5D0CA

Crystal structure of the first bromodomain of human brd4 in complex with benzo[cd]indol-2(1h)-one ligand
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
129
structure length
129
Chain Sequence
LVPRGSNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Discovery of Benzo[cd]indol-2(1H)-ones as Potent and Specific BET Bromodomain Inhibitors: Structure-Based Virtual Screening, Optimization, and Biological Evaluation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 41
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2015-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5d0cA01
4IOOA 4UYFB 4YYJA 4MR5A 5DY7A 4CFLA 5KHMA 5IGMA 4YYMA 4MR3A 4CUUA 2DWWA 4O7BA 4QSQA 4BHWA 4NQNA 4UITA 4XUBA 3O34A 4UYDA 5L8UA 5CRMA 4WIVA 4YATA 3LQHA 4NRCA 4IR6A 2DKWA 4A9MA 3HMFA 5FE1A 4TS8A 5L96A 5EPBA 5F62A 5HCLA 5DYUA 5E73A 4MEQA 5F60A 3QZTA 4QEWA 3MQMA 5LJ2A 5F2PA 5I1QA 5I83A 5FE5A 4A9OA 5FFWA 4UYEA 5D25A 2RFJA 5E9KA 4PCEA 5A5NA 5ACYA 5BT5A 5HJCA 4QSUA 5CUCA 4KV4A 2NXBA 4LZSA 5JWMA 5A83A 5C89A 2OSSA 5FB0A 4YYHA 4NRAA 4HXKA 2I8NA 5EV9A 5FG6A 5EGUA 5EVAA 4A9KA 5JI8A 5DFCA 4QEUA 4Y03A 4ZW1A 4OGIA 1E6IA 4XY8A 4MENA 4HXMA 4NYWA 4O7AA 3O33A 2R0VA 4WHWA 5L97A 1JSPB 4NR8A 4QR4A 5CP5A 5EISA 5CUAA 2R0SA 4O72A 2RNYA 2YEKA 5HQ7A 3P1DA 5BT4A 5F61A 4MEOA 4QZSA 3I3JA 5D3PA 2H60A 4TTEA 5DKHA 4YK0A 3QZVA 4HXLA 4N3WA 5DLZA 5HELA 4YBTA 4ZQLA 4KCXA 5FH7A 5I80A 4YBSA 4TU4A 5CUEA 4NRBA 5IGKA 5FB1A 4UYFA 5CTLA 4BW4A 5LJ0A 4NYXA 5EU1A 4QB3A 5FDZA 4YYDA 5HRWA 1WUMA 5DYCA 5E3DA 4O7EA 4QR5A 5HRVA 5AD2A 4NYVA 4BW1A 5A7CA 5DX4A 2YYNA 4BW2A 5LKZA 5CQ5A 4NUCA 5CRZA 4HXSA 5HM0A 4TT6A 5CQ4A 4QBMA 3IU6A 5E0RA 5COIA 4NQMA 4A9HA 5EWDA 5ENHA 4LDFA 3O35A 5EP7A 5ENJA 5AMFA 2YDWA 4QSRA 4UIYA 5D26A 5H1TA 5IGNA 4N4GA 2LSPB 5DFDA 3FKMX 5C8GA 2E7NA 3NXBA 3P5OA 4YYKA 2N9GA 4IR4A 4YH4A 4TYLA 5CQTA 4O77A 4UIZA 5A5SA 2R0YA 1WUGA 4X2IA 5LJ1A 2MJVB 2E3KA 5CS8A 5ENBA 4N4IA 5KU3A 4HXOA 5L8TA 5HQ6A 5DYAA 4HBVA 5L98A 5IGLA 5EPRA 3MB4A 4Z6HA 4E96A 4F3IA 4O7CA 5FE3A 5LKTA 5F1HA 2D9EA 4O70A 5F36A 4J1PA 5CZGA 5D24A 4Z6IA 5DW2A 3JVLA 5EWCA 5HFRA 5II2A 4CUQA 4HXPA 4GPJA 5CU8A 4YC9A 4NR6A 4PY6A 5ETDA 3G0JA 5E9MA 1ZS5A 5I7XA 4QSWA 3UV4A 3DWYA 5CGPA 4QSVA 4PTBA 4ALGA 4TQNA 5D3LA 4QR3A 2D82A 4C67A 2RNWA 5DW1A 4CUTA 5EM3A 5FBXA 1EQFA 4CL9A 2L84A 5CY9A 4NR5A 3G0LA 4MEPA 1X0JA 3S92A 5ENGA 3TLPA 4CUSA 5A82A 5E9VA 4QC1A 3MUKA 3QZSA 5D3RA 5A81A 4A9JA 5FE0A 2WP2A 3JVMA 4MR4A 3Q2EA 5EI4A 3LXJA 3U5MA 4CLBA 4O76A 5I40A 4HBXA 4PS5A 2FSAA 3D7CA 2WP1A 5CUDA 4OUFA 4UYGA 3O36A 2RS9B 3ZYUA 3U5JA 5FH8A 3UVXA 4LC2A 5FG5A 5H85A 3UV5A 5G4SA 2RNXA 5C7NA 5FE4A 5AMEA 4O78A 4N4HA 5TCMA 4LYSA 4YABA 5LVRA 5I7YA 4NS5A 5D3TA 3K2JA 5IBNA 2YEMA 2L85A 5CQAA 4RVRA 5HQ5A 5KO4A 5FE7A 2YQDA 4CFKA 4O71A 4QC3A 1JM4B 4NXJA 4O74A 5E9IA 5HEMA 2KTBB 5F3AA 4C66A 4CUPA 4QSPA 5E3GA 4UIVA 3IU5A 4ZC9A 5ETBA 4A9EA 5LKUA 5ENEA 4J0SA 4TZ2A 4IR5A 4QUUA 3U5OA 2DVQA 2R10A 5D3JA 2YELA 2YW5A 4YY4A 4UIUA 5FE8A 5C4QA 3UW9A 4QSTA 3UVYA 5I29A 4Z93A 3O37A 5F5ZA 4NR4A 5BT3A 5F25A 2DVVA 2DATA 4TT4A 4HBYA 5FG4A 4BW3A 3HMEA 4PKLA 5FE2A 5H1UA 4A9IA 3P1EA 4QUTA 4BJXA 5D0CA 3SVGA 5LUUA 5FFVA 5D7XA 4OGJA 5K29A 5ENIA 2RO1A 5HLSA 5DBMA 5DKDA 2GRCA 4IORA 5I89A 4LYWA 5J0DA 3U5LA 5FH6A 4HBWA 4UIWA 4NUEA 4Z1QA 4XY9A 3MULA 4NR9A 4QSXA 3S91A 3LQJA 4KV1A 5EPSA 5LVQA 3U5NA 4QYDA 5IG6A 4TU6A 5EWWA 4YY6A 4MR6A 4HXRA 5F1LA 4A9FA 3RCWA 5EK9A 3AQAA 3UV2A 4QY4A 3SVHA 5LKXA 2G4AA 4PCIA 4XYAA 5DKCA 4A9LA 4WHUA 5A5PA 1N72A 5DLXA 5G4RA 5II1A 4UIXA 3GG3A 2DVSA 5A5QA 4Z1SA 4YBMA 5L99A 4Q0OA 5KTXA 3P1FA 5HRXA 5E7DA 4AKNA 4A9NA 5IIDA 4FLPA 4UYHA 3JVJA 4QSSA 5D3SA 5CQ3A 5EWVA 3AADA 2E7OA 4YYGA 3U5PA 3MXFA 5CFWA 3DAIA 4Q0NA 5CQ8A 3UVWA 4N4FA 5FE9A 1F68A 4HXNA 4J0RA 4TZ8A 4LZ2A 5CUBA 4YADA 5ENFA 2I7KA 3HMHA 5CQ7A 5EA1A 4YYIA 5HFQA 5C87A 2F6JA 3LQIA 2DVRA 2OO1A 4J3IA 5FFYA 3UVDA 3JVKA 3LJWA 5A5RA 2OUOA 4YAXA 5F63A 4DONA 5H1VA 4CURA 5FE6A 4LYIA 2L5EA 5D3HA 5EQ1A 5EICA 4YYNA 2F6NA 3ONIA 3U5KA 4QEVA 4QNSA 5E9LA 3P1CA 4LZRA 5DYXA 5AD3A 5A85A 4IR3A 4ALHA 5I86A 3Q2FA 4NR7A 3MB3A 4LRGA 5ENCA 4O7FA 5EWHA 5KTUA 5I88A 5DFBA 4O75A 4TT2A 5HENA 5C85A 4NUDA 5E9YA 4QYLA 5CQ6A 5KTWA 5CUGA 4LR6A 3SVFA 4YH3A 5A5OA 4IOQA 5TB6A 4XUAA 2RI7A 5D3NA 5E74A 5CPEA
chains in the Genus database with same CATH superfamily
4IOOA 4UYFB 4YYJA 4MR5A 5DY7A 4CFLA 5KHMA 5IGMA 4YYMA 4MR3A 4CUUA 2DWWA 4O7BA 4QSQA 4BHWA 4NQNA 4UITA 4XUBA 3O34A 4UYDA 5L8UA 5CRMA 4WIVA 4YATA 3LQHA 4NRCA 4IR6A 2DKWA 4A9MA 3HMFA 5FE1A 4TS8A 5L96A 5EPBA 5F62A 5HCLA 5DYUA 5E73A 4MEQA 5F60A 3QZTA 4QEWA 3MQMA 5LJ2A 5F2PA 5I1QA 5I83A 5FE5A 4A9OA 5FFWA 4UYEA 5D25A 2RFJA 5E9KA 4PCEA 5A5NA 5ACYA 5BT5A 5HJCA 4QSUA 5CUCA 4KV4A 2NXBA 4LZSA 5JWMA 5A83A 5C89A 2OSSA 5FB0A 4YYHA 4NRAA 4HXKA 2I8NA 5EV9A 5FG6A 5EGUA 5EVAA 4A9KA 5JI8A 5DFCA 4QEUA 4Y03A 4ZW1A 4OGIA 1E6IA 4XY8A 4MENA 4HXMA 4NYWA 4O7AA 3O33A 2R0VA 4WHWA 5L97A 1JSPB 4NR8A 4QR4A 5CP5A 1PUOA 5EISA 5CUAA 2R0SA 4O72A 4AKGA 2RNYA 2YEKA 5HQ7A 3P1DA 5BT4A 5F61A 4MEOA 4QZSA 3I3JA 5D3PA 2H60A 4TTEA 5DKHA 4YK0A 3QZVA 4HXLA 4N3WA 5DLZA 5HELA 4YBTA 4ZQLA 4KCXA 5FH7A 5I80A 4YBSA 4TU4A 5CUEA 4NRBA 5IGKA 5FB1A 4UYFA 4AKIA 5CTLA 4BW4A 5LJ0A 4NYXA 5EU1A 4QB3A 5FDZA 4YYDA 5HRWA 1WUMA 5DYCA 5E3DA 4O7EA 4QR5A 5HRVA 5AD2A 4NYVA 4BW1A 5A7CA 5DX4A 2YYNA 4BW2A 3D1DA 5LKZA 5CQ5A 4NUCA 5CRZA 4HXSA 5HM0A 4TT6A 5CQ4A 4QBMA 3IU6A 5E0RA 5COIA 4NQMA 4A9HA 5EWDA 5ENHA 4LDFA 3O35A 5EP7A 5ENJA 5AMFA 2YDWA 4QSRA 4UIYA 5D26A 5H1TA 5IGNA 4N4GA 2LSPB 5DFDA 3FKMX 5C8GA 2E7NA 3NXBA 3P5OA 4YYKA 2N9GA 4IR4A 4YH4A 4TYLA 5CQTA 4O77A 4UIZA 5A5SA 2R0YA 1WUGA 4X2IA 5LJ1A 2MJVB 2E3KA 5CS8A 5ENBA 4N4IA 5KU3A 4HXOA 5L8TA 5HQ6A 4AKHA 5DYAA 4HBVA 5L98A 5IGLA 5EPRA 3MB4A 4Z6HA 4E96A 4F3IA 4O7CA 5FE3A 5LKTA 5F1HA 2D9EA 4O70A 3ERRA 5F36A 4J1PA 5CZGA 5D24A 4Z6IA 5DW2A 3JVLA 5EWCA 5HFRA 5II2A 4CUQA 4HXPA 4GPJA 5CU8A 4YC9A 4NR6A 4PY6A 5ETDA 3G0JA 5E9MA 1ZS5A 5I7XA 4QSWA 3UV4A 3DWYA 5CGPA 4QSVA 4PTBA 2EJNA 4ALGA 4TQNA 5D3LA 4QR3A 2D82A 4C67A 2RNWA 5DW1A 4CUTA 5EM3A 5FBXA 1EQFA 4CL9A 2L84A 5CY9A 4NR5A 3G0LA 4MEPA 1X0JA 3S92A 5ENGA 3TLPA 4CUSA 5A82A 5E9VA 4QC1A 3MUKA 3QZSA 5D3RA 5A81A 4A9JA 5FE0A 2WP2A 3JVMA 4MR4A 3Q2EA 5EI4A 3LXJA 3U5MA 4CLBA 4O76A 5I40A 4HBXA 4PS5A 2FSAA 3D7CA 2WP1A 5CUDA 4OUFA 4UYGA 3O36A 2RS9B 3ZYUA 3U5JA 5FH8A 3UVXA 4LC2A 5FG5A 5H85A 3UV5A 5G4SA 2RNXA 5C7NA 5FE4A 5AMEA 4O78A 4N4HA 5TCMA 4LYSA 4YABA 5LVRA 5I7YA 4NS5A 5D3TA 3K2JA 5IBNA 2YEMA 2L85A 5CQAA 4RVRA 5HQ5A 5KO4A 5FE7A 2YQDA 4CFKA 4O71A 4QC3A 1JM4B 4NXJA 4O74A 5E9IA 5HEMA 2KTBB 5F3AA 4C66A 4CUPA 4QSPA 5E3GA 4UIVA 3IU5A 4ZC9A 5ETBA 4A9EA 5LKUA 5ENEA 4J0SA 4TZ2A 4IR5A 4QUUA 3U5OA 2DVQA 2R10A 5D3JA 2YELA 2YW5A 4YY4A 4UIUA 5FE8A 5C4QA 3UW9A 3VKHA 4QSTA 3UVYA 5I29A 4Z93A 3O37A 5F5ZA 4NR4A 5BT3A 5F25A 2DVVA 2DATA 4TT4A 4HBYA 5FG4A 4BW3A 3HMEA 4PKLA 5FE2A 5H1UA 4A9IA 3P1EA 4QUTA 4BJXA 5D0CA 3SVGA 5LUUA 5FFVA 5D7XA 4OGJA 5K29A 5ENIA 2RO1A 5HLSA 5DBMA 5DKDA 2GRCA 4IORA 5I89A 4LYWA 5J0DA 3U5LA 5FH6A 4HBWA 4UIWA 4NUEA 4Z1QA 4XY9A 3MULA 4NR9A 3D1BA 4QSXA 3S91A 3LQJA 4KV1A 5EPSA 5LVQA 3U5NA 4QYDA 5IG6A 4TU6A 5EWWA 4YY6A 4MR6A 4HXRA 5F1LA 4A9FA 3RCWA 5EK9A 3AQAA 3UV2A 4QY4A 3SVHA 5LKXA 2G4AA 4PCIA 4XYAA 5DKCA 4A9LA 4WHUA 5A5PA 1N72A 5DLXA 5G4RA 5II1A 4UIXA 3GG3A 2DVSA 5A5QA 4Z1SA 4YBMA 5L99A 4Q0OA 5KTXA 3P1FA 5HRXA 5E7DA 4AKNA 4A9NA 5IIDA 4FLPA 4UYHA 3JVJA 4QSSA 5D3SA 5CQ3A 5EWVA 3AADA 2E7OA 4YYGA 3U5PA 3MXFA 5CFWA 3DAIA 4Q0NA 5CQ8A 3UVWA 4N4FA 5FE9A 1F68A 4HXNA 4J0RA 4TZ8A 4LZ2A 5CUBA 4YADA 5ENFA 2I7KA 3HMHA 5CQ7A 5EA1A 4YYIA 5HFQA 5C87A 2F6JA 3LQIA 2DVRA 2OO1A 4J3IA 5FFYA 3UVDA 3JVKA 4AI6A 3LJWA 5A5RA 2OUOA 4YAXA 5F63A 4DONA 5H1VA 4CURA 5FE6A 4LYIA 2L5EA 5D3HA 5EQ1A 5EICA 4YYNA 2F6NA 3ONIA 3U5KA 4QEVA 4QNSA 5E9LA 1ZKRA 3P1CA 4LZRA 5DYXA 5AD3A 3VKGA 5A85A 4IR3A 4ALHA 5I86A 3Q2FA 4NR7A 3MB3A 4LRGA 5ENCA 4O7FA 5EWHA 5KTUA 5I88A 5DFBA 4O75A 4TT2A 5HENA 5C85A 4NUDA 5E9YA 4QYLA 5CQ6A 5KTWA 5CUGA 4LR6A 3SVFA 4YH3A 5A5OA 4IOQA 5TB6A 4XUAA 2RI7A 5D3NA 5E74A 5CPEA
chains in the Genus database with same CATH topology
4IOOA 4UYFB 4YYJA 4MR5A 5DY7A 4CFLA 5KHMA 5IGMA 4YYMA 4MR3A 4CUUA 2DWWA 4O7BA 4QSQA 4BHWA 4NQNA 4UITA 4XUBA 3O34A 4UYDA 5L8UA 5CRMA 4WIVA 4YATA 3LQHA 4NRCA 4IR6A 2DKWA 4A9MA 3HMFA 5FE1A 4TS8A 5L96A 5EPBA 5F62A 5HCLA 5DYUA 5E73A 4MEQA 5F60A 3QZTA 4QEWA 3MQMA 5LJ2A 5F2PA 5I1QA 5I83A 5FE5A 4A9OA 5FFWA 4UYEA 5D25A 2RFJA 5E9KA 4PCEA 5A5NA 5ACYA 5BT5A 5HJCA 4QSUA 5CUCA 4KV4A 2NXBA 4LZSA 5JWMA 5A83A 5C89A 2OSSA 5FB0A 4YYHA 4NRAA 4HXKA 2I8NA 5EV9A 5FG6A 5EGUA 5EVAA 4A9KA 5JI8A 5DFCA 4QEUA 4Y03A 4ZW1A 4OGIA 1E6IA 4XY8A 4MENA 4HXMA 4NYWA 4O7AA 3O33A 2R0VA 4WHWA 5L97A 1JSPB 4NR8A 4QR4A 5CP5A 5EISA 5CUAA 2R0SA 4O72A 2RNYA 2YEKA 5HQ7A 3P1DA 5BT4A 5F61A 4MEOA 4QZSA 3I3JA 5D3PA 2H60A 4TTEA 5DKHA 4YK0A 3QZVA 4HXLA 4N3WA 5DLZA 5HELA 4YBTA 4ZQLA 4KCXA 5FH7A 5I80A 4YBSA 4TU4A 5CUEA 4NRBA 5IGKA 5FB1A 4UYFA 5CTLA 4BW4A 5LJ0A 4NYXA 5EU1A 4QB3A 5FDZA 4YYDA 5HRWA 1WUMA 5DYCA 5E3DA 4O7EA 4QR5A 5HRVA 5AD2A 4NYVA 4BW1A 5A7CA 5DX4A 2YYNA 4BW2A 5LKZA 5CQ5A 4NUCA 5CRZA 4HXSA 5HM0A 4TT6A 5CQ4A 4QBMA 3IU6A 5E0RA 5COIA 4NQMA 4A9HA 5EWDA 5ENHA 4LDFA 3O35A 5EP7A 5ENJA 5AMFA 2YDWA 4QSRA 4UIYA 5D26A 5H1TA 5IGNA 4N4GA 2LSPB 5DFDA 3FKMX 5C8GA 2E7NA 3NXBA 3P5OA 4YYKA 2N9GA 4IR4A 4YH4A 4TYLA 5CQTA 4O77A 4UIZA 5A5SA 2R0YA 1WUGA 4X2IA 5LJ1A 2MJVB 2E3KA 5CS8A 5ENBA 4N4IA 5KU3A 4HXOA 5L8TA 5HQ6A 5DYAA 4HBVA 5L98A 5IGLA 5EPRA 3MB4A 4Z6HA 4E96A 4F3IA 4O7CA 5FE3A 5LKTA 5F1HA 2D9EA 4O70A 5F36A 4J1PA 5CZGA 5D24A 4Z6IA 5DW2A 3JVLA 5EWCA 5HFRA 5II2A 4CUQA 4HXPA 4GPJA 5CU8A 4YC9A 4NR6A 4PY6A 5ETDA 3G0JA 5E9MA 1ZS5A 5I7XA 4QSWA 3UV4A 3DWYA 5CGPA 4QSVA 4PTBA 4ALGA 4TQNA 5D3LA 4QR3A 2D82A 4C67A 2RNWA 5DW1A 4CUTA 5EM3A 5FBXA 1EQFA 4CL9A 2L84A 5CY9A 4NR5A 3G0LA 4MEPA 1X0JA 3S92A 5ENGA 3TLPA 4CUSA 5A82A 5E9VA 4QC1A 3MUKA 3QZSA 5D3RA 5A81A 4A9JA 5FE0A 2WP2A 3JVMA 4MR4A 3Q2EA 5EI4A 3LXJA 3U5MA 4CLBA 4O76A 5I40A 4HBXA 4PS5A 2FSAA 3D7CA 2WP1A 5CUDA 4OUFA 4UYGA 3O36A 2RS9B 3ZYUA 3U5JA 5FH8A 3UVXA 4LC2A 5FG5A 5H85A 3UV5A 5G4SA 2RNXA 5C7NA 5FE4A 5AMEA 4O78A 4N4HA 5TCMA 4LYSA 4YABA 5LVRA 5I7YA 4NS5A 5D3TA 3K2JA 5IBNA 2YEMA 2L85A 5CQAA 4RVRA 5HQ5A 5KO4A 5FE7A 2YQDA 4CFKA 4O71A 4QC3A 1JM4B 4NXJA 4O74A 5E9IA 5HEMA 2KTBB 5F3AA 4C66A 4CUPA 4QSPA 5E3GA 4UIVA 3IU5A 4ZC9A 5ETBA 4A9EA 5LKUA 5ENEA 4J0SA 4TZ2A 4IR5A 4QUUA 3U5OA 2DVQA 2R10A 5D3JA 2YELA 2YW5A 4YY4A 4UIUA 5FE8A 5C4QA 3UW9A 4QSTA 3UVYA 5I29A 4Z93A 3O37A 5F5ZA 4NR4A 5BT3A 5F25A 2DVVA 2DATA 4TT4A 4HBYA 5FG4A 4BW3A 3HMEA 4PKLA 5FE2A 5H1UA 4A9IA 3P1EA 4QUTA 4BJXA 5D0CA 3SVGA 5LUUA 5FFVA 5D7XA 4OGJA 5K29A 5ENIA 2RO1A 5HLSA 5DBMA 5DKDA 2GRCA 4IORA 5I89A 4LYWA 5J0DA 3U5LA 5FH6A 4HBWA 4UIWA 4NUEA 4Z1QA 4XY9A 3MULA 4NR9A 4QSXA 3S91A 3LQJA 4KV1A 5EPSA 5LVQA 3U5NA 4QYDA 5IG6A 4TU6A 5EWWA 4YY6A 4MR6A 4HXRA 5F1LA 4A9FA 3RCWA 5EK9A 3AQAA 3UV2A 4QY4A 3SVHA 5LKXA 2G4AA 4PCIA 4XYAA 5DKCA 4A9LA 4WHUA 5A5PA 1N72A 5DLXA 5G4RA 5II1A 4UIXA 3GG3A 2DVSA 5A5QA 4Z1SA 4YBMA 5L99A 4Q0OA 5KTXA 3P1FA 5HRXA 5E7DA 4AKNA 4A9NA 5IIDA 4FLPA 4UYHA 3JVJA 4QSSA 5D3SA 5CQ3A 5EWVA 3AADA 2E7OA 4YYGA 3U5PA 3MXFA 5CFWA 3DAIA 4Q0NA 5CQ8A 3UVWA 4N4FA 5FE9A 1F68A 4HXNA 4J0RA 4TZ8A 4LZ2A 5CUBA 4YADA 5ENFA 2I7KA 3HMHA 5CQ7A 5EA1A 4YYIA 5HFQA 5C87A 2F6JA 3LQIA 2DVRA 2OO1A 4J3IA 5FFYA 3UVDA 3JVKA 3LJWA 5A5RA 2OUOA 4YAXA 5F63A 4DONA 5H1VA 4CURA 5FE6A 4LYIA 2L5EA 5D3HA 5EQ1A 5EICA 4YYNA 2F6NA 3ONIA 3U5KA 4QEVA 4QNSA 5E9LA 3P1CA 4LZRA 5DYXA 5AD3A 5A85A 4IR3A 4ALHA 5I86A 3Q2FA 4NR7A 3MB3A 4LRGA 5ENCA 4O7FA 5EWHA 5KTUA 5I88A 5DFBA 4O75A 4TT2A 5HENA 5C85A 4NUDA 5E9YA 4QYLA 5CQ6A 5KTWA 5CUGA 4LR6A 3SVFA 4YH3A 5A5OA 4IOQA 5TB6A 4XUAA 2RI7A 5D3NA 5E74A 5CPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOO A;  4UYF B;  4YYJ A;  4MR5 A;  5DY7 A;  4CFL A;  5KHM A;  5IGM A;  4YYM A;  4MR3 A;  4CUU A;  2DWW A;  4O7B A;  4QSQ A;  4BHW A;  4NQN A;  4UIT A;  4XUB A;  3O34 A;  4UYD A;  5L8U A;  5CRM A;  4WIV A;  4YAT A;  3LQH A;  4NRC A;  4IR6 A;  2DKW A;  4A9M A;  3HMF A;  5FE1 A;  4TS8 A;  5L96 A;  5EPB A;  5F62 A;  5HCL A;  5DYU A;  5E73 A;  4MEQ A;  5F60 A;  3QZT A;  4QEW A;  3MQM A;  5LJ2 A;  5F2P A;  5I1Q A;  5I83 A;  5FE5 A;  4A9O A;  5FFW A;  4UYE A;  5D25 A;  2RFJ A;  5E9K A;  4PCE A;  5A5N A;  5ACY A;  5BT5 A;  5HJC A;  4QSU A;  5CUC A;  4KV4 A;  2NXB A;  4LZS A;  5JWM A;  5A83 A;  5C89 A;  2OSS A;  5FB0 A;  4YYH A;  4NRA A;  4HXK A;  2I8N A;  5EV9 A;  5FG6 A;  5EGU A;  5EVA A;  4A9K A;  5JI8 A;  5DFC A;  4QEU A;  4Y03 A;  4ZW1 A;  4OGI A;  1E6I A;  4XY8 A;  4MEN A;  4HXM A;  4NYW A;  4O7A A;  3O33 A;  2R0V A;  4WHW A;  5L97 A;  1JSP B;  4NR8 A;  4QR4 A;  5CP5 A;  5EIS A;  5CUA A;  2R0S A;  4O72 A;  2RNY A;  2YEK A;  5HQ7 A;  3P1D A;  5BT4 A;  5F61 A;  4MEO A;  4QZS A;  3I3J A;  5D3P A;  2H60 A;  4TTE A;  5DKH A;  4YK0 A;  3QZV A;  4HXL A;  4N3W A;  5DLZ A;  5HEL A;  4YBT A;  4ZQL A;  4KCX A;  5FH7 A;  5I80 A;  4YBS A;  4TU4 A;  5CUE A;  4NRB A;  5IGK A;  5FB1 A;  4UYF A;  5CTL A;  4BW4 A;  5LJ0 A;  4NYX A;  5EU1 A;  4QB3 A;  5FDZ A;  4YYD A;  5HRW A;  1WUM A;  5DYC A;  5E3D A;  4O7E A;  4QR5 A;  5HRV A;  5AD2 A;  4NYV A;  4BW1 A;  5A7C A;  5DX4 A;  2YYN A;  4BW2 A;  5LKZ A;  5CQ5 A;  4NUC A;  5CRZ A;  4HXS A;  5HM0 A;  4TT6 A;  5CQ4 A;  4QBM A;  3IU6 A;  5E0R A;  5COI A;  4NQM A;  4A9H A;  5EWD A;  5ENH A;  4LDF A;  3O35 A;  5EP7 A;  5ENJ A;  5AMF A;  2YDW A;  4QSR A;  4UIY A;  5D26 A;  5H1T A;  5IGN A;  4N4G A;  2LSP B;  5DFD A;  3FKM X;  5C8G A;  2E7N A;  3NXB A;  3P5O A;  4YYK A;  2N9G A;  4IR4 A;  4YH4 A;  4TYL A;  5CQT A;  4O77 A;  4UIZ A;  5A5S A;  2R0Y A;  1WUG A;  4X2I A;  5LJ1 A;  2MJV B;  2E3K A;  5CS8 A;  5ENB A;  4N4I A;  5KU3 A;  4HXO A;  5L8T A;  5HQ6 A;  5DYA A;  4HBV A;  5L98 A;  5IGL A;  5EPR A;  3MB4 A;  4Z6H A;  4E96 A;  4F3I A;  4O7C A;  5FE3 A;  5LKT A;  5F1H A;  2D9E A;  4O70 A;  5F36 A;  4J1P A;  5CZG A;  5D24 A;  4Z6I A;  5DW2 A;  3JVL A;  5EWC A;  5HFR A;  5II2 A;  4CUQ A;  4HXP A;  4GPJ A;  5CU8 A;  4YC9 A;  4NR6 A;  4PY6 A;  5ETD A;  3G0J A;  5E9M A;  1ZS5 A;  5I7X A;  4QSW A;  3UV4 A;  3DWY A;  5CGP A;  4QSV A;  4PTB A;  4ALG A;  4TQN A;  5D3L A;  4QR3 A;  2D82 A;  4C67 A;  2RNW A;  5DW1 A;  4CUT A;  5EM3 A;  5FBX A;  1EQF A;  4CL9 A;  2L84 A;  5CY9 A;  4NR5 A;  3G0L A;  4MEP A;  1X0J A;  3S92 A;  5ENG A;  3TLP A;  4CUS A;  5A82 A;  5E9V A;  4QC1 A;  3MUK A;  3QZS A;  5D3R A;  5A81 A;  4A9J A;  5FE0 A;  2WP2 A;  3JVM A;  4MR4 A;  3Q2E A;  5EI4 A;  3LXJ A;  3U5M A;  4CLB A;  4O76 A;  5I40 A;  4HBX A;  4PS5 A;  2FSA A;  3D7C A;  2WP1 A;  5CUD A;  4OUF A;  4UYG A;  3O36 A;  2RS9 B;  3ZYU A;  3U5J A;  5FH8 A;  3UVX A;  4LC2 A;  5FG5 A;  5H85 A;  3UV5 A;  5G4S A;  2RNX A;  5C7N A;  5FE4 A;  5AME A;  4O78 A;  4N4H A;  5TCM A;  4LYS A;  4YAB A;  5LVR A;  5I7Y A;  4NS5 A;  5D3T A;  3K2J A;  5IBN A;  2YEM A;  2L85 A;  5CQA A;  4RVR A;  5HQ5 A;  5KO4 A;  5FE7 A;  2YQD A;  4CFK A;  4O71 A;  4QC3 A;  1JM4 B;  4NXJ A;  4O74 A;  5E9I A;  5HEM A;  2KTB B;  5F3A A;  4C66 A;  4CUP A;  4QSP A;  5E3G A;  4UIV A;  3IU5 A;  4ZC9 A;  5ETB A;  4A9E A;  5LKU A;  5ENE A;  4J0S A;  4TZ2 A;  4IR5 A;  4QUU A;  3U5O A;  2DVQ A;  2R10 A;  5D3J A;  2YEL A;  2YW5 A;  4YY4 A;  4UIU A;  5FE8 A;  5C4Q A;  3UW9 A;  4QST A;  3UVY A;  5I29 A;  4Z93 A;  3O37 A;  5F5Z A;  4NR4 A;  5BT3 A;  5F25 A;  2DVV A;  2DAT A;  4TT4 A;  4HBY A;  5FG4 A;  4BW3 A;  3HME A;  4PKL A;  5FE2 A;  5H1U A;  4A9I A;  3P1E A;  4QUT A;  4BJX A;  5D0C A;  3SVG A;  5LUU A;  5FFV A;  5D7X A;  4OGJ A;  5K29 A;  5ENI A;  2RO1 A;  5HLS A;  5DBM A;  5DKD A;  2GRC A;  4IOR A;  5I89 A;  4LYW A;  5J0D A;  3U5L A;  5FH6 A;  4HBW A;  4UIW A;  4NUE A;  4Z1Q A;  4XY9 A;  3MUL A;  4NR9 A;  4QSX A;  3S91 A;  3LQJ A;  4KV1 A;  5EPS A;  5LVQ A;  3U5N A;  4QYD A;  5IG6 A;  4TU6 A;  5EWW A;  4YY6 A;  4MR6 A;  4HXR A;  5F1L A;  4A9F A;  3RCW A;  5EK9 A;  3AQA A;  3UV2 A;  4QY4 A;  3SVH A;  5LKX A;  2G4A A;  4PCI A;  4XYA A;  5DKC A;  4A9L A;  4WHU A;  5A5P A;  1N72 A;  5DLX A;  5G4R A;  5II1 A;  4UIX A;  3GG3 A;  2DVS A;  5A5Q A;  4Z1S A;  4YBM A;  5L99 A;  4Q0O A;  5KTX A;  3P1F A;  5HRX A;  5E7D A;  4AKN A;  4A9N A;  5IID A;  4FLP A;  4UYH A;  3JVJ A;  4QSS A;  5D3S A;  5CQ3 A;  5EWV A;  3AAD A;  2E7O A;  4YYG A;  3U5P A;  3MXF A;  5CFW A;  3DAI A;  4Q0N A;  5CQ8 A;  3UVW A;  4N4F A;  5FE9 A;  1F68 A;  4HXN A;  4J0R A;  4TZ8 A;  4LZ2 A;  5CUB A;  4YAD A;  5ENF A;  2I7K A;  3HMH A;  5CQ7 A;  5EA1 A;  4YYI A;  5HFQ A;  5C87 A;  2F6J A;  3LQI A;  2DVR A;  2OO1 A;  4J3I A;  5FFY A;  3UVD A;  3JVK A;  3LJW A;  5A5R A;  2OUO A;  4YAX A;  5F63 A;  4DON A;  5H1V A;  4CUR A;  5FE6 A;  4LYI A;  2L5E A;  5D3H A;  5EQ1 A;  5EIC A;  4YYN A;  2F6N A;  3ONI A;  3U5K A;  4QEV A;  4QNS A;  5E9L A;  3P1C A;  4LZR A;  5DYX A;  5AD3 A;  5A85 A;  4IR3 A;  4ALH A;  5I86 A;  3Q2F A;  4NR7 A;  3MB3 A;  4LRG A;  5ENC A;  4O7F A;  5EWH A;  5KTU A;  5I88 A;  5DFB A;  4O75 A;  4TT2 A;  5HEN A;  5C85 A;  4NUD A;  5E9Y A;  4QYL A;  5CQ6 A;  5KTW A;  5CUG A;  4LR6 A;  3SVF A;  4YH3 A;  5A5O A;  4IOQ A;  5TB6 A;  4XUA A;  2RI7 A;  5D3N A;  5E74 A;  5CPE A; 
#chains in the Genus database with same CATH topology
 4IOO A;  4UYF B;  4YYJ A;  4MR5 A;  5DY7 A;  4CFL A;  5KHM A;  5IGM A;  4YYM A;  4MR3 A;  4CUU A;  2DWW A;  4O7B A;  4QSQ A;  4BHW A;  4NQN A;  4UIT A;  4XUB A;  3O34 A;  4UYD A;  5L8U A;  5CRM A;  4WIV A;  4YAT A;  3LQH A;  4NRC A;  4IR6 A;  2DKW A;  4A9M A;  3HMF A;  5FE1 A;  4TS8 A;  5L96 A;  5EPB A;  5F62 A;  5HCL A;  5DYU A;  5E73 A;  4MEQ A;  5F60 A;  3QZT A;  4QEW A;  3MQM A;  5LJ2 A;  5F2P A;  5I1Q A;  5I83 A;  5FE5 A;  4A9O A;  5FFW A;  4UYE A;  5D25 A;  2RFJ A;  5E9K A;  4PCE A;  5A5N A;  5ACY A;  5BT5 A;  5HJC A;  4QSU A;  5CUC A;  4KV4 A;  2NXB A;  4LZS A;  5JWM A;  5A83 A;  5C89 A;  2OSS A;  5FB0 A;  4YYH A;  4NRA A;  4HXK A;  2I8N A;  5EV9 A;  5FG6 A;  5EGU A;  5EVA A;  4A9K A;  5JI8 A;  5DFC A;  4QEU A;  4Y03 A;  4ZW1 A;  4OGI A;  1E6I A;  4XY8 A;  4MEN A;  4HXM A;  4NYW A;  4O7A A;  3O33 A;  2R0V A;  4WHW A;  5L97 A;  1JSP B;  4NR8 A;  4QR4 A;  5CP5 A;  1PUO A;  5EIS A;  5CUA A;  2R0S A;  4O72 A;  4AKG A;  2RNY A;  2YEK A;  5HQ7 A;  3P1D A;  5BT4 A;  5F61 A;  4MEO A;  4QZS A;  3I3J A;  5D3P A;  2H60 A;  4TTE A;  5DKH A;  4YK0 A;  3QZV A;  4HXL A;  4N3W A;  5DLZ A;  5HEL A;  4YBT A;  4ZQL A;  4KCX A;  5FH7 A;  5I80 A;  4YBS A;  4TU4 A;  5CUE A;  4NRB A;  5IGK A;  5FB1 A;  4UYF A;  4AKI A;  5CTL A;  4BW4 A;  5LJ0 A;  4NYX A;  5EU1 A;  4QB3 A;  5FDZ A;  4YYD A;  5HRW A;  1WUM A;  5DYC A;  5E3D A;  4O7E A;  4QR5 A;  5HRV A;  5AD2 A;  4NYV A;  4BW1 A;  5A7C A;  5DX4 A;  2YYN A;  4BW2 A;  3D1D A;  5LKZ A;  5CQ5 A;  4NUC A;  5CRZ A;  4HXS A;  5HM0 A;  4TT6 A;  5CQ4 A;  4QBM A;  3IU6 A;  5E0R A;  5COI A;  4NQM A;  4A9H A;  5EWD A;  5ENH A;  4LDF A;  3O35 A;  5EP7 A;  5ENJ A;  5AMF A;  2YDW A;  4QSR A;  4UIY A;  5D26 A;  5H1T A;  5IGN A;  4N4G A;  2LSP B;  5DFD A;  3FKM X;  5C8G A;  2E7N A;  3NXB A;  3P5O A;  4YYK A;  2N9G A;  4IR4 A;  4YH4 A;  4TYL A;  5CQT A;  4O77 A;  4UIZ A;  5A5S A;  2R0Y A;  1WUG A;  4X2I A;  5LJ1 A;  2MJV B;  2E3K A;  5CS8 A;  5ENB A;  4N4I A;  5KU3 A;  4HXO A;  5L8T A;  5HQ6 A;  4AKH A;  5DYA A;  4HBV A;  5L98 A;  5IGL A;  5EPR A;  3MB4 A;  4Z6H A;  4E96 A;  4F3I A;  4O7C A;  5FE3 A;  5LKT A;  5F1H A;  2D9E A;  4O70 A;  3ERR A;  5F36 A;  4J1P A;  5CZG A;  5D24 A;  4Z6I A;  5DW2 A;  3JVL A;  5EWC A;  5HFR A;  5II2 A;  4CUQ A;  4HXP A;  4GPJ A;  5CU8 A;  4YC9 A;  4NR6 A;  4PY6 A;  5ETD A;  3G0J A;  5E9M A;  1ZS5 A;  5I7X A;  4QSW A;  3UV4 A;  3DWY A;  5CGP A;  4QSV A;  4PTB A;  2EJN A;  4ALG A;  4TQN A;  5D3L A;  4QR3 A;  2D82 A;  4C67 A;  2RNW A;  5DW1 A;  4CUT A;  5EM3 A;  5FBX A;  1EQF A;  4CL9 A;  2L84 A;  5CY9 A;  4NR5 A;  3G0L A;  4MEP A;  1X0J A;  3S92 A;  5ENG A;  3TLP A;  4CUS A;  5A82 A;  5E9V A;  4QC1 A;  3MUK A;  3QZS A;  5D3R A;  5A81 A;  4A9J A;  5FE0 A;  2WP2 A;  3JVM A;  4MR4 A;  3Q2E A;  5EI4 A;  3LXJ A;  3U5M A;  4CLB A;  4O76 A;  5I40 A;  4HBX A;  4PS5 A;  2FSA A;  3D7C A;  2WP1 A;  5CUD A;  4OUF A;  4UYG A;  3O36 A;  2RS9 B;  3ZYU A;  3U5J A;  5FH8 A;  3UVX A;  4LC2 A;  5FG5 A;  5H85 A;  3UV5 A;  5G4S A;  2RNX A;  5C7N A;  5FE4 A;  5AME A;  4O78 A;  4N4H A;  5TCM A;  4LYS A;  4YAB A;  5LVR A;  5I7Y A;  4NS5 A;  5D3T A;  3K2J A;  5IBN A;  2YEM A;  2L85 A;  5CQA A;  4RVR A;  5HQ5 A;  5KO4 A;  5FE7 A;  2YQD A;  4CFK A;  4O71 A;  4QC3 A;  1JM4 B;  4NXJ A;  4O74 A;  5E9I A;  5HEM A;  2KTB B;  5F3A A;  4C66 A;  4CUP A;  4QSP A;  5E3G A;  4UIV A;  3IU5 A;  4ZC9 A;  5ETB A;  4A9E A;  5LKU A;  5ENE A;  4J0S A;  4TZ2 A;  4IR5 A;  4QUU A;  3U5O A;  2DVQ A;  2R10 A;  5D3J A;  2YEL A;  2YW5 A;  4YY4 A;  4UIU A;  5FE8 A;  5C4Q A;  3UW9 A;  3VKH A;  4QST A;  3UVY A;  5I29 A;  4Z93 A;  3O37 A;  5F5Z A;  4NR4 A;  5BT3 A;  5F25 A;  2DVV A;  2DAT A;  4TT4 A;  4HBY A;  5FG4 A;  4BW3 A;  3HME A;  4PKL A;  5FE2 A;  5H1U A;  4A9I A;  3P1E A;  4QUT A;  4BJX A;  5D0C A;  3SVG A;  5LUU A;  5FFV A;  5D7X A;  4OGJ A;  5K29 A;  5ENI A;  2RO1 A;  5HLS A;  5DBM A;  5DKD A;  2GRC A;  4IOR A;  5I89 A;  4LYW A;  5J0D A;  3U5L A;  5FH6 A;  4HBW A;  4UIW A;  4NUE A;  4Z1Q A;  4XY9 A;  3MUL A;  4NR9 A;  3D1B A;  4QSX A;  3S91 A;  3LQJ A;  4KV1 A;  5EPS A;  5LVQ A;  3U5N A;  4QYD A;  5IG6 A;  4TU6 A;  5EWW A;  4YY6 A;  4MR6 A;  4HXR A;  5F1L A;  4A9F A;  3RCW A;  5EK9 A;  3AQA A;  3UV2 A;  4QY4 A;  3SVH A;  5LKX A;  2G4A A;  4PCI A;  4XYA A;  5DKC A;  4A9L A;  4WHU A;  5A5P A;  1N72 A;  5DLX A;  5G4R A;  5II1 A;  4UIX A;  3GG3 A;  2DVS A;  5A5Q A;  4Z1S A;  4YBM A;  5L99 A;  4Q0O A;  5KTX A;  3P1F A;  5HRX A;  5E7D A;  4AKN A;  4A9N A;  5IID A;  4FLP A;  4UYH A;  3JVJ A;  4QSS A;  5D3S A;  5CQ3 A;  5EWV A;  3AAD A;  2E7O A;  4YYG A;  3U5P A;  3MXF A;  5CFW A;  3DAI A;  4Q0N A;  5CQ8 A;  3UVW A;  4N4F A;  5FE9 A;  1F68 A;  4HXN A;  4J0R A;  4TZ8 A;  4LZ2 A;  5CUB A;  4YAD A;  5ENF A;  2I7K A;  3HMH A;  5CQ7 A;  5EA1 A;  4YYI A;  5HFQ A;  5C87 A;  2F6J A;  3LQI A;  2DVR A;  2OO1 A;  4J3I A;  5FFY A;  3UVD A;  3JVK A;  4AI6 A;  3LJW A;  5A5R A;  2OUO A;  4YAX A;  5F63 A;  4DON A;  5H1V A;  4CUR A;  5FE6 A;  4LYI A;  2L5E A;  5D3H A;  5EQ1 A;  5EIC A;  4YYN A;  2F6N A;  3ONI A;  3U5K A;  4QEV A;  4QNS A;  5E9L A;  1ZKR A;  3P1C A;  4LZR A;  5DYX A;  5AD3 A;  3VKG A;  5A85 A;  4IR3 A;  4ALH A;  5I86 A;  3Q2F A;  4NR7 A;  3MB3 A;  4LRG A;  5ENC A;  4O7F A;  5EWH A;  5KTU A;  5I88 A;  5DFB A;  4O75 A;  4TT2 A;  5HEN A;  5C85 A;  4NUD A;  5E9Y A;  4QYL A;  5CQ6 A;  5KTW A;  5CUG A;  4LR6 A;  3SVF A;  4YH3 A;  5A5O A;  4IOQ A;  5TB6 A;  4XUA A;  2RI7 A;  5D3N A;  5E74 A;  5CPE A; 
#chains in the Genus database with same CATH homology
 4IOO A;  4UYF B;  4YYJ A;  4MR5 A;  5DY7 A;  4CFL A;  5KHM A;  5IGM A;  4YYM A;  4MR3 A;  4CUU A;  2DWW A;  4O7B A;  4QSQ A;  4BHW A;  4NQN A;  4UIT A;  4XUB A;  3O34 A;  4UYD A;  5L8U A;  5CRM A;  4WIV A;  4YAT A;  3LQH A;  4NRC A;  4IR6 A;  2DKW A;  4A9M A;  3HMF A;  5FE1 A;  4TS8 A;  5L96 A;  5EPB A;  5F62 A;  5HCL A;  5DYU A;  5E73 A;  4MEQ A;  5F60 A;  3QZT A;  4QEW A;  3MQM A;  5LJ2 A;  5F2P A;  5I1Q A;  5I83 A;  5FE5 A;  4A9O A;  5FFW A;  4UYE A;  5D25 A;  2RFJ A;  5E9K A;  4PCE A;  5A5N A;  5ACY A;  5BT5 A;  5HJC A;  4QSU A;  5CUC A;  4KV4 A;  2NXB A;  4LZS A;  5JWM A;  5A83 A;  5C89 A;  2OSS A;  5FB0 A;  4YYH A;  4NRA A;  4HXK A;  2I8N A;  5EV9 A;  5FG6 A;  5EGU A;  5EVA A;  4A9K A;  5JI8 A;  5DFC A;  4QEU A;  4Y03 A;  4ZW1 A;  4OGI A;  1E6I A;  4XY8 A;  4MEN A;  4HXM A;  4NYW A;  4O7A A;  3O33 A;  2R0V A;  4WHW A;  5L97 A;  1JSP B;  4NR8 A;  4QR4 A;  5CP5 A;  5EIS A;  5CUA A;  2R0S A;  4O72 A;  2RNY A;  2YEK A;  5HQ7 A;  3P1D A;  5BT4 A;  5F61 A;  4MEO A;  4QZS A;  3I3J A;  5D3P A;  2H60 A;  4TTE A;  5DKH A;  4YK0 A;  3QZV A;  4HXL A;  4N3W A;  5DLZ A;  5HEL A;  4YBT A;  4ZQL A;  4KCX A;  5FH7 A;  5I80 A;  4YBS A;  4TU4 A;  5CUE A;  4NRB A;  5IGK A;  5FB1 A;  4UYF A;  5CTL A;  4BW4 A;  5LJ0 A;  4NYX A;  5EU1 A;  4QB3 A;  5FDZ A;  4YYD A;  5HRW A;  1WUM A;  5DYC A;  5E3D A;  4O7E A;  4QR5 A;  5HRV A;  5AD2 A;  4NYV A;  4BW1 A;  5A7C A;  5DX4 A;  2YYN A;  4BW2 A;  5LKZ A;  5CQ5 A;  4NUC A;  5CRZ A;  4HXS A;  5HM0 A;  4TT6 A;  5CQ4 A;  4QBM A;  3IU6 A;  5E0R A;  5COI A;  4NQM A;  4A9H A;  5EWD A;  5ENH A;  4LDF A;  3O35 A;  5EP7 A;  5ENJ A;  5AMF A;  2YDW A;  4QSR A;  4UIY A;  5D26 A;  5H1T A;  5IGN A;  4N4G A;  2LSP B;  5DFD A;  3FKM X;  5C8G A;  2E7N A;  3NXB A;  3P5O A;  4YYK A;  2N9G A;  4IR4 A;  4YH4 A;  4TYL A;  5CQT A;  4O77 A;  4UIZ A;  5A5S A;  2R0Y A;  1WUG A;  4X2I A;  5LJ1 A;  2MJV B;  2E3K A;  5CS8 A;  5ENB A;  4N4I A;  5KU3 A;  4HXO A;  5L8T A;  5HQ6 A;  5DYA A;  4HBV A;  5L98 A;  5IGL A;  5EPR A;  3MB4 A;  4Z6H A;  4E96 A;  4F3I A;  4O7C A;  5FE3 A;  5LKT A;  5F1H A;  2D9E A;  4O70 A;  5F36 A;  4J1P A;  5CZG A;  5D24 A;  4Z6I A;  5DW2 A;  3JVL A;  5EWC A;  5HFR A;  5II2 A;  4CUQ A;  4HXP A;  4GPJ A;  5CU8 A;  4YC9 A;  4NR6 A;  4PY6 A;  5ETD A;  3G0J A;  5E9M A;  1ZS5 A;  5I7X A;  4QSW A;  3UV4 A;  3DWY A;  5CGP A;  4QSV A;  4PTB A;  4ALG A;  4TQN A;  5D3L A;  4QR3 A;  2D82 A;  4C67 A;  2RNW A;  5DW1 A;  4CUT A;  5EM3 A;  5FBX A;  1EQF A;  4CL9 A;  2L84 A;  5CY9 A;  4NR5 A;  3G0L A;  4MEP A;  1X0J A;  3S92 A;  5ENG A;  3TLP A;  4CUS A;  5A82 A;  5E9V A;  4QC1 A;  3MUK A;  3QZS A;  5D3R A;  5A81 A;  4A9J A;  5FE0 A;  2WP2 A;  3JVM A;  4MR4 A;  3Q2E A;  5EI4 A;  3LXJ A;  3U5M A;  4CLB A;  4O76 A;  5I40 A;  4HBX A;  4PS5 A;  2FSA A;  3D7C A;  2WP1 A;  5CUD A;  4OUF A;  4UYG A;  3O36 A;  2RS9 B;  3ZYU A;  3U5J A;  5FH8 A;  3UVX A;  4LC2 A;  5FG5 A;  5H85 A;  3UV5 A;  5G4S A;  2RNX A;  5C7N A;  5FE4 A;  5AME A;  4O78 A;  4N4H A;  5TCM A;  4LYS A;  4YAB A;  5LVR A;  5I7Y A;  4NS5 A;  5D3T A;  3K2J A;  5IBN A;  2YEM A;  2L85 A;  5CQA A;  4RVR A;  5HQ5 A;  5KO4 A;  5FE7 A;  2YQD A;  4CFK A;  4O71 A;  4QC3 A;  1JM4 B;  4NXJ A;  4O74 A;  5E9I A;  5HEM A;  2KTB B;  5F3A A;  4C66 A;  4CUP A;  4QSP A;  5E3G A;  4UIV A;  3IU5 A;  4ZC9 A;  5ETB A;  4A9E A;  5LKU A;  5ENE A;  4J0S A;  4TZ2 A;  4IR5 A;  4QUU A;  3U5O A;  2DVQ A;  2R10 A;  5D3J A;  2YEL A;  2YW5 A;  4YY4 A;  4UIU A;  5FE8 A;  5C4Q A;  3UW9 A;  4QST A;  3UVY A;  5I29 A;  4Z93 A;  3O37 A;  5F5Z A;  4NR4 A;  5BT3 A;  5F25 A;  2DVV A;  2DAT A;  4TT4 A;  4HBY A;  5FG4 A;  4BW3 A;  3HME A;  4PKL A;  5FE2 A;  5H1U A;  4A9I A;  3P1E A;  4QUT A;  4BJX A;  5D0C A;  3SVG A;  5LUU A;  5FFV A;  5D7X A;  4OGJ A;  5K29 A;  5ENI A;  2RO1 A;  5HLS A;  5DBM A;  5DKD A;  2GRC A;  4IOR A;  5I89 A;  4LYW A;  5J0D A;  3U5L A;  5FH6 A;  4HBW A;  4UIW A;  4NUE A;  4Z1Q A;  4XY9 A;  3MUL A;  4NR9 A;  4QSX A;  3S91 A;  3LQJ A;  4KV1 A;  5EPS A;  5LVQ A;  3U5N A;  4QYD A;  5IG6 A;  4TU6 A;  5EWW A;  4YY6 A;  4MR6 A;  4HXR A;  5F1L A;  4A9F A;  3RCW A;  5EK9 A;  3AQA A;  3UV2 A;  4QY4 A;  3SVH A;  5LKX A;  2G4A A;  4PCI A;  4XYA A;  5DKC A;  4A9L A;  4WHU A;  5A5P A;  1N72 A;  5DLX A;  5G4R A;  5II1 A;  4UIX A;  3GG3 A;  2DVS A;  5A5Q A;  4Z1S A;  4YBM A;  5L99 A;  4Q0O A;  5KTX A;  3P1F A;  5HRX A;  5E7D A;  4AKN A;  4A9N A;  5IID A;  4FLP A;  4UYH A;  3JVJ A;  4QSS A;  5D3S A;  5CQ3 A;  5EWV A;  3AAD A;  2E7O A;  4YYG A;  3U5P A;  3MXF A;  5CFW A;  3DAI A;  4Q0N A;  5CQ8 A;  3UVW A;  4N4F A;  5FE9 A;  1F68 A;  4HXN A;  4J0R A;  4TZ8 A;  4LZ2 A;  5CUB A;  4YAD A;  5ENF A;  2I7K A;  3HMH A;  5CQ7 A;  5EA1 A;  4YYI A;  5HFQ A;  5C87 A;  2F6J A;  3LQI A;  2DVR A;  2OO1 A;  4J3I A;  5FFY A;  3UVD A;  3JVK A;  3LJW A;  5A5R A;  2OUO A;  4YAX A;  5F63 A;  4DON A;  5H1V A;  4CUR A;  5FE6 A;  4LYI A;  2L5E A;  5D3H A;  5EQ1 A;  5EIC A;  4YYN A;  2F6N A;  3ONI A;  3U5K A;  4QEV A;  4QNS A;  5E9L A;  3P1C A;  4LZR A;  5DYX A;  5AD3 A;  5A85 A;  4IR3 A;  4ALH A;  5I86 A;  3Q2F A;  4NR7 A;  3MB3 A;  4LRG A;  5ENC A;  4O7F A;  5EWH A;  5KTU A;  5I88 A;  5DFB A;  4O75 A;  4TT2 A;  5HEN A;  5C85 A;  4NUD A;  5E9Y A;  4QYL A;  5CQ6 A;  5KTW A;  5CUG A;  4LR6 A;  3SVF A;  4YH3 A;  5A5O A;  4IOQ A;  5TB6 A;  4XUA A;  2RI7 A;  5D3N A;  5E74 A;  5CPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...