5D0OE

Bamabcde complex, outer membrane beta barrel assembly machinery entire complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
83
structure length
83
Chain Sequence
RPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor BamA
publication title Structural basis of outer membrane protein insertion by the BAM complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 11
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2015-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04355 SmpA_OmlA SmpA / OmlA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 5d0oE01
3E2LC 2KXXA 4DM5A 2KM7A 3E2KC 3C7UB 3GMUB 5D0OE 2B5RC 2YH9A 5D0QE 3N4IB 1S0WC 3C4OB 2G2UB 5AYWE 3C7VB 2G2WB 3C4PB 5EKQE 3D4EA 2PXGA 1XXMC 1JTGB
chains in the Genus database with same CATH superfamily
3E2LC 2KXXA 4DM5A 2GUMA 2KM7A 3E2KC 3C7UB 3GMUB 5D0OE 2B5RC 2YH9A 5D0QE 3FVCA 3N4IB 1S0WC 3NW8A 3NWAA 3C4OB 2G2UB 5AYWE 3C7VB 3NWFA 2G2WB 4HSIA 3C4PB 5EKQE 3D4EA 4L1RA 2PXGA 1XXMC 1JTGB 3NWDA
chains in the Genus database with same CATH topology
3E2LC 2KXXA 4DM5A 2GUMA 2KM7A 3E2KC 3C7UB 3GMUB 5D0OE 2B5RC 2YH9A 5D0QE 3FVCA 3N4IB 1S0WC 3NW8A 3NWAA 3C4OB 2G2UB 5AYWE 3C7VB 3NWFA 2G2WB 4HSIA 3C4PB 5EKQE 3D4EA 4L1RA 2PXGA 1XXMC 1JTGB 3NWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E2L C;  2KXX A;  4DM5 A;  2KM7 A;  3E2K C;  3C7U B;  3GMU B;  5D0O E;  2B5R C;  2YH9 A;  5D0Q E;  3N4I B;  1S0W C;  3C4O B;  2G2U B;  5AYW E;  3C7V B;  2G2W B;  3C4P B;  5EKQ E;  3D4E A;  2PXG A;  1XXM C;  1JTG B; 
#chains in the Genus database with same CATH topology
 3E2L C;  2KXX A;  4DM5 A;  2GUM A;  2KM7 A;  3E2K C;  3C7U B;  3GMU B;  5D0O E;  2B5R C;  2YH9 A;  5D0Q E;  3FVC A;  3N4I B;  1S0W C;  3NW8 A;  3NWA A;  3C4O B;  2G2U B;  5AYW E;  3C7V B;  3NWF A;  2G2W B;  4HSI A;  3C4P B;  5EKQ E;  3D4E A;  4L1R A;  2PXG A;  1XXM C;  1JTG B;  3NWD A; 
#chains in the Genus database with same CATH homology
 3E2L C;  2KXX A;  4DM5 A;  2GUM A;  2KM7 A;  3E2K C;  3C7U B;  3GMU B;  5D0O E;  2B5R C;  2YH9 A;  5D0Q E;  3FVC A;  3N4I B;  1S0W C;  3NW8 A;  3NWA A;  3C4O B;  2G2U B;  5AYW E;  3C7V B;  3NWF A;  2G2W B;  4HSI A;  3C4P B;  5EKQ E;  3D4E A;  4L1R A;  2PXG A;  1XXM C;  1JTG B;  3NWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...