5D0OE

Bamabcde complex, outer membrane beta barrel assembly machinery entire complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
83
structure length
83
Chain Sequence
b'RPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor BamA
publication title Structural basis of outer membrane protein insertion by the BAM complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 11
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2015-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04355 SmpA_OmlA SmpA / OmlA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 5d0oE01
5D0QE 2YH9A 3C4OB 3C7UB 2KM7A 5D0OE 3E2LC 2G2WB 2KXXA 4DM5A 5AYWE 3GMUB 3C7VB 1JTGB 2PXGA 3N4IB 2G2UB 5EKQE 2B5RC 1S0WC 3C4PB 3E2KC 3D4EA 1XXMC
chains in the Genus database with same CATH superfamily
5D0QE 2YH9A 3C4OB 4L1RA 3NWDA 3NW8A 3C7UB 2KM7A 3NWFA 5D0OE 2GUMA 3E2LC 2G2WB 2KXXA 4DM5A 5AYWE 3GMUB 3C7VB 3FVCA 1JTGB 2PXGA 3N4IB 2G2UB 5EKQE 2B5RC 3NWAA 4HSIA 1S0WC 3C4PB 3E2KC 3D4EA 1XXMC
chains in the Genus database with same CATH topology
5D0QE 2YH9A 3C4OB 4L1RA 3NWDA 3NW8A 3C7UB 2KM7A 3NWFA 5D0OE 2GUMA 3E2LC 2G2WB 2KXXA 4DM5A 5AYWE 3GMUB 3C7VB 3FVCA 1JTGB 2PXGA 3N4IB 2G2UB 5EKQE 2B5RC 3NWAA 4HSIA 1S0WC 3C4PB 3E2KC 3D4EA 1XXMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D0Q E;  2YH9 A;  3C4O B;  3C7U B;  2KM7 A;  5D0O E;  3E2L C;  2G2W B;  2KXX A;  4DM5 A;  5AYW E;  3GMU B;  3C7V B;  1JTG B;  2PXG A;  3N4I B;  2G2U B;  5EKQ E;  2B5R C;  1S0W C;  3C4P B;  3E2K C;  3D4E A;  1XXM C; 
#chains in the Genus database with same CATH topology
 5D0Q E;  2YH9 A;  3C4O B;  4L1R A;  3NWD A;  3NW8 A;  3C7U B;  2KM7 A;  3NWF A;  5D0O E;  2GUM A;  3E2L C;  2G2W B;  2KXX A;  4DM5 A;  5AYW E;  3GMU B;  3C7V B;  3FVC A;  1JTG B;  2PXG A;  3N4I B;  2G2U B;  5EKQ E;  2B5R C;  3NWA A;  4HSI A;  1S0W C;  3C4P B;  3E2K C;  3D4E A;  1XXM C; 
#chains in the Genus database with same CATH homology
 5D0Q E;  2YH9 A;  3C4O B;  4L1R A;  3NWD A;  3NW8 A;  3C7U B;  2KM7 A;  3NWF A;  5D0O E;  2GUM A;  3E2L C;  2G2W B;  2KXX A;  4DM5 A;  5AYW E;  3GMU B;  3C7V B;  3FVC A;  1JTG B;  2PXG A;  3N4I B;  2G2U B;  5EKQ E;  2B5R C;  3NWA A;  4HSI A;  1S0W C;  3C4P B;  3E2K C;  3D4E A;  1XXM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...