5CZVA

Crystal structure of notch3 nrr in complex with 20350 fab
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
243
structure length
225
Chain Sequence
ACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of activating mutations of NOTCH3 in T-cell acute lymphoblastic leukemia and anti-leukemic activity of NOTCH3 inhibitory antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Neurogenic locus notch homolog protein 3
total genus 61
structure length 225
sequence length 243
ec nomenclature
pdb deposition date 2015-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5czvA02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5czvA01
3ETOA 2OO4A 5CZXA 5CZVA 4ZLPA 3L95X
chains in the Genus database with same CATH superfamily
1UL3A 3C15A 5IWAJ 4IYQA 2VBWA 1E6VB 2HK2A 3DMJB 3UVJB 4WP9A 1HBOA 3A4IA 2DNNA 2JEIA 2B7CB 4Q8FA 3CC7S 3NGUA 4CT9A 1HNVB 1SKUB 3O5TB 1FKOA 2ZD1A 4G36A 1CS4B 4IFVB 4PXEA 3W64A 1R43A 4MT1A 1QVFR 5KFAA 2PN2A 3PROC 1TKTA 4NLQA 3WC0A 3OSPA 2AYGA 4DCOB 4EO8A 4CH0S 3GIIA 4DUYJ 2FHOB 3PV8A 3PEJA 2VSQA 5GVQA 3IR5B 3TEGA 3K7RA 3DOMB 3W5YA 1HIYA 2IBOA 3W61A 4OX6A 5HBMB 1R0CB 2R7OA 4NI2B 5KG6A 3NGDA 4AT1B 3ZZYA 1S12A 3CJ0A 2HRUA 3FCVA 4C97A 4ECZA 2CQ1A 4F02A 3R7BB 1CJVA 4LRCA 4RJVA 2ZM6J 2XSJA 4C98A 4DL5A 4LT6A 1VQMS 2DR8A 3J81D 5BR8F 1Q16B 2OMOA 4TKTA 5AXKA 4DV2C 1S9FA 3KLVA 1IKYB 4WV3A 2Z2ZA 4NXNC 2BYCA 1NYEA 3GG0A 2A6OA 3BYPA 3PR5B 1NLKL 4CO4A 5IFMA 3AF5A 2OUGA 3DDNA 1J5OB 2UXCJ 4UW2A 1NK8A 3E7XA 2IM3A 1B0PA 2CADA 4ZP6A 2ZWOA 5C7PA 2W24A 1WTBA 2RF2A 5D0GA 4X4NA 4MK8A 3VGTA 3EE3A 3H4DA 1GMUA 2XNQA 2HNZA 3IO1A 3C6UA 4P75A 2LEPA 2PT0A 4OZ2A 3THVA 4Q2MA 2VV5A 2R7VA 4O0NA 2DXEA 2GVZB 4X66C 2EK6A 3EX7B 3C3LA 2BX6A 2OPQA 2ZJPQ 1RYSA 2KTQA 3W2VA 2IA0A 1CEZA 4ZP9A 3C66A 3DOMA 4TU7A 2VPWB 3OBIA 4AL5A 3I6PA 1V3ZA 3VAIA 4RU2A 1RYRA 3POTB 4WKYA 4FDFA 4Q0BA 3Q8UA 1QVGR 2I2YA 3ZXWA 5J2PB 4OZ1A 4PG4A 4QWEA 2XMVA 2R4FA 3F73A 2G2ZA 3M6UA 2KT2A 3L3CA 4YQWA 2D3ZA 4Y2MA 1AFIA 4A8QA 1PG4A 4MKAA 4DFKA 1XHJA 3T3FA 3AJ1A 1WF3A 4QZVB 4WTOB 3DI6A 2DBBA 3LP1B 3Q0AA 1VC6A 4GKKJ 4DDFA 4DPOA 1R0AB 1OQ6A 5KAKA 4LQ3A 2IC3A 3I82A 4CM0A 1N8RT 4JV5J 2CRLA 1KHWA 3WX4A 2MZQA 4HTJA 3DXBA 1Q5VA 4X4PA 1SQEA 1IBKC 2F4VC 3BBBA 1T3NA 1MMDA 3HHLD 4JI0F 4DUZC 2PFDA 3Q8SB 3R1LA 4ZLJA 3W2VB 1SL2A 4NXNF 4NOHA 1JXEA 2M52A 5FD1A 2Y0BB 2PFFB 4LRDA 4UOFA 1T9TA 4DR3F 3UD4P 3M6WA 1T03A 2MKKA 3NCRA 2XMWA 2Z8QA 3GJRB 1F5AA 1ZOTA 2AJ1A 2A18A 2W2QP 3L09A 4Z7YA 2BJOA 2Y4OA 3DAYA 1NK0A 3OFHA 1Q0NA 2ZM6C 3HKWA 5A1IA 3DRPA 2DHMA 3TUFA 4CH7A 4DQPA 3HT0A 1HARA 1S49A 3K5LA 2B6AA 3VWSA 2QFJA 1RWUA 2KYZA 5CYJA 1V9OA 4OYXA 3VAFA 2KO1A 4ID8A 2X1FA 4BS2A 2ERRA 3QGGA 4X4OA 1CJTA 1RGVA 4ZPWR 1U48A 2YX1A 4USJC 4DU8A 3W9HA 1M1HA 1UAWA 2C2EA 1VBXA 5AE1A 1ZA1B 5U47A 3ENVA 2CWXA 5CYQA 1L3UA 2F65A 2DY1A 2IAJB 4HHHA 4NYPA 2AEFA 3GV8B 3DLHA 4B9SA 4FYDA 3GPAA 2RU9A 1GXUA 2AHOB 3IMQJ 2GQCA 4OZ0A 5CZVA 2JDJA 5KYVA 4LFBC 2E1RA 3RW6A 2JMPA 3LGNA 2OPRA 3SFGA 1PKUA 2J9DE 2NUUG 3RU0A 3MECA 4DPXA 4YUDA 1HLWA 1ZAVA 2F4FA 3M2RB 3PFOA 4LSLB 1T03B 2POKA 3CCES 1RLCL 2VQFC 2HBZB 4KH1B 1T02A 2I0XA 4QW8A 1N52B 1RY2A 4N56A 1HWUA 1O8BA 2YKMA 5B0FA 4ZJQA 5KFBA 3BSAA 4NMLA 3IWXA 2KJVA 2BOAA 2QEXS 4IKAA 1JJHA 4RBUA 3PACA 4A48A 3IM9A 2UV8G 3P5BP 1NAQA 5A6WA 5KG5A 1APSA 1RACB 1RUSA 1SJQA 1HKAA 1U6FA 1U8SA 4A47A 4DLEA 1NJXA 3CQ1A 3FDSA 2HFVA 2ZITA 4FKXA 3GV5B 2YXLA 2BQRA 2V4JA 2VOOA 1WCJA 1BQMA 4ZJLA 1FXLA 1N5YB 4B9VA 2E9ZA 3MMCA 4B3TC 2YNHB 4QIEA 3MEDB 2C1EB 2BW7A 4DCPB 3KLHA 3LGXA 4FN5A 1LW2A 2FDNA 3SQGA 4DR1F 2D7VA 1PJ7A 1KP6A 3DC2A 2NLWA 2OELA 3GG1A 3CT9A 3RG2A 2KDNA 1R0BG 2IJRA 3DGPB 2PN6A 3BM7A 1JQGA 1PBUA 2BJ8A 4JP8A 4DL2A 1X4BA 4GS5A 4O3QA 1RWWB 2JFDA 4OV1A 4PPZA 1NY8A 3QZ7A 3GCWP 4ZCMA 2FHMA 3E01B 3HHKA 1FJGJ 3DRYA 2K7KA 3M8SA 2QZ8A 3MMBB 3LP2A 2EKNA 2DYAA 2VG5B 4KV8A 5DQIA 3J81U 1U4BA 2MB0B 1HR0C 1RT1A 1OMSA 1P27B 3PTWA 1S6UA 2HKEA 4V1Ak 3IEUA 1Q82T 4PUHA 1YI2S 4C0OC 1ZAWA 3QWPA 4I1TA 5D15A 2HZAA 3OVAA 3EYZA 2OPPA 3K5NA 2ROPA 4RMNA 1TL1A 1RHMB 4OV6A 2FC9A 3M1VB 4JUZA 2FZCB 4BWJA 5M2UA 4OYBA 5KT6A 1KLMA 1SC1B 4I56A 3CC4S 1FNXH 2BJ9A 4F4XA 1U6BA 2OP5A 2V94A 4DBQA 3W62A 5SZTA 4PAAA 1NK4A 3AOCA 1RTDB 2DISA 4JI4J 2CUYA 3PJ9A 1LW2B 2IMWP 1Y5NB 4H4KA 2JEJA 2G4BA 3R27A 2UU9F 1PC5A 6FDRA 2RVJA 4AXIA 3PZPA 5EDWA 3DRRA 3QLHB 5M2PA 3EMTA 1TR0A 1C4AA 4WU2A 3AJDA 2V67A 4RBTA 2PC6A 3E01A 4QYRA 4Z37A 5DLFA 2VFRA 1PA4A 4ZK7M 4IG0A 2VG5A 2ZE2B 2YKAA 5CABA 1D9AA 5GADU 1A7GE 3PO4A 5T8SA 1C0UB 1VJWA 3ISZA 3T1HF 4KHPC 4NEZA 2AX0A 2R8GA 3KMQA 2CPYA 4RUHA 1FK9B 2XGPA 2JL9A 4EUVA 1FEEA 2EK1A 4M8LA 1G2EA 1MMNA 1SC4B 4JI7C 4DV3J 3J7Z5 3NNAA 4FXDA 2W7AA 2AD9A 4NXMC 1NM2A 1WD6A 1KONA 2H54B 4U6PA 2VA2A 4M94A 3GFHA 2BJDA 2ZH6A 3TWZA 3H59A 2MCQA 2GZOA 4P6QA 3US5A 2A0FB 1U1RA 2KYXA 3BN4A 2EFPA 2UUBC 4RVNA 3MF5A 3HZGA 4OX9J 4UUWA 4TYBA 1TV6B 1TP7A 3GR0A 3EGZA 4RNFA 4LF7C 4NRUA 1URNA 2UUCF 4C0HA 1KQGB 3KHHA 4DR7C 1JJCB 4UT4A 4R0EA 2B9WA 1K1SA 2KVQE 2QLWA 4ANCA 3RB3A 1L5UA 3DRSB 1VQ4S 1S1UA 2HZVA 3I07A 2HK3A 2GAGC 2ZEJA 5KFRA 4EMDA 4P2SA 1HR0J 3CJEA 1C0UA 3RGIA 2VDHA 3K58A 4FTFA 4OXIA 3G2XA 1UJ6A 4ZOSA 1E6YB 4M1KA 3IAM9 2HBQB 1KBRA 3PYGA 1ZZFA 2H3EB 2Z2YB 3CCRS 1S97A 4J90A 2AZ1A 1T05B 3BH6B 5L46A 2XM3A 3PG9A 5C24B 1JLFB 1VIOA 2HURA 4PXDA 3KG4A 3VR1A 1LXJA 2DH7A 4TU9A 4DV3F 5DGAA 4LFBF 4FUTA 1REGX 3GFYA 3S1TA 3I31A 1LXNA 2A6MA 3B78A 3AQPA 3M8YA 1Z2LA 5B08A 3KHGA 3VAJA 4KYZA 1JNRB 1L3TA 1MD9A 1N6QB 2E7GA 1BXNA 2HMIB 3DMJA 2HAFA 4O4GB 2MGZB 1CBKA 4C0BA 3TX0A 3RG6A 7FD1A 3CJRA 3DU6A 3O1LA 3W1YC 3PVXA 1R8BA 2GNKA 4F0MA 4DF4A 1FDBA 1VRTB 2DH8A 3DOLA 3S01A 4R5PB 2LQ8A 3PO5A 5KFQA 2E9RX 1B7FA 3L7PA 1MXCA 3M8QA 3ET6B 3HD2A 5CZXA 1N54B 1QE1B 2MKCA 2XLIA 1JJ4A 2EG2A 1S1UB 2FZGB 2WVFA 3S8SA 4IDKA 3CJ3A 5HBMA 1NCLA 5K20B 1VC0A 5ETQA 3C5EA 4OHWA 1F0XA 3S7RA 2OFHX 1HL6A 2K8GA 3HSGA 2QA4S 2ZFHA 2Z0GA 3PJWA 1LEOA 4NLPA 4YP3A 2E29A 3KUHA 4D56A 1WF0A 2XSJB 2ZBPA 4N7TA 4DV0C 2F1FA 2ADBA 5BSUA 3BDPA 5IWAF 1FNMA 2QLXA 2PIIA 4O3RA 5H9UA 1H6KX 3R5DA 3DLGB 1RU1A 2DPLA 1WOSA 4GC6A 4GKKC 2JZ5A 3KXWA 4GXQA 4USUA 4JI1C 5KG7A 1MN9A 1RT7A 1U45A 2YNGA 1GMWD 1Y10A 3J81Y 3M9MB 1KKHA 1C0TA 1NB2A 1RT4B 2RF2B 5A8WA 4ZITA 3B7WA 2X51A 5LT5A 2HW3A 4A8YA 2UVVA 1HHQA 2HNZB 2QL7B 3UD5A 4I0WA 2AEJA 3H42A 4Q2LA 4QWAA 2B9XA 1M5KC 2AIRB 2GVZA 1NH8A 1QE1A 3PIPQ 1X8DA 2RRNA 3BEGB 3H5SA 4KKOB 4XDCA 3TUPA 1YHQS 3JQJA 1EETA 1ZPWX 2NSBA 5FLXU 4IDKB 1SXLA 3QYYA 4OYOA 4ITSA 4RL1A 4DR1J 1ZB8A 2O67A 3MCOA 2GMHA 1DQ8A 3POTA 5T8TA 1BHNA 1CC8A 3Q2SC 1FERA 2CJYB 1JLBA 3FEZA 3RBEA 2QN6B 3MOJB 4MH4A 4HPVA 3ONQA 1U7LA 1X5TA 1TZ0A 2QYCA 3TJAA 1WEZA 3DM2B 3THTA 2M8DB 4NLXA 1X9SA 2BOPA 4A8KA 3D0HE 4CO0A 2F3JA 2F8EX 2PI5A 4ZDNA 1I94C 3GJSB 2D3O1 2R2RA 1GPMA 3DI6B 5H9EK 2MZRA 2ATWA 4V19X 1Y9OA 4Y6IA 2JVRA 4FBUA 2CJXB 5F8GA 2ZHBA 1UWDA 1JK9B 3FQKA 3EWGA 3KLGA 1RHKB 3EJMA 3NS5A 4KGKA 5KG1A 1QDUB 2PEHA 1RAIB 1NK5A 1FD2A 2BQ3A 4MTPA 2HQIA 1O90A 2VZEA 2OSRA 3AFGA 1UKUA 2QX0A 2YPYA 3D6HB 5D3GA 3J7A1 3D5MA 5L1JA 1B64A 2W9CA 2B8PA 1AZSB 5HN0A 2FIUA 2JEGA 3OVBA 1M5HA 1K44A 5CCLA 3JS9A 4U7UK 3PIOQ 3VNQA 2CDRB 1WACA 2MLZA 2MJNA 4F2RA 3ENQA 2RMLA 2V8DA 1X4HA 1IBLC 2DB1A 2D1CA 2DHHA 1TUWA 2UVUA 1RWKB 4DFJA 2UUBF 1NO8A 2EFQA 1HHTP 3MTKA 1IWAA 3ULHA 1Y5LB 4PQUA 5D6GA 3R9WA 2MZ1A 2WW8A 1W25A 1MXBA 4I9FA 1MU2A 3DOKA 3MPYA 4HT7A 1OY6A 3QO9B 3K57A 1SJRA 5A76A 1N48A 3HHDA 5KT5A 1CULA 1RB0A 4X64F 5HVHA 2A2CA 1X31C 1S0MA 1D1UA 2I9SA 2F9DA 2NZCA 4KR0B 5H9FJ 1WORA 3T1HJ 1EIYB 1BUXA 3GU0A 5HL7Q 4RLQA 2MQPA 3EGWB 1O92A 3QT5A 4UOHA 5AJ3F 1SL1A 5FJ4A 4M5HA 3MZIA 1IWGA 4DR3J 2UP1A 1LWXA 4KPYA 1XNQJ 1BQNB 3SBMA 2FY1A 4C8KA 4NLTA 4ZVUB 3K2YA 4ICLA 2CPEA 2MSTA 1HA1A 4PCQA 3QFWA 1REVA 4PPDA 1WC0A 2W2OP 2XY5A 1FRLA 2W7PA 1R31A 4LF4C 1TUGB 1Y5IB 2CG8A 4HDHA 4X4RA 4FS2A 2UU9C 2Q43A 3MM9A 3R6GB 3I32A 3J7AN 1M6XC 1H2VZ 5B0AA 2YKMB 3EQ6A 1KKGA 1TL3B 3CMAS 3W3SA 2LLZA 2ZH9A 4GC7A 2CNKB 1EKSA 4J9NA 4WFAQ 3M9NB 3H5YA 1FEHA 2XMKA 5KFEA 5CD4H 5K85A 4Q5VA 2FHJA 3HJVA 1DJ0A 4K4YA 3QNWB 2UUAJ 1WHWA 1SVDA 1RHUB 2FYXA 3NYQA 4JI5C 1K1QA 3SV4A 1WC1A 4L76A 3RB0A 1IBLF 1BQMB 1YJWS 1AMUA 4YOEA 2YX7A 1HR0F 3MOZA 2B4OA 1UA1A 3EVWA 4FYXB 5LSLA 3LWLA 1TAQA 3ETOA 1S72S 3HO1A 2E8CA 2PSZA 2WHOA 5CH7B 1NKEA 3SQGB 2K3KA 1VCTA 4WKRA 1MN7A 3OD2A 3QIDA 3TVKA 4WXOA 3KK3B 3BO4A 2ZZMA 1WF1A 3IWLA 2XTJP 3A3NB 4DMZA 2VH7A 2DHAA 2P9CA 4CNZA 2DITA 2MKSA 1QY7A 2VPZB 1IBMF 3QWUA 2QGFB 1O6XA 5DG9A 2DIVA 1QM9A 4KV8B 1TL3A 5M2RA 3SEOA 2F5GA 5E3RA 4MFBA 2HVZA 4OHYA 4ZLNA 1BWEA 3WDOA 5F8JA 4CRJA 4EZ9A 2EW9A 3VQTA 1Y3JA 4K4SA 4BC7A 4ZCKA 4PWWA 2KFNA 5A2QY 4JI0C 2M88A 4F4AA 3EZ5A 3OTOC 3PM9A 1JB0C 2DGSA 5GMEA 3O2EA 2XBPA 4ZVRB 5B0DA 2MQQA 4ZHRB 3CJTA 1RKJA 2HSEB 5T14A 2BA9A 2RRBA 3PYDA 5LSOA 3PEHA 1WKJA 4J9LA 4JI8C 3H2LA 3OTEA 3MHYA 5K8FA 3VQSA 3P45B 1FFWB 2MKHA 2G13A 3AH6A 4F36A 4DXLA 4TQSA 2DHSA 4XPCA 2AYEA 1PSDA 2AX1A 3DKDA 4C2MA 2AJ0A 1FKPA 5C42A 3FBEA 2ZKUA 4W4MA 1AROP 2BJEA 2DNRA 2UU9J 2QVXX 1F3FA 1VYAA 1S9GA 3C16B 4MK9A 4IG0B 1F60B 3TAQA 4JI4F 3VNSA 3WIVA 4LFAC 1B7YB 5ETMA 4B3MJ 3VGUA 2HQ3A 4MFBB 1SUQB 3NWRA 2QA2A 1RHRB 2OBVA 5HLFA 2IVFB 5BSWA 4PEOA 4DPYA 2KN4A 1P9QC 5KFLA 3MFHA 4DR7J 4X4UA 1IQTA 5HJXA 1GH8A 3G7SA 4S0MA 4MIAA 4DUYC 1X5OA 4ZVSB 3HVTA 4M5MA 2GO8A 3CCMS 1LCIA 3SMZA 1GQEA 4NCAA 5DS7A 4CH1A 1WKKA 4WYLA 3OL8A 1SIZA 2WAQD 2WONA 3JTOA 1UTAA 4OLOA 4WPAA 1FNOA 4KC5A 2E7WA 2BW2A 2V0NA 2NXEA 2QLBB 2AWZA 5CQGA 1HBUA 3MEEA 4EYHB 1LWCA 2J6SA 4XPEA 2B4PA 1IR0A 1L3SA 3DGVA 3BKFA 3H40A 5IM0B 4B3RJ 4G65A 1UP1A 2R2UA 3OVSA 4KFBB 1FKPB 2MMAB 2YWWA 3H2UB 2W4PA 4JBCA 3SI8A 2UUAC 4USKA 3IR7B 5KFXA 3DDKA 1XMOF 2BE2A 1AXQA 2FGCA 4I6YA 2P2MA 1Y11A 2DR9A 4ALZA 2RDIA 3QGHA 3MCNA 4DV7F 2ZNYA 4CNYA 2VHGA 3CW9A 5HATA 5DO2A 3BS9A 5HLFB 2DVIA 2V8GA 2E7XA 1UVNA 1JWWA 1R3NA 1HBMA 2CNLB 2VG6A 2OAUA 5K8MA 3PESA 5C24A 1GTEA 1KRPA 2HHHJ 3P49B 1GMVA 4K5RA 2AJ4A 1UWAA 1RWVB 3T9ZA 1EQMA 2V34A 5KFNA 2FJVA 2U1AA 3G86A 1VBZA 3CDWA 4CZCA 5DDPC 3MPVA 2X1GA 3QGIA 5A0YB 4ECYA 3B4DA 4PYAA 3ITHA 4JI4C 4O4GA 2MGZA 1WUUA 3MGJA 3U02A 1S76D 4WZMA 3SCLE 2VD3A 1LWEB 2ZVIA 4MJKA 4O4RA 4YHHF 2KRRA 2V2QA 1NMEB 2VICA 5DDRC 2PD1A 3EDQB 4ZS6A 2QVYX 3T6JA 3N79A 3HULA 5ETOA 1KOHA 3PYEA 2QTWA 1Q81T 2CQ2A 3QRRA 3DCAA 2R7TA 2HHWA 4U7UD 3LO3A 3RBDA 4LF8F 3GILA 4RW9A 4KHPJ 2V7BA 2ABYA 2VG6B 2IJNA 3BKTA 4C9DA 4JM1A 2EBEA 2KZFA 4QWDA 3K5OA 3BQ2A 1N32F 2PO4A 1H3DA 1R6VA 3QIPB 1KQKA 4PG5A 4Y0FA 4LVOP 1M5PC 4USVA 3SFUA 1U6ZA 3DLKB 1WWHA 1BE4A 1OQ3A 1RT7B 2HQDA 3D68A 2Q6CA 1E6VA 3EZOA 4FYVB 3R8YA 4DJBA 1IBCB 5G0RA 1RT4A 4YB5A 5J1NA 1IBMJ 1LWEA 2RJZA 3DLJA 9RUBA 2WOMB 2UUBJ 3NAIA 3OFFA 4L3NA 1Y3KA 2A3JA 1K47A 3GIRA 4TXSA 4PWDB 5RUBA 2ZBCA 3TQ1A 1SJ4P 1A6LA 1I94J 1N5VA 2AMCB 1W26A 2HFNA 3MTJA 4WIIA 4X65F 3CCZA 1EETB 3JSMA 2XYGB 4F8RA 1IR2A 5GAGI 1AA1B 1YJNS 5HMWA 4C8ZA 2NXCA 2OHDA 1JLBB 1KVKA 3SSQA 3M6VA 1CJVB 3V5RA 4BCAA 2BDPA 1OS5A 3QATA 2BE9B 3GIJA 3GONA 3AJ2A 5I3PA 3U1LA 3HZEA 3AB2B 2CDQA 2XHWA 3T1YC 2DTJA 3BGOP 3QIPA 2LEBA 4ZPCA 2LYVA 2RQKA 3GV7B 4G3IA 4UF4A 4ED3A 1NK9A 3ILOA 3NWGA 4HDGA 3C19A 4KIAA 3MDFA 4QIWD 4J9KA 4HKQA 4HH0A 1Z1ZA 4I2QB 1F9FA 4C48A 5G0RB 3J7YI 2DNKA 3MI7X 3E51A 1X0FA 3W8GA 1NZAA 3I9ZA 4X65J 3TOQA 3G6XA 3NCQA 4P73A 4N41A 2VZ9A 1VHFA 3BDEA 3SV3A 3KFWX 2V8PA 3CCVS 1I94F 1WH9A 2O5DA 4RLEA 4JI7J 4P9SA 4RM2A 3Q8PB 2E0GA 4DOZA 2D7SA 4ANEA 1TMJA 4OX9F 3AB4B 2E8FA 1HPZA 2PROA 4Y00A 2ASYA 3SIPB 4O3PA 2XB2D 2XR1A 2GAHC 2OPSA 4NASA 2HYIB 2QT7A 4OX8A 4WU3A 3I0RB 3KLEA 2FJAB 1HNXJ 1N36C 1SB6A 1S57A 3FSYA 4FVCA 3CCJS 5CA5A 3W65A 1NKCA 1Q8LA 5KFIA 4ECTA 5B09A 5KT4A 1Q79A 4J9OA 1BGXT 4C7QA 1UMJA 1OO0B 3N5FA 2X3GA 4P7TA 2Z4PA 1NSPA 1RQ0A 1S7IA 2KVIA 2YKOA 3QO9A 4NL5A 4JV2A 1R0AA 4LF4J 3NL0A 1D9FA 3TQEA 4U95A 5FDLB 1Q1KA 3O2IA 3G9CA 2WBRA 3ZZ0A 3UX2A 4OYAA 2VBZA 1QD1A 4KB7A 1J5EF 2XS2A 1V5VA 1U02A 2AYMA 2DT9A 4GVBA 4CQ1A 1BWVA 2MLYA 4TY8B 2ZVSA 2I6WA 4DX6A 2W9BB 3Q23A 1FUGA 1JNZB 5LSRA 1X7VA 1UEUA 3IBCB 3RAXA 2CAJA 4NA3A 4U96A 4K4VA 3CEDA 4ETZA 4Y34A 3HHEA 2HRYA 5E0OA 3UR3C 1REVB 2KZZA 1T9XA 4NZ6A 2C2RA 2GW8A 2Q66A 3KLEB 2MZTA 3RAMA 3EVOA 2ADCA 2AQ4A 4F50A 1FJGC 1EP4A 1XTZA 3FZ2A 3V6JA 2C2DA 2KHDA 1H38A 4G1QB 1ITPA 2QMWA 3IMLA 3NS7B 2HHVA 2B6AB 3J80Y 2MHEA 1FWKA 4X66F 2KXNB 2ZOGA 2XS5A 1GMWA 3G6VA 2C2NA 3VAHA 2BKOA 1KN6A 1YG0A 4DV7J 1HWKA 1TELA 2EXUA 3FEYB 3GTYX 3IC1A 3OXLA 3SCIE 1RZMA 3M2VB 4B3RF 4QPTA 4EBEA 5LL6d 4C6AA 2J9DA 1XMOJ 5KG2A 5L9XA 3SO4A 4DSJA 3WQPA 4H4OA 5DM6Q 2G1DA 1M5OC 2AYBA 3LAKA 2E5LC 1XJWB 1RAOA 3D7SB 2IRYA 1VOMA 1NJIT 4DV3C 2EI5A 4YB6A 4CLFA 4Q44A 2DR7A 4UQTA 2XNRA 5J1PA 5L1LA 5F3TA 3MECB 5LJ3Y 1ML8A 4KTTA 1NDKA 3DFEA 3CGIA 4U8VA 3FCEA 1TK0A 2GJ2A 4C3MA 1JJ2R 4BHQA 4IRCA 5BURA 1WHXA 1T94A 3A8EA 2KM8B 1RAEB 3RB4A 2OEKA 3HX9A 4OJ1A 1LFPA 2UXBF 4EZ6A 3TO8A 2R7XA 2LQJA 1QSYA 4URGA 1O0PA 1WOOA 1UEKA 2N7CA 1P1LA 4ECSA 4L74A 2HHXA 3CNQP 5EN1A 2DRDA 3V4IA 3KTQA 3LQVA 1KQFB 4RLFA 5C25A 2QW0X 3ZZPA 3G82B 2G0JA 2OI2A 2XC9A 4OHZA 1MWZA 2BZ2A 1UFKA 4A8XA 3TUZC 3B82A 4J7CA 3OLBA 3RTVA 1VQKS 2V4JB 4J9SA 4DV2J 4DQRA 1RSCA 3D28A 3FSIA 1P1TA 3V6HA 3VNRA 3IEVA 2KI2A 2YNHA 5IT4A 5DLGA 3T1HC 3OHBA 4DR6F 2L9DA 5HMZA 2EFOA 5HQ8A 5F3ZA 2ZKTA 3BKUA 2RRAA 4DV1C 1IBMC 1CJUB 4AYBD 2KFYA 2BR0A 4F25A 1N32C 2P5VA 4LF2A 3TEHB 5BYQA 3CJ8A 2M8HA 2NXJA 5KOXA 4ILMA 3LNVA 3LF0A 4ECVA 3KUEA 1RT6B 1CC7A 1SH3A 1PG5B 1TKZB 3MUTP 1P4EC 4J5OA 5B0BA 4DFMA 1YRXA 2BANA 2E5IA 1WEYA 4M5LA 4L72B 2RDJA 5BUQA 3V81A 5JXSA 3IRXA 1MWQA 3KG1A 4HEA9 2WVCA 4LFCJ 3IBWA 4CO3A 1NB7A 4FUQA 2QRRA 4HH1A 3CDEA 3IAS9 3WX8A 3RRHA 4JI3J 3R3TA 4LF5J 3G82A 1T9YA 1WDDA 3ISNC 4M5DB 1LW0B 2H1YA 3HVTB 3M1VA 3QSIA 3KLFB 5BR8C 2CPJA 3OTCA 5HANA 5C2CA 5HMXA 4GKJF 4DV6C 5FIIA 5HQMA 1MW7A 1RLDA 2DEIA 2G2OA 4GO7X 4OI6A 4ZVFA 3CPWR 4ECXA 5BSRA 1WI6A 3HKZD 4DR5F 2CQGA 4DV0J 2PMZD 4K59A 1NZ8A 1V3RA 2COLA 2DNOA 3AOBA 5JRHA 3M2UA 1TUVA 3UI3A 1LWCB 1N56A 1KD1T 2DH9A 2DXDA 2ALZA 3GYGA 2UUCJ 2ZOFA 2QG9B 4Y65A 4KFBA 5DJBA 4OHXA 3JAMY 2ZH2A 4DR6C 4MMOA 4H4MA 5L38A 3JYTB 4DV7C 4DR2C 1BLUA 4ED7A 4B9LA 3A9UA 2J7WA 2I38A 1NSAA 2FPHX 2VPXB 1EZZB 1RAAB 1R27B 3EDRB 3CF5Q 4M5KA 4A8FA 2BABA 3H0PA 1RWOB 1J5EC 3VAKA 2D3OR 4DCSA 2FHJD 2AP6A 4IH5A 2W4CA 2XWYA 5H1SV 3D67A 4M5DA 4USWA 2XY7A 1VQOS 1I6JA 3KK2B 2XSFA 2AJFE 1AFJA 2JNVA 2RHQB 2Y3YA 4YY3C 4ES2A 1R8AA 2R7WA 3MAHA 4B3SF 4YHHC 1YX2A 4BC9A 3D1QA 3TAMA 8ATCB 2FQQB 3RRGA 4K0KJ 3ITHB 2R7RA 1Q5YA 3M32B 1OPZA 2KRBA 3D0GE 3QAUA 4USHA 2AGQA 1NPPA 1IM4A 5L39A 1N34C 2ZDOA 1TKDA 2MQOA 1JLEB 2G0IA 5HROA 2R3VA 4E0DA 5GMDA 4P7VA 2B9EA 2HEKA 2HWTA 1S1WA 4CM2A 2HLTA 1HWIA 1YRTA 4QR0A 4EU0A 4H4MB 5AJ3J 4HVZA 4UTGA 2AJ2A 3DRSA 3OFGA 4KAIA 2QYGA 3HDSA 1EX8A 5D4NA 1HI0P 1QAJA 1TH5A 4L7IA 2F40A 5KFDA 1Q86T 1S77D 1JX4A 4DUZJ 4C8NA 1G1XA 1R6YA 1S9EB 5AT1B 5C2GA 4LF5C 3OUYB 1J2VA 3KDOA 2DXFA 4CDIA 3TX8A 3NKYA 1IJFB 1U09A 2B8QA 3QQCD 3TVZA 2B5JB 2AF6A 3Q2TC 5EUHA 5AXLA 2Q79A 3OL9A 3W2WB 1XBWA 2PDAA 3M8ZA 1L3KA 4HR2A 3IRWP 1S1VB 3HSDA 2YVSA 4HTIA 3P3DA 3ZC4A 2MDAA 1S1TA 2RAQA 3CCSS 3E8OA 1RI7A 3DLKA 3ZNUA 3TAMB 4IOCQ 4R25A 1AB8A 1B99A 2L48A 3UN5A 3QRQA 2HQFA 2DNLA 2H9ZA 3IGNA 3U7JA 2JVOA 5EX3A 1VRTA 5HROB 1IKXB 5E3CA 4JI2F 2W8KA 3Q22A 1H2TZ 3CMQA 2I5JA 4BWMA 3NS6A 4JI3C 3JAMD 3JB9k 1MDFA 4LQ9A 1B0TA 4M63A 2HIQA 2HNYB 4DSLA 1XNRJ 3JSMB 1FJ7A 1UWBA 1C2PA 1TL7A 2DNPA 3RUBL 4EEYA 2QJ3A 3M4XA 4WFBQ 4NLUA 4I9GA 3EPIA 1J5EJ 2LXUA 1PYOB 2P6SA 4FS1A 1T0TV 1S9EA 4KHRA 3R97A 1TFYA 4DV6F 5B0EA 4U5YD 1S0OA 3TNVA 3MAQA 4GO5X 1WDTA 2J76E 2XI2A 4K4UA 1WG5A 2KXHA 2YWHA 2QMXA 4LRBA 5JJBA 5A2QD 1EB0A 1ZS6A 1RTZA 2CQCA 4UUXA 3PCOB 3DLGA 2JRSA 3EPGA 4PXCA 2ALYB 2LQ5A 2UUCC 3C2PA 4F26A 2HS0A 2QMUB 3I55S 2GQQA 4DUZF 4X2BA 1VC5A 4PHTA 5E7QA 1QSLA 1WG4A 2BJ1A 2KT3A 4I2QA 5ADZA 1C0TB 5A8WB 1XMQC 4UQGA 1QLNA 1FRHA 2QE5A 1HYSB 2CQPA 3GSDA 2DNZA 2ZD1B 3NG8A 4F0KA 1XWLA 2ZNZA 3OR2A 5KFJA 2IHR1 4D3GA 1OY8A 3TANA 1RAFB 2XULA 1RT3B 2R42A 3UWTA 1V6HA 3MUVP 3BSCA 2GJIA 4EI2A 1HPZB 2GMJA 3U27A 2MM9A 3U1NA 3CULA 4G37A 3QJLA 2HFSA 3AXKA 1IN0A 2IRUA 3M30A 4ZPVR 3RZAA 1FFGB 2GV1A 3HHLB 1VFJA 4J9MA 4IFYA 4ER8A 3T5HA 2EEYA 3NXZA 1ELOA 2QL9B 2HS3A 4P74A 3CJKB 4DN9A 4J9UE 3NBPA 4DR2F 3OW2R 2HHQA 3G4SS 1Q78A 2ZBIA 4E98A 1VQNS 5KFSA 2C42A 1JLGA 2GVDB 2G9OA 3FBCA 5GAGU 2D9PA 3FK4A 4J91A 3KJVB 5LMUJ 5I42A 4RVOA 3QSYB 2UVWA 2KG1A 1UVMA 2HFOA 4R0MA 4LMZA 4JI6C 4OLPA 4V19J 4TPSB 4WFXA 4KTVA 4MKVA 3PKMA 3QRPA 2VIHA 3R5JB 2VDIA 5I3UA 2AEMA 1FWPA 3W5XA 1RCOB 1NDCA 3W9JA 4ZN3A 1TAUA 3IPLA 4WFYA 1VLYA 2HS4A 3C14A 2IVMA 1XR6A 1UVKA 1UW4A 3FVYA 4PG7A 5D4OA 5ETKA 3RBXA 4F4YA 2HVIA 3K17A 4QIVA 3TR5A 2BRKA 1DLOB 1VHIA 3CTRA 3IBFB 3AOAA 3HHLC 4FVMA 5SUHA 4ENOA 3LALA 4I4BA 5DG7A 4OMFG 2XQCA 2HHHC 1HQUA 4DG9A 4IR7A 3CCLS 5BYSA 3ZTOA 4BSZA 3D2WA 4YDXA 3UN3A 4ED1A 1S5ZA 2GA7A 3W5ZA 4Q0BB 4B9TA 2HVHA 3F41A 4CLZA 2LXFA 3HHLA 2BKNA 4KGZB 4JI2J 3HHNB 1JOSA 2AYAA 5A19A 1PYSB 1X4DA 2HHPA 2M70A 4NLSA 1S6QA 2XMAA 1Q7YT 3I4HX 2NZ4A 2RS8A 4IOAQ 2D1SA 1XR5A 3AD7C 2OPLA 2ZUAA 2P02A 1P4EA 4RBVA 5I42B 4RKUC 3FZBA 4PUOB 1USPB 3UCZP 1X9MA 4E8UA 1QTNB 4ZKAA 5HK4A 4L3KA 1I5OB 1VMBA 1NK7A 4LVNP 2E1CA 3PRVA 1ZM9A 4PWUA 2V69A 4DV4C 1RT2B 5JMNA 1IM6A 4CO2A 2Y1IA 4LIRA 1SPBP 3N4WA 2ZHOA 2E1MC 5KFUA 5HMYA 1O9TA 4H4OB 5IS2A 3PHTA 3HMJG 1HNWF 5AXMA 1X60A 1UKKA 4OYCA 1N0VC 1BQNA 2EC2A 5BSMA 4Q8EA 1HMVB 4NXMJ 2ZH3A 4NRTA 2ZZTA 4DL4A 1GAOA 4GRSA 4K2XA 2IM1A 2CPXA 4MKBA 2VUGA 1ICEB 2F8MA 4DSIA 5D4PA 1CQNA 1S6QB 3JTNA 2Y1LB 2BRLA 3CJ4A 3DRPB 4Y2IA 5L8RC 1S48A 2E7VA 1EGAA 1N33C 4LF6J 4DCTA 2XYPB 1Y4ZB 5GADI 2UXCF 2W25A 4OZ5A 4RPFA 3R44A 3THPA 4B3MC 1T3OA 3GR1A 3I4PA 4RZRA 2JFKA 4B17A 3UDEA 3N01A 3W8PA 1VK8A 3V6DB 3N9UC 1JIHA 3FFIA 4HACB 4W98A 3G96A 2WTFA 3CJ5A 3MM8A 1U1QA 3GMGA 4AL7A 4CLYA 1Q8KA 1OIAA 3K89A 1Q7LB 4EWTA 1FI4A 2JOQA 2JH3A 4KJIA 4QYZK 4ZJZA 2IAJA 2NYIA 3KLIB 4XTTA 3UE2A 5F8IA 2HPUA 4FPIA 1GT8A 1RCXB 4UOCA 2ZBRA 5JUMA 3G8TA 4WFZA 4A8MP 1S59A 3H4BA 1T5HX 2ACMA 3CIMA 3CVKA 2J9EA 1TKXA 1CJUA 2H5EA 3MD3A 4Z7CA 4B08A 3BSNA 3LP0B 4OX7A 4P2XA 4RW6A 1CJKA 3TARA 1FFSB 3I9V9 4WTYA 4RNNA 1D9DA 1FDAA 1NU4A 3HFVA 4NLDA 4B3OA 4RWXA 2UXDJ 4ELUA 1ZM4A 1YZ7A 2W1BA 1TKZA 5L1KA 3O44A 2FLPA 2FJWA 2A10A 3OL6A 1O51A 4CO1A 2KG0A 4FNHA 4OFZA 4URSA 4DSKA 1U2FA 2LQBA 2YKQA 2OGUA 2RDDA 2C3MA 3T9NA 3UNYA 3V81B 5H9EJ 1F2GA 2HBYB 3IM8A 1DZ5A 3MMJA 5CD4A 4MTNA 2VC1A 4IR1A 5C5JA 3OQ2A 3FC9A 1KWMA 3RYLA 4UZCA 2VJUA 3PJXA 2DY9A 5KG4A 3UDCA 2V9KA 1RA7A 1LQ9A 1LW0A 1O5JA 4RNMA 3D1HA 1KSPA 2N3LA 4X62F 4ZMMA 1B3TA 1H72C 2VB6A 4ZVGA 5KFVA 4LF5F 3CD5A 4DCVA 1N5SA 1N5YA 3MMCB 2FLOA 1JXLA 1LQLA 1Q8IA 1QAIA 5KG3A 4P71A 3AF6A 3PYFA 4NE9C 5A8RA 4CWBA 4I6AA 3AD9C 5DQHA 2F8HA 4NLVA 1TKXB 4AD6A 1GFWB 3AY0A 4N8NA 1B70B 2YNIA 4DF8A 2BJ7A 3KNGA 4IRDA 4B3OB 4NXNJ 1IKVA 1XQIA 2IFXA 2KU7A 2FJDB 3G8QA 3NLCA 3BBCA 4LR8A 3K6RA 4LRAA 5E7OB 1K8AT 3R2DJ 3JYTA 1SQGA 1PIEA 1FX4A 1N88A 2PMWA 3LP2B 3Q8YA 4OYWA 4TYAA 4EK2A 2RUGA 5L9NA 3PX4A 2IY5B 2GJFA 3PX0A 1RT1B 2WVEA 5ETNA 2MZSA 4GKKF 4RNHA 3B6BA 3B8HA 3ISND 4HL9A 1P7LA 2MY8A 3BH7B 2WK4A 2HVEA 4NA1A 4K5SA 5LMUF 1XNQC 3OR1B 2VG7B 3P4UB 5ETVA 2YWGA 3M7VA 4JI8F 4IH6A 4M95A 1N33F 1T11A 1H2UX 2IM2A 5DG8A 2VQFF 1WEXA 2PA8D 1ZM2A 4M5IA 4K0BA 1PCAA 2Z58B 3CO0P 4ZLPA 2XO6A 3CUNA 4LF7F 3R9XA 2ZDPA 5B7WA 1DTTB 1YK9A 2CA9A 2JNJA 5GAHU 2ZH5A 2B4UA 5IT9U 4LF6C 2O01C 3MEEB 4AQYJ 4JI7F 1ZBTA 5F41A 2CVIA 3PRDA 3PNIA 1KQSR 4DSFA 2XS7A 1SI9A 3QPIA 1RBAA 2FLNA 4ED5A 1U47A 5IT9Y 1RADB 4IG3A 4G6VB 5D77A 5J2MA 1HNWC 3GJQB 4L73A 4AQYF 2QFIA 2I1RA 5CXTA 3NMAA 2Z51A 1NRKA 3DXSX 1S6OA 2CWKA 3F44A 2VFSA 4QU7A 1XN9A 2DGUA 2LU1A 1D8YA 3E2EA 2ZJRQ 4OJGA 2Z56B 4ED2A 2HAIA 1UPPA 4MAKA 2LP4A 3EICA 4ID5A 4NCGB 4YFUA 3CD6S 3OUYA 1ROFA 1HBMB 5DZ6A 1PJ5A 4EBDA 1PAUB 2W2PP 2YQ3A 1SCJB 2B5JA 2J7UA 3OR1A 4IO1A 4X4QA 3AHPA 2V63A 2MQ8A 4KGMA 1XNRC 4DX8H 1S1VA 2OEJA 3H25A 3GPCA 1LWFB 4ATNA 1YJTA 2FHKA 3A4TA 1RG9A 1XMQJ 4XX2A 4HHJA 4RW8A 3KJQB 4L2ZA 5GAHI 4ES3A 1X4GA 2YH0A 3ZTPA 2O3DA 2ASDA 1TV6A 5LMNJ 2MQLA 1GEHA 1CS4A 2KKHA 3I5BA 2CJBA 2J7KA 4IFVA 4MIBA 4CLLA 3R1HA 3AA9A 3KJFB 3BJYA 2QLFB 2I5JB 3NAHA 4ODJA 1TKTB 3UEBA 1FX2A 4OZNA 1V25A 4W90B 3BQ1A 1Q8BA 2HNYA 3EGNA 2JLFA 2W2NP 2CFXA 4M5JA 4FYWB 3TUJC 1LKZA 3FNNA 3LH2S 1JLQB 2DEJA 4IOBA 1RTIA 1Y7PA 1X4FA 1YLXA 3PR4A 2D9OA 2V8HA 4NI2A 3CWJA 3QAEA 3NGTA 5D0HA 3WC2A 3CO9A 2FZKB 4NCGA 2NYHA 4LJMA 4DPUA 3MR7A 3HPOA 3MR5A 3HK2A 4DR6J 3KXDA 1CPZA 1BY9A 1I51B 4ECQA 2DYJA 4YEAA 3IWNC 3NOCA 1N5TA 3P5TL 2ROEA 3GZ7A 2RNEA 4R1MA 1YWXA 2XGQA 3R7NB 1V26A 1YJRA 3MEGB 3OV7A 1KNZA 3J80D 1J5OA 4B3TJ 2GMLA 3CQ2A 1NK6A 1F6TA 2MYFA 2P8IA 5KFPA 5ETTA 4RUCA 4NLYA 2JX2A 1H7XA 3NPDA 1ZZNA 2E5GA 2HZCA 2G1HA 2EKYA 2C3UA 1QAXA 1XEZA 3T19A 2X1AA 1HYSA 3W63A 2EVZA 4R5PA 1DAXA 1TVRB 5H9FK 3OR2B 2P2QA 2CPFA 4Y2CA 1RWPB 1YTYA 2CY1A 3NNHA 5BSTA 4K7QA 4GKJC 3VVUA 3KJNB 4NOZA 2VODA 4ETXA 4N5SA 2GX8A 2C3PA 2M5YA 1BD6A 2RH3A 4JV0A 1JLQA 1VLOA 1F5BA 1RTIB 2MTLA 2XHCA 2C28A 2I8EA 2PGCA 1EHWA 4JI2C 1ZPVA 3VAMA 2L41A 4NYZA 1CG2A 1H73A 3QBCA 3L95X 4ZPDA 4YDDB 2DNHA 4MH8A 2CZ9A 4IFYB 3OTOF 4ZVTB 2HHSA 1RP5A 5D8HB 3PRBA 2VKZG 3PW7A 4B3RC 1GXLA 2PT7G 2Z57B 5KFOA 3EXCX 4WF9Q 1SC6A 2D41A 3G87A 1NH7A 4OI4A 3CD7A 5F0WA 3VGVA 2R8IA 3KNAA 4IH7A 4RR5A 4ERDA 2PEBA 5GAEI 2FJBB 4ZVQB 4BBYA 3GE9A 4K8RA 1OYDA 3ENWA 2YKPA 3OTBA 1HNIA 1S6PB 1RTHA 3D6TB 3GWCA 5I3UB 4FF2A 3N28A 1MWYA 1LFWA 2IC3B 3UDVA 4B9MA 3LW5C 2U2FA 4Y2AA 1U26A 5EWEA 3HF5A 4JYAF 3WBZA 4CLPA 1DLOA 1XERA 3LUSA 2W01A 4KKOA 3D0IE 4WXWA 2FVCA 2DGVA 2YKNA 3NEKA 1HQUB 3K59A 2J0QD 2V9WA 4QU6A 1AUDA 3UX3A 1WSRA 2B56A 1HNZF 2ONFA 1Q95G 2OPSB 1XS3A 2LDYA 3IS9B 4FXVA 4C8LA 4B3TF 1DTQB 2W8LA 1GX5A 4P52A 2OMLA 3H20A 1RKIA 3TUIC 3O6QA 3PW0A 4OYZA 5CHCB 3FBBA 3MR2A 4IUFA 2YX4A 3K8WA 2WVDA 2QVZX 4DR3C 1OSCA 2OO4A 1KTQA 3DM2A 4YR3A 2R8KA 1FCAA 2K3IA 3JXOA 3DLPX 4QIGA 1DHMA 2OFGX 2B0GA 1RAHB 2J0WA 4WYWA 3N5BA 3M6XA 3VZHA 2F9JA 4XDDA 5THWA 5DDQC 3RAQA 2BBEA 4B3MF 3MM5A 2IIHA 2VASA 4QWBA 3MXHP 3A3PB 3S82A 1HNIB 2JLEA 2P6TA 3VZIA 1CJTB 4F3QA 2OSQA 3ZZOA 4DPTA 1HW8A 2B3TB 1H74A 1TL4A 4ED4A 2XCPA 2ZM6F 1UFWA 1HWLA 2VBYA 4NCBA 3CJSA 3CW8X 4WE1A 3LUYA 1TMMA 1NPRA 2DJWA 3QT6A 4LIWA 4PUOA 4PYDA 4TY8A 4OI1A 2CKWA 3HFKA 5CCMA 2R9LA 4X62C 1RBLA 2GO9A 3PW2A 1KOOA 2C3YA 3CCWA 1AYEA 1AZSA 3CD0A 4JI5J 3I0SA 1VI7A 2HQCA 2MKJA 3BBFA 1WHVA 3MPDA 4DZDA 1TK5A 1N34F 1FF2A 2NSCA 2C2KB 1QM4A 4CP5A 5ETRA 2H51B 5KFKA 1DTQA 3UOWA 2W9AA 2N3OA 4TNOA 4B3SC 2AU0A 5KEIA 3OTDA 1EP4B 5E3PA 4YB1P 2GGPB 3M8PA 4KO0B 2EBGA 3SCJE 4DV4F 2WSEC 4PQUB 4JV5C 4DG1A 3TAPA 4QCLA 1JKHA 1WI8A 1FRIA 4OZ3A 5HO4A 2UXDC 1MU2B 1YGYA 2BJ3A 2LFVA 1UJ4A 3DOKB 3ZZUA 3N2QA 1MMLA 2ROGA 1R89A 2YQ1A 4DR2J 4DR4F 1SH0A 3MM8B 2UXBJ 1KTVA 2CYYA 1YZ6A 1VRUA 2Y4NA 2OD4A 4WE1B 2W7OA 1N0UA 4FZVA 2V5HG 5KT2A 1EJ7L 3EM1A 5HP1A 3VV2B 4EO6A 1UVIA 1KDNA 1X4CA 3Q89A 1QUPA 5IV3A 4QOTA 3NGRA 5E5NA 5AXNA 3KUGA 2ZJQQ 3D6FB 4DR4C 5LM7E 4ZIWA 1VBYA 3TA0A 4ICLB 1Z2ZA 2V2KA 3OSNA 3N6LA 2WZ1A 4ZPBA 2UXDF 4KE5A 5F0UA 3N6NA 4J37A 4F7VA 2F4VF 3LAMA 4KPCA 2R8HA 1VJQA 3SSSA 4H54A 3BO3A 2MXYA 1QTMA 1RU2A 1MKYA 2GGPA 4KO0A 2M5HA 3UCUP 1FT8A 1G6BA 1FRJA 1W7WA 3D4JA 3HVAA 4JI8J 1XRAA 1Z4UA 4OZJA 4K50A 1A9NB 4KY3A 2DD8S 2Q6BA 4F0HA 1SJ3P 1MDBA 2BACA 2XZDB 2KT5A 2A2DA 3Q8VA 2FVRA 2GHPA 1ZB9A 1UZDA 2DGTA 3UNGC 4QBUA 3CCUS 4DV6J 3RV2A 1JLCA 3J80U 3TJ9A 4CI0B 1MXAA 3BREA 3TA2A 3K0JA 1TTHB 1U25A 1PBAA 4RM3A 5JVHQ 1FDNA 1VRUB 1DQAA 3OTOJ 3Q8QB 4TN2A 1HQEB 2MKIA 4LF8C 2DCLA 2WP0C 1IQZA 4RU9A 3H8YA 4K0KC 1CVJA 2P20A 1JLAA 2Y9HA 2HHUA 4TLQA 1R8HA 3MCSA 3FRZA 4FPRA 2APOA 5G4DA 4DS4A 4YR2A 3HT3A 3FBFA 1NPKA 2E44A 4FYYB 1XNQF 4DS5A 1U1MA 5FLXD 5MLCV 2RB7A 5LMUC 2JC1A 4LF9C 2LVWA 1IUJA 2PE8A 3F0NA 5EX0A 2M7SA 2DGWA 4OI2A 2R2TA 4JI6J 3QMQA 4DCJB 3MUMP 3DN9A 4TY9A 2DPIA 6FD1A 5EHHA 4I7FB 4NEYA 4NPOA 3IFEA 4DV5J 3W60A 2YCBA 2XI3A 1S99A 1UVLA 3NGKA 4JV1A 1VK3A 4ZCLA 5DGBA 3GIKA 4O3NA 4CLSA 1FK9A 2ACYA 1DFDA 3I5AA 3ZZRA 4C8YA 4I67A 2CPHA 4FF1A 1RBOB 4K4WA 1T5DX 1WF2A 2VFVA 3J7YU 1ZAXA 5BXIA 3QJJA 4F67A 3BZQA 1K0VA 1HQEA 1RHJB 1F3VA 2KXFA 2NCKL 3HD1A 4WCEQ 2ZH1A 1MNEA 1NJYA 4CYUA 4X4SA 5GTDA 2WBMA 3NY0A 2ILYA 1XRCA 5E3AA 3OXGA 1EQ0A 1UJ5A 2R8JA 1PYTA 3M2UB 4J9PA 2BUNA 3BV8A 1RT5B 2OEMA 4AQYC 2C3OA 2XY6A 2VFUA 2RQ4A 2YWFA 1TL5A 3HFZB 2CJQA 4Y3CA 1U1PA 5J2MB 2GHVC 1KFSA 3TZXA 2K7JA 2ZWPA 4EFAC 3HM9A 4I7FA 4DHVA 4ZLLA 1F9EB 4ZPAA 2B43A 5CAAA 3CDBA 4QPXA 2ZH4A 1NXIA 2HG4A 2QL5B 1R8CA 3BO2A 1RWXB 1U8WA 1B4SA 2CNOB 1U1OA 4FF3A 1YJVA 1VISA 5D0EA 2K1RB 4ID5B 2EG1A 4NZ0A 2CPDA 2OD6A 3UR0A 5IZHA 1FKAF 2OTLS 4KHMA 1UVJA 7AT1B 2GCFA 2DO0A 3KG0A 2X7IA 4WK1A 2XCAA 3UDLA 2CQBA 4LF6F 1MROB 2MQMA 3T6BA 2FUG9 2XZTB 5IT0A 1X4EA 4I6WA 1UFLA 2AZ3A 6AT1B 1XC9A 3FMBA 3A25A 3UN2A 4K4ZA 1MSWD 2J8SA 4CYUB 1N6QA 2HMIA 3A1YG 2DIUA 2XMJA 1UA0A 4RW8B 3FUYA 2CQDA 2V2VA 2HWHA 1KS2A 1HBUB 2C2MB 1RT5A 3NGSA 3DOLB 1PGZA 2ZZNA 3LANA 3IXQA 3HP6A 2V68A 1FJEB 1M6XA 5B0GA 3ET6A 3BB5A 2F7VA 3CC2S 2CPIA 2EPIA 2IYGA 1GNKA 2BE2B 3M8WA 2M0GB 4KH0B 2HLUA 4DL3A 4PRFA 4DV5C 2YWEA 4P2MA 2CNNB 2XO7A 1FRKA 2NS1B 2Z2LA 2RKIB 3FKBA 4LR7A 2DNMA 3GP9A 3SDEA 2K1RA 4F04B 3R5BA 5EWGA 1YDLA 1N33J 1Q53A 4GKJJ 3UFCX 2LA6A 2DK2A 4WP3A 4X64J 1VQ6S 2H5JB 4X4VA 2DHXA 4LF1A 5KFHA 4ILLA 1N32J 1YVFA 1G4CA 4A46A 2NPIA 2FB0A 1V3SA 3C6TB 5CYMB 3MEGA 4DQIA 4KHPF 1YQHA 2CQ0A 2D69A 1J27A 2UZAA 3C15B 4DZ6A 1RDRA 3FCCA 1HHSA 1RISA 1HBOB 2J8AA 4AE5A 2KB2A 3CXCR 2QSWA 3AT1B 3Q24A 1VEHA 2Y1JA 2YWCA 3T5JA 3T1YJ 4W92B 4ZCIA 3GLJA 4EYIB 3DNCA 3W66A 3OJUA 2V8VA 4LFCC 2OJ3A 2LKZA 3D1OA 2VA3A 4ZPTR 1HH2P 1GK8A 1S4FA 3LTOA 4WK3A 1XNRF 2NR0A 2SXLA 4DUYF 3D3BJ 4LSNA 4M5NA 4RW4A 5BYRA 5DQGA 1TL7B 4JI0J 2D1TA 2W9BA 3DHXA 4J9QA 5A8KB 4DR5C 2EFGA 4OI0A 2RKIA 2LECA 3GIMA 2FY8A 4RW9B 4O44B 2D74B 2DGQA 2GC8A 4CCHA 4IQXA 4MIWA 3VVTA 4U8YA 3RR7A 3PX6A 4HI1A 2FD2A 4U67Q 5JVGQ 2Y0SD 2OIHA 2JJ4D 1DARA 3EGVA 3NYRA 2AGOA 4OZLA 5KG0A 1FHTA 1FWLA 2RE1A 3C6TA 3P8BB 5CYMA 3RJMB 5BJRA 3K5MA 2O1PA 2HHHF 2ZC3A 4N8OA 1X4AA 1IBKF 4JB8B 1HQ2A 4X4TA 2IYIA 3D9BA 3EVMA 3T1AA 1RTHB 4OIXA 4GMKA 2YY3A 4QJVA 3S6EA 5DDOC 3P6YC 1KFDA 2AKWB 2WOMA 3A3OB 4BLGA 4CLUA 3KLGB 2OTJS 1U24A 3J7ZT 3PDNA 4KBIA 4X65C 4RWWA 2N82B 4QIFA 1VQ8S 2ZOMA 1WTFA 3FEXB 3DRXA 3MCMA 4PUGA 3H90A 2ASBA 1RT3A 4K4TA 4EBCA 5D3GB 2RD5C 2OPQB 1EARA 2FC8A 3HCXA 4KTQA 3QJPA 2YKNB 3GFZA 4RW4B 4JV5F 4MYTA 2MSSA 3AXMA 3TRGA 4FXWA 4FKYA 5KFGA 3MPUB 3ENAA 1PJ6A 1WC6A 5A8KA 3H5XA 3ILIA 3W9IA 3KOAA 2P2BA 5K14A 3BSOA 2WSCC 4I69A 4O44A 4J9RA 2D3UA 1FJCA 3OT9A 4OHVA 1VGYA 4DL6A 4X64C 3NBPB 4LBPA 5IC4B 2H5IB 3R9LA 2RILA 3KJVA 3TA1A 4CO5A 2J6TA 1CLFA 5KFZA 2KH9A 3FRYA 3DHWC 4A8SA 3E7WA 3RBZA 1W2IA 1CULB 1M1GA 3CMES 2NCLA 2O66A 2UXBC 1ULRA 3TZZA 3JTPA 3C14B 4KQZA 2YBVA 3DYAA 3KHRA 1N4LA 3AQOA 3O3LA 2MMYA 3LPYA 1TFWA 2K06A 3KDNA 3HJFA 3ZTSA 3LWMA 4CT8A 3G6ES 5KFCA 1D8ZA 1GXTA 4ZP8A 4D57A 3N0VA 3I0SB 4OYIA 4B9UA 2Q3PA 3ZZTA 2CG4A 2XLKA 4RW7B 1RHQB 2AW0A 3BPDA 1M0SA 1HNWJ 4R1LA 5HAOA 3FCWA 1ULTA 1TK8A 3MM9B 3CJ2A 4DN0A 5F8NA 2DGOA 5LXRA 4LF4F 5IC6B 1SBRA 3MMAA 3PFEA 1NJWA 2D28C 1JKHB 4Q45A 2CVEA 3KMSA 2HRTA 3AAWB 4I64A 1OSDA 3VF0B 1X0PA 4UY8T 2FJXA 5KFWA 2M3DA 7FDRA 3M05A 1T8EA 2QO3A 4NWBA 5KYTA 4OYPA 3IGVA 4C11A 1NNDA 3FGVA 3LGHA 4C3KA 1W2BR 1K73T 1FJGF 3A13A 3R5CA 3M9OB 1XMOC 3DYAB 2M4MA 4ZIVA 4D4IA 4LRFA 4JI6F 2W2MP 4L75A 4QQBA 4FNIA 4TLRA 1RK8A 3FMWA 3B4MA 1YBUA 4KSEB 1QJHA 4TVAB 1HMVA 3ZTRA 3MR6A 5L1IA 4EGLA 1ZM3A 4DFPA 5DV9A 1WKLA 2OPRB 2MQNA 3VALA 1FVSA 2LMIA 5F8MA 3JSYA 4LSLA 1G3OA 1U0HB 2GIFA 2J9CA 5LMNF 2UXCC 1V60A 1U2CA 3LGMA 1XMBA 4HYKA 2R7QA 3FCHA 4RUBA 4RUAA 4NMXA 4TU8A 2QSFA 2JHEA 2KL8A 3MM7A 3R2CJ 1EKRA 3GJTB 4O3SA 3EERA 2B9YA 2GQ2A 3HVWA 3GYXB 1C4CA 4J9VA 2MEWA 3LNOA 2HQGA 2HVDA 3V6DA 2V4QA 5IT9D 4QR2A 1KR4A 5EGYA 1JLCB 2VPYB 4QW9A 1RWMB 3V6KA 2E5LF 3CJQA 3T5LA 1WC5A 2M5OA 2M9KA 3I5CA 3OFEA 3Q83A 2VFTA 3MD1A 4F4WA 2MHNA 1OY9A 4USIA 2R7UA 1SJ1A 3KLIA 3BGUA 2DRAA 4OQJA 4ZHRA 3BR8A 3KLHB 1YRUA 1HNZC 1JLAB 4B02A 3KWMA 2IJFA 4P2FA 2VC0A 1QWIA 4LE5A 1M5VC 3ZNJ1 4B9NA 2KFZA 3GB0A 1B0VA 1CJKB 1I1GA 2A1BA 2KDOA 3HSJA 2PI4A 3DGPA 3D66A 1X9WA 2ZBQA 3CB4A 4DV0F 4WS9A 1HI8A 1U0HA 5C42B 1YJ9S 2DPJA 3T1YF 1L2FA 4F4KA 2XG8A 1CQMA 2CJAA 2RT3A 3A8IA 1S9GB 2L9NA 3C16A 3MMBA 2CJ9A 4F2SA 4Q7AA 5IFIA 3K5PA 4WBFA 2LCWA 1OYEA 3MM7B 2YTCA 2CPZA 1HBNB 1S4EA 2VQEJ 3RB6A 2ATLA 4YS2A 2BVZA 2XWXA 1WC4A 2Q1LA 5ETLA 3PXGa 3UQSA 2V6AA 2KHCA 5HSPA 4M5GA 3V4IB 4JI3F 1QAYA 4X84A 2VQEF 3LPEA 1TL1B 3VAGA 2L08A 1R8PA 4GXRA 5BR8J 4D3HA 1KLMB 1JXVA 3SCKE 4N77A 8AT1B 1YBTA 1RA6A 4P72A 5AE2A 1WC3A 1YKWA 3DLBA 1O93A 4PZPA 3X3UA 5KFYA 2XMMA 5A8RB 4DV5F 2GIQA 1VS3A 4DQQA 2XYHB 1WNEA 3IG1B 4ECRA 2YNIB 3I08A 5LMNC 5KOWA 1N5QA 2HNDA 2LA4A 3KKFA 5ETPA 2UUTA 1IKVB 2WVBA 3DRRB 3QLHA 5IM0A 1SC3B 1S1XB 4HHUA 3HSZA 4YHHJ 1U2RA 3FQLA 4LREA 2VBXA 2V4RA 1YJUA 1HNXC 2EFVA 4WIQA 4WZQA 5IQ6A 4PR6A 1X5SA 4HT5A 2P2JA 1OJ4A 4ZVOB 3PHEA 2UVRA 2IBKA 1HW9A 4UZBA 4X62J 2NREA 4NLWA 1UW9A 2CQ3A 4A8OA 4C8MA 4HLBA 1YIJS 1YITS 4R0JA 4AXJA 4I2PB 2VJVA 2NXNA 3TI0A 5BUSA 3CCTA 2VG7A 2WW4A 3KLFA 2Y8YA 2VU5A 1BA3A 2RU3A 1T95A 4D4GA 5MAOA 2CJKA 4YY3J 1GX6A 5KFTA 3ZZZA 4Y28C 1FD8A 2BMBA 4ED8A 4OI3A 1VQLS 3WZ0A 4LSZB 4PABA 1M1KT 1S0NA 3PW5A 1HNZJ 1HNXF 1DTTA 1LK5A 3NNCA 1FLOA 2LDIA 2RQCA 3D54A 3H98A 3OPKA 4XO0A 4L6V3 5DZ7A 1X5PA 4E2FB 3A12A 4NZ7A 3BN7A 2DRBA 2D27A 1S1XA 2VL1A 4IG3B 4FBTA 3ADAC 4ZVEA 1C1BA 2IA6A 4PQAA 3D3CJ 1JMTA 2BEFA 3QT8A 4F3MA 4ED6A 4I68A 1ZETA 1L3VA 1VLAA 1SKSA 2E1PA 3R5GA 4B3SJ 3SDEB 3H7HB 5D4LA 3BQ0A 1T05A 1IBKJ 3NOGA 2MZJA 2Y27A 4N47A 4I2PA 1RWNB 5BSVA 3DLEA 1FDDA 1IVZA 2P9EA 1S7HA 3G71S 4DR7F 3H2TA 4NYOA 5F8HA 1LV5A 1ZH5A 3QZ8A 1LWFA 2GS8A 3HXMA 2CQIA 3A9VA 2XZWA 5J1EA 2CZVC 2NPFA 2ASJA 2IRXA 4YN3B 3TYTA 2J6UA 2FTRA 3UZ0A 2XMUA 3MAAB 2ZHAA 3SZ2A 4ANDA 2VQEC 1PO6A 2ZC4A 4LR9A 3HVRA 5K8NA 4Q43A 5FLXY 4PWDA 3M8QB 3CCQS 4LFAF 4NXMF 3C46A 4ECUA 2QV6A 3AD8C 4N76A 1K0RA 3HLUA 4LSNB 3TZYA 2WD9A 4WJBA 3MPWA 4G1IA 3I56S 4FF4A 1P8GA 2L9WA 3J81j 1QSSA 2KZMA 3GKUA 4DR5J 4LBHA 1UZHA 2HHTA 2ASLA 2EC0A 1OPIA 4WWSA 2R7SA 2D1QA 4IQMA 5D0RA 3WIUA 5KFMA 3UD3P 3CQ3A 3JQKA 4QWCA 2JC0A 3KHLA 1NSKL 1WSVA 2GFFA 3GSIA 4LFBJ 4K2JA 1Q4RA 4ZJOA 1K9MT 1SJFA 1FE4A 3N54B 3DDIA 4ECWA 1ZTTA 5A1GA 1RJJA 4Z2XA 2UUWA 2BE7D 1NDPA 3ELHA 2K2PA 4ISBA 1TU0B 1WG1A 2YNGB 3P96A 5IWAC 3UVJA 4A8WA 1F2HA 3OJSA 1FRXA 1YSJA 3MAAA 2Z2MA 5DRKA 3SQOP 3W7BA 5KT7A 1VDHA 4LF8J 3QGPA 2AGPA 1TVRA 1IKXA 4LUBA 3TVYA 3BR9A 3H5UA 5HJYA 3PKYA 3ETCA 2W4DA 2X3DA 1NBEB 4USMA 4OL8A 3R7SB 5IOLA 2XLJA 2E5JA 4UY85 2HGMA 4CLKA 1FXDA 2RIJA 1URRA 4LF9J 1IJEB 3A8KA 3MFIA 2ZUGA 1XMQF 1WOPA 2DHGA 3NRBA 1SKRA 2V2ZA 2OLWA 1NSQA 5K14B 4DX7A 4JYAJ 1HD1A 1TQLA 1SL0A 3I0RA 5A6PA 1RAJA 1U0SA 3GFXA 5K8PA 4C4WA 3FJ2A 1M5SA 4DLGA 4DR4J 2N7YA 4P10A 2B4VA 4ZA1A 1IKYA 1NEEA 2MPUA 5T7LA 4LF7J 4U7CA 5F8LA 2E9TA 1BC6A 2RSQA 3HI9A 4UOGA 2OH2A 4GVLA 2JWNA 5HI7A 4H4KC 2C2ZB 4F3OA 1N2FA 2E1AA 2B7BB 3GYNA 3AA8A 2QA4G 3TDEA 2C2OB 4K4XA 3TQIA 2H48B 4PZVA 1GTHA 2BH1X 1S6PA 1KLNA 3I96A 5FDLA 2YWKA 3R5AA 3L8CA 4QR1A 3L4BC 1SIWB 4URQU 3MWBA 3C6UB 2HWIA 1KC8T 4GVBB 1F9HA 2LU2A 3CSKA 3TP2A 1LNQA 1PU1A 4DPWA 4PG6A 4U9RA 1FA0A 2G0CA 1QUVA 2IVYA 4YB7A 2W9CB 1RE1B 4JI5F 2D1RA 1D3WA 1KVIA 4IZ6A 4HI2A 2AT1B 4R8UA 1FXRA 4RW7A 4NX9A 3IS9A 2VQFJ 4F4ZA 3M30B 4EATA 1KEKA 4Y2KA 5J2PA 2H65B 2AJQA 3LA0A 1FTCA 2CQ4A 5HVFA 2Z30B 2MJUA 1WJ9A 5HQLA 3UO0A 3CJKA 3GQCA 3CDUA 2RQMA 4DU7A 1RAGB 4XAKA 2IDEA 4G1QA 5T7LB 2HFZA 3U1MA 3B54A 1JLGB 2GVDA 3PBKA 3MMAB 1Y00A 5E33A 1U1NA 2FJEB 3BGLA 1DQ9A 3G6YA 1K0TA 2E8EA 1AUSL 3WHIA 4X66J 2FLLA 1VIXA 3I87A 3LP1A 3MM5B 2EGTA 1MG7A 3L9ZA 4DWIA 4JOUA 4MYUA 3LOUA 4C11B 1OWXA 4CLTA 1FVQA 4ZN1A 5DETA 3M2VA 1A0OB 1NUEA 5K8OA 1XK8A 3BPSP 2FVQA 2AV5A 2MLXA 2LQ9A 1T9WA 1C1CA 3ETMA 4CIOA 1N36J 4DX5A 4WP8A 1AW0A 5ITHA 4KGVB 4NA2A 4LFAJ 1XIQA 1VR6A 4O3OA 4R8UB 1ZYQA 1LOUA 3UCGA 1N36F 4O0IA 4JYAC 1PAEX 2NXUA 3BGRB 2HGNA 2QLJB 4YMEA 2DR5A 3PY8A 3F56A 1FESA 4ED0A 1T9VA 2EFNA 3IR6B 4RO0A 4DCUA 1F1BB 3M8PB 5E2QA 3NP5A 2OPLB 2L3MA 4OX9C 1NHKL 4ELVA 1BMQB 1EAYC 3BGFA 3ZO7A 4DG1B 1USPA 5J2NA 1SKWA 5T41A 3AODA 4PG8A 1ZA2B 4PKDB 4DG8A 5C25B 4DSEA 2VKRA 2HJGA 2XEXA 3V4MA 5LJ5Y 1RT2A 2H4WB 2RS2A 1H98A 4L4QA 1XRBA 1UEVA 1VRQC 3A26A 1XR7A 1UCNA 3K8VA 3D6MB 2IMOA 5CYQB 1C1CB 1SH2A 5HP1B 4O23A 8RUCA 2VOPA 2F4VJ 3Q86A 1D0EA 4PROC 2JEFA 5DM7Q 2DO4A 3C8YA 3GCXP 3ZFVA 5D78A 3JAMU 3KK3A 2IM0A 1DY3A 2MY7A 1NHUA 2E66A 2QA1A 3A8JA 1BQXA 3JSRA 3O8WA 4ZP7A 5E41A 3PW4A 3RR8A 2RHSB 2XMTA 3IA0A 3M2RA 3BGRA 1RT6A 1NHVA 1S79A 1FO1A 5K5MA 1DBDA 1HD0A 5ETSA 2E5HA 2MKYA 3CE8A 2C22A 3NMRA 3M8RA 2HFUA 2BANB 3QT7A 4OYMA 5LXYA 4K0KF 1RTJB 3T5KA 3EXYA 4DV1F 4DL7A 1VQSA 3IRXB 4RNOA 3KYLA 1VQ7S 2PA3A 2YWBA 1V5IB 1HBNA 4KT0C 5J2NB 3TW0A 4DQSA 1RTDA 3ICLA 3UW1A 4OJ3A 2DGXA 2YH1A 2E5LJ 2DCUB 3NI2A 5A2QU 4PXBA 2X1BA 3V2UC 2BV3A 3L7OA 3NCPA 4MK7A 2ATCB 2IPOB 3FFIB 2BXJA 2BM1A 3DU5A 3MEKA 4HACA 3TJ8A 3UPFA 3EZUA 1ZTWA 2VF3A 5GMKa 3T41A 1YBAA 4MKYA 1DURA 1VQYA 5F9LA 4AUKA 3MEDA 2LEAA 2DNQA 1H7WA 3BF4A 2H4YB 3OXFA 1S10A 2QIFA 4AFFA 2ZH7A 4LF9F 5F9NA 2BQUA 3IG1A 2FVPA 4ZVPB 3LP0A 4RW6B 1AT1B 5HVGA 4LBIA 4QYZJ 4USTA 3IN5A 2HNDB 4RX6A 1FRMA 4XK8C 4JI1F 2WCXA 2B51A 4DR1C 2UV8A 3QFHA 4C3LA 2M2BA 5EWFA 1IXKA 4ES1A 1FE0A 4JI1J 4CTAB 4DV2F 2WSFC 4IO9Q 1U49A 1RTJA 2CU6A 3Q8RB 4WFNQ 1NDLA 1H0HB 2GIRA 4XIUA 2KZ0A 3H2VE 5IXUA 4ELTA 1LK7A 1WELA 1SUQA 1F5CA 2HIYA 2DNGA 2JLGA 4NLRA 4NLGA 1DRZA 4DUTA 2LXIA 2OPPB 2JSXA 3RW7A 5KTQA 3DHVA 3KK2A 2DR6A 1IKWB 3ILJA 3IP0A 2YNFA 5J2QA 1U1LA 2FVSA 2G2YA 2CZ4A 1T7PA 2KM8C 4OJHA 4A4JA 1VBKA 3OLAA 3KK1B 4C8OA 4NLOA 4LFCF 1HFEL 5AE3A 1VQ5S 1HI1A 2WONB 3SYZA 2N4CA 4DV1J 1IB8A 2V50A 2CQHA 3M32A 2J0SD 1UPMB 2WB4A 1U1KA 2P2FA 1PC4A 1Y0HA 2HGLA 2P9GA 2NQPA 5IQQA 1JLEA 1YJ7A 2FGOA 1S0VA 2RUSA 4TQRA 1RXOB 1S1WB 4DL0C 3CIZA 2WB1D 1C1BB 2GHWA 4CTAA 2YPZA 3G8SA 4NDNA 1IBLJ 1PILA 3MM6A 3OL7A 3VGSA 2ZE2A 4FP9A 3R6LB 3MURP 2BM0A 2KJWA 3RRKA 2DNYA 5KFFA 3DLLQ 2UUAF 1NKBA 4ILRA 5B0CA 2VONA 5LCIA 1SV5A 1HWJA 3JQMA 1IKWA 3DLEB 3TZWA 2YNFB 3VHQA 1MROA 3W2WA 4DV4J 5J2QB 2J5AA 5IV4A 1M90T 2CXEA 1VQPS 3KK1A 1S1TB 4CLWA 3EUNA 1SQFA 4PUIA 2BKPA 3JSBA 5A0YA 5J1EB 2PMHA 2IDLA 1P6TA 2QC3A 3X1LB 1T9UA 4ZVHA 2YQ0A 4IRKA 5I3QA 1MLAA 3BYRA 4BDPA 5GAEU 3ZTQA 1N34J 2OKQA 1HNVA 1KHVA 2DKOB 1FKOB 2QL8A 1ACMB 1P9YA 2EWHA 1FTRA 3CDAA 4IR9A 2NUHA 5E3QA 5LOQA 2P2CB 2F63A 4DEZA 5I4MA 2ZH8A 1KVJA 2HBRB 1PG3A 3MM6B 2WRMA 2Y1RI 1UWBB 3E3XA 1WHYA 4KRWA 3OHAA 3MR3A 2R2SA 3CW2C 5K9FA 1R7IA 2CIMA 4KGXB 4G1PA 3FSXA 3ILLA 1E6YA 1RABB 3TR3A 3N6MA 4YY3F 2N4DA 1JLFA 1SV5B 4YR0A 1NJZA 3SSRA 1VQ9S 1IR1A 2J0XA 1CSJA 3SXLA 2Y8WA 2CXCA 3VCDA 5KT3A 4AL6A 1D09B 2ILZA 4DI6A 9ATCB 3VTIA 1I3OB 3L7UA 1UETA 3LAXA 1G7CB
chains in the Genus database with same CATH topology
1UL3A 4IYQA 2VBWA 1E6VB 3DMJB 3A4IA 1HBOA 2DNNA 2JEIA 2B7CB 4Q8FA 3CC7S 4CT9A 1HNVB 3O5TB 1FKOA 2ZD1A 4G36A 4IFVB 1QVFR 4PXEA 1R43A 5KFAA 2PN2A 3PROC 1TKTA 4NLQA 3WC0A 3OSPA 2AYGA 4I9FA 4EO8A 4CH0S 3GIIA 2VSQA 2FHOB 3PEJA 5GVQA 3IR5B 3K7RA 5HBMB 2IBOA 4OX6A 2R7OA 5KG6A 3NGDA 4ECZA 3ZZYA 3CJ0A 2HRUA 4C97A 4F02A 2CQ1A 2DR8A 2XSJA 4C98A 4DL5A 4LT6A 1VQMS 3J81D 5BR8F 1Q16B 2OMOA 4TKTA 5AXKA 4DV2C 3KLVA 1IKYB 4WV3A 4NXNC 2BYCA 1NYEA 3GG0A 3PR5B 4CO4A 5IFMA 3AF5A 1J5OB 3DDNA 4UW2A 1NK8A 3E7XA 2IM3A 1B0PA 4ZP6A 1WTBA 2W24A 2RF2A 4X4NA 4MK8A 3H4DA 3RAQA 3TUFA 2XNQA 2HNZA 3IO1A 3C6UA 3THVA 2LEPA 2PT0A 2R7VA 1O90A 4Q2MA 2VV5A 4X66C 2EK6A 3EX7B 3C3LA 2OPQA 2KTQA 2ZJPQ 1RYSA 3W2VA 2IA0A 1CEZA 4ZP9A 3C66A 3DOMA 4TU7A 2VPWB 3OBIA 4AL5A 3I6PA 1V3ZA 3VAIA 4RU2A 1RYRA 3POTB 4WKYA 4Q0BA 1QVGR 2I2YA 5J2PB 4OZ1A 4PG4A 4QWEA 2XMVA 2R4FA 3F73A 3M6UA 2KT2A 3L3CA 4YQWA 2D3ZA 4Y2MA 1AFIA 4A8QA 1PG4A 4MKAA 4DFKA 3T3FA 3AJ1A 1WF3A 4QZVB 3Q0AA 3DI6A 2DBBA 3LP1B 1VC6A 4DDFA 4DPOA 1R0AB 1OQ6A 5KAKA 4LQ3A 2IC3A 3I82A 1N8RT 2CRLA 1KHWA 3WX4A 2MZQA 4HTJA 3DXBA 4X4PA 2F4VC 1SQEA 1IBKC 1T3NA 1MMDA 3HHLD 4JI0F 4DUZC 3Q8SB 3R1LA 3W2VB 1SL2A 4NXNF 4NOHA 1JXEA 2M52A 5FD1A 2PFFB 4DR3F 3UD4P 3M6WA 1T03A 2MKKA 3NCRA 2XMWA 2Z8QA 5BSUA 1F5AA 1ZOTA 2AJ1A 2A18A 3L09A 2BJOA 2Y4OA 3DAYA 2ZM6C 1NK0A 3OFHA 3HKWA 5A1IA 3DRPA 4CH7A 4DQPA 1HARA 1S49A 3K5LA 2B6AA 3VWSA 2QFJA 1RWUA 2KYZA 5CYJA 1V9OA 3VAFA 2KO1A 4ID8A 2X1FA 4BS2A 2ERRA 3QGGA 4X4OA 1RGVA 4ZPWR 1U48A 2YX1A 4USJC 2C2EA 1UAWA 1VBXA 5AE1A 5U47A 3ENVA 5CYQA 1L3UA 2IAJB 3GV8B 3DLHA 4NYPA 4B9SA 4FYDA 2RU9A 1GXUA 2GQCA 4OZ0A 5CZVA 2JDJA 5KYVA 4LFBC 2E1RA 3RW6A 2JMPA 3LGNA 2OPRA 3SFGA 2J9DE 4YUDA 2NUUG 3RU0A 3MECA 3PFOA 1ZAVA 1T03B 3M2RB 4LSLB 2POKA 3CCES 2VQFC 1T02A 2I0XA 4QW8A 1N52B 1RY2A 4N56A 1HWUA 1O8BA 2YKMA 5B0FA 5KFBA 3BSAA 4NMLA 3IWXA 2KJVA 2QEXS 4IKAA 1JJHA 4RBUA 3PACA 4A48A 2UV8G 1NAQA 5A6WA 5KG5A 1APSA 1SJQA 1U6FA 4DLEA 1U8SA 4A47A 1NJXA 3FDSA 2ZITA 3GV5B 2BQRA 2VOOA 2V4JA 1BQMA 1FXLA 1N5YB 4B9VA 2E9ZA 3MMCA 4B3TC 2YNHB 4QIEA 3MEDB 3KLHA 3LGXA 4FN5A 1LW2A 2FDNA 3SQGA 4DR1F 2D7VA 3DC2A 2NLWA 3GG1A 3CT9A 3RG2A 2PN6A 3BM7A 4DL2A 4GS5A 1X4BA 4O3QA 4OV1A 2JFDA 4PPZA 3QZ7A 4ZCMA 2FHMA 3E01B 3HHKA 3DRYA 2K7KA 3M8SA 2QZ8A 3MMBB 3LP2A 2VG5B 4KV8A 5DQIA 1U4BA 2MB0B 1HR0C 1RT1A 1P27B 1S6UA 3IEUA 1Q82T 1YI2S 4C0OC 1ZAWA 3QWPA 4I1TA 3K5NA 3OVAA 3EYZA 2OPPA 2ROPA 1TL1A 2FC9A 3M1VB 4JUZA 4BWJA 5M2UA 5KT6A 1KLMA 4I56A 3CC4S 1FNXH 4F4XA 1U6BA 2OP5A 2V94A 4DBQA 5SZTA 1NK4A 5BSTA 2DISA 1LW2B 2IMWP 1Y5NB 4H4KA 2JEJA 2G4BA 3R27A 2UU9F 1PC5A 6FDRA 2RVJA 4AXIA 3PZPA 5EDWA 3DRRA 3QLHB 5M2PA 1TR0A 1C4AA 4WU2A 4RBTA 2PC6A 3E01A 4QYRA 4Z37A 5DLFA 2VFRA 1PA4A 4ZK7M 4IG0A 2VG5A 2ZE2B 2YKAA 1D9AA 5GADU 1A7GE 3PO4A 5T8SA 1C0UB 1VJWA 3ISZA 4KHPC 2R8GA 2AX0A 3KMQA 2CPYA 4RUHA 1FK9B 2XGPA 2JL9A 4EUVA 1FEEA 2EK1A 4M8LA 1G2EA 1MMNA 4JI7C 3J7Z5 3NNAA 4FXDA 2W7AA 2AD9A 4NXMC 4M94A 1WD6A 1KONA 2VA2A 4U6PA 3GFHA 2BJDA 2ZH6A 3H59A 4P6QA 3US5A 1U1RA 2KYXA 3BN4A 2EFPA 2UUBC 4RVNA 3MF5A 3HZGA 4UUWA 4TYBA 1TV6B 1TP7A 3GR0A 3EGZA 4RNFA 4LF7C 4NRUA 1URNA 2UUCF 4C0HA 1KQGB 3KHHA 4DR7C 4R0EA 2B9WA 2QLWA 1K1SA 3RB3A 1L5UA 1VQ4S 3DRSB 3I07A 1S1UA 5KFRA 4P2SA 3CJEA 1C0UA 3K58A 4FTFA 4OXIA 1UJ6A 4ZOSA 1E6YB 4M1KA 3IAM9 3CCRS 1T05B 1ZZFA 1S97A 2R7TA 5C24B 1JLFB 1VIOA 4PXDA 3VR1A 3KG4A 4TU9A 1LXJA 2DH7A 4DV3F 5DGAA 4LFBF 4FUTA 3GFYA 3S1TA 3I31A 1LXNA 3B78A 5B08A 3AQPA 3VAJA 1Z2LA 3KHGA 2E7GA 1L3TA 1MD9A 1JNRB 1N6QB 2HMIB 3DMJA 4O4GB 2MGZB 4C0BA 7FD1A 3O1LA 3DU6A 3PVXA 1R8BA 2GNKA 4DF4A 1FDBA 1VRTB 2DH8A 3DOLA 3S01A 4R5PB 3PO5A 2E9RX 5KFQA 1B7FA 1MXCA 3L7PA 3M8QA 5CZXA 1N54B 1QE1B 2MKCA 2XLIA 1JJ4A 2EG2A 1S1UB 3S8SA 4IDKA 3CJ3A 5HBMA 1VC0A 3C5EA 4OHWA 1F0XA 3S7RA 2OFHX 1HL6A 2K8GA 2QA4S 3T1HF 2ZFHA 2Z0GA 3PJWA 4NLPA 4YP3A 2E29A 4D56A 1WF0A 2XSJB 4DV0C 2F1FA 2ADBA 3BDPA 5IWAF 2QLXA 1FNMA 2PIIA 4O3RA 5H9UA 1H6KX 3R5DA 3DLGB 2DPLA 4GC6A 4GKKC 2JZ5A 3KXWA 4GXQA 4JI1C 5KG7A 1U45A 1RT7A 2YNGA 3J81Y 3M9MB 1C0TA 1RT4B 5A8WA 2RF2B 3B7WA 2X51A 5LT5A 2HW3A 4A8YA 2HNZB 1M5KC 4ED5A 4WS9A 4I0WA 4Q2LA 4QWAA 2B9XA 1NH8A 1QE1A 3PIPQ 1X8DA 2RRNA 3BEGB 3H5SA 4KKOB 4XDCA 1YHQS 1EETA 1ZPWX 2NSBA 4IDKB 1SXLA 3QYYA 4ITSA 1ZB8A 2O67A 2GMHA 1DQ8A 3POTA 5T8TA 1CC8A 3Q2SC 1FERA 3FEZA 1JLBA 3RBEA 4MH4A 3MOJB 4HPVA 3ONQA 1U7LA 1X5TA 1TZ0A 2QYCA 2M8DB 1WEZA 3DM2B 3THTA 4NLXA 1X9SA 2BOPA 4A8KA 3D0HE 4CO0A 2F3JA 2F8EX 2PI5A 4ZDNA 1I94C 1GPMA 3DI6B 2ATWA 2MZRA 4V19X 1Y9OA 4Y6IA 2JVRA 4FBUA 5F8GA 2ZHBA 1JK9B 3FQKA 3KLGA 3NS5A 4KGKA 5KG1A 2PEHA 1NK5A 1FD2A 2BQ3A 4MTPA 2HQIA 2VZEA 2OSRA 5D3GA 1UKUA 3J7A1 3D5MA 5L1JA 1B64A 2W9CA 5HN0A 2FIUA 2JEGA 3OVBA 1M5HA 5CCLA 4U7UK 3PIOQ 3VNQA 1WACA 2MJNA 4F2RA 3ENQA 2RMLA 2V8DA 1X4HA 1IBLC 2DB1A 2D1CA 2UVUA 4DFJA 2UUBF 1NO8A 2EFQA 1HHTP 3MTKA 3ULHA 1Y5LB 4PQUA 5D6GA 3R9WA 2MZ1A 2WW8A 1W25A 1MXBA 1MU2A 3DOKA 3MPYA 4HT7A 3QO9B 3K57A 1SJRA 1N48A 3HHDA 5KT5A 4X64F 1S0MA 2A2CA 1D1UA 2UVVA 2I9SA 2F9DA 4KR0B 5H9FJ 5HL7Q 4RLQA 2MQPA 3EGWB 1O92A 5AJ3F 1SL1A 5FJ4A 3MZIA 2UP1A 4KPYA 1BQNB 2FY1A 4C8KA 4NLTA 3K2YA 4ICLA 2CPEA 2MSTA 1HA1A 4PCQA 4PPDA 1REVA 2XY5A 1FRLA 2W7PA 1R31A 4LF4C 4HDHA 1Y5IB 4X4RA 4FS2A 2UU9C 2Q43A 3MM9A 3I32A 1H2VZ 5B0AA 2YKMB 3EQ6A 1KKGA 1TL3B 3CMAS 3W3SA 2LLZA 2ZH9A 4GC7A 4J9NA 4WFAQ 3M9NB 3H5YA 1FEHA 2XMKA 5KFEA 5CD4H 5K85A 4Q5VA 2FHJA 1DJ0A 4K4YA 4JI5C 1WHWA 3NYQA 1K1QA 3SV4A 3RB0A 1IBLF 1BQMB 1YJWS 1AMUA 4YOEA 2YX7A 1HR0F 3MOZA 2B4OA 1UA1A 5LSLA 3LWLA 1TAQA 3ETOA 1S72S 3HO1A 2E8CA 2PSZA 2WHOA 5CH7B 1NKEA 3SQGB 2K3KA 4WKRA 3QIDA 3TVKA 3KK3B 2ZZMA 4WXOA 3BO4A 1WF1A 3IWLA 4DMZA 2VH7A 2DHAA 2P9CA 4CNZA 2DITA 2MKSA 1QY7A 2VPZB 1IBMF 3QWUA 5DG9A 2DIVA 1QM9A 4KV8B 1TL3A 5M2RA 3SEOA 5E3RA 4MFBA 2HVZA 4OHYA 1BWEA 3WDOA 5F8JA 4EZ9A 2EW9A 3VQTA 1Y3JA 4K4SA 4BC7A 4ZCKA 2KFNA 5A2QY 4JI0C 2M88A 3EZ5A 3OTOC 3PM9A 1JB0C 2DGSA 2XBPA 5B0DA 2MQQA 4ZHRB 1RKJA 5T14A 2BA9A 2RRBA 5LSOA 4J9LA 3PEHA 4JI8C 3H2LA 3OTEA 3MHYA 5K8FA 3VQSA 2MKHA 2G13A 3AH6A 4TQSA 2DHSA 4XPCA 2AYEA 1PSDA 2AX1A 4C2MA 5C42A 2AJ0A 1FKPA 5I3QA 2R2RA 2ZKUA 2QVXX 1AROP 2BJEA 2DNRA