBA 2MZRA 2OMOA 2RAQA 3HVAA 4NCAA 4PUIA 1SKUB 2F4VC 4LF4F 3M8WA 3W9HA 4DCUA 1ZPVA 3US5A 2G2YA 4KQZA 4M5IA 4DG1A 2MZ1A 5FLXD 1SH0A 1VR6A 4G65A 4DR1J 2NCLA 1VS3A 3W5XA 4DHVA 4K5SA 3NAHA 3DRPB 3VNRA 1U8WA 2BW2A 3FZ2A 5C25B 2HJGA 4JI6J 3UDLA 3JAMD 1CJUB 2VD3A 3ENAA 2UVRA 1IVZA 1H2TZ 3DRXA 3PO4A 4KGVB 1X4AA 2E9ZA 2QZ8A 2DISA 3G7SA 4H4MB 4B08A 1Q7YT 1JLBB 1X0FA 4PZVA 3C6UB 4ZMMA 2OGUA 2KG1A 2VQEJ 5KAKA 2DPIA 1ULTA 1OY6A 1Y5IB 3A13A 3AA8A 1UVJA 2B4OA 2BANA 4QR1A 3BM7A 2GMLA 3TUJC 1VBZA 3UDVA 3P45B 2Z2ZA 4EK2A 4I68A 4WFXA 4X62F 1HR0F 2UUTA 2ZE2A 5KFDA 1FJGJ 1K9MT 3ZZZA 2IMWP 3J81D 1UVKA 3F56A 3VV2B 3A3PB 2F1FA 5LSRA 2GQQA 3ELHA 4NA1A 1QSSA 2V9WA 4JOUA 4PQUB 2JC1A 5L8RC 4R5PB 3MCNA 2IFXA 4ECYA 4MJKA 1CEZA 4F2RA 1MLAA 1S9GB 3NL0A 3NI2A 4XO0A 3C6UA 1YJNS 2VQFC 4PG7A 3I5BA 2C2EA 2BM1A 3JSMB 4UF4A 2E7XA 1R0BG 2ZJQQ 1S72S 3FVYA 1RLCL 1NPRA 1S49A 2ILZA 3OTOJ 1TK0A 2UUBJ 1TUVA 1N52B 2N4DA 5DQHA 2R7XA 4I7FB 2KJWA 3CUNA 1QDUB 1SJQA 1GX6A 1EP4A 1BE4A 4CTAA 3SBMA 3GIMA 4DUYJ 1I94J 3G86A 1HHTP 2R7UA 1P7LA 4HPVA 1HNVA 2N4CA 4FYVB 1F2HA 4C11A 4KTQA 1FE4A 1ZZNA 3P49B 3HFZB 2QC3A 4IDKA 4QPXA 5MAOA 2R2TA 1LWFB 1LWCB 2PROA 3T3FA 2KB2A 2MZJA 1VQ4S 1D09B 3VALA 4JI6F 3H25A 3QJPA 3W65A 4PABA 1WHXA 3HJVA 1W7WA 5IQQA 4EO8A 3RAXA 1URRA 2GQCA 3K59A 1N5YA 4B3TF 2Y8YA 2AEFA 3MM9A 1JLCB 2EKYA 4WJBA 5IFMA 3RAMA 1SUQB 1FA0A 1R8BA 1V3ZA 3BPDA 3SMZA 3DRSB 3DRRB 3I31A 2A3JA 1WKKA 1Q16B 4IO1A 3G8TA 4DS5A 4FF2A 1EQ0A 1OIAA 2CADA 4JI3C 4AQYJ 3FCCA 2V4QA 1XNRF 1FXRA 3MEDA 3CJ8A 2B6AA 3RB6A 4JYAJ 1WC6A 1WWHA 1C1CA 3ZTOA 1VK8A 4DL2A 2DYJA 1FVSA 1O51A 2Y4NA 3IRXA 3HP6A 2OD6A 1JLGB 4CLFA 2C2MB 1IQZA 3D0GE 4ZDNA 4J9PA 5J2MA 3BYPA 4X84A 1M5SA 1UPMB 1HBOB 2M5YA 3SQOP 3UVJB 4C11B 2VG6B 3DLBA 1JLAB 3SXLA 2IAJA 2W8LA 4NYOA 2HRUA 2AGQA 2AZ3A 4USMA 3CO0P 4J9SA 4OI0A 1XHJA 4LF5C 1YLXA 1UJ4A 2HGMA 3P3DA 4IG0A 4DSKA 1J2VA 3J7YI 4G1QA 3W9JA 4DQIA 1RI7A 2MKYA 4ELUA 2CA9A 3K0JA 4U8YA 2DR7A 1HMVA 2MGZA 1R0AA 8RUCA 1TKXB 1Y5NB 2HVEA 3NY0A 4GXQA 3UEBA 2LP4A 2B9XA 5KFAA 3E51A 4DZDA 3GTYX 4F4AA 3CULA 3BBBA 3FSXA 1V5IB 2P20A 3AAWB 4X64J 4ECSA 2NPIA 2RMLA 4N5SA 3EZUA 3DU6A 1U45A 5HAOA 5AXMA 4FP9A 4O3NA 3G71S 4IFVB 4DR4J 1JMTA 2VG7A 4P74A 5HQMA 1FXLA 1N33F 1IB8A 4OLPA 4NLGA 2PD1A 4AL6A 5F8IA 2UXBF 1X5OA 4W90B 2ZHAA 2VBYA 2B9WA 4OZ1A 3NGDA 1U2RA 2CJKA 2E5HA 4G1IA 4U96A 5CABA 3DHWC 2HFZA 3VNQA 2AZ1A 5FDLB 3TJ9A 4YB7A 1KOOA 3CF5Q 4M63A 2Z4PA 4B9SA 1JX4A 1UL3A 4F02A 2YNGA 1UETA 2L08A 5KOWA 4F8RA 4EZ6A 3BDPA 1G6BA 2OEJA 1WSVA 1KLMA 2K3IA 2LEPA 3CD7A 1TL1B 3FSYA 3R8YA 2P9GA 2HQFA 5LXRA 2G1HA 1S59A 3H2LA 1TZ0A 4U8VA 1GTEA 4OX9F 3OR1B 2I6WA 1KFSA 4DR5C 3SI8A 4D4GA 2M4MA 3LA0A 3MAQA 1PU1A 2A18A 1QUVA 2AYGA 4D3GA 3HSDA 3KK1B 3QSIA 4I69A 4NASA 3PIPQ 4BS2A 3BZQA 3DXSX 2BJ7A 3GV8B 4LF8C 4FDFA 4KO0A 5F41A 3FQLA 4DLGA 2KZFA 1AROP 2CNLB 2DHMA 2MKKA 2I38A 5KFJA 3PKYA 1WNEA 1PKUA 1UEVA 3CC4S 4DCSA 5A2QY 3JQKA 2H5JB 2I0XA 2JL9A 3TQ1A 2DPJA 3TR3A 5L1LA 1TKZB 3NP5A 2QVXX 2EFQA 2ROGA 1BGXT 1UW9A 1VQYA 2XYHB 2DIUA 4KE5A 2V2KA 5GAGI 2E8FA 3IG1A 1NAQA 1N48A 1GTHA 4QIEA 1N0UA 3N79A 5LOQA 4YY3J 4DV7C 3TEGA 2CRLA 5DG8A 2FPHX 3I0RA 4R0JA 4M5DB 4ZVQB 3ILJA 3MPYA 1SL1A 1P4EA 1RGVA 3T5JA 1UWBB 3P8BB 4ID5B 1PG5B 1PYTA 1WG1A 2FHMA 4ZVFA 2MQNA 4DV4F 5BR8J 2DNHA 1H2VZ 1RQ0A 4ECUA 4OX9C 3C14A 5AXNA 3PYEA 1HNIA 5J2NA 4D3HA 3VGSA 1FRJA 1FFGB 1HR0J 3PW7A 1RT6B 1FJGF 3GILA 2CDQA 3ZXWA 4W4MA 5DM6Q 5KYVA 2ASBA 4H4KC 2P6SA 1EZZB 1IBMJ 3EYZA 3JS9A 5LMUJ 2AWZA 2ZM6F 1HNZJ 2HHVA 2D1RA 1VQ9S 4GKJJ 1RWNB 1WC0A 2QFJA 3K5LA 4C0OC 3OL8A 4DR6J 1FUGA 2Z2MA 6FD1A 3D6FB 2JOQA 3GFZA 2AJ2A 1EB0A 2C2OB 2LKZA 2KKHA 2BEFA 4LF9F 2BDPA 1N8RT 1BXNA 2UUCF 5DQGA 4ECVA 1F9HA 1VI7A 2AX0A 2DXEA 1Q7LB 1TV6B 3BGUA 3CDUA 1KP6A 2ASDA 2VA3A 2RVJA 1C0TB 4K4UA 5T7LB 1XRBA 4FF3A 3F0NA 5LM7E 4JM1A 4X2BA 2MZTA 2M88A 2GGPA 3MR3A 4XPEA 2W2NP 1PYOB 3GE9A 4RW9A 1TR0A 4OYXA 3CXCR 2DNGA 1KHWA 2PEBA 3D0IE 4URQU 2WTFA 2KYZA 4X65F 4JI6C 4L3NA 4OV1A 2IPOB 2K2PA 5A8WA 2R7SA 3OTEA 2H1YA 4WU3A 2IMOA 5CCMA 2M5HA 1RU2A 4X4SA 3DGVA 1S1UB 4NXMC 3D6MB 2E1MC 1S9EA 1HMVB 3CJRA 5IM0A 1R31A 2MGZB 4B3RC 3M1VB 5E3PA 4ED6A 1R89A 1FLOA 4ZHRA 1EJ7L 4ICLA 4YQWA 4JI2C 4KYZA 4CO5A 1IBCB 1CBKA 1NK0A 4C8ZA 2ZUAA 4Q0BA 3HHKA 2IJNA 3UN2A 4Y2AA 3LPEA 1RTIA 2R7VA 1O93A 1AYEA 1B0TA 3TAMA 5GTDA 5D3GA 5LMUF 3D6TB 2WK4A 1WHVA 1APSA 3JAMU 4AE5A 5U47A 5J2MB 3RR8A 2HVIA 3A9UA 3ITHA 4O4RA 1W2IA 2GVDB 1QE1A 4A8QA 2DNZA 1D9DA 3D0HE 3KXWA 4O4GA 1RT1B 2K3KA 2FVRA 1K0RA 2GHWA 1YDLA 3OXLA 3PX0A 1UCNA 3KLHB 4DR1F 5EWFA 1NRKA 4C9DA 4PR6A 1KVIA 1FDDA 3DLJA 3S01A 3IEVA 5LT5A 3AQOA 2IRXA 5KFXA 2BJEA 3JSBA 3J80U 3L7UA 3N28A 4JI7F 5I42B 1RA7A 5F8HA 4Y2IA 1U09A 1FRHA 1T03A 2VC0A 2ATWA 5IWAC 3J81U 3V6KA 1JJ4A 2I2YA 1KR4A 2C3PA 1U8SA 2PMWA 3L7PA 1PAEX 1TKZA 3B78A 4ANCA 3D5MA 3VAIA 1F9EB 8AT1B 1QY7A 4B9NA 1UWDA 4ECTA 4FPIA 3WDOA 2AW0A 4JI8J 5F9NA 2ZHBA 3R5GA 3I9V9 1OY8A 3HULA 2KRRA 3DLHA 4F0MA 4X62C 3KNGA 3KUEA 3MECB 1QLNA 1JOSA 5A8WB 1KKHA 1XR5A 4HYKA 3DLLQ 3KMQA 1S4FA 1WOOA 3OTDA 1XMOJ 1E6VB 2B8QA 3Q8UA 2R8GA 4I64A 1S9EB 3CJQA 5IM0B 1NLKL 2CPXA 2DNRA
chains in the Genus database with same CATH topology
3GYNA 1Q8IA 1QAYA 4TY8A 4F67A 1TKDA 3E7WA 3CCZA 3T5HA 4LFCF 1N88A 3T1HC 2F7VA 2W7OA 3GQCA 4MMOA 3A9VA 2PA8D 2GGPB 2QMXA 4Z37A 3HVRA 4RW6A 4BC7A 1LFPA 3BO3A 1OPIA 5A8KA 1C0TA 1NEEA 4JUZA 2E8CA 1D9AA 1MU2B 4QW8A 4DF4A 1VRUA 3Q8RB 2FC8A 1QAIA 4K0KF 3M30A 5BSUA 2BANB 4KAIA 1YJVA 2E8EA 2UUAC 4KKOB 3NCRA 4B3TC 2ERRA 1U1QA 3DHXA 1S0NA 2KM8B 1LCIA 3A1YG 1JLQA 1U24A 5L38A 5L9NA 1A7GE 3T1YC 4PWDB 3R5AA 5J2NB 3NWGA 4C2MA 5B08A 1HQEA 2YTCA 3BO4A 3SV4A 4DL7A 4ISBA 4EATA 2KT2A 2V8GA 2WAQD 3B82A 1SIWB 1KVJA 1LK5A 2QA1A 5E41A 4L6V3 4XPCA 1BQMB 4DR2F 4JV0A 4NA3A 3N6MA 4LJMA 1IUJA 4RZRA 4I2PB 4H4OB 3TDEA 4I9GA 3NMAA 3RW7A 5KFPA 3HXMA 1D0EA 3C3LA 4WIIA 4EEYA 4Y6IA 5F3ZA 2FD2A 3U1NA 4RM3A 4DV0C 4OI2A 4PQAA 3M2VB 3MURP 3E2EA 3MWBA 2J0SD 4B9LA 5L1KA 5BSWA 1FRMA 1N32C 3J7Z5 2MYFA 3LP1A 1U1KA 3IFEA 4YFUA 3MD3A 5L1IA 1WG5A 1KOHA 3DMJB 3M1VA 4OIXA 4U67Q 3CMAS 2ZOFA 4WYWA 1SJ4P 3UW1A 3LGNA 4C98A 4DR3F 4X64F 1LWCA 3B4DA 2VBZA 4KO0B 2KFNA 2UUBC 3CCTA 4I6WA 3HKZD 5EDWA 4JI7C 2N7CA 4YDDB 5HL7Q 1EP4B 2YWFA 4CTAB 3U27A 2XMKA 4FXWA 2HHTA 3OTBA 3GMGA 2VSQA 1JLEA 2W7AA 3PY8A 2RKIA 3QIDA 4IG3A 4O3SA 5B7WA 4DUZC 4RMNA 5IT9Y 1SB6A 4KFBA 3KHHA 1VQNS 4USJC 5KG1A 4LT6A 1XERA 2YNHB 3GSDA 3ISZA 2FJEB 2G1DA 2OPQB 3DLGB 5B0FA 1VQKS 3ZZRA 4MYTA 3LQVA 2KFZA 1GX5A 3CE8A 2XS2A 1R3NA 3PFEA 4K50A 3TAQA 3BDEA 2R7WA 2LA6A 2VZEA 1SC6A 1J5EC 1USPB 5DO2A 2UU9F 3T1HF 4GKJC 2HWTA 1Q78A 1IKYA 3BR9A 4OZ5A 4DR3C 1HW9A 4LVOP 2XS5A 1DQAA 3ICLA 3CGIA 4LF8F 1V26A 3OXGA 4IQMA 4IQXA 3O44A 4QIFA 1VQPS 2MY8A 3GFXA 2DR9A 2D1CA 1FKAF 4X4VA 3OJUA 2ATLA 3QMQA 3UR3C 2MHEA 2CPDA 3IEUA 3RZAA 2XZWA 1WI6A 5B0DA 2P6TA 1Z2LA 3GG0A 3KLIA 1FRKA 1YBAA 4UOCA 1S1VB 1PC4A 3GFHA 4IFVA 3I08A 5KFKA 5IS2A 1N36F 2V8VA 5F8JA 4OJ1A 2QRRA 3K5OA 4O0IA 1QAXA 5DV9A 4DFPA 2HHWA 3N6NA 2CQPA 1HWIA 2CQ2A 2RQ4A 2FVCA 3E8OA 3H2TA 2VH7A 3FFIB 2B56A 1W25A 2B0GA 1J5EF 5E3RA 2M3DA 2UZAA 1O5JA 2DNQA 4DR2C 4KTTA 2IBOA 2M2BA 1R8CA 4RVOA 2I5JB 4DR4C 2O66A 1K1SA 2EFPA 2MQOA 1UVNA 3CC7S 1QAJA 1IJFB 1IBKF 2GNKA 2FHJD 1N6QB 1NJZA 4NXNC 4DR7F 3V2UC 1OSCA 2U1AA 4RW4A 1RT7A 5J2PB 2XI2A 3HJFA 5A0YA 3QPIA 1ELOA 2YNGB 3IG1B 1WD6A 4NA2A 4WZQA 4TNOA 4QU6A 4DEZA 1LKZA 4V19J 3ITHB 3J7A1 5J2QA 2CQGA 5FDLA 4EWTA 4LSLA 3CDAA 1YJUA 5J1PA 4C97A 1BQMA 4OJ3A 2V94A 4R0EA 1DRZA 4WFYA 4N8NA 2ZHOA 2OFHX 4Y3CA 4ED3A 1VIOA 1PC5A 2YY3A 5KT6A 1FESA 2ZVSA 2Y1IA 3DRSA 4OHXA 5AE1A 2X1AA 4JI4C 3HVTB 1VBXA 3M8SA 1FKPA 2LMIA 1MW7A 2FGCA 3HHLA 1C0UA 3OFHA 3CJ2A 3VR1A 4CI0B 3BSOA 2HHPA 3DC2A 4L72B 3MTJA 4ILMA 1XTZA 3K5NA 1XMOC 1JLFA 5D8HB 1WEXA 2J7UA 5H1SV 3JTOA 5CYJA 3OBIA 1TL1A 3SSSA 3LP2A 4RNFA 2R2RA 2RS2A 2LQBA 4P7TA 1TVRA 4ELTA 2N82B 3L09A 4YY3C 4F4YA 1LW0A 3QJJA 4CO0A 1HQUA 2JLFA 5EGYA 2P9CA 1DLOA 1KSPA 3HHNB 5GAHU 1PO6A 5BR8C 3MMJA 3OTOF 4GKJF 2RQMA 2UU9C 1RT5A 4HH1A 4ZPBA 3PJWA 1SKWA 2BABA 3VNSA 2L48A 2ZBIA 1M0SA 4E0DA 2VONA 2OAUA 3K8VA 1J5OB 2VV5A 4DLEA 4C4WA 1RT3A 2F9JA 2NLWA 1VRTA 2RRNA 4KV8B 1NB7A 4JI6C 3BQ1A 3GB0A 4F50A 1DARA 3TYTA 2BUNA 2G4BA 2W25A 3CCRS 3IPLA 2HRYA 5KFWA 3PIOQ 2L9DA 3M9NB 3EPIA 4QIVA 1RKIA 3ZC4A 3TA1A 4WF9Q 4FNIA 4RKUC 2ZZMA 4UUXA 2QIFA 2LQJA 3R5BA 1SH2A 3O2IA 3A4IA 2XSFA 3V6DA 2ONFA 1U48A 5M2PA 3GIKA 3MXHP 2WONA 4KHPF 4IDKB 5JUMA 5IQ6A 1JLAA 4NX9A 1N2FA 3TVYA 4B3OB 2E0GA 1Q1KA 1Y4ZB 2BM0A 2F9DA 1KHVA 3GYXB 3NGKA 5I3PA 3THVA 3M6UA 5E7OB 3KK3B 1RT1A 4U7CA 4ZVGA 1DURA 2DGTA 3RYLA 4KHRA 3AJ2A 2WOMA 2GHVC 2QEXS 4LF6C 2EVZA 3I82A 5HLFB 5CYQB 4R8UB 2CPIA 4IKAA 3CSKA 1BD6A 1SV5B 1F9FA 1V6HA 1S9GA 3BN7A 3DLKA 1B64A 2DPLA 1WF0A 4NLVA 2AF6A 3RB4A 2EFOA 2G13A 2VFRA 1WTBA 5FIIA 3UQSA 2EG1A 3L8CA 1JJHA 5CH7B 3M8QA 4B3RC 1Y7PA 2O3DA 4MKYA 3CO9A 3PROC 1O8BA 1Y3KA 2MKJA 1S1UA 4PPDA 4IFYB 5HMYA 5KT4A 5I3UA 4EBCA 4GKKC 2KDOA 3DRYA 1MXCA 3GV7B 4GO7X 3LUYA 1NKEA 1GQEA 3NAIA 4C3KA 2O67A 4RLEA 4WTYA 4AQYC 2ZNZA 4NZ7A 3V5RA 2CQIA 1MWZA 1O9TA 2W24A 3Q24A 3MR6A 3M9OB 3DCAA 5MLCV 2VASA 3PACA 1HFEL 1YRXA 3PW2A 1VBYA 1JWWA 1RAJA 3AY0A 3NCPA 5BSRA 1REVB 2CPFA 4HH0A 2MMYA 4YUDA 3MR5A 4N8OA 4C8MA 4LSNB 3X3UA 5G0RB 3RTVA 3KFWX 2OMLA 2XEXA 2YKMA 3GFYA 1XMOF 2P2BA 1RG9A 3PW0A 4PQUA 4RNMA 1KS2A 1R8HA 3CWJA 1G1XA 5BUQA 2XSJB 4JI8C 2EI5A 1U1PA 1FK9A 4RW8A 2DHAA 4ILRA 4X4QA 1TQLA 4DV5F 3HKWA 2QLXA 2D3OR 1NK9A 2YNFA 3DI6B 3BGRA 4C3MA 1IJEB 3T1AA 2RRAA 1KTQA 4TY9A 1XNQF 4FN5A 4H4MA 3MEEB 2XS7A 3HHEA 4LF5F 1S6PA 1N5VA 4H4KA 4QW9A 2B5JA 1ZTTA 3TR5A 1O92A 4X64C 3C8YA 3OVSA 3CJKB 4CO1A 5L1JA 2RRBA 1M5KC 3O1LA 2UUBF 2M70A 5DDOC 3BQ2A 3IA0A 1GXLA 3I0RB 2VKRA 4PPZA 4XAKA 1KNZA 3CCWA 3G6XA 3PR4A 1B0VA 2HNDA 2CY1A 2HVHA 1XK8A 3LAKA 1SIZA 1RP5A 2AYAA 1HBUB 3QO9B 2PI5A 4BWJA 4KTVA 2Q3PA 1FEEA 1DBDA 3MEDB 5K8FA 1NO8A 4YP3A 3M2RA 4NZ0A 4B3SF 3Q2SC 3AHPA 4USIA 4DFJA 1SQEA 4KR0B 2YNFB 4OLOA 2C3YA 4FUQA 3CT9A 4ZK7M 2QA4S 2YVSA 3E3XA 4PWDA 3RRKA 1RTHA 2V8DA 1N54B 3MEEA 5K8MA 2OH2A 3MMCB 2ZM6C 4B3MC 3EGZA 4Z2XA 2HLUA 1H6KX 1T05B 5GAEI 5GTDA 1YJTA 2M8HA 1IQTA 1LQ9A 1NK8A 2LQ9A 4A46A 5E3AA 4PROC 3HFKA 3M9MB 1FNMA 1VQ5S 3I87A 1HNXC 1YIJS 3DFEA 2J7WA 3MEKA 5A2QD 4DR5F 3T5KA 5LSOA 1R8PA 5BYQA 3OFEA 3M32B 3KLEB 2DHXA 1QJHA 4LSNA 2ZUGA 1NNDA 4XDDA 3PX6A 4B9UA 3QWUA 3I5AA 4YDXA 4GC6A 4KFBB 2J9EA 4TQSA 3MZIA 2IRUA 2W4PA 1D8YA 3KG1A 4X65C 3AB4B 1HBMA 1SH3A 2CVIA 2I8EA 5AXLA 3FQKA 4ECQA 2XWXA 1WTFA 2LECA 1X0PA 2Q1LA 3KG0A 4DWIA 1QSYA 3PM9A 2WSEC 2V8HA 4AQYF 4MIBA 4DF8A 2JMPA 3KOAA 4YHHC 2IM2A 2HHQA 5A8RB 3RR7A 4F4WA 2V0NA 2VPZB 1JLFB 3I56S 5K8PA 1S1TA 1FCAA 2OPPB 3FEYB 4Q8FA 4RNOA 2OD4A 4IO9Q 1SI9A 1OPZA 1U49A 4NLSA 5DLFA 2NYIA 2PO4A 2WB1D 2KVIA 3FEZA 1T03B 4NLDA 3M2UA 2GHPA 2X51A 3QIPA 2AYBA 3PKMA 4AFFA 2ADCA 3MM5A 4IR9A 2CYYA 3NNHA 2UV8A 1WG4A 5T8TA 1VC5A 1SXLA 3TANA 4JI0F 4X4TA 3OLAA 2NREA 5LSLA 1FKOA 1I1GA 1L3SA 3QO9A 4MIWA 1R7IA 4ZCIA 2CQHA 3MUTP 3U1MA 1VQ7S 1TKTB 1ZM3A 4IRCA 3HF5A 2AJ0A 3OLBA 1L3VA 1RKJA 4N56A 5IWAF 2BZ2A 4NL5A 2UXBC 4RUCA 1WHWA 4OI1A 3SO4A 3I96A 4DMZA 2DR5A 3LGXA 4BC9A 2QVYX 3G8SA 4NPOA 2XMJA 2LEAA 1P27B 1T5HX 4I6AA 1JLCA 1FRIA 1Y5LB 4KGMA 2EK6A 3CCES 2JEFA 1LQLA 2LDIA 3WZ0A 2OIHA 1IKYB 3I6PA 1V3RA 4QZVB 4QWCA 5KFUA 4OMFG 1NJWA 4DSLA 3LANA 1QSLA 1ZZFA 1YGYA 3JTPA