5D0QE

Bamacde complex, outer membrane beta-barrel assembly machinery (bam) complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
ERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor BamA
publication title Structural basis of outer membrane protein insertion by the BAM complex.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Protein transport
total genus 11
structure length 87
sequence length 87
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04355 SmpA_OmlA SmpA / OmlA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 5d0qE01
2YH9A 3E2KC 3D4EA 4DM5A 3C4OB 3E2LC 3C4PB 5EKQE 3C7VB 2B5RC 5AYWE 2G2UB 5D0QE 2PXGA 3N4IB 2KM7A 1XXMC 2G2WB 3GMUB 3C7UB 2KXXA 5D0OE 1JTGB 1S0WC
chains in the Genus database with same CATH superfamily
2YH9A 3E2KC 3D4EA 4DM5A 3C4OB 3E2LC 3C4PB 5EKQE 3C7VB 3NWFA 2B5RC 4HSIA 3NWAA 5AYWE 3NWDA 2G2UB 2GUMA 5D0QE 2PXGA 3N4IB 2KM7A 3NW8A 1XXMC 2G2WB 4L1RA 3GMUB 3C7UB 2KXXA 3FVCA 5D0OE 1JTGB 1S0WC
chains in the Genus database with same CATH topology
2YH9A 3E2KC 3D4EA 4DM5A 3C4OB 3E2LC 3C4PB 5EKQE 3C7VB 3NWFA 2B5RC 4HSIA 3NWAA 5AYWE 3NWDA 2G2UB 2GUMA 5D0QE 2PXGA 3N4IB 2KM7A 3NW8A 1XXMC 2G2WB 4L1RA 3GMUB 3C7UB 2KXXA 3FVCA 5D0OE 1JTGB 1S0WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YH9 A;  3E2K C;  3D4E A;  4DM5 A;  3C4O B;  3E2L C;  3C4P B;  5EKQ E;  3C7V B;  2B5R C;  5AYW E;  2G2U B;  5D0Q E;  2PXG A;  3N4I B;  2KM7 A;  1XXM C;  2G2W B;  3GMU B;  3C7U B;  2KXX A;  5D0O E;  1JTG B;  1S0W C; 
#chains in the Genus database with same CATH topology
 2YH9 A;  3E2K C;  3D4E A;  4DM5 A;  3C4O B;  3E2L C;  3C4P B;  5EKQ E;  3C7V B;  3NWF A;  2B5R C;  4HSI A;  3NWA A;  5AYW E;  3NWD A;  2G2U B;  2GUM A;  5D0Q E;  2PXG A;  3N4I B;  2KM7 A;  3NW8 A;  1XXM C;  2G2W B;  4L1R A;  3GMU B;  3C7U B;  2KXX A;  3FVC A;  5D0O E;  1JTG B;  1S0W C; 
#chains in the Genus database with same CATH homology
 2YH9 A;  3E2K C;  3D4E A;  4DM5 A;  3C4O B;  3E2L C;  3C4P B;  5EKQ E;  3C7V B;  3NWF A;  2B5R C;  4HSI A;  3NWA A;  5AYW E;  3NWD A;  2G2U B;  2GUM A;  5D0Q E;  2PXG A;  3N4I B;  2KM7 A;  3NW8 A;  1XXM C;  2G2W B;  4L1R A;  3GMU B;  3C7U B;  2KXX A;  3FVC A;  5D0O E;  1JTG B;  1S0W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...