5D0QE

Bamacde complex, outer membrane beta-barrel assembly machinery (bam) complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
b'ERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor BamA
publication title Structural basis of outer membrane protein insertion by the BAM complex.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Protein transport
total genus 11
structure length 87
sequence length 87
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04355 SmpA_OmlA SmpA / OmlA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 5d0qE01
3C7UB 3E2LC 3C4PB 4DM5A 2B5RC 2G2UB 1JTGB 5D0QE 5D0OE 2G2WB 3C7VB 3D4EA 2YH9A 2KM7A 2PXGA 1S0WC 5EKQE 2KXXA 3N4IB 3GMUB 5AYWE 3E2KC 1XXMC 3C4OB
chains in the Genus database with same CATH superfamily
3C7UB 3E2LC 3C4PB 4DM5A 2B5RC 3NW8A 2G2UB 1JTGB 3FVCA 5D0QE 5D0OE 2G2WB 3C7VB 3D4EA 2YH9A 4HSIA 2KM7A 2PXGA 2GUMA 1S0WC 5EKQE 2KXXA 3N4IB 3GMUB 3NWFA 5AYWE 3E2KC 3NWDA 4L1RA 1XXMC 3C4OB 3NWAA
chains in the Genus database with same CATH topology
3C7UB 3E2LC 3C4PB 4DM5A 2B5RC 3NW8A 2G2UB 1JTGB 3FVCA 5D0QE 5D0OE 2G2WB 3C7VB 3D4EA 2YH9A 4HSIA 2KM7A 2PXGA 2GUMA 1S0WC 5EKQE 2KXXA 3N4IB 3GMUB 3NWFA 5AYWE 3E2KC 3NWDA 4L1RA 1XXMC 3C4OB 3NWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7U B;  3E2L C;  3C4P B;  4DM5 A;  2B5R C;  2G2U B;  1JTG B;  5D0Q E;  5D0O E;  2G2W B;  3C7V B;  3D4E A;  2YH9 A;  2KM7 A;  2PXG A;  1S0W C;  5EKQ E;  2KXX A;  3N4I B;  3GMU B;  5AYW E;  3E2K C;  1XXM C;  3C4O B; 
#chains in the Genus database with same CATH topology
 3C7U B;  3E2L C;  3C4P B;  4DM5 A;  2B5R C;  3NW8 A;  2G2U B;  1JTG B;  3FVC A;  5D0Q E;  5D0O E;  2G2W B;  3C7V B;  3D4E A;  2YH9 A;  4HSI A;  2KM7 A;  2PXG A;  2GUM A;  1S0W C;  5EKQ E;  2KXX A;  3N4I B;  3GMU B;  3NWF A;  5AYW E;  3E2K C;  3NWD A;  4L1R A;  1XXM C;  3C4O B;  3NWA A; 
#chains in the Genus database with same CATH homology
 3C7U B;  3E2L C;  3C4P B;  4DM5 A;  2B5R C;  3NW8 A;  2G2U B;  1JTG B;  3FVC A;  5D0Q E;  5D0O E;  2G2W B;  3C7V B;  3D4E A;  2YH9 A;  4HSI A;  2KM7 A;  2PXG A;  2GUM A;  1S0W C;  5EKQ E;  2KXX A;  3N4I B;  3GMU B;  3NWF A;  5AYW E;  3E2K C;  3NWD A;  4L1R A;  1XXM C;  3C4O B;  3NWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...