5D14A

The atomic resolution crystal structure of human il-8
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
KELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-8
publication title The atomic resolution crystal structure of human IL-8
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2015-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d14A00
1RJTA 2NYZD 2DY7A 1RTNA 1WD0A 2RA4A 1ESRA 3QO2A 2KECA 2D9UA 4HAEA 1AZQA 1G2TA 1F9SA 4O42A 3F2UA 2HUGA 5COYA 1DZ1A 1EIGA 3SVMA 1QG7A 2EOTA 1HUMA 4OIJA 2FFKB 1MSHA 3KUPA 1NCVA 4R8IA 1EIHA 1RODA 1B4OA 4IUUA 2X6GA 1SDFA 2B2TC 1E0BA 2RSOA 3GV3A 2FJ2A 2RSNA 1S4ZA 5CMDA 1MI2A 2KVMA 1JICA 5D14A 2VXWA 4UAIA 1KNEA 1VMPA 1X32A 2EE1A 2HCCA 4IUQA 1RHPA 4LMQD 4HCSA 4OIKA 4ZAIA 1CA5A 2FINB 4RAUC 5CORA 4XDXA 1BNZA 1O80A 1WTQA 1TVXA 4XT3B 4NW2A 5EKIA 1KNAA 1AP0A 4IURA 1HA6A 4QUCA 5E4XA 3I3CA 4QUFA 1ILPA 1EQTA 4X3TA 2KOLA 4MN3A 1WTPA 5EPJA 1F9PA 2KEEA 1EL0A 1GUWA 3I90A 4X3KA 4X3SA 1AZPA 1PFMA 1HUNA 1SSOA 1F2LA 3I8ZA 2B2UA 2B2TA 2J7ZA 1DOKA 2L1BA 2MPMA 4IUTA 5E4WC 1U4RA 2FHTA 2NZ1D 4MHEA 2B2UC 3N52A 1X3QA 2SDFA 2L9HA 3DEOA 5CBAE 2XIWA 4HEDA 5T1GA 1J8IA 4ZK9B 1RTOA 1SAPA 2JYOA 2Q8RE 1B53A 1ZXTA 2M2LA 3DM1A 2B2VA 5EPKA 1B2TA 1G91A 1QNKA 2RVLA 5D65A 2K05A 3MTSA 1IL8A 2B2VC 1VMCA 2HDLA 3HP3A 3IL8A 4IUPA 1U4LA 1NR4A 5DNFA 2KEDA 4ZKCB 3Q6SA 2Q8TA 1DOMA 1NAPA 4IUVA 4RWSC 1PFBA 1B3AA 1WTOA 2R3ZA 1NR2A 3GV6A 1CM9A 2MGSA 2N88A 1BBXC 4DN4M 3KBXA 2EPBA 4R9WA 2IL8A 1BO0A 2X69A 1WVLA 1WD1A 1XYIA 3ONAB 3P7JA 1JE4A 3LWEA 4ZLTF 1IKMA 1MGSA 2N55A 3H91A 5EQ0A 2K01A 1LV9A 3MWYW 3UI2A 3DEPA 1BF4A 1A15A 2L11A 1DONA 1F9QA 2K04A 2HCIA 1O7ZA 2HDMA 3G7LA 4HSVA 1WTWA 1MSGA 1U4MA 2NWGA 1XX8A 1U4PA 4RA8A 1HHVA 2K03A 2CVRA 3FDTA 2KUMA 2MJ8A 3TZDA 1WTVA 1IKLA 3R93A 1WTRA 4XT1B 1DOLA 1PFNA 2H1EA 3TN2A 2DY8A 2K28A 2MP1A 1EOTA 4X3UA 1F9RA 1J9OA 1ILQA 4CJ2C 4CJ0B 3FPUB 2X6LA 5T1IA 1QE6A 1M8AA 2B2YA 2BDNA 2L4NA 1O7YA 5EJWA 5CBEE 4CJ1B 1WTXA 1C8CA 1B50A 1G6ZA 2B2YC 5EPLA 2JP1A 1PLFA 5AFWA 1CA6A 1PDQA 2L12A 1G2SA 3I91A 4ZKBB 1Q3LA 2K1BA 1ML0D 2B2WA 1X3PA 1HFNA 1ICWA 3D6WA 1HRJA 1HFGA 4U68A 2B2WC 2FMMA 5JJZA 3IFDA
chains in the Genus database with same CATH superfamily
3MHBA 1N34Q 4UPAA 1U5KA 3CRKC 3MVVA 2EOTA 3KUPA 5IT9L 1NCVA 5IGEA 1R4PB 1QUQB 2LXJA 3A5ZB 5CR3A 3WOEA 4A3DB 3GV3A 2F0DA 4RMFA 1MI2A 4UAIA 4IO9A 1QZGA 1EYGA 1KRTA 2E2HB 1SROA 5BN3A 4PMWA 2EY5A 1KNAA 1MJCA 3DXJC 1I3QH 2PZUA 2RCFA 2LFNA 4IALA 1AZPA 4X3SA 1A2TA 1TIID 1F2LA 2B8FA 1GUOA 4IUTA 3S2DH 3UDGA 1I4QA 1U4RA 1GO3E 3OIPA 4RGOS 2XWBB 4KTAA 1PH5A 2Y0SB 2EYFA 4O1NA 1YNNC 1LACA 3E9IA 1RTOA 5EPKA 2EY1A 4Q5VA 1PH7A 3SK5A 1TY0A 3IAYA 3MXNB 2V1CC 3KLRA 5C5LA 2P5ZX 2CWPA 3T1HL 3F8TA 4RHSA 4DV4L 4DA2A 5GAHC 2JA6B 2AKWB 3GTPB 1W3SA 1XNQL 5F2DA 3D4WA 3PCOB 1PFSA 5CV7A 4A3MG 1F2YA 4X64L 2HT1A 1TWHH 1LO5D 3T51B 1TWGH 2K5VA 1N36L 3KFUA 4GKKQ 4ZLTF 2UUBQ 3W1BA 2YU9H 3K5NA 5ELFA 1KAWA 5M3FG 1C4QA 1PH6A 1JOKA 4G7OC 2D2CC 5FO8B 4GNXB 4FXDA 4X66Q 1XTDA 1CUKA 4RGNA 3UDIA 3T56B 5GQOA 3EN2A 1DOLA 3RLNA 3SK4A 3HKZE 1Q7YC 4LFAQ 1GUTA 1H9JA 1MBYA 3NE5B 4UP8A 4CJ0B 5C3WA 3VA7A 4A3MB 1SNOA 4DV6Q 1QE6A 2E8GA 5EJWA 1C7YA 3BU2A 4K6DA 1CKNB 4KHPQ 1Z9FA 5LMNW 1AH9A 4LF9Q 4YY3L 4ZKBB 1I6HB 3D6WA 4DAPA 5LMUL 5M5XB 1VQBA 4FNFA 1YHQA 1VQAA 4A3EH 4IPGA 2KECA 3PQIA 1F9SA 5DLQE 3ULPA 1DZ1A 3H6MA 3SDZA 2ASBA 1Q86C 3T1YL 4RHRA 4UDUC 2D5DA 2HQLA 4DGZA 3M7NA 3RZOH 5KIXA 4A3BG 5CMDA 1Y1WG 1LM0A 4P72A 4NXML 1VMPA 4LAAA 1I4HA 1K8OA 4AQYL 4JI3Q 1HJPA 5C0XH 2F0FA 3PO3G 4KMUC 5JOBA 1K0SA 3I7FA 2CH4W 3J7A5 3HOUH 3K6OA 1HR0W 1R9TH 3VR3A 3I4LA 4OL7A 2VQFL 2VUMG 3HOZB 2UUCL 3AYHB 1CKOA 3DWQA 4A3BB 2V4DA 1Y1WB 1II3A 3GTKB 2Z1CA 1B2TA 4YHHL 3D3RA 5KRUA 2RDFA 1VDZA 1FL0A 5AJ3L 3ITPA 2KEDA 2Q8TA 4L5TA 1N8RC 4GOPA 4A93H 4C3HH 2R6GA 3BYTB 1K28A 1P8LA 5ELNA 4JI5Q 1JOQA 1E2WA 1CHQD 1FD7D 4QQBX 3NQTA 4LJZC 5IIFA 1IZ6A 1K73C 2OTLA 2Z9HA 3CCLA 5D3IB 4BY1H 2MO1A 2R7ZB 2K01A 2OQKA 1CZWA 3UI2A 1HR0L 2PO4A 3P20A 1PTOC 3OW2A 1U4MA 1U4PA 4RA8A 4HJ8A 2K03A 4PZ6A 2MJ8A 1SMXA 1C0AA 1WTRA 2PQAA 5IT9c 1F9RA 1JR0D 1J9OA 3BJUA 2X6LA 1PTOB 2XN9C 2PW5A 2YU9B 4ID6A 4YWMA 3N6RA 1WTXA 4HJ9A 5LMNQ 1YITA 1EFWA 1A62A 2B2YC 2C35B 4UHVA 1E1TA 2F0TA 3RD4A 2I0QA 2CCZA 4LF7L 2JA5G 2NVTH 1HRJA 3DUZA 4LUVA 2JEAI 4DUZQ 2NYZD 3PIPA 1SNMA 4H13C 3T16A 2G9DA 2MO0A 4B3RL 1AN8A 3A56A 5IGDA 3SHLA 4K5VA 4DV2Q 5KNDA 1SDFA 2JSOA 4JYAL 1F77A 3WWVA 1S4ZA 4RKLA 3J80L 1D5MC 4DNTB 4L5SA 2DGYA 3MFYA 3HKSA 1AEXA 4Y7NB 1I4GA 1FJGQ 4IJHA 1FNUA 4KJNA 4DR1Q 3P75A 1QILA 1WTPA 2IT1A 1STNA 4IZ8A 1I50H 5FOBB 5IWAQ 4HN7A 1TWAB 3S1NH 1Z7TA 2UXBL 2IHFA 1BR9A 4MTNA 4ZRZA 1SNDA 5C0XJ 3KF8B 3KLWA 5TSSA 1WYDA 2QF7A 1HNZL 2Z0SA 4XTCS 5M3MG 4O2DA 3PO2H 2GA4B 2I5HA 5ISRA 4H44C 2F0GA 4DV0Q 1EU3A 1M1KC 3D4RA 3GTJB 1JMCA 4GS3A 1NR4A 2UUAQ 5LL6X 2GVAA 1DOMA 1NAPA 4IUVA 2AHOB 1YZ6A 1PFBA 1R9TB 1WTOA 4UY8C 3GO5A 2CWAA 4LUOA 1VQDA 2K52A 2EJGC 4BA1I 2LKVA 3RN5A 5FJ8H 3NP8A 1N9WA 1M90C 2AMCB 3CW2C 1GD7A 4A3CH 4YCWA 1MGSA 1F2MA 5M3MB 3H91A 2LY7A 1JE5A 2A69C 1SE4A 3NXWA 3PUYA 4L5QA 4JI8L 1B1ZA 5ELEA 5FLXc 1XMOQ 1O7ZA 3ERSX 5IYCG 4EQNA 3U50C 1MSGA 1K3RA 4GLVB 3PF4A 1XX8A 4C3HB 4A93B 4I7AA 4A3GH 4P75A 5IYBG 4KD3A 1S3OA 1S72A 3GTLB 1TKWB 1HZBA 4H02A 1SNQA 4X3UA 2NN6G 2E5LL 4TKOB 1L1OA 1DCZA 1BXTA 1G6ZA 3S14B 1H95A 2UXDQ 3RN2A 1Q3LA 1HFNA 3Q0AA 4HJAA 4OELB 3S16B 1I6VC 1LLRD 2N8NA 1EOVA 2A6ED 2OEOA 4DXGA 4CKEA 2A69D 4A3KB 1B7YB 1KLUD 1FGUA 4AH6A 3F2BA 1NY4A 4ZAIA 3NEMA 1D5ZC 1GM5A 3FKIH 3S1MH 4MNOA 1WTQA 4PG3A 2JA7H 2LSSA 1JT8A 3EFXD 4OX9Q 2ALYB 3DLLA 1K8AC 5C4JH 4TQUS 3GP7A 4RG1A 4BA2I 1QCBD 2F0NA 3EA6A 4TVAB 5IGFA 4CKBA 3RZDH 4LFCQ 4DR3L 2EYJA 1UE5A 2JA8H 5CBAE 2K5WA 4DV7Q 4K2LA 4ZK9B 1ENAA 3HOXG 4A3FG 1KXLA 3PV0A 3IFTA 2O2LD 1YNJC 2RKSA 3BS1A 1EYAA 3M3YH 5C3EH 2KBNA 3OPOA 1IBLL 5IP7H 1HNWL 1JQYD 1SFOH 1KHIA 2N88A 1PA6A 2B8GA 1PMRA 1I94Q 1PYWD 1SN8A 3M4OH 4L8JA 1HH2P 4LW1A 3P7JA 1JE4A 1JC7A 4BWGB 4DV3L 5JEAG 1Q12A 1PH8A 4R4CA 1V1QA 2B39A 5EQ0A 3CXCA 1VQLA 3X3MA 5I9PA 1LT6D 3PIP3 4DV1Q 4C3JG 2F3IA 1MJEA 3GTMB 1F9QA 5FLMH 3CF5A 3G7LA 5C44G 2EY2A 1KQSA 4WJ3M 1WI5A 5J1ZA 2VB2X 5KEEA 2IX3A 2RDHA 3JAMi 2RCNA 1VQ5A 3OTOQ 4XQQA 3PSIA 3Q24A 3HOWG 3J80c 5IGBA 2EY6A 1SJHD 5EPLA 2IWHA 4LK1C 2ZJPA 1FGBD 5CV4A 4RCNA 1E1OA 1SYBA 1X3PA 5I2XA 2E2IB 1W2BA 2YTXA 4U68A 3T13A 2YTVA 1EYDA 1K83H 2IHEA 1EY4A 3QO2A 2F0MA 3VR4A 1QZHA 2I07B 4GKJQ 1MSHA 3HOYG 3R3OA 1VQ6A 2QILA 3HOWB 3PUZA 3ZJYC 3GTOH 4LMQD 4C2MB 1CA5A 3S24A 1TVXA 1B3QA 1A63A 3I4MB 1J6QA 2F0SA 4DUYQ 2EIFA 4HIOA 3S15H 2XTIA 5J22A 4DV5Q 1GHJA 2QEJC 1E24A 3BZKA 2QDLA 1DOKA 4MHEA 5L37A 1TWCB 5HURA 2R92H 1EEID 5LL6S 4DAYB 4B3ML 3FKIB 4BXXH 3U9SA 4HEDA 1WCMG 4OXPA 4Z9CB 3D0FA 3S17H 1N32Q 5H1SE 4IOCA 3KF6B 2WINB 3CCEA 1VMCA 1IXRA 1TS5A 1U4LA 4L63B 2XSCA 4K8IA 1KLGD 1PRTD 5IYDG 2R61A 4LF4Q 1TR5A 3I72A 2O5JC 1FNWA 4BS9A 4NB3A 1EQRA 1RDPD 1WJJA 3C1FA 2CQOA 2PW7A 3NBHB 1MHWC 4NPSA 1WCMB 2ZTEA 1VS0A 1C48A 4NXNL 4LWCA 5C3EB 1RL2A 1EY5A 3GTQH 2XGTA 1UNSA 2A8VA 2F0WA 3FDTA 2O4XA 4LF6L 4N8FA 2ENBA 5FO9B 1YNXA 2DY8A 4B3TQ 2AUJD 1Q90A 3J81j 4ODGA 3A74A 3ZYYX 4LF5L 2G9HD 4TRDA 2JA9A 5CBEE 1Y1VH 2EQSA 2K7VA 3P1HA 3MC0B 1BCPB 4JI6Q 4EGVA 1YEZA 3A8IE 1STGA 1FNVA 2BDOA 3BZCA 1OXVA 1TU2B 1EY9A 1EIGA 4A3DG 3CCRA 2VQEL 1UE7A 3TP8A 1B44D 1HQRD 2ICEC 4G57A 3K5LA 4HCSA 4AIMA 1A3VA 3TP5A 1E7ZA 5M3FH 4KD4A 1O80A 1BNZA 4IURA 1JWUD 5C4ZA 4XQNA 4DU9A 3H09A 2KCTA 2F4VL 3EQLC 3CD6A 4GN5A 4YWLA 1JWSD 2FXQA 2WAQB 2B2TA 3VYRA 1VQ8A 1EY7A 4H7BA 3VA5A 4JI4L 4A3IH 2Y0SG 1J8IA 2OT2A 2L55A 3A7LA 1I4XA 4DAVA 3H0GH 1HXYD 2DJGC 5M5YB 3TZUA 1J5EQ 2HIVA 2UUBL 3WDNA 2JA6G 4DNRB 5I4DA 2BH8A 3GDEA 3KDFB 4DN4M 2R92B 1NJIC 2NN6I 1B9NA 3J81c 1XXGA 2EZVA 4ZYSA 1QB5D 3S1QH 4CKCA 1IBKQ 3CQZH 3DEPA 4IFDG 2K04A 1ONLA 3MXUA 3D4DA 1KTKA 2BA0A 2OTJA 3W5OA 4QMGA 3FRPB 4DR6Q 1JB7A 2VL6A 2ZM6Q 2Q2TA 4A3LG 2PI2E 3CHBD 4CJ2C 4GNXC 1LTGD 4ZCKA 3E6ZX 4DR2Q 1PH3A 1D2BA 4M1UB 1M8AA 2B2YA 4CJ1B 1O7YA 4FP5D 2YV5A 4YCUA 3GTQB 4LFBL 1KC8C 1KDBA 1ML0D 1M4VA 1U9RA 5CV5A 1ENFA 4JBJA 1ICFB 4BBRG 4WORA 2N3SA 1SYFA 4X62L 4HAEA 1UWVA 3M4YA 4A4IA 3A5UA 2KHJA 1HUMA 4K2KA 1YNND 2Z6KC 4JV5L 4QB4A 1EIHA 3AQQA 1BOSA 3DMUA 1YJWA 2NVYH 2PYKA 5D14A 3HOVB 4Y52H 3A0JA 2EYOA 3JAME 3QJYA 2BCOA 2K5QA 2LMCB 4QUCA 1LT4D 4A3JH 3FP9A 3S1RB 4BBRB 4MN3A 5C3XA 1HZCA 3KK7A 4JI0L 4P73A 3S9WA 1XPRA 2F4IA 2DJFC 3BDOA 4CGYB 2L1BA 3LGJA 3HOZG 2NUCA 3T1HQ 1VQOA 4L5RC 4HIMA 5C4XH 1G51A 1IYUA 1XNQQ 1H9RA 3CC4A 2K05A 4X64Q 1S5DD 1TQOA 1V1PB 4DXFA 4MIUA 1SE8A 2WKCA 3LWUA 2JA5H 1N36Q 1CKMA 1AFPA 3LX0A 1SE3A 4HIKA 1QVCA 5JPNC 5FO7B 1K0RA 3QR8A 1LTBD 4IN3A 3TP7A 4EQOA 4HJ5A 1XPUA 1YBYA 2R7ZG 5DM73 1DONA 1STAA 3LNNA 1I3QB 2LXKA 1WTWA 4DKAC 3TZDA 1LABA 5JJLA 3S2DB 2MP1A 3QB3A 5LMUQ 2JN4A 2KCMA 4KY5A 1XTCD 3EVQA 3JC66 3KJPA 4V0BA 3L9AX 1KDCA 2L12A 3T1YQ 3DHQA 4DK0A 3QIAA 2JEBI 5FLXE 5HGQA 1LTTD 2B2WC 3K80C 5KNBA 5JJZA 5E1FA 4NXMQ 1G2TA 1YIJA 2JJQA 1ESRA 4GZYC 2VS1A 1OXSC 4ZQ3A 4AQYQ 3S2HH 1KRSA 2WFWA 4R4QA 2QKIC 1TWHB 3K7AH 1TWGB 2RSNA 1KAAA 4NP5A 2KVMA 4JI2L 3CMAA 2EE1A 5K36H 1RHPA 3NTIA 3PGZA 1RCVD 2VQFQ 4A3EG 1UEAB 3UE1A 3CKIB 2UUCQ 1KDAA 5IYCH 4QJFA 1X55A 2ICIA 1F9PA 4YHHQ 1RD9D 4DR5L 3PUVA 1A3TA 2OF1A 3I8ZA 4RGTA 3SK6A 5AJ3Q 2NN6H 2L9HA 3CC7A 1PTOD 5T1GA 3AB9A 3CCQA 1CK1A 5C0XG 2NVXH 4F7XA 2CHBD 4X65L 2F0JA 4OO1I 4A3EB 4GLAC 2F0HA 2MUYA 3M4PA 5EKKA 3K58A 2VY3A 1BBWA 2E2JH 1DXMA 1HR0Q 1RIPA 5EBCA 3RZOB 1XMOL 1BO0A 1N33Q 4DF7A 5M5WH 4YWKA 3LWEA 2F0EA 3Q22A 2F0VA 4QCLA 1CQFA 3VYSA 3Q8DA 4BY7H 3KLSA 2AWOA 2Y0SE 4CDCC 4DK6C 2HDMA 4HSVA 4A93G 4C3HG 1PYSB 3HOUB 3CCMA 1JCKB 1IKLA 3R93A 1PFNA 4CDDC 3PIOA 1NTGA 4BBSH 1STBA 4LF7Q 1PVOA 4ULLA 3OSOA 1QVGA 4BY1G 5KYIA 4KKUA 1PYBA 1RF2D 2R93H 1B50A 4DAMA 4FYDA 1CFMA 1VQKA 4B3RQ 2K14A 5AFWA 3A7AB 3HOXH 4A3FH 5IGGA 4JYAQ 2E2DC 1CQVA 4OGQC 1PZJD 2IX0A 1PH4A 4KKSA 3OWFA 1LYLA 2D9UA 1A0IA 3CCVA 1ZYRC 5IE8A 2QCPX 1FR3A 4KN4C 4LF8L 3NHHA 1B4OA 4IUUA 4A3KG 1TS2A 2JK8A 1HPCA 2RHQB 2XRSD 1XNRL 2G5DA 4OHJA 2JQOA 4BY1B 3A55A 3F1ZA 2D0OA 2UXBQ 1I4RA 2NVQH 3NTHA 4OEMB 4JI7Q 3M85A 2K6AA 3G6JB 4C3JH 3C2PA 4IOAA 3K5OA 4UP7A 1HNZQ 5C44H 3CP0A 2XRQD 4FVMA 4GOPC 4CDFC 1XJVA 3HS0C 3G6EA 2H4OA 4WFN3 2FHTA 1S40A 4F8MA 3RLOA 1EQQA 1ASYA 3TS2A 3DM1A 1G91A 4PMCA 3FEWX 3L0OA 4GOPB 2NVTB 4HR7B 1DD2A 2N49A 2B2VC 4K6LA 1SYDA 4IFDI 1I5FA 3BVGA 1XWEA 1G6PA 3TEHB 3NQIA 4JOIA 3L7ZC 5CGKA 1PZID 1SLJA 4R4TA 1CM9A 4FF3A 3RR5A 4DV1L 1SNCA 4JBKA 4JI8Q 4XIGS 4DK1A 1IL2A 1E2ZA 1VF7A 4KHZA 3HOYH 2F52A 2KCCA 5JVH3 3PO2G 4R4IA 3ER0A 4KY6A 4C3IH 3GD7A 2N55A 3KYHC 4YCVA 4JPBW 4C1NI 3MA2B 2E5LQ 2PQAB 1Y8OB 1EU4A 2OCEA 2IJ0A 4DR7L 1H9SA 1CZGA 1I50B 2CVRA 4HIDA 3S1NB 2A5HA 2OXPA 2R7DA 4IPHA 5FJ8G 1EY6A 1EOTA 4N9TA 5M5WB 1ET9A 3BDCA 4A3CG 4GLXA 1OXUA 3ULLA 5T1IA 4ABNA 4K0KL 1DYQA 2B63H 3PO2B 1D8LA 4HCEA 1LUZA 1U0LA 4NKLA 2GN5A 4B9WA 4U673 1VQ9A 4K5XA 4A3GG 1NUCA 2NZOA 2BH2A 1WD0A 2TSSA 5JPMC 4XQJA 1PH1A 1DM0B 4BBSB 1T5XD 1QG7A 1RODA 4DPGA 2KQ3A 3TBIB 2CKZB 2R93B 3F2DA 2KJXA 1YNJD 1X3EA 4OWXB 3K5MA 4DUYL 1HNXL 2OWOA 1VQ7A 3E3XA 3F2CA 2IX1A 1QUQA 2NB0A 2UU9L 4R1JA 5EKIA 3I4MG 3TS0A 4OO1H 1T9HA 5IP9G 4DR3Q 1JJCB 2BE5C 4JVZA 5C4HA 3J7YW 3NUCA 2Q2UA 4A3GB 2EYLA 1AE2A 1TXYA 2NBFA 2OQ0A 3ERQA 1N32L 3ND9A 4GN4B 5JEAJ 2HHHL 2NZ1D 1IBLQ 4DR4L 3G48A 1HNWQ 3FKIG 4PMBA 5CC4A 2A73B 1VQEA 1LTID 1SAPA 1TWFH 3A8JE 1SE2A 1X65A 4KN7C 1Q1BA 5D65A 1IL8A 1ESFA 4JI1L 2WB1B 1KABA 3TMEA 4ALPA 4DV3Q 1O7IA 3FPPA 2EJMA 1JWMD 3AU7A 1ASZA 1B3AA 1PRTF 1STHA 3MXNA 3H3VC 1EZ8A 2MGSA 3GV6A 2F0KA 4MZ9A 1G8ZD 1ENCA 2M9VA 2ZTCA 4J8QA 3I4NH 2CW0C 5BR8L 3I56A 5GROA 2BE5D 1IKMA 1SMYC 3VYUA 1GXDC 4RGMA 3S1MB 2Z4IA 3MEHA 5LHY1 4O0AA 2E2HH 4B3TL 2JA7B 4C56C 5C3EG 2WV6D 4FF2A 1NSNS 1B8AA 1EYCA 3W2DA 3E0EA 4K8JA 1EQVA 1NE3A 4G7HC 5C4JB 2A74C 3D6CA 3V05A 4PV1C 1L1OB 5BN4A 2PPBC 3I4OA 3OWEB 4GNXA 5E3FA 3RZDB 4XXEA 3K0XA 3J81E 2H5XA 4KK7A 2A68C 2ATWA 2JA8B 3J7AF 4RFBA 1HTLD 2BDNA 1NNXA 1L0YB 1A6XA 2JP1A 1O7LA 4HTHA 5FLMG 2UXCL 1EFID 3HRZC 4IPDA 5EKLA 3M3YB 5JJIA 1IYVA 4Q0FA 1CKNA 1UEBA 2CW0D 1SFOB 5ELDA 2EXDA 2JA6H 1SMYD 2Z6KA 4ZUIA 1BCPC 3F2UA 4B3SQ 3DM3A 3AMUA 1IBMQ 3GTGH 3M4OB 3SR1A 2B63B 2D0PA 4JG2A 4PQXA 5I9OA 4EX5A 4AYBG 1Y14B 3KBGA 1N34L 3MXGA 1X9NA 3E5SA 1SNPA 1A3UA 1V8QA 1YVCA 3HG9A 2BOSA 2Q2HA 3OMCA 4IFDH 1E3PA 1XMQQ 4B3MQ 2A68D 1BBUA 2EYHA 2D62A 4JC0A 4K5WA 3KLSX 4X3KA 1PFMA 1SSOA 2WAQG 2J7ZA 4DK3C 2K5DA 3QWNA 4A3LH 2B2UC 2DNCA 4A3MH 1K8GA 2IPKD 4K14A 1D7QA 3OYYA 1G291 5GAGC 3ULJA 4AYBB 5A2QE 4FF4A 1PH9A 1BCPD 2I46A 3BG3A 1I6HH 2F0OA 1K83B 3K57A 2M00A 3UDFA 1HCZA 4RWSC 2F03A 4NXNQ 1SYCA 2PNRC 3KBXA 1F2ZA 2R92G 4G7ZC 2WP8J 1HTPA 4RH6A 1WVLA 2F0UA 2QEXA 3GTOB 4LF6Q 3STBC 4V190 3NWSA 1D1IA 1Y8NB 4ME5A 1SR3A 2L11A 2KENA 4CHTB 4KV6A 4LF5Q 2L0CA 1STYA 2EYMA 2ZXOA 1BQQT 3EBEA 1X6OA 4GKKL 3S15B 2QA4A 1EUJA 4MTKA 1K3BC 3C46A 2C5CA 4P2CB 3I4NB 1B70B 2CQAA 2EDGA 4X66L 5G3LD 2O5IC 1B9MA 4APVA 3HOZH 3KJOA 3TDQA 3S17B 1SBBB 1Y1WH 4A3BH 1YI2A 1C9OA 3GTKH 1PLFA 4NMZA 3I91A 3JAML 2YYZA 2B2WA 4IUNA 2VQEQ 4LFAL 2VB3X 2K5NA 1PH2A 2Z6BA 3J80i 3AEVA 3SGIA 2F3VA 4DV6L 1Z6HA 3PUWA 3PO3H 1RTNA 5IY0A 3STBD 4KHPL 3NK9A 2ZXPA 4LF9L 2Q2IA 5M9OA 4YIJA 1Y1VG 4PZ8A 3E0JA 4J15A 2VUMH 2A6HC 1DGSA 2HCCA 3BDLA 4OIKA 2F4VQ 3HOVG 1X54A 2R7ZH 5CORA 4TSSA 3CCJA 1VQHA 3MFGA 5CV8A 3CCSA 4JI4Q 4B9XA 1E2VA 2K5HA 3HEJA 4X3TA 5EPJA 2RF4A 2KEEA 3M9BA 4POFA 1EL0A 1GOZA 3GTGB 4JI3L 5IT9E 1GHKA 3VDYA 3W1GA 1OXXK 1EZ6A 1VQ4A 1YJNA 1IHZA 2F0QA 2J0TD 1Y1VB 2SDFA 2YTYA 1PTOH 3D8GA 4IFDJ 1ZEQX 4EQ5A 4JBWA 2RVLA 2ZT9C 3KF8A 3MTSA 1Q82C 1Z47A 4GN3B 5DEHA 2KCNA 2ZJQA 2AQ3B 2WB1E 2A6HD 3QG1A 2PZTA 4A3IG 1JJGA 1JOOA 3R2TA 2IL8A 2K33A 5JJKA 5HGTA 4DV4Q 2F0LA 1MIUA 2GVBA 3H0GG 3MZ5A 5M3FB 1GUSA 1PZKD 5IOCA 4HMJA 3AFQA 1BF4A 3HFZB 3PF5A 4JI5L 5FLXL 1E22A 2SEBD 3D31A 4Y7NH 3ICEA 1IW7C 2PMZB 4I65A 3R8BA 2MHVA 2C9OA 3AFPA 1VQJA 3HGBA 4HJ7A 4XT1B 2Z8LA 2N78A 4OWTB 3TN2A 1QVFA 4LFBQ 1TWAH 1HQMC 3NPPA 4A3IB 2AWNA 1V9PA 1SJED 4X62Q 1C8CA 1BVSA 4PZ7A 2AQ2B 1FYCA 1CA6A 1ZKOA 1CSPA 1G2SA 1SXTA 3H0GB 4JV5Q 1EWCA 1V43A 1EWIA 1HFGA 4FF1A 3M7GA 3GTJH 1PXUA 4N8X1 4QIWB 1RJTA 1CSQA 4WJWA 1H9KA 3CCUA 5LMNL 4ZUJA 4G4KA 3SVMA 4YY3Q 4R8IA 4WRDA 5BN5A 2B2TC 3S1QB 2PNHA 3SEBA 4KY7A 1IW7D 4DUZL 3VR2A 2DNEA 4EQPA 4IUQA 1JB3A 3CQZB 5JAVA 4JI0Q 5C5MA 2ZJRA 5M3MH 4RAUC 3H3VI 3FVQA 1V1OA 4KKTA 3DWPA 4FO2A 4KLKA 4DV2L 3PO3B 2I5LX 3I3CA 1KL9A 1K8MA 1GKHA 3UE0A 3GTLH 4PNYA 2MFIA 1BUVT 1OXTA 4KI0A 3M4QA 2QW7A 5EBDA 1FJGL 2VUMB 2L5TA 3N52A 3U58A 3A54A 3VR5A 4DR1L 1PTOF 3Q23A 2XNAC 1FVIA 4EVOA 5IWAL 5J39A 2B2VA 5EGTA 3S14H 2E74C 4A3JG 3TP6A 1N33L 4AYBE 3S16H 3URYA 5I2YA 5GADC 3C3LA 2WKDA 1R4QB 5DM63 2BA1A 1H9MA 5IYBH 4DV0L 1BDOA 1LTSD 5C4XG 2I5MX 3QOJA 3TQYA 2NVYB 4A3KH 1XYIA 1BKBA 4X6AH 1WOCA 2WAQE 2UUAL 1LTLA 3JAMc 1LT5D 2EVBA 2PQEA 3MEFA 3OOCA 4A3JB 1AW7A 3J81i 1D1KA 5HY6A 1Q46A 2NWGA 4ME3A 3HOUG 3DWAA 1L0WA 3EJIA 2K28A 1Y69U 4C1NK 2SOBA 1A2UA 5C4XB 3CAMA 3UDXA 2PI2A 3VR6A 4NDXA 2MNAA 2IY5B 4OONA 2RQXA 4F87A 1L2FA 1PDQA 1TS4A 2CFMA 3MXPA 1HZ9A 2K1BA 1QJOA 3IRBA 3O13A 3BZDB 2JA5B 1ET6A 2JXMB 4JI2Q 3U4VA 1JJ2A 1UE1A 5COYA 1STEA 1IYJB 2IW3A 4JI7L 2A1AA 2UXDL 3G4SA 2FJ2A 3NSWA 1JICA 4LUZA 2VXWA 1KNEA 4IJLA 2XVSA 2ZTDA 2EXZA 5CYUA 1LTRD 1Q1EA 4DR5Q 1TT2A 2KHIA 1HA6A 3GTMH 1O78A 5IODA 3RMHA 1ILPA 3OIQA 2KOLA 1RKNA 4A75A 3BVMA 2A6EC 4X65Q 1GJXA 5CV6A 3X3NA 1OO9B 5K36G 4OX9L 2K50A 1X3QA 1YHAA 3DEOA 3J80E 2VNUD 2JYOA 3U9OA 2MQHA 2Q8RE 2NZHA 3HZXA 3FHWA 5JEAH 1QNKA 1SRUA 3R2IA 1X3FA 3IL8A 3CC2A 2NTSA 4DAYA 2E2IH 4LFCL 1W6JA 5EAYA 1W6KA 3T53B 4DV7L 3NWTA 3S2HB 4P74A 3KF6A 1BBXC 1MD2D 3NENA 1YJ9A 3K0YA 3K7AB 2EPBA 2X69A 1S5CD 3RNUA 4R4OA 3HOWH 5I6WA 3L2PA 3OMGA 3BVZA 4C2MH 3MWYW 1UUPA 2B3GA 1ZYRD 2QDBA 3QOLA 1I94L 3GQBA 4E6IA 1S5FD 4IPCA 3I4MH 2A19A 3NBHA 5IP9H 2K75A 2QGQA 5ELBA 4B08A 2H1EA 2PMZE 4S3SA 3NBIA 2DN8A 4R8NA 5D3DA 3FPUB 2WACA 1TWCH 4BY7G 2NVXB 3TRZA 4IQZA 3H3VH 4LF8Q 5CV9A 4J1MA 3WOFA 2K32A 5K5PA 1ICWA 3OTOL 1XNRQ 1L0XB 4FXKC 2FMMA 2Z4HA 5ELOA 5A35A 2DY7A 1UE6A 2HQEA 2RA4A 5I6YA 1AZQA 2LS01 2E2JB 4F88A 3SE0A 4BBSG 4JBMA 5IGCA 2HUGA 4QIWE 4OIJA 4QL5A 3ND8A 1XPOA 2FFKB 4XYOA 2RBMA 2X6GA 1QWYA 2R93G 1PV4A 2FMCA 3KOJA 1WTHA 3OHXC 4WJ4A 5E7NA 1GUGA 4BY7B 5FKAC 2AQ1B 4OWWB 1EY8A 2FINB 1WCMH 4GKJL 1NMGA 1S5BD 1QNUA 4XDXA 4XT3B 4NW2A 1I4PA 5E4XA 2J4XA 3T4AC 1HA5A 4QUFA 3CRLC 1EQTA 3K59A 1GUWA 3C1EA 3I90A 5J3BA 4I7ZC 1TS3A 1Y8PB 1LT3D 1D5XC 2SNSA 2B2UA 5IYDH 1NMFA 5E4WC 3V2TA 2WIIB 4CDEC 5FK9C 1TY2A 1Q81C 2XIWA 1S5ED 2VW9A 2NTTA 3TSSA 4JW0A 4A3FB 3HOXB 3EROA 1EEFD 4DV5L 4DFAA 4IUPA 2WB1G 2E75C 1YHBA 3HKZG 1Q8IA 4ZKCB 1VQCA 3Q6SA 4LNQA 2F1MA 1VQGA 1NR2A 3H94A 4QGUA 1GUNA 2K4KA 1LTAD 1VQMA 3J81L 1A8VA 1P16A 2DUDA 2XWJB 4KHVA 3ONAB 4DR7Q 2F3WA 3OW7A 4JCVE 3FMCA 3KDFA 2KHSA 3V96A 5KNCA 1Q8KA 3CMEA 1KIXA 1GVPA 2NVQB 2JA7G 2CH4A 5C6AA 4C3JB 1A15A 4LF4L 3J7AV 3E9HA 4K0KQ 2KA7A 5C44B 3PIO3 3HKZB 4M8AA 3H15A 2L15A 1OTCA 3I2ZA 1ILQA 1VCIA 1D6EC 4C3IG 1CT1D 3I73A 4A3DH 2JA8G 2E76C 1PRTC 2RHSB 2L4NA 4L6TB 1SYGA 3VYTA 4J6HA 1L1OC 3NELA 4B3SL 1X56A 1EY0A 1IBML 4RKBA 3K7UC 2PCFB 1CHPD 2VZAA 3G71A 1SYEA 4H0LC 5M5YH 5IP7G 4POGA 3PMFA 1HNXQ 3IFDA 1PRTB 3L3OC 3CU7A 4O42A 1DJRD 3BYYB 2ES2A 2EJFC 2UU9Q 4JI6L 2ID0A 3HOYB 2B63G 1E0BA 2RSOA 4FXGC 3NTKA 3IKJA 4C3IB 1XMQL 1MKHA 1X32A 3RLFA 2ZXRA 2EYPA 5A2QL 2HHHQ 4FDBA 1VQFA 1AP0A 1T5EA 2SNMA 1QOHA 4DR4Q 1CI3M 4UP9A 2B29A 3RUZA 4QY7A 2Q8IB 4JOIC 1HUNA 2PZWA 1PHJA 1EIYB 3GTPH 5KGUA 4JI1Q 5ELCA 5KYLA 2MPMA 1SEBD 4DNIA 4ILWA 1CTMA 2TMPA 3W3AA 1K9MC 1B53A 1ZXTA 1UAPA 2M2LA 4QF4A 2HIXA 4OO1G 4CBVA 1JORA 5C0XI 1BCPF 2HDLA 3HP3A 5BR8Q 1NBWA 2JE6I 2R7FA 5DNFA 5NUCA 3K81C 3TREA 3CPFA 3A8KE 2R3ZA 4XYQA 1EWHA 1V1PA 3EIVA 4R9WA 1WD1A 1J5EL 4JK1C 3U4ZA 1AE3A 2F0IA 3B6YA 5DAUA 1VF5C 1EIFA 1VQIA 4N9PA 4HMIA 1H9SB 1LV9A 5GAEC 3HOVH 3K8AA 3J7ZC 2HCIA 4KJOA 5M5XH 1HHVA 3S1RH 4BBRH 3I70A 5JVG3 2KUMA 1WTVA 1IBKL 4HSPA 2HD3A 2UXCQ 4A76A 3SXHA 3I4NG 2AUKA 4RCOA 4BXXG 5G3LF 1X3GA 3I55A 4P71A 2RDGA 3MAQA 1VQNA 1TWFB 1WFQA 4DR6L 1HZAA 2F0PA 3CPWA 2ZM6L 3SK8A 3PUXA 4DR2L 1VQPA 1KD1C
chains in the Genus database with same CATH topology
3MHBA 3CRKC 3MVVA 2EOTA 3KUPA 5IT9L 1NCVA 5IGEA 1R4PB 5CR3A 3WOEA 4A3DB 3GV3A 2F0DA 1MI2A 4UAIA 2E2HB 5BN3A 4PMWA 2EY5A 1KNAA 3DXJC 2PZUA 2LFNA 4IALA 1AZPA 4X3SA 1A2TA 1TIID 1F2LA 2B8FA 1GUOA 4IUTA 1I4QA 1U4RA 3OIPA 4RGOS 2XWBB 4KTAA 2Y0SB 2EYFA 4O1NA 1YNNC 1LACA 1RTOA 5EPKA 2EY1A 4Q5VA 3SK5A 1TY0A 3IAYA 3KLRA 5C5LA 4RHSA 4DA2A 2JA6B 3GTPB 5F2DA 3D4WA 5CV7A 1F2YA 1LO5D 3T51B 4ZLTF 3K5NA 5ELFA 1C4QA 1JOKA 4G7OC 2D2CC 5FO8B 4FXDA 4RGNA 3T56B 1DOLA 3SK4A 1GUTA 1H9JA 1MBYA 3NE5B 4CJ0B 3VA7A 5C3WA 4A3MB 1SNOA 1QE6A 5EJWA 4K6DA 4ZKBB 1I6HB 3D6WA 4DAPA 5M5XB 4FNFA 2KECA 1F9SA 1DZ1A 3H6MA 3SDZA 4RHRA 4UDUC 2D5DA 4DGZA 3M7NA 5KIXA 5CMDA 1VMPA 4LAAA 1I4HA 1K8OA 5C0XH 2F0FA 4KMUC 5JOBA 3K6OA 3VR3A 3I4LA 4OL7A 3HOZB 3DWQA 4A3BB 2V4DA 1Y1WB 1II3A 3GTKB 2Z1CA 1B2TA 3D3RA 5KRUA 2RDFA 1VDZA 3ITPA 2KEDA 2Q8TA 2R6GA 3BYTB 1JOQA 1E2WA 1CHQD 1FD7D 3NQTA 4LJZC 5IIFA 5D3IB 2R7ZB 2K01A 1CZWA 3UI2A 2PO4A 3P20A 1PTOC 1U4MA 1U4PA 4RA8A 2K03A 2MJ8A 1WTRA 1F9RA 1JR0D 1J9OA 2X6LA 1PTOB 2XN9C 2PW5A 2YU9B 4ID6A 3N6RA 1WTXA 2B2YC 2F0TA 3RD4A 1HRJA 3DUZA 2JEAI 2NYZD 1SNMA 4H13C 3T16A 2G9DA 1AN8A 3A56A 5IGDA 3SHLA 4K5VA 5KNDA 1SDFA 2JSOA 1F77A 1S4ZA 4RKLA 3J80L 1D5MC 4DNTB 3MFYA 1AEXA 4Y7NB 1I4GA 1FNUA 4KJNA 3P75A 1QILA 1WTPA 2IT1A 1STNA 4IZ8A 5FOBB 4HN7A 1TWAB 1Z7TA 1BR9A 4ZRZA 1SNDA 5C0XJ 5TSSA 2QF7A 4XTCS 2GA4B 5ISRA 4H44C 2F0GA 1EU3A 3D4RA 3GTJB 1NR4A 5LL6X 1DOMA 1NAPA 4IUVA 1PFBA 1R9TB 1WTOA 3GO5A 4BA1I 2EJGC 2LKVA 3NP8A 1MGSA 1F2MA 5M3MB 3H91A 2LY7A 2A69C 1SE4A 3NXWA 3PUYA 1B1ZA 5ELEA 1O7ZA 4EQNA 1MSGA 4A93B 1XX8A 4C3HB 4KD3A 3GTLB 1TKWB 1SNQA 4X3UA 2NN6G 4TKOB 1DCZA 1BXTA 1G6ZA 3S14B 1Q3LA 1HFNA 3Q0AA 3S16B 1I6VC 1LLRD 2A6ED 2OEOA 4DXGA 4CKEA 2A69D 4A3KB 1KLUD 4ZAIA 1D5ZC 1WTQA 3EFXD 4TQUS 3GP7A 4BA2I 1QCBD 2F0NA 3EA6A 5IGFA 4CKBA 2EYJA 5CBAE 2K5WA 4K2LA 4ZK9B 1ENAA 3PV0A 3IFTA 2O2LD 1YNJC 2RKSA 3BS1A 1EYAA 3OPOA 1JQYD 2N88A 2B8GA 1PMRA 1PYWD 4L8JA 3P7JA 1JE4A 1JC7A 4BWGB 5JEAG 1Q12A 2B39A 5EQ0A 3X3MA 5I9PA 1LT6D 3PIP3 4C3JG 3GTMB 1F9QA 3G7LA 2EY2A 5J1ZA 2VB2X 5KEEA 2IX3A 2RDHA 4XQQA 3Q24A 5IGBA 2EY6A 1SJHD 5EPLA 2IWHA 4LK1C 1FGBD 5CV4A 4RCNA 1SYBA 1X3PA 5I2XA 2E2IB 4U68A 3T13A 1EYDA 1EY4A 3QO2A 2F0MA 3VR4A 2I07B 1MSHA 3R3OA 2QILA 3HOWB 3PUZA 4LMQD 4C2MB 1CA5A 1TVXA 3I4MB 2F0SA 5J22A 1GHJA 2QEJC 1DOKA 4MHEA 1TWCB 5HURA 1EEID 5LL6S 3FKIB 3U9SA 4HEDA 4Z9CB 2WINB 1VMCA 1TS5A 1U4LA 4L63B 2XSCA 4K8IA 1KLGD 1PRTD 2R61A 1TR5A 3I72A 2O5JC 1FNWA 4BS9A 1RDPD 3C1FA 2PW7A 1WCMB 1C48A 5C3EB 1EY5A 1UNSA 2F0WA 3FDTA 2O4XA 2ENBA 5FO9B 2DY8A 2AUJD 1Q90A 4ODGA 3ZYYX 2G9HD 4TRDA 5CBEE 2K7VA 3P1HA 3MC0B 1BCPB 4EGVA 3A8IE 1STGA 1FNVA 2BDOA 1OXVA 1TU2B 1EY9A 1EIGA 3TP8A 1B44D 1HQRD 2ICEC 4G57A 3K5LA 4HCSA 1A3VA 3TP5A 1BNZA 4KD4A 1O80A 4IURA 1JWUD 5C4ZA 4XQNA 4DU9A 3H09A 3EQLC 1JWSD 2WAQB 2B2TA 3VYRA 1EY7A 4H7BA 3VA5A 1J8IA 2OT2A 2L55A 3A7LA 1I4XA 4DAVA 1HXYD 5M5YB 3TZUA 3WDNA 4DNRB 5I4DA 4DN4M 2R92B 2NN6I 1B9NA 1XXGA 2EZVA 4ZYSA 1QB5D 4CKCA 3DEPA 4IFDG 2K04A 1ONLA 3MXUA 3D4DA 1KTKA 2BA0A 4QMGA 3FRPB 4CJ2C 3CHBD 1D2BA 1LTGD 3E6ZX 4M1UB 1M8AA 2B2YA 4CJ1B 1O7YA 4FP5D 3GTQB 1KDBA 1ML0D 1M4VA 1U9RA 5CV5A 1ENFA 4WORA 1SYFA 4HAEA 3M4YA 1HUMA 4K2KA 1YNND 1EIHA 4QB4A 1BOSA 3DMUA 2PYKA 5D14A 3HOVB 2EYOA 3JAME 3QJYA 2BCOA 2K5QA 2LMCB 4QUCA 1LT4D 3S1RB 4BBRB 4MN3A 5C3XA 3KK7A 3S9WA 2F4IA 3BDOA 4CGYB 2L1BA 2NUCA 1IYUA 1H9RA 2K05A 1S5DD 1TQOA 1V1PB 4DXFA 4MIUA 2WKCA 3LWUA 1AFPA 3LX0A 1SE3A 5JPNC 5FO7B 1LTBD 4IN3A 3TP7A 4EQOA 5DM73 1DONA 1STAA 3LNNA 1I3QB 1WTWA 3TZDA 1LABA 3S2DB 2MP1A 3QB3A 4KY5A 1XTCD 3EVQA 4V0BA 3L9AX 1KDCA 2L12A 3DHQA 4DK0A 3QIAA 2JEBI 5FLXE 1LTTD 2B2WC 5KNBA 5JJZA 5E1FA 1G2TA 1ESRA 4GZYC 1OXSC 4ZQ3A 2QKIC 1TWHB 1TWGB 2RSNA 1KAAA 4NP5A 2KVMA 2EE1A 5K36H 1RHPA 3NTIA 1RCVD 1UEAB 3CKIB 1KDAA 2ICIA 1F9PA 1RD9D 3PUVA 1A3TA 2OF1A 3I8ZA 4RGTA 3SK6A 2NN6H 2L9HA 1PTOD 5T1GA 3AB9A 1CK1A 5C0XG 4F7XA 2CHBD 2F0JA 4OO1I 4A3EB 2F0HA 2MUYA 5EKKA 3K58A 1DXMA 5EBCA 3RZOB 1BO0A 4DF7A 3LWEA 2F0EA 3Q22A 2F0VA 4QCLA 1CQFA 3VYSA 3KLSA 2AWOA 2HDMA 4HSVA 4C3HG 3HOUB 1JCKB 1IKLA 3R93A 1PFNA 1STBA 4ULLA 3OSOA 5KYIA 4KKUA 1RF2D 1B50A 4FYDA 1CFMA 5AFWA 3A7AB 5IGGA 2E2DC 1CQVA 4OGQC 1PZJD 2IX0A 4KKSA 3OWFA 2D9UA 1ZYRC 2QCPX 1FR3A 4KN4C 3NHHA 1B4OA 4IUUA 1TS2A 2XRSD 1HPCA 4OHJA 4BY1B 3A55A 1I4RA 3NTHA 3M85A 2K6AA 3G6JB 3C2PA 3K5OA 2XRQD 4FVMA 3HS0C 2H4OA 4WFN3 2FHTA 4F8MA 3DM1A 1G91A 4PMCA 3FEWX 2NVTB 4HR7B 1DD2A 2B2VC 4K6LA 1SYDA 4IFDI 3BVGA 1XWEA 3NQIA 3L7ZC 5CGKA 1PZID 1CM9A 4FF3A 1SNCA 4XIGS 4DK1A 1E2ZA 1VF7A 4KHZA 2KCCA 5JVH3 4KY6A 3GD7A 2N55A 4C1NI 3MA2B 1Y8OB 1EU4A 2IJ0A 1H9SA 1CZGA 1I50B 2CVRA 3S1NB 2A5HA 2OXPA 1EY6A 1EOTA 4N9TA 5M5WB 1ET9A 3BDCA 1OXUA 5T1IA 4ABNA 1DYQA 3PO2B 4HCEA 4NKLA 4B9WA 4U673 4K5XA 1NUCA 1WD0A 2TSSA 5JPMC 4XQJA 1DM0B 4BBSB 1T5XD 1QG7A 1RODA 2KQ3A 3TBIB 2R93B 2KJXA 1YNJD 3K5MA 2IX1A 2NB0A 5EKIA 4OO1H 2BE5C 5C4HA 3J7YW 3NUCA 4A3GB 2EYLA 2NBFA 3ERQA 3ND9A 5JEAJ 2NZ1D 4PMBA 5CC4A 2A73B 1LTID 1SAPA 3A8JE 1SE2A 4KN7C 1Q1BA 5D65A 1IL8A 1ESFA 2WB1B 1KABA 3TMEA 3FPPA 2EJMA 1JWMD 3AU7A 1B3AA 1PRTF 1STHA 3MXNA 3H3VC 1EZ8A 2MGSA 3GV6A 2F0KA 1G8ZD 1ENCA 2M9VA 4J8QA 2CW0C 2BE5D 1IKMA 1SMYC 3VYUA 1GXDC 4RGMA 3S1MB 2Z4IA 3MEHA 5LHY1 2JA7B 4C56C 2WV6D 4FF2A 1NSNS 1EYCA 3W2DA 4K8JA 1EQVA 4G7HC 5C4JB 2A74C 3D6CA 3V05A 4PV1C 5BN4A 2PPBC 3OWEB 5E3FA 3RZDB 4XXEA 3J81E 4KK7A 2A68C 2JA8B 3J7AF 4RFBA 1HTLD 2BDNA 1L0YB 1A6XA 2JP1A 1O7LA 4HTHA 1EFID 3HRZC 5EKLA 3M3YB 1IYVA 4Q0FA 2CW0D 1SFOB 5ELDA 1SMYD 4ZUIA 1BCPC 3F2UA 3AMUA 3M4OB 3SR1A 2B63B 4PQXA 5I9OA 3KBGA 3MXGA 3E5SA 1SNPA 1A3UA 1V8QA 3HG9A 2BOSA 3OMCA 4IFDH 2A68D 2EYHA 2D62A 4K5WA 3KLSX 4X3KA 1PFMA 1SSOA 2J7ZA 2K5DA 3QWNA 2B2UC 2DNCA 2IPKD 4K14A 1G291 4AYBB 5A2QE 4FF4A 1BCPD 2I46A 3BG3A 2F0OA 1K83B 3K57A 2M00A 1HCZA 4RWSC 2F03A 1SYCA 2PNRC 3KBXA 1F2ZA 4G7ZC 2WP8J 1HTPA 4RH6A 1WVLA 2F0UA 3GTOB 4V190 3NWSA 1D1IA 1Y8NB 4ME5A 2L11A 4CHTB 4KV6A 2L0CA 1STYA 2EYMA 2ZXOA 1BQQT 3S15B 3C46A 2C5CA 4P2CB 3I4NB 2CQAA 2EDGA 5G3LD 2O5IC 1B9MA 3TDQA 3S17B 1SBBB 1PLFA 4NMZA 3I91A 3JAML 2YYZA 2B2WA 4IUNA 2VB3X 2F3VA 1Z6HA 3PUWA 1RTNA 3NK9A 2ZXPA 5M9OA 4YIJA 3E0JA 2A6HC 2HCCA 3BDLA 4OIKA 5CORA 4TSSA 3MFGA 5CV8A 4B9XA 1E2VA 3HEJA 4X3TA 5EPJA 2KEEA 1EL0A 1GOZA 3GTGB 5IT9E 1GHKA 1OXXK 1EZ6A 1IHZA 2F0QA 2J0TD 1Y1VB 2SDFA 4IFDJ 1PTOH 3D8GA 1ZEQX 4JBWA 2RVLA 2ZT9C 3KF8A 3MTSA 1Z47A 5DEHA 2KCNA 2AQ3B 2A6HD 3QG1A 2PZTA 1JOOA 3R2TA 2IL8A 2K33A 5HGTA 2F0LA 3MZ5A 5M3FB 1GUSA 1PZKD 5IOCA 4HMJA 1BF4A 5FLXL 3D31A 2SEBD 1IW7C 2PMZB 4I65A 3R8BA 2MHVA 2C9OA 3HGBA 4XT1B 2Z8LA 3TN2A 1HQMC 3NPPA 4A3IB 2AWNA 1SJED 1C8CA 2AQ2B 1FYCA 1CA6A 1ZKOA 1G2SA 3H0GB 1SXTA 1EWCA 1V43A 1HFGA 4FF1A 3M7GA 1PXUA 4QIWB 1RJTA 4WJWA 1H9KA 4ZUJA 4G4KA 3SVMA 4R8IA 4WRDA 5BN5A 2B2TC 3S1QB 3SEBA 4KY7A 1IW7D 3VR2A 2DNEA 4EQPA 4IUQA 1JB3A 3CQZB 5JAVA 5C5MA 4RAUC 3FVQA 1V1OA 4KKTA 3DWPA 4FO2A 3PO3B 3I3CA 1K8MA 4PNYA 1BUVT 1OXTA 4KI0A 5EBDA 2VUMB 2L5TA 3N52A 3A54A 3VR5A 1PTOF 3Q23A 2XNAC 4EVOA 5J39A 2B2VA 5EGTA 2E74C 3TP6A 3URYA 5I2YA 3C3LA 2WKDA 1R4QB 5DM63 2BA1A 1H9MA 1BDOA 1LTSD 3QOJA 2NVYB 1XYIA 1LT5D 2EVBA 2PQEA 3OOCA 4A3JB 1AW7A 1D1KA 2NWGA 3DWAA 3EJIA 2K28A 1Y69U 4C1NK 2SOBA 1A2UA 5C4XB 3VR6A 4NDXA 2RQXA 4F87A 1PDQA 1TS4A 3MXPA 2K1BA 1QJOA 3O13A 3BZDB 2JA5B 1ET6A 2JXMB 5COYA 1STEA 2IW3A 2FJ2A 3NSWA 1JICA 2VXWA 1KNEA 2XVSA 2EXZA 5CYUA 1LTRD 1Q1EA 1TT2A 1HA6A 1O78A 5IODA 3RMHA 1ILPA 3OIQA 2KOLA 1RKNA 3BVMA 2A6EC 1GJXA 5CV6A 3X3NA 1OO9B 5K36G 1X3QA 3J80E 3DEOA 2VNUD 2JYOA 3U9OA 2Q8RE 3HZXA 5JEAH 1QNKA 3R2IA 3IL8A 2NTSA 4DAYA 1W6JA 1W6KA 3T53B 3NWTA 3S2HB 1BBXC 1MD2D 3K0YA 3K7AB 2EPBA 2X69A 1S5CD 5I6WA 3OMGA 3BVZA 3MWYW 1UUPA 1ZYRD 2QDBA 3QOLA 3GQBA 4E6IA 1S5FD 3NBHA 5ELBA 4B08A 2H1EA 4S3SA 3NBIA 2DN8A 4R8NA 5D3DA 3FPUB 2WACA 2NVXB 4IQZA 5CV9A 4J1MA 3WOFA 2K32A 5K5PA 1ICWA 1L0XB 4FXKC 2FMMA 2Z4HA 5A35A 2DY7A 2HQEA 2RA4A 5I6YA 1AZQA 2E2JB 2LS01 4F88A 3SE0A 5IGCA 2HUGA 4OIJA 3ND8A 2FFKB 4XYOA 2RBMA 2X6GA 1QWYA 2FMCA 3OHXC 4BY7B 1GUGA 5FKAC 2AQ1B 1EY8A 2FINB 1S5BD 4XDXA 1QNUA 4XT3B 4NW2A 1I4PA 5E4XA 2J4XA 3T4AC 1HA5A 4QUFA 3CRLC 1EQTA 3K59A 1GUWA 3C1EA 3I90A 4I7ZC 1TS3A 1Y8PB 1LT3D 1D5XC 2SNSA 2B2UA 5E4WC 3V2TA 2WIIB 5FK9C 1TY2A 2XIWA 1S5ED 2NTTA 3TSSA 4A3FB 3HOXB 3EROA 1EEFD 4DFAA 4IUPA 2E75C 1Q8IA 4ZKCB 3Q6SA 2F1MA 1NR2A 3H94A 1GUNA 1LTAD 3J81L 2XWJB 4KHVA 3ONAB 2F3WA 3OW7A 3FMCA 3V96A 2KHSA 5KNCA 2NVQB 5C6AA 4C3JB 1A15A 3J7AV 2KA7A 5C44B 3PIO3 3HKZB 4M8AA 1ILQA 1VCIA 1D6EC 4C3IG 1CT1D 3I73A 2E76C 1PRTC 2L4NA 4L6TB 1SYGA 3VYTA 4J6HA 1EY0A 4RKBA 2PCFB 1CHPD 1SYEA 4H0LC 3PMFA 3IFDA 1PRTB 3L3OC 3CU7A 4O42A 1DJRD 3BYYB 2EJFC 2ID0A 3HOYB 1E0BA 2RSOA 4FXGC 3NTKA 3IKJA 4C3IB 3RLFA 1X32A 2ZXRA 2EYPA 5A2QL 1AP0A 1T5EA 2SNMA 1QOHA 1CI3M 3RUZA 2Q8IB 1HUNA 2PZWA 5KGUA 5ELCA 5KYLA 2MPMA 1SEBD 4ILWA 1CTMA 2TMPA 3W3AA 1B53A 1ZXTA 1UAPA 2M2LA 4QF4A 4OO1G 4CBVA 1JORA 5C0XI 1BCPF 2HDLA 3HP3A 2JE6I 5DNFA 5NUCA 3A8KE 2R3ZA 4XYQA 1EWHA 1V1PA 4R9WA 1WD1A 4JK1C 2F0IA 5DAUA 1VF5C 4N9PA 4HMIA 1H9SB 1LV9A 2HCIA 4KJOA 1HHVA 3I70A 5JVG3 2KUMA 1WTVA 4HSPA 3SXHA 2AUKA 4RCOA 5G3LF 2RDGA 3MAQA 1TWFB 2F0PA 3SK8A 3PUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RJT A;  2NYZ D;  2DY7 A;  1RTN A;  1WD0 A;  2RA4 A;  1ESR A;  3QO2 A;  2KEC A;  2D9U A;  4HAE A;  1AZQ A;  1G2T A;  1F9S A;  4O42 A;  3F2U A;  2HUG A;  5COY A;  1DZ1 A;  1EIG A;  3SVM A;  1QG7 A;  2EOT A;  1HUM A;  4OIJ A;  2FFK B;  1MSH A;  3KUP A;  1NCV A;  4R8I A;  1EIH A;  1ROD A;  1B4O A;  4IUU A;  2X6G A;  1SDF A;  2B2T C;  1E0B A;  2RSO A;  3GV3 A;  2FJ2 A;  2RSN A;  1S4Z A;  5CMD A;  1MI2 A;  2KVM A;  1JIC A;  5D14 A;  2VXW A;  4UAI A;  1KNE A;  1VMP A;  1X32 A;  2EE1 A;  2HCC A;  4IUQ A;  1RHP A;  4LMQ D;  4HCS A;  4OIK A;  4ZAI A;  1CA5 A;  2FIN B;  4RAU C;  5COR A;  4XDX A;  1BNZ A;  1O80 A;  1WTQ A;  1TVX A;  4XT3 B;  4NW2 A;  5EKI A;  1KNA A;  1AP0 A;  4IUR A;  1HA6 A;  4QUC A;  5E4X A;  3I3C A;  4QUF A;  1ILP A;  1EQT A;  4X3T A;  2KOL A;  4MN3 A;  1WTP A;  5EPJ A;  1F9P A;  2KEE A;  1EL0 A;  1GUW A;  3I90 A;  4X3K A;  4X3S A;  1AZP A;  1PFM A;  1HUN A;  1SSO A;  1F2L A;  3I8Z A;  2B2U A;  2B2T A;  2J7Z A;  1DOK A;  2L1B A;  2MPM A;  4IUT A;  5E4W C;  1U4R A;  2FHT A;  2NZ1 D;  4MHE A;  2B2U C;  3N52 A;  1X3Q A;  2SDF A;  2L9H A;  3DEO A;  5CBA E;  2XIW A;  4HED A;  5T1G A;  1J8I A;  4ZK9 B;  1RTO A;  1SAP A;  2JYO A;  2Q8R E;  1B53 A;  1ZXT A;  2M2L A;  3DM1 A;  2B2V A;  5EPK A;  1B2T A;  1G91 A;  1QNK A;  2RVL A;  5D65 A;  2K05 A;  3MTS A;  1IL8 A;  2B2V C;  1VMC A;  2HDL A;  3HP3 A;  3IL8 A;  4IUP A;  1U4L A;  1NR4 A;  5DNF A;  2KED A;  4ZKC B;  3Q6S A;  2Q8T A;  1DOM A;  1NAP A;  4IUV A;  4RWS C;  1PFB A;  1B3A A;  1WTO A;  2R3Z A;  1NR2 A;  3GV6 A;  1CM9 A;  2MGS A;  2N88 A;  1BBX C;  4DN4 M;  3KBX A;  2EPB A;  4R9W A;  2IL8 A;  1BO0 A;  2X69 A;  1WVL A;  1WD1 A;  1XYI A;  3ONA B;  3P7J A;  1JE4 A;  3LWE A;  4ZLT F;  1IKM A;  1MGS A;  2N55 A;  3H91 A;  5EQ0 A;  2K01 A;  1LV9 A;  3MWY W;  3UI2 A;  3DEP A;  1BF4 A;  1A15 A;  2L11 A;  1DON A;  1F9Q A;  2K04 A;  2HCI A;  1O7Z A;  2HDM A;  3G7L A;  4HSV A;  1WTW A;  1MSG A;  1U4M A;  2NWG A;  1XX8 A;  1U4P A;  4RA8 A;  1HHV A;  2K03 A;  2CVR A;  3FDT A;  2KUM A;  2MJ8 A;  3TZD A;  1WTV A;  1IKL A;  3R93 A;  1WTR A;  4XT1 B;  1DOL A;  1PFN A;  2H1E A;  3TN2 A;  2DY8 A;  2K28 A;  2MP1 A;  1EOT A;  4X3U A;  1F9R A;  1J9O A;  1ILQ A;  4CJ2 C;  4CJ0 B;  3FPU B;  2X6L A;  5T1I A;  1QE6 A;  1M8A A;  2B2Y A;  2BDN A;  2L4N A;  1O7Y A;  5EJW A;  5CBE E;  4CJ1 B;  1WTX A;  1C8C A;  1B50 A;  1G6Z A;  2B2Y C;  5EPL A;  2JP1 A;  1PLF A;  5AFW A;  1CA6 A;  1PDQ A;  2L12 A;  1G2S A;  3I91 A;  4ZKB B;  1Q3L A;  2K1B A;  1ML0 D;  2B2W A;  1X3P A;  1HFN A;  1ICW A;  3D6W A;  1HRJ A;  1HFG A;  4U68 A;  2B2W C;  2FMM A;  5JJZ A;  3IFD A; 
#chains in the Genus database with same CATH topology
 3MHB A;  1N34 Q;  4UPA A;  1U5K A;  3CRK C;  3MVV A;  2EOT A;  3KUP A;  5IT9 L;  1NCV A;  5IGE A;  1R4P B;  1QUQ B;  2LXJ A;  3A5Z B;  5CR3 A;  3WOE A;  4A3D B;  3GV3 A;  2F0D A;  4RMF A;  1MI2 A;  4UAI A;  4IO9 A;  1QZG A;  1EYG A;  1KRT A;  2E2H B;  1SRO A;  5BN3 A;  4PMW A;  2EY5 A;  1KNA A;  1MJC A;  3DXJ C;  1I3Q H;  2PZU A;  2RCF A;  2LFN A;  4IAL A;  1AZP A;  4X3S A;  1A2T A;  1TII D;  1F2L A;  2B8F A;  1GUO A;  4IUT A;  3S2D H;  3UDG A;  1I4Q A;  1U4R A;  1GO3 E;  3OIP A;  4RGO S;  2XWB B;  4KTA A;  1PH5 A;  2Y0S B;  2EYF A;  4O1N A;  1YNN C;  1LAC A;  3E9I A;  1RTO A;  5EPK A;  2EY1 A;  4Q5V A;  1PH7 A;  3SK5 A;  1TY0 A;  3IAY A;  3MXN B;  2V1C C;  3KLR A;  5C5L A;  2P5Z X;  2CWP A;  3T1H L;  3F8T A;  4RHS A;  4DV4 L;  4DA2 A;  5GAH C;  2JA6 B;  2AKW B;  3GTP B;  1W3S A;  1XNQ L;  5F2D A;  3D4W A;  3PCO B;  1PFS A;  5CV7 A;  4A3M G;  1F2Y A;  4X64 L;  2HT1 A;  1TWH H;  1LO5 D;  3T51 B;  1TWG H;  2K5V A;  1N36 L;  3KFU A;  4GKK Q;  4ZLT F;  2UUB Q;  3W1B A;  2YU9 H;  3K5N A;  5ELF A;  1KAW A;  5M3F G;  1C4Q A;  1PH6 A;  1JOK A;  4G7O C;  2D2C C;  5FO8 B;  4GNX B;  4FXD A;  4X66 Q;  1XTD A;  1CUK A;  4RGN A;  3UDI A;  3T56 B;  5GQO A;  3EN2 A;  1DOL A;  3RLN A;  3SK4 A;  3HKZ E;  1Q7Y C;  4LFA Q;  1GUT A;  1H9J A;  1MBY A;  3NE5 B;  4UP8 A;  4CJ0 B;  5C3W A;  3VA7 A;  4A3M B;  1SNO A;  4DV6 Q;  1QE6 A;  2E8G A;  5EJW A;  1C7Y A;  3BU2 A;  4K6D A;  1CKN B;  4KHP Q;  1Z9F A;  5LMN W;  1AH9 A;  4LF9 Q;  4YY3 L;  4ZKB B;  1I6H B;  3D6W A;  4DAP A;  5LMU L;  5M5X B;  1VQB A;  4FNF A;  1YHQ A;  1VQA A;  4A3E H;  4IPG A;  2KEC A;  3PQI A;  1F9S A;  5DLQ E;  3ULP A;  1DZ1 A;  3H6M A;  3SDZ A;  2ASB A;  1Q86 C;  3T1Y L;  4RHR A;  4UDU C;  2D5D A;  2HQL A;  4DGZ A;  3M7N A;  3RZO H;  5KIX A;  4A3B G;  5CMD A;  1Y1W G;  1LM0 A;  4P72 A;  4NXM L;  1VMP A;  4LAA A;  1I4H A;  1K8O A;  4AQY L;  4JI3 Q;  1HJP A;  5C0X H;  2F0F A;  3PO3 G;  4KMU C;  5JOB A;  1K0S A;  3I7F A;  2CH4 W;  3J7A 5;  3HOU H;  3K6O A;  1HR0 W;  1R9T H;  3VR3 A;  3I4L A;  4OL7 A;  2VQF L;  2VUM G;  3HOZ B;  2UUC L;  3AYH B;  1CKO A;  3DWQ A;  4A3B B;  2V4D A;  1Y1W B;  1II3 A;  3GTK B;  2Z1C A;  1B2T A;  4YHH L;  3D3R A;  5KRU A;  2RDF A;  1VDZ A;  1FL0 A;  5AJ3 L;  3ITP A;  2KED A;  2Q8T A;  4L5T A;  1N8R C;  4GOP A;  4A93 H;  4C3H H;  2R6G A;  3BYT B;  1K28 A;  1P8L A;  5ELN A;  4JI5 Q;  1JOQ A;  1E2W A;  1CHQ D;  1FD7 D;  4QQB X;  3NQT A;  4LJZ C;  5IIF A;  1IZ6 A;  1K73 C;  2OTL A;  2Z9H A;  3CCL A;  5D3I B;  4BY1 H;  2MO1 A;  2R7Z B;  2K01 A;  2OQK A;  1CZW A;  3UI2 A;  1HR0 L;  2PO4 A;  3P20 A;  1PTO C;  3OW2 A;  1U4M A;  1U4P A;  4RA8 A;  4HJ8 A;  2K03 A;  4PZ6 A;  2MJ8 A;  1SMX A;  1C0A A;  1WTR A;  2PQA A;  5IT9 c;  1F9R A;  1JR0 D;  1J9O A;  3BJU A;  2X6L A;  1PTO B;  2XN9 C;  2PW5 A;  2YU9 B;  4ID6 A;  4YWM A;  3N6R A;  1WTX A;  4HJ9 A;  5LMN Q;  1YIT A;  1EFW A;  1A62 A;  2B2Y C;  2C35 B;  4UHV A;  1E1T A;  2F0T A;  3RD4 A;  2I0Q A;  2CCZ A;  4LF7 L;  2JA5 G;  2NVT H;  1HRJ A;  3DUZ A;  4LUV A;  2JEA I;  4DUZ Q;  2NYZ D;  3PIP A;  1SNM A;  4H13 C;  3T16 A;  2G9D A;  2MO0 A;  4B3R L;  1AN8 A;  3A56 A;  5IGD A;  3SHL A;  4K5V A;  4DV2 Q;  5KND A;  1SDF A;  2JSO A;  4JYA L;  1F77 A;  3WWV A;  1S4Z A;  4RKL A;  3J80 L;  1D5M C;  4DNT B;  4L5S A;  2DGY A;  3MFY A;  3HKS A;  1AEX A;  4Y7N B;  1I4G A;  1FJG Q;  4IJH A;  1FNU A;  4KJN A;  4DR1 Q;  3P75 A;  1QIL A;  1WTP A;  2IT1 A;  1STN A;  4IZ8 A;  1I50 H;  5FOB B;  5IWA Q;  4HN7 A;  1TWA B;  3S1N H;  1Z7T A;  2UXB L;  2IHF A;  1BR9 A;  4MTN A;  4ZRZ A;  1SND A;  5C0X J;  3KF8 B;  3KLW A;  5TSS A;  1WYD A;  2QF7 A;  1HNZ L;  2Z0S A;  4XTC S;  5M3M G;  4O2D A;  3PO2 H;  2GA4 B;  2I5H A;  5ISR A;  4H44 C;  2F0G A;  4DV0 Q;  1EU3 A;  1M1K C;  3D4R A;  3GTJ B;  1JMC A;  4GS3 A;  1NR4 A;  2UUA Q;  5LL6 X;  2GVA A;  1DOM A;  1NAP A;  4IUV A;  2AHO B;  1YZ6 A;  1PFB A;  1R9T B;  1WTO A;  4UY8 C;  3GO5 A;  2CWA A;  4LUO A;  1VQD A;  2K52 A;  2EJG C;  4BA1 I;  2LKV A;  3RN5 A;  5FJ8 H;  3NP8 A;  1N9W A;  1M90 C;  2AMC B;  3CW2 C;  1GD7 A;  4A3C H;  4YCW A;  1MGS A;  1F2M A;  5M3M B;  3H91 A;  2LY7 A;  1JE5 A;  2A69 C;  1SE4 A;  3NXW A;  3PUY A;  4L5Q A;  4JI8 L;  1B1Z A;  5ELE A;  5FLX c;  1XMO Q;  1O7Z A;  3ERS X;  5IYC G;  4EQN A;  3U50 C;  1MSG A;  1K3R A;  4GLV B;  3PF4 A;  1XX8 A;  4C3H B;  4A93 B;  4I7A A;  4A3G H;  4P75 A;  5IYB G;  4KD3 A;  1S3O A;  1S72 A;  3GTL B;  1TKW B;  1HZB A;  4H02 A;  1SNQ A;  4X3U A;  2NN6 G;  2E5L L;  4TKO B;  1L1O A;  1DCZ A;  1BXT A;  1G6Z A;  3S14 B;  1H95 A;  2UXD Q;  3RN2 A;  1Q3L A;  1HFN A;  3Q0A A;  4HJA A;  4OEL B;  3S16 B;  1I6V C;  1LLR D;  2N8N A;  1EOV A;  2A6E D;  2OEO A;  4DXG A;  4CKE A;  2A69 D;  4A3K B;  1B7Y B;  1KLU D;  1FGU A;  4AH6 A;  3F2B A;  1NY4 A;  4ZAI A;  3NEM A;  1D5Z C;  1GM5 A;  3FKI H;  3S1M H;  4MNO A;  1WTQ A;  4PG3 A;  2JA7 H;  2LSS A;  1JT8 A;  3EFX D;  4OX9 Q;  2ALY B;  3DLL A;  1K8A C;  5C4J H;  4TQU S;  3GP7 A;  4RG1 A;  4BA2 I;  1QCB D;  2F0N A;  3EA6 A;  4TVA B;  5IGF A;  4CKB A;  3RZD H;  4LFC Q;  4DR3 L;  2EYJ A;  1UE5 A;  2JA8 H;  5CBA E;  2K5W A;  4DV7 Q;  4K2L A;  4ZK9 B;  1ENA A;  3HOX G;  4A3F G;  1KXL A;  3PV0 A;  3IFT A;  2O2L D;  1YNJ C;  2RKS A;  3BS1 A;  1EYA A;  3M3Y H;  5C3E H;  2KBN A;  3OPO A;  1IBL L;  5IP7 H;  1HNW L;  1JQY D;  1SFO H;  1KHI A;  2N88 A;  1PA6 A;  2B8G A;  1PMR A;  1I94 Q;  1PYW D;  1SN8 A;  3M4O H;  4L8J A;  1HH2 P;  4LW1 A;  3P7J A;  1JE4 A;  1JC7 A;  4BWG B;  4DV3 L;  5JEA G;  1Q12 A;  1PH8 A;  4R4C A;  1V1Q A;  2B39 A;  5EQ0 A;  3CXC A;  1VQL A;  3X3M A;  5I9P A;  1LT6 D;  3PIP 3;  4DV1 Q;  4C3J G;  2F3I A;  1MJE A;  3GTM B;  1F9Q A;  5FLM H;  3CF5 A;  3G7L A;  5C44 G;  2EY2 A;  1KQS A;  4WJ3 M;  1WI5 A;  5J1Z A;  2VB2 X;  5KEE A;  2IX3 A;  2RDH A;  3JAM i;  2RCN A;  1VQ5 A;  3OTO Q;  4XQQ A;  3PSI A;  3Q24 A;  3HOW G;  3J80 c;  5IGB A;  2EY6 A;  1SJH D;  5EPL A;  2IWH A;  4LK1 C;  2ZJP A;  1FGB D;  5CV4 A;  4RCN A;  1E1O A;  1SYB A;  1X3P A;  5I2X A;  2E2I B;  1W2B A;  2YTX A;  4U68 A;  3T13 A;  2YTV A;  1EYD A;  1K83 H;  2IHE A;  1EY4 A;  3QO2 A;  2F0M A;  3VR4 A;  1QZH A;  2I07 B;  4GKJ Q;  1MSH A;  3HOY G;  3R3O A;  1VQ6 A;  2QIL A;  3HOW B;  3PUZ A;  3ZJY C;  3GTO H;  4LMQ D;  4C2M B;  1CA5 A;  3S24 A;  1TVX A;  1B3Q A;  1A63 A;  3I4M B;  1J6Q A;  2F0S A;  4DUY Q;  2EIF A;  4HIO A;  3S15 H;  2XTI A;  5J22 A;  4DV5 Q;  1GHJ A;  2QEJ C;  1E24 A;  3BZK A;  2QDL A;  1DOK A;  4MHE A;  5L37 A;  1TWC B;  5HUR A;  2R92 H;  1EEI D;  5LL6 S;  4DAY B;  4B3M L;  3FKI B;  4BXX H;  3U9S A;  4HED A;  1WCM G;  4OXP A;  4Z9C B;  3D0F A;  3S17 H;  1N32 Q;  5H1S E;  4IOC A;  3KF6 B;  2WIN B;  3CCE A;  1VMC A;  1IXR A;  1TS5 A;  1U4L A;  4L63 B;  2XSC A;  4K8I A;  1KLG D;  1PRT D;  5IYD G;  2R61 A;  4LF4 Q;  1TR5 A;  3I72 A;  2O5J C;  1FNW A;  4BS9 A;  4NB3 A;  1EQR A;  1RDP D;  1WJJ A;  3C1F A;  2CQO A;  2PW7 A;  3NBH B;  1MHW C;  4NPS A;  1WCM B;  2ZTE A;  1VS0 A;  1C48 A;  4NXN L;  4LWC A;  5C3E B;  1RL2 A;  1EY5 A;  3GTQ H;  2XGT A;  1UNS A;  2A8V A;  2F0W A;  3FDT A;  2O4X A;  4LF6 L;  4N8F A;  2ENB A;  5FO9 B;  1YNX A;  2DY8 A;  4B3T Q;  2AUJ D;  1Q90 A;  3J81 j;  4ODG A;  3A74 A;  3ZYY X;  4LF5 L;  2G9H D;  4TRD A;  2JA9 A;  5CBE E;  1Y1V H;  2EQS A;  2K7V A;  3P1H A;  3MC0 B;  1BCP B;  4JI6 Q;  4EGV A;  1YEZ A;  3A8I E;  1STG A;  1FNV A;  2BDO A;  3BZC A;  1OXV A;  1TU2 B;  1EY9 A;  1EIG A;  4A3D G;  3CCR A;  2VQE L;  1UE7 A;  3TP8 A;  1B44 D;  1HQR D;  2ICE C;  4G57 A;  3K5L A;  4HCS A;  4AIM A;  1A3V A;  3TP5 A;  1E7Z A;  5M3F H;  4KD4 A;  1O80 A;  1BNZ A;  4IUR A;  1JWU D;  5C4Z A;  4XQN A;  4DU9 A;  3H09 A;  2KCT A;  2F4V L;  3EQL C;  3CD6 A;  4GN5 A;  4YWL A;  1JWS D;  2FXQ A;  2WAQ B;  2B2T A;  3VYR A;  1VQ8 A;  1EY7 A;  4H7B A;  3VA5 A;  4JI4 L;  4A3I H;  2Y0S G;  1J8I A;  2OT2 A;  2L55 A;  3A7L A;  1I4X A;  4DAV A;  3H0G H;  1HXY D;  2DJG C;  5M5Y B;  3TZU A;  1J5E Q;  2HIV A;  2UUB L;  3WDN A;  2JA6 G;  4DNR B;  5I4D A;  2BH8 A;  3GDE A;  3KDF B;  4DN4 M;  2R92 B;  1NJI C;  2NN6 I;  1B9N A;  3J81 c;  1XXG A;  2EZV A;  4ZYS A;  1QB5 D;  3S1Q H;  4CKC A;  1IBK Q;  3CQZ H;  3DEP A;  4IFD G;  2K04 A;  1ONL A;  3MXU A;  3D4D A;  1KTK A;  2BA0 A;  2OTJ A;  3W5O A;  4QMG A;  3FRP B;  4DR6 Q;  1JB7 A;  2VL6 A;  2ZM6 Q;  2Q2T A;  4A3L G;  2PI2 E;  3CHB D;  4CJ2 C;  4GNX C;  1LTG D;  4ZCK A;  3E6Z X;  4DR2 Q;  1PH3 A;  1D2B A;  4M1U B;  1M8A A;  2B2Y A;  4CJ1 B;  1O7Y A;  4FP5 D;  2YV5 A;  4YCU A;  3GTQ B;  4LFB L;  1KC8 C;  1KDB A;  1ML0 D;  1M4V A;  1U9R A;  5CV5 A;  1ENF A;  4JBJ A;  1ICF B;  4BBR G;  4WOR A;  2N3S A;  1SYF A;  4X62 L;  4HAE A;  1UWV A;  3M4Y A;  4A4I A;  3A5U A;  2KHJ A;  1HUM A;  4K2K A;  1YNN D;  2Z6K C;  4JV5 L;  4QB4 A;  1EIH A;  3AQQ A;  1BOS A;  3DMU A;  1YJW A;  2NVY H;  2PYK A;  5D14 A;  3HOV B;  4Y52 H;  3A0J A;  2EYO A;  3JAM E;  3QJY A;  2BCO A;  2K5Q A;  2LMC B;  4QUC A;  1LT4 D;  4A3J H;  3FP9 A;  3S1R B;  4BBR B;  4MN3 A;  5C3X A;  1HZC A;  3KK7 A;  4JI0 L;  4P73 A;  3S9W A;  1XPR A;  2F4I A;  2DJF C;  3BDO A;  4CGY B;  2L1B A;  3LGJ A;  3HOZ G;  2NUC A;  3T1H Q;  1VQO A;  4L5R C;  4HIM A;  5C4X H;  1G51 A;  1IYU A;  1XNQ Q;  1H9R A;  3CC4 A;  2K05 A;  4X64 Q;  1S5D D;  1TQO A;  1V1P B;  4DXF A;  4MIU A;  1SE8 A;  2WKC A;  3LWU A;  2JA5 H;  1N36 Q;  1CKM A;  1AFP A;  3LX0 A;  1SE3 A;  4HIK A;  1QVC A;  5JPN C;  5FO7 B;  1K0R A;  3QR8 A;  1LTB D;  4IN3 A;  3TP7 A;  4EQO A;  4HJ5 A;  1XPU A;  1YBY A;  2R7Z G;  5DM7 3;  1DON A;  1STA A;  3LNN A;  1I3Q B;  2LXK A;  1WTW A;  4DKA C;  3TZD A;  1LAB A;  5JJL A;  3S2D B;  2MP1 A;  3QB3 A;  5LMU Q;  2JN4 A;  2KCM A;  4KY5 A;  1XTC D;  3EVQ A;  3JC6 6;  3KJP A;  4V0B A;  3L9A X;  1KDC A;  2L12 A;  3T1Y Q;  3DHQ A;  4DK0 A;  3QIA A;  2JEB I;  5FLX E;  5HGQ A;  1LTT D;  2B2W C;  3K80 C;  5KNB A;  5JJZ A;  5E1F A;  4NXM Q;  1G2T A;  1YIJ A;  2JJQ A;  1ESR A;  4GZY C;  2VS1 A;  1OXS C;  4ZQ3 A;  4AQY Q;  3S2H H;  1KRS A;  2WFW A;  4R4Q A;  2QKI C;  1TWH B;  3K7A H;  1TWG B;  2RSN A;  1KAA A;  4NP5 A;  2KVM A;  4JI2 L;  3CMA A;  2EE1 A;  5K36 H;  1RHP A;  3NTI A;  3PGZ A;  1RCV D;  2VQF Q;  4A3E G;  1UEA B;  3UE1 A;  3CKI B;  2UUC Q;  1KDA A;  5IYC H;  4QJF A;  1X55 A;  2ICI A;  1F9P A;  4YHH Q;  1RD9 D;  4DR5 L;  3PUV A;  1A3T A;  2OF1 A;  3I8Z A;  4RGT A;  3SK6 A;  5AJ3 Q;  2NN6 H;  2L9H A;  3CC7 A;  1PTO D;  5T1G A;  3AB9 A;  3CCQ A;  1CK1 A;  5C0X G;  2NVX H;  4F7X A;  2CHB D;  4X65 L;  2F0J A;  4OO1 I;  4A3E B;  4GLA C;  2F0H A;  2MUY A;  3M4P A;  5EKK A;  3K58 A;  2VY3 A;  1BBW A;  2E2J H;  1DXM A;  1HR0 Q;  1RIP A;  5EBC A;  3RZO B;  1XMO L;  1BO0 A;  1N33 Q;  4DF7 A;  5M5W H;  4YWK A;  3LWE A;  2F0E A;  3Q22 A;  2F0V A;  4QCL A;  1CQF A;  3VYS A;  3Q8D A;  4BY7 H;  3KLS A;  2AWO A;  2Y0S E;  4CDC C;  4DK6 C;  2HDM A;  4HSV A;  4A93 G;  4C3H G;  1PYS B;  3HOU B;  3CCM A;  1JCK B;  1IKL A;  3R93 A;  1PFN A;  4CDD C;  3PIO A;  1NTG A;  4BBS H;  1STB A;  4LF7 Q;  1PVO A;  4ULL A;  3OSO A;  1QVG A;  4BY1 G;  5KYI A;  4KKU A;  1PYB A;  1RF2 D;  2R93 H;  1B50 A;  4DAM A;  4FYD A;  1CFM A;  1VQK A;  4B3R Q;  2K14 A;  5AFW A;  3A7A B;  3HOX H;  4A3F H;  5IGG A;  4JYA Q;  2E2D C;  1CQV A;  4OGQ C;  1PZJ D;  2IX0 A;  1PH4 A;  4KKS A;  3OWF A;  1LYL A;  2D9U A;  1A0I A;  3CCV A;  1ZYR C;  5IE8 A;  2QCP X;  1FR3 A;  4KN4 C;  4LF8 L;  3NHH A;  1B4O A;  4IUU A;  4A3K G;  1TS2 A;  2JK8 A;  1HPC A;  2RHQ B;  2XRS D;  1XNR L;  2G5D A;  4OHJ A;  2JQO A;  4BY1 B;  3A55 A;  3F1Z A;  2D0O A;  2UXB Q;  1I4R A;  2NVQ H;  3NTH A;  4OEM B;  4JI7 Q;  3M85 A;  2K6A A;  3G6J B;  4C3J H;  3C2P A;  4IOA A;  3K5O A;  4UP7 A;  1HNZ Q;  5C44 H;  3CP0 A;  2XRQ D;  4FVM A;  4GOP C;  4CDF C;  1XJV A;  3HS0 C;  3G6E A;  2H4O A;  4WFN 3;  2FHT A;  1S40 A;  4F8M A;  3RLO A;  1EQQ A;  1ASY A;  3TS2 A;  3DM1 A;  1G91 A;  4PMC A;  3FEW X;  3L0O A;  4GOP B;  2NVT B;  4HR7 B;  1DD2 A;  2N49 A;  2B2V C;  4K6L A;  1SYD A;  4IFD I;  1I5F A;  3BVG A;  1XWE A;  1G6P A;  3TEH B;  3NQI A;  4JOI A;  3L7Z C;  5CGK A;  1PZI D;  1SLJ A;  4R4T A;  1CM9 A;  4FF3 A;  3RR5 A;  4DV1 L;  1SNC A;  4JBK A;  4JI8 Q;  4XIG S;  4DK1 A;  1IL2 A;  1E2Z A;  1VF7 A;  4KHZ A;  3HOY H;  2F52 A;  2KCC A;  5JVH 3;  3PO2 G;  4R4I A;  3ER0 A;  4KY6 A;  4C3I H;  3GD7 A;  2N55 A;  3KYH C;  4YCV A;  4JPB W;  4C1N I;  3MA2 B;  2E5L Q;  2PQA B;  1Y8O B;  1EU4 A;  2OCE A;  2IJ0 A;  4DR7 L;  1H9S A;  1CZG A;  1I50 B;  2CVR A;  4HID A;  3S1N B;  2A5H A;  2OXP A;  2R7D A;  4IPH A;  5FJ8 G;  1EY6 A;  1EOT A;  4N9T A;  5M5W B;  1ET9 A;  3BDC A;  4A3C G;  4GLX A;  1OXU A;  3ULL A;  5T1I A;  4ABN A;  4K0K L;  1DYQ A;  2B63 H;  3PO2 B;  1D8L A;  4HCE A;  1LUZ A;  1U0L A;  4NKL A;  2GN5 A;  4B9W A;  4U67 3;  1VQ9 A;  4K5X A;  4A3G G;  1NUC A;  2NZO A;  2BH2 A;  1WD0 A;  2TSS A;  5JPM C;  4XQJ A;  1PH1 A;  1DM0 B;  4BBS B;  1T5X D;  1QG7 A;  1ROD A;  4DPG A;  2KQ3 A;  3TBI B;  2CKZ B;  2R93 B;  3F2D A;  2KJX A;  1YNJ D;  1X3E A;  4OWX B;  3K5M A;  4DUY L;  1HNX L;  2OWO A;  1VQ7 A;  3E3X A;  3F2C A;  2IX1 A;  1QUQ A;  2NB0 A;  2UU9 L;  4R1J A;  5EKI A;  3I4M G;  3TS0 A;  4OO1 H;  1T9H A;  5IP9 G;  4DR3 Q;  1JJC B;  2BE5 C;  4JVZ A;  5C4H A;  3J7Y W;  3NUC A;  2Q2U A;  4A3G B;  2EYL A;  1AE2 A;  1TXY A;  2NBF A;  2OQ0 A;  3ERQ A;  1N32 L;  3ND9 A;  4GN4 B;  5JEA J;  2HHH L;  2NZ1 D;  1IBL Q;  4DR4 L;  3G48 A;  1HNW Q;  3FKI G;  4PMB A;  5CC4 A;  2A73 B;  1VQE A;  1LTI D;  1SAP A;  1TWF H;  3A8J E;  1SE2 A;  1X65 A;  4KN7 C;  1Q1B A;  5D65 A;  1IL8 A;  1ESF A;  4JI1 L;  2WB1 B;  1KAB A;  3TME A;  4ALP A;  4DV3 Q;  1O7I A;  3FPP A;  2EJM A;  1JWM D;  3AU7 A;  1ASZ A;  1B3A A;  1PRT F;  1STH A;  3MXN A;  3H3V C;  1EZ8 A;  2MGS A;  3GV6 A;  2F0K A;  4MZ9 A;  1G8Z D;  1ENC A;  2M9V A;  2ZTC A;  4J8Q A;  3I4N H;  2CW0 C;  5BR8 L;  3I56 A;  5GRO A;  2BE5 D;  1IKM A;  1SMY C;  3VYU A;  1GXD C;  4RGM A;  3S1M B;  2Z4I A;  3MEH A;  5LHY 1;  4O0A A;  2E2H H;  4B3T L;  2JA7 B;  4C56 C;  5C3E G;  2WV6 D;  4FF2 A;  1NSN S;  1B8A A;  1EYC A;  3W2D A;  3E0E A;  4K8J A;  1EQV A;  1NE3 A;  4G7H C;  5C4J B;  2A74 C;  3D6C A;  3V05 A;  4PV1 C;  1L1O B;  5BN4 A;  2PPB C;  3I4O A;  3OWE B;  4GNX A;  5E3F A;  3RZD B;  4XXE A;  3K0X A;  3J81 E;  2H5X A;  4KK7 A;  2A68 C;  2ATW A;  2JA8 B;  3J7A F;  4RFB A;  1HTL D;  2BDN A;  1NNX A;  1L0Y B;  1A6X A;  2JP1 A;  1O7L A;  4HTH A;  5FLM G;  2UXC L;  1EFI D;  3HRZ C;  4IPD A;  5EKL A;  3M3Y B;  5JJI A;  1IYV A;  4Q0F A;  1CKN A;  1UEB A;  2CW0 D;  1SFO B;  5ELD A;  2EXD A;  2JA6 H;  1SMY D;  2Z6K A;  4ZUI A;  1BCP C;  3F2U A;  4B3S Q;  3DM3 A;  3AMU A;  1IBM Q;  3GTG H;  3M4O B;  3SR1 A;  2B63 B;  2D0P A;  4JG2 A;  4PQX A;  5I9O A;  4EX5 A;  4AYB G;  1Y14 B;  3KBG A;  1N34 L;  3MXG A;  1X9N A;  3E5S A;  1SNP A;  1A3U A;  1V8Q A;  1YVC A;  3HG9 A;  2BOS A;  2Q2H A;  3OMC A;  4IFD H;  1E3P A;  1XMQ Q;  4B3M Q;  2A68 D;  1BBU A;  2EYH A;  2D62 A;  4JC0 A;  4K5W A;  3KLS X;  4X3K A;  1PFM A;  1SSO A;  2WAQ G;  2J7Z A;  4DK3 C;  2K5D A;  3QWN A;  4A3L H;  2B2U C;  2DNC A;  4A3M H;  1K8G A;  2IPK D;  4K14 A;  1D7Q A;  3OYY A;  1G29 1;  5GAG C;  3ULJ A;  4AYB B;  5A2Q E;  4FF4 A;  1PH9 A;  1BCP D;  2I46 A;  3BG3 A;  1I6H H;  2F0O A;  1K83 B;  3K57 A;  2M00 A;  3UDF A;  1HCZ A;  4RWS C;  2F03 A;  4NXN Q;  1SYC A;  2PNR C;  3KBX A;  1F2Z A;  2R92 G;  4G7Z C;  2WP8 J;  1HTP A;  4RH6 A;  1WVL A;  2F0U A;  2QEX A;  3GTO B;  4LF6 Q;  3STB C;  4V19 0;  3NWS A;  1D1I A;  1Y8N B;  4ME5 A;  1SR3 A;  2L11 A;  2KEN A;  4CHT B;  4KV6 A;  4LF5 Q;  2L0C A;  1STY A;  2EYM A;  2ZXO A;  1BQQ T;  3EBE A;  1X6O A;  4GKK L;  3S15 B;  2QA4 A;  1EUJ A;  4MTK A;  1K3B C;  3C46 A;  2C5C A;  4P2C B;  3I4N B;  1B70 B;  2CQA A;  2EDG A;  4X66 L;  5G3L D;  2O5I C;  1B9M A;  4APV A;  3HOZ H;  3KJO A;  3TDQ A;  3S17 B;  1SBB B;  1Y1W H;  4A3B H;  1YI2 A;  1C9O A;  3GTK H;  1PLF A;  4NMZ A;  3I91 A;  3JAM L;  2YYZ A;  2B2W A;  4IUN A;  2VQE Q;  4LFA L;  2VB3 X;  2K5N A;  1PH2 A;  2Z6B A;  3J80 i;  3AEV A;  3SGI A;  2F3V A;  4DV6 L;  1Z6H A;  3PUW A;  3PO3 H;  1RTN A;  5IY0 A;  3STB D;  4KHP L;  3NK9 A;  2ZXP A;  4LF9 L;  2Q2I A;  5M9O A;  4YIJ A;  1Y1V G;  4PZ8 A;  3E0J A;  4J15 A;  2VUM H;  2A6H C;  1DGS A;  2HCC A;  3BDL A;  4OIK A;  2F4V Q;  3HOV G;  1X54 A;  2R7Z H;  5COR A;  4TSS A;  3CCJ A;  1VQH A;  3MFG A;  5CV8 A;  3CCS A;  4JI4 Q;  4B9X A;  1E2V A;  2K5H A;  3HEJ A;  4X3T A;  5EPJ A;  2RF4 A;  2KEE A;  3M9B A;  4POF A;  1EL0 A;  1GOZ A;  3GTG B;  4JI3 L;  5IT9 E;  1GHK A;  3VDY A;  3W1G A;  1OXX K;  1EZ6 A;  1VQ4 A;  1YJN A;  1IHZ A;  2F0Q A;  2J0T D;  1Y1V B;  2SDF A;  2YTY A;  1PTO H;  3D8G A;  4IFD J;  1ZEQ X;  4EQ5 A;  4JBW A;  2RVL A;  2ZT9 C;  3KF8 A;  3MTS A;  1Q82 C;  1Z47 A;  4GN3 B;  5DEH A;  2KCN A;  2ZJQ A;  2AQ3 B;  2WB1 E;  2A6H D;  3QG1 A;  2PZT A;  4A3I G;  1JJG A;  1JOO A;  3R2T A;  2IL8 A;  2K33 A;  5JJK A;  5HGT A;  4DV4 Q;  2F0L A;  1MIU A;  2GVB A;  3H0G G;  3MZ5 A;  5M3F B;  1GUS A;  1PZK D;  5IOC A;  4HMJ A;  3AFQ A;  1BF4 A;  3HFZ B;  3PF5 A;  4JI5 L;  5FLX L;  1E22 A;  2SEB D;  3D31 A;  4Y7N H;  3ICE A;  1IW7 C;  2PMZ B;  4I65 A;  3R8B A;  2MHV A;  2C9O A;  3AFP A;  1VQJ A;  3HGB A;  4HJ7 A;  4XT1 B;  2Z8L A;  2N78 A;  4OWT B;  3TN2 A;  1QVF A;  4LFB Q;  1TWA H;  1HQM C;  3NPP A;  4A3I B;  2AWN A;  1V9P A;  1SJE D;  4X62 Q;  1C8C A;  1BVS A;  4PZ7 A;  2AQ2 B;  1FYC A;  1CA6 A;  1ZKO A;  1CSP A;  1G2S A;  1SXT A;  3H0G B;  4JV5 Q;  1EWC A;  1V43 A;  1EWI A;  1HFG A;  4FF1 A;  3M7G A;  3GTJ H;  1PXU A;  4N8X 1;  4QIW B;  1RJT A;  1CSQ A;  4WJW A;  1H9K A;  3CCU A;  5LMN L;  4ZUJ A;  4G4K A;  3SVM A;  4YY3 Q;  4R8I A;  4WRD A;  5BN5 A;  2B2T C;  3S1Q B;  2PNH A;  3SEB A;  4KY7 A;  1IW7 D;  4DUZ L;  3VR2 A;  2DNE A;  4EQP A;  4IUQ A;  1JB3 A;  3CQZ B;  5JAV A;  4JI0 Q;  5C5M A;  2ZJR A;  5M3M H;  4RAU C;  3H3V I;  3FVQ A;  1V1O A;  4KKT A;  3DWP A;  4FO2 A;  4KLK A;  4DV2 L;  3PO3 B;  2I5L X;  3I3C A;  1KL9 A;  1K8M A;  1GKH A;  3UE0 A;  3GTL H;  4PNY A;  2MFI A;  1BUV T;  1OXT A;  4KI0 A;  3M4Q A;  2QW7 A;  5EBD A;  1FJG L;  2VUM B;  2L5T A;  3N52 A;  3U58 A;  3A54 A;  3VR5 A;  4DR1 L;  1PTO F;  3Q23 A;  2XNA C;  1FVI A;  4EVO A;  5IWA L;  5J39 A;  2B2V A;  5EGT A;  3S14 H;  2E74 C;  4A3J G;  3TP6 A;  1N33 L;  4AYB E;  3S16 H;  3URY A;  5I2Y A;  5GAD C;  3C3L A;  2WKD A;  1R4Q B;  5DM6 3;  2BA1 A;  1H9M A;  5IYB H;  4DV0 L;  1BDO A;  1LTS D;  5C4X G;  2I5M X;  3QOJ A;  3TQY A;  2NVY B;  4A3K H;  1XYI A;  1BKB A;  4X6A H;  1WOC A;  2WAQ E;  2UUA L;  1LTL A;  3JAM c;  1LT5 D;  2EVB A;  2PQE A;  3MEF A;  3OOC A;  4A3J B;  1AW7 A;  3J81 i;  1D1K A;  5HY6 A;  1Q46 A;  2NWG A;  4ME3 A;  3HOU G;  3DWA A;  1L0W A;  3EJI A;  2K28 A;  1Y69 U;  4C1N K;  2SOB A;  1A2U A;  5C4X B;  3CAM A;  3UDX A;  2PI2 A;  3VR6 A;  4NDX A;  2MNA A;  2IY5 B;  4OON A;  2RQX A;  4F87 A;  1L2F A;  1PDQ A;  1TS4 A;  2CFM A;  3MXP A;  1HZ9 A;  2K1B A;  1QJO A;  3IRB A;  3O13 A;  3BZD B;  2JA5 B;  1ET6 A;  2JXM B;  4JI2 Q;  3U4V A;  1JJ2 A;  1UE1 A;  5COY A;  1STE A;  1IYJ B;  2IW3 A;  4JI7 L;  2A1A A;  2UXD L;  3G4S A;  2FJ2 A;  3NSW A;  1JIC A;  4LUZ A;  2VXW A;  1KNE A;  4IJL A;  2XVS A;  2ZTD A;  2EXZ A;  5CYU A;  1LTR D;  1Q1E A;  4DR5 Q;  1TT2 A;  2KHI A;  1HA6 A;  3GTM H;  1O78 A;  5IOD A;  3RMH A;  1ILP A;  3OIQ A;  2KOL A;  1RKN A;  4A75 A;  3BVM A;  2A6E C;  4X65 Q;  1GJX A;  5CV6 A;  3X3N A;  1OO9 B;  5K36 G;  4OX9 L;  2K50 A;  1X3Q A;  1YHA A;  3DEO A;  3J80 E;  2VNU D;  2JYO A;  3U9O A;  2MQH A;  2Q8R E;  2NZH A;  3HZX A;  3FHW A;  5JEA H;  1QNK A;  1SRU A;  3R2I A;  1X3F A;  3IL8 A;  3CC2 A;  2NTS A;  4DAY A;  2E2I H;  4LFC L;  1W6J A;  5EAY A;  1W6K A;  3T53 B;  4DV7 L;  3NWT A;  3S2H B;  4P74 A;  3KF6 A;  1BBX C;  1MD2 D;  3NEN A;  1YJ9 A;  3K0Y A;  3K7A B;  2EPB A;  2X69 A;  1S5C D;  3RNU A;  4R4O A;  3HOW H;  5I6W A;  3L2P A;  3OMG A;  3BVZ A;  4C2M H;  3MWY W;  1UUP A;  2B3G A;  1ZYR D;  2QDB A;  3QOL A;  1I94 L;  3GQB A;  4E6I A;  1S5F D;  4IPC A;  3I4M H;  2A19 A;  3NBH A;  5IP9 H;  2K75 A;  2QGQ A;  5ELB A;  4B08 A;  2H1E A;  2PMZ E;  4S3S A;  3NBI A;  2DN8 A;  4R8N A;  5D3D A;  3FPU B;  2WAC A;  1TWC H;  4BY7 G;  2NVX B;  3TRZ A;  4IQZ A;  3H3V H;  4LF8 Q;  5CV9 A;  4J1M A;  3WOF A;  2K32 A;  5K5P A;  1ICW A;  3OTO L;  1XNR Q;  1L0X B;  4FXK C;  2FMM A;  2Z4H A;  5ELO A;  5A35 A;  2DY7 A;  1UE6 A;  2HQE A;  2RA4 A;  5I6Y A;  1AZQ A;  2LS0 1;  2E2J B;  4F88 A;  3SE0 A;  4BBS G;  4JBM A;  5IGC A;  2HUG A;  4QIW E;  4OIJ A;  4QL5 A;  3ND8 A;  1XPO A;  2FFK B;  4XYO A;  2RBM A;  2X6G A;  1QWY A;  2R93 G;  1PV4 A;  2FMC A;  3KOJ A;  1WTH A;  3OHX C;  4WJ4 A;  5E7N A;  1GUG A;  4BY7 B;  5FKA C;  2AQ1 B;  4OWW B;  1EY8 A;  2FIN B;  1WCM H;  4GKJ L;  1NMG A;  1S5B D;  1QNU A;  4XDX A;  4XT3 B;  4NW2 A;  1I4P A;  5E4X A;  2J4X A;  3T4A C;  1HA5 A;  4QUF A;  3CRL C;  1EQT A;  3K59 A;  1GUW A;  3C1E A;  3I90 A;  5J3B A;  4I7Z C;  1TS3 A;  1Y8P B;  1LT3 D;  1D5X C;  2SNS A;  2B2U A;  5IYD H;  1NMF A;  5E4W C;  3V2T A;  2WII B;  4CDE C;  5FK9 C;  1TY2 A;  1Q81 C;  2XIW A;  1S5E D;  2VW9 A;  2NTT A;  3TSS A;  4JW0 A;  4A3F B;  3HOX B;  3ERO A;  1EEF D;  4DV5 L;  4DFA A;  4IUP A;  2WB1 G;  2E75 C;  1YHB A;  3HKZ G;  1Q8I A;  4ZKC B;  1VQC A;  3Q6S A;  4LNQ A;  2F1M A;  1VQG A;  1NR2 A;  3H94 A;  4QGU A;  1GUN A;  2K4K A;  1LTA D;  1VQM A;  3J81 L;  1A8V A;  1P16 A;  2DUD A;  2XWJ B;  4KHV A;  3ONA B;  4DR7 Q;  2F3W A;  3OW7 A;  4JCV E;  3FMC A;  3KDF A;  2KHS A;  3V96 A;  5KNC A;  1Q8K A;  3CME A;  1KIX A;  1GVP A;  2NVQ B;  2JA7 G;  2CH4 A;  5C6A A;  4C3J B;  1A15 A;  4LF4 L;  3J7A V;  3E9H A;  4K0K Q;  2KA7 A;  5C44 B;  3PIO 3;  3HKZ B;  4M8A A;  3H15 A;  2L15 A;  1OTC A;  3I2Z A;  1ILQ A;  1VCI A;  1D6E C;  4C3I G;  1CT1 D;  3I73 A;  4A3D H;  2JA8 G;  2E76 C;  1PRT C;  2RHS B;  2L4N A;  4L6T B;  1SYG A;  3VYT A;  4J6H A;  1L1O C;  3NEL A;  4B3S L;  1X56 A;  1EY0 A;  1IBM L;  4RKB A;  3K7U C;  2PCF B;  1CHP D;  2VZA A;  3G71 A;  1SYE A;  4H0L C;  5M5Y H;  5IP7 G;  4POG A;  3PMF A;  1HNX Q;  3IFD A;  1PRT B;  3L3O C;  3CU7 A;  4O42 A;  1DJR D;  3BYY B;  2ES2 A;  2EJF C;  2UU9 Q;  4JI6 L;  2ID0 A;  3HOY B;  2B63 G;  1E0B A;  2RSO A;  4FXG C;  3NTK A;  3IKJ A;  4C3I B;  1XMQ L;  1MKH A;  1X32 A;  3RLF A;  2ZXR A;  2EYP A;  5A2Q L;  2HHH Q;  4FDB A;  1VQF A;  1AP0 A;  1T5E A;  2SNM A;  1QOH A;  4DR4 Q;  1CI3 M;  4UP9 A;  2B29 A;  3RUZ A;  4QY7 A;  2Q8I B;  4JOI C;  1HUN A;  2PZW A;  1PHJ A;  1EIY B;  3GTP H;  5KGU A;  4JI1 Q;  5ELC A;  5KYL A;  2MPM A;  1SEB D;  4DNI A;  4ILW A;  1CTM A;  2TMP A;  3W3A A;  1K9M C;  1B53 A;  1ZXT A;  1UAP A;  2M2L A;  4QF4 A;  2HIX A;  4OO1 G;  4CBV A;  1JOR A;  5C0X I;  1BCP F;  2HDL A;  3HP3 A;  5BR8 Q;  1NBW A;  2JE6 I;  2R7F A;  5DNF A;  5NUC A;  3K81 C;  3TRE A;  3CPF A;  3A8K E;  2R3Z A;  4XYQ A;  1EWH A;  1V1P A;  3EIV A;  4R9W A;  1WD1 A;  1J5E L;  4JK1 C;  3U4Z A;  1AE3 A;  2F0I A;  3B6Y A;  5DAU A;  1VF5 C;  1EIF A;  1VQI A;  4N9P A;  4HMI A;  1H9S B;  1LV9 A;  5GAE C;  3HOV H;  3K8A A;  3J7Z C;  2HCI A;  4KJO A;  5M5X H;  1HHV A;  3S1R H;  4BBR H;  3I70 A;  5JVG 3;  2KUM A;  1WTV A;  1IBK L;  4HSP A;  2HD3 A;  2UXC Q;  4A76 A;  3SXH A;  3I4N G;  2AUK A;  4RCO A;  4BXX G;  5G3L F;  1X3G A;  3I55 A;  4P71 A;  2RDG A;  3MAQ A;  1VQN A;  1TWF B;  1WFQ A;  4DR6 L;  1HZA A;  2F0P A;  3CPW A;  2ZM6 L;  3SK8 A;  3PUX A;  4DR2 L;  1VQP A;  1KD1 C; 
#chains in the Genus database with same CATH homology
 3MHB A;  3CRK C;  3MVV A;  2EOT A;  3KUP A;  5IT9 L;  1NCV A;  5IGE A;  1R4P B;  5CR3 A;  3WOE A;  4A3D B;  3GV3 A;  2F0D A;  1MI2 A;  4UAI A;  2E2H B;  5BN3 A;  4PMW A;  2EY5 A;  1KNA A;  3DXJ C;  2PZU A;  2LFN A;  4IAL A;  1AZP A;  4X3S A;  1A2T A;  1TII D;  1F2L A;  2B8F A;  1GUO A;  4IUT A;  1I4Q A;  1U4R A;  3OIP A;  4RGO S;  2XWB B;  4KTA A;  2Y0S B;  2EYF A;  4O1N A;  1YNN C;  1LAC A;  1RTO A;  5EPK A;  2EY1 A;  4Q5V A;  3SK5 A;  1TY0 A;  3IAY A;  3KLR A;  5C5L A;  4RHS A;  4DA2 A;  2JA6 B;  3GTP B;  5F2D A;  3D4W A;  5CV7 A;  1F2Y A;  1LO5 D;  3T51 B;  4ZLT F;  3K5N A;  5ELF A;  1C4Q A;  1JOK A;  4G7O C;  2D2C C;  5FO8 B;  4FXD A;  4RGN A;  3T56 B;  1DOL A;  3SK4 A;  1GUT A;  1H9J A;  1MBY A;  3NE5 B;  4CJ0 B;  3VA7 A;  5C3W A;  4A3M B;  1SNO A;  1QE6 A;  5EJW A;  4K6D A;  4ZKB B;  1I6H B;  3D6W A;  4DAP A;  5M5X B;  4FNF A;  2KEC A;  1F9S A;  1DZ1 A;  3H6M A;  3SDZ A;  4RHR A;  4UDU C;  2D5D A;  4DGZ A;  3M7N A;  5KIX A;  5CMD A;  1VMP A;  4LAA A;  1I4H A;  1K8O A;  5C0X H;  2F0F A;  4KMU C;  5JOB A;  3K6O A;  3VR3 A;  3I4L A;  4OL7 A;  3HOZ B;  3DWQ A;  4A3B B;  2V4D A;  1Y1W B;  1II3 A;  3GTK B;  2Z1C A;  1B2T A;  3D3R A;  5KRU A;  2RDF A;  1VDZ A;  3ITP A;  2KED A;  2Q8T A;  2R6G A;  3BYT B;  1JOQ A;  1E2W A;  1CHQ D;  1FD7 D;  3NQT A;  4LJZ C;  5IIF A;  5D3I B;  2R7Z B;  2K01 A;  1CZW A;  3UI2 A;  2PO4 A;  3P20 A;  1PTO C;  1U4M A;  1U4P A;  4RA8 A;  2K03 A;  2MJ8 A;  1WTR A;  1F9R A;  1JR0 D;  1J9O A;  2X6L A;  1PTO B;  2XN9 C;  2PW5 A;  2YU9 B;  4ID6 A;  3N6R A;  1WTX A;  2B2Y C;  2F0T A;  3RD4 A;  1HRJ A;  3DUZ A;  2JEA I;  2NYZ D;  1SNM A;  4H13 C;  3T16 A;  2G9D A;  1AN8 A;  3A56 A;  5IGD A;  3SHL A;  4K5V A;  5KND A;  1SDF A;  2JSO A;  1F77 A;  1S4Z A;  4RKL A;  3J80 L;  1D5M C;  4DNT B;  3MFY A;  1AEX A;  4Y7N B;  1I4G A;  1FNU A;  4KJN A;  3P75 A;  1QIL A;  1WTP A;  2IT1 A;  1STN A;  4IZ8 A;  5FOB B;  4HN7 A;  1TWA B;  1Z7T A;  1BR9 A;  4ZRZ A;  1SND A;  5C0X J;  5TSS A;  2QF7 A;  4XTC S;  2GA4 B;  5ISR A;  4H44 C;  2F0G A;  1EU3 A;  3D4R A;  3GTJ B;  1NR4 A;  5LL6 X;  1DOM A;  1NAP A;  4IUV A;  1PFB A;  1R9T B;  1WTO A;  3GO5 A;  4BA1 I;  2EJG C;  2LKV A;  3NP8 A;  1MGS A;  1F2M A;  5M3M B;  3H91 A;  2LY7 A;  2A69 C;  1SE4 A;  3NXW A;  3PUY A;  1B1Z A;  5ELE A;  1O7Z A;  4EQN A;  1MSG A;  4A93 B;  1XX8 A;  4C3H B;  4KD3 A;  3GTL B;  1TKW B;  1SNQ A;  4X3U A;  2NN6 G;  4TKO B;  1DCZ A;  1BXT A;  1G6Z A;  3S14 B;  1Q3L A;  1HFN A;  3Q0A A;  3S16 B;  1I6V C;  1LLR D;  2A6E D;  2OEO A;  4DXG A;  4CKE A;  2A69 D;  4A3K B;  1KLU D;  4ZAI A;  1D5Z C;  1WTQ A;  3EFX D;  4TQU S;  3GP7 A;  4BA2 I;  1QCB D;  2F0N A;  3EA6 A;  5IGF A;  4CKB A;  2EYJ A;  5CBA E;  2K5W A;  4K2L A;  4ZK9 B;  1ENA A;  3PV0 A;  3IFT A;  2O2L D;  1YNJ C;  2RKS A;  3BS1 A;  1EYA A;  3OPO A;  1JQY D;  2N88 A;  2B8G A;  1PMR A;  1PYW D;  4L8J A;  3P7J A;  1JE4 A;  1JC7 A;  4BWG B;  5JEA G;  1Q12 A;  2B39 A;  5EQ0 A;  3X3M A;  5I9P A;  1LT6 D;  3PIP 3;  4C3J G;  3GTM B;  1F9Q A;  3G7L A;  2EY2 A;  5J1Z A;  2VB2 X;  5KEE A;  2IX3 A;  2RDH A;  4XQQ A;  3Q24 A;  5IGB A;  2EY6 A;  1SJH D;  5EPL A;  2IWH A;  4LK1 C;  1FGB D;  5CV4 A;  4RCN A;  1SYB A;  1X3P A;  5I2X A;  2E2I B;  4U68 A;  3T13 A;  1EYD A;  1EY4 A;  3QO2 A;  2F0M A;  3VR4 A;  2I07 B;  1MSH A;  3R3O A;  2QIL A;  3HOW B;  3PUZ A;  4LMQ D;  4C2M B;  1CA5 A;  1TVX A;  3I4M B;  2F0S A;  5J22 A;  1GHJ A;  2QEJ C;  1DOK A;  4MHE A;  1TWC B;  5HUR A;  1EEI D;  5LL6 S;  3FKI B;  3U9S A;  4HED A;  4Z9C B;  2WIN B;  1VMC A;  1TS5 A;  1U4L A;  4L63 B;  2XSC A;  4K8I A;  1KLG D;  1PRT D;  2R61 A;  1TR5 A;  3I72 A;  2O5J C;  1FNW A;  4BS9 A;  1RDP D;  3C1F A;  2PW7 A;  1WCM B;  1C48 A;  5C3E B;  1EY5 A;  1UNS A;  2F0W A;  3FDT A;  2O4X A;  2ENB A;  5FO9 B;  2DY8 A;  2AUJ D;  1Q90 A;  4ODG A;  3ZYY X;  2G9H D;  4TRD A;  5CBE E;  2K7V A;  3P1H A;  3MC0 B;  1BCP B;  4EGV A;  3A8I E;  1STG A;  1FNV A;  2BDO A;  1OXV A;  1TU2 B;  1EY9 A;  1EIG A;  3TP8 A;  1B44 D;  1HQR D;  2ICE C;  4G57 A;  3K5L A;  4HCS A;  1A3V A;  3TP5 A;  1BNZ A;  4KD4 A;  1O80 A;  4IUR A;  1JWU D;  5C4Z A;  4XQN A;  4DU9 A;  3H09 A;  3EQL C;  1JWS D;  2WAQ B;  2B2T A;  3VYR A;  1EY7 A;  4H7B A;  3VA5 A;  1J8I A;  2OT2 A;  2L55 A;  3A7L A;  1I4X A;  4DAV A;  1HXY D;  5M5Y B;  3TZU A;  3WDN A;  4DNR B;  5I4D A;  4DN4 M;  2R92 B;  2NN6 I;  1B9N A;  1XXG A;  2EZV A;  4ZYS A;  1QB5 D;  4CKC A;  3DEP A;  4IFD G;  2K04 A;  1ONL A;  3MXU A;  3D4D A;  1KTK A;  2BA0 A;  4QMG A;  3FRP B;  4CJ2 C;  3CHB D;  1D2B A;  1LTG D;  3E6Z X;  4M1U B;  1M8A A;  2B2Y A;  4CJ1 B;  1O7Y A;  4FP5 D;  3GTQ B;  1KDB A;  1ML0 D;  1M4V A;  1U9R A;  5CV5 A;  1ENF A;  4WOR A;  1SYF A;  4HAE A;  3M4Y A;  1HUM A;  4K2K A;  1YNN D;  1EIH A;  4QB4 A;  1BOS A;  3DMU A;  2PYK A;  5D14 A;  3HOV B;  2EYO A;  3JAM E;  3QJY A;  2BCO A;  2K5Q A;  2LMC B;  4QUC A;  1LT4 D;  3S1R B;  4BBR B;  4MN3 A;  5C3X A;  3KK7 A;  3S9W A;  2F4I A;  3BDO A;  4CGY B;  2L1B A;  2NUC A;  1IYU A;  1H9R A;  2K05 A;  1S5D D;  1TQO A;  1V1P B;  4DXF A;  4MIU A;  2WKC A;  3LWU A;  1AFP A;  3LX0 A;  1SE3 A;  5JPN C;  5FO7 B;  1LTB D;  4IN3 A;  3TP7 A;  4EQO A;  5DM7 3;  1DON A;  1STA A;  3LNN A;  1I3Q B;  1WTW A;  3TZD A;  1LAB A;  3S2D B;  2MP1 A;  3QB3 A;  4KY5 A;  1XTC D;  3EVQ A;  4V0B A;  3L9A X;  1KDC A;  2L12 A;  3DHQ A;  4DK0 A;  3QIA A;  2JEB I;  5FLX E;  1LTT D;  2B2W C;  5KNB A;  5JJZ A;  5E1F A;  1G2T A;  1ESR A;  4GZY C;  1OXS C;  4ZQ3 A;  2QKI C;  1TWH B;  1TWG B;  2RSN A;  1KAA A;  4NP5 A;  2KVM A;  2EE1 A;  5K36 H;  1RHP A;  3NTI A;  1RCV D;  1UEA B;  3CKI B;  1KDA A;  2ICI A;  1F9P A;  1RD9 D;  3PUV A;  1A3T A;  2OF1 A;  3I8Z A;  4RGT A;  3SK6 A;  2NN6 H;  2L9H A;  1PTO D;  5T1G A;  3AB9 A;  1CK1 A;  5C0X G;  4F7X A;  2CHB D;  2F0J A;  4OO1 I;  4A3E B;  2F0H A;  2MUY A;  5EKK A;  3K58 A;  1DXM A;  5EBC A;  3RZO B;  1BO0 A;  4DF7 A;  3LWE A;  2F0E A;  3Q22 A;  2F0V A;  4QCL A;  1CQF A;  3VYS A;  3KLS A;  2AWO A;  2HDM A;  4HSV A;  4C3H G;  3HOU B;  1JCK B;  1IKL A;  3R93 A;  1PFN A;  1STB A;  4ULL A;  3OSO A;  5KYI A;  4KKU A;  1RF2 D;  1B50 A;  4FYD A;  1CFM A;  5AFW A;  3A7A B;  5IGG A;  2E2D C;  1CQV A;  4OGQ C;  1PZJ D;  2IX0 A;  4KKS A;  3OWF A;  2D9U A;  1ZYR C;  2QCP X;  1FR3 A;  4KN4 C;  3NHH A;  1B4O A;  4IUU A;  1TS2 A;  2XRS D;  1HPC A;  4OHJ A;  4BY1 B;  3A55 A;  1I4R A;  3NTH A;  3M85 A;  2K6A A;  3G6J B;  3C2P A;  3K5O A;  2XRQ D;  4FVM A;  3HS0 C;  2H4O A;  4WFN 3;  2FHT A;  4F8M A;  3DM1 A;  1G91 A;  4PMC A;  3FEW X;  2NVT B;  4HR7 B;  1DD2 A;  2B2V C;  4K6L A;  1SYD A;  4IFD I;  3BVG A;  1XWE A;  3NQI A;  3L7Z C;  5CGK A;  1PZI D;  1CM9 A;  4FF3 A;  1SNC A;  4XIG S;  4DK1 A;  1E2Z A;  1VF7 A;  4KHZ A;  2KCC A;  5JVH 3;  4KY6 A;  3GD7 A;  2N55 A;  4C1N I;  3MA2 B;  1Y8O B;  1EU4 A;  2IJ0 A;  1H9S A;  1CZG A;  1I50 B;  2CVR A;  3S1N B;  2A5H A;  2OXP A;  1EY6 A;  1EOT A;  4N9T A;  5M5W B;  1ET9 A;  3BDC A;  1OXU A;  5T1I A;  4ABN A;  1DYQ A;  3PO2 B;  4HCE A;  4NKL A;  4B9W A;  4U67 3;  4K5X A;  1NUC A;  1WD0 A;  2TSS A;  5JPM C;  4XQJ A;  1DM0 B;  4BBS B;  1T5X D;  1QG7 A;  1ROD A;  2KQ3 A;  3TBI B;  2R93 B;  2KJX A;  1YNJ D;  3K5M A;  2IX1 A;  2NB0 A;  5EKI A;  4OO1 H;  2BE5 C;  5C4H A;  3J7Y W;  3NUC A;  4A3G B;  2EYL A;  2NBF A;  3ERQ A;  3ND9 A;  5JEA J;  2NZ1 D;  4PMB A;  5CC4 A;  2A73 B;  1LTI D;  1SAP A;  3A8J E;  1SE2 A;  4KN7 C;  1Q1B A;  5D65 A;  1IL8 A;  1ESF A;  2WB1 B;  1KAB A;  3TME A;  3FPP A;  2EJM A;  1JWM D;  3AU7 A;  1B3A A;  1PRT F;  1STH A;  3MXN A;  3H3V C;  1EZ8 A;  2MGS A;  3GV6 A;  2F0K A;  1G8Z D;  1ENC A;  2M9V A;  4J8Q A;  2CW0 C;  2BE5 D;  1IKM A;  1SMY C;  3VYU A;  1GXD C;  4RGM A;  3S1M B;  2Z4I A;  3MEH A;  5LHY 1;  2JA7 B;  4C56 C;  2WV6 D;  4FF2 A;  1NSN S;  1EYC A;  3W2D A;  4K8J A;  1EQV A;  4G7H C;  5C4J B;  2A74 C;  3D6C A;  3V05 A;  4PV1 C;  5BN4 A;  2PPB C;  3OWE B;  5E3F A;  3RZD B;  4XXE A;  3J81 E;  4KK7 A;  2A68 C;  2JA8 B;  3J7A F;  4RFB A;  1HTL D;  2BDN A;  1L0Y B;  1A6X A;  2JP1 A;  1O7L A;  4HTH A;  1EFI D;  3HRZ C;  5EKL A;  3M3Y B;  1IYV A;  4Q0F A;  2CW0 D;  1SFO B;  5ELD A;  1SMY D;  4ZUI A;  1BCP C;  3F2U A;  3AMU A;  3M4O B;  3SR1 A;  2B63 B;  4PQX A;  5I9O A;  3KBG A;  3MXG A;  3E5S A;  1SNP A;  1A3U A;  1V8Q A;  3HG9 A;  2BOS A;  3OMC A;  4IFD H;  2A68 D;  2EYH A;  2D62 A;  4K5W A;  3KLS X;  4X3K A;  1PFM A;  1SSO A;  2J7Z A;  2K5D A;  3QWN A;  2B2U C;  2DNC A;  2IPK D;  4K14 A;  1G29 1;  4AYB B;  5A2Q E;  4FF4 A;  1BCP D;  2I46 A;  3BG3 A;  2F0O A;  1K83 B;  3K57 A;  2M00 A;  1HCZ A;  4RWS C;  2F03 A;  1SYC A;  2PNR C;  3KBX A;  1F2Z A;  4G7Z C;  2WP8 J;  1HTP A;  4RH6 A;  1WVL A;  2F0U A;  3GTO B;  4V19 0;  3NWS A;  1D1I A;  1Y8N B;  4ME5 A;  2L11 A;  4CHT B;  4KV6 A;  2L0C A;  1STY A;  2EYM A;  2ZXO A;  1BQQ T;  3S15 B;  3C46 A;  2C5C A;  4P2C B;  3I4N B;  2CQA A;  2EDG A;  5G3L D;  2O5I C;  1B9M A;  3TDQ A;  3S17 B;  1SBB B;  1PLF A;  4NMZ A;  3I91 A;  3JAM L;  2YYZ A;  2B2W A;  4IUN A;  2VB3 X;  2F3V A;  1Z6H A;  3PUW A;  1RTN A;  3NK9 A;  2ZXP A;  5M9O A;  4YIJ A;  3E0J A;  2A6H C;  2HCC A;  3BDL A;  4OIK A;  5COR A;  4TSS A;  3MFG A;  5CV8 A;  4B9X A;  1E2V A;  3HEJ A;  4X3T A;  5EPJ A;  2KEE A;  1EL0 A;  1GOZ A;  3GTG B;  5IT9 E;  1GHK A;  1OXX K;  1EZ6 A;  1IHZ A;  2F0Q A;  2J0T D;  1Y1V B;  2SDF A;  4IFD J;  1PTO H;  3D8G A;  1ZEQ X;  4JBW A;  2RVL A;  2ZT9 C;  3KF8 A;  3MTS A;  1Z47 A;  5DEH A;  2KCN A;  2AQ3 B;  2A6H D;  3QG1 A;  2PZT A;  1JOO A;  3R2T A;  2IL8 A;  2K33 A;  5HGT A;  2F0L A;  3MZ5 A;  5M3F B;  1GUS A;  1PZK D;  5IOC A;  4HMJ A;  1BF4 A;  5FLX L;  3D31 A;  2SEB D;  1IW7 C;  2PMZ B;  4I65 A;  3R8B A;  2MHV A;  2C9O A;  3HGB A;  4XT1 B;  2Z8L A;  3TN2 A;  1HQM C;  3NPP A;  4A3I B;  2AWN A;  1SJE D;  1C8C A;  2AQ2 B;  1FYC A;  1CA6 A;  1ZKO A;  1G2S A;  3H0G B;  1SXT A;  1EWC A;  1V43 A;  1HFG A;  4FF1 A;  3M7G A;  1PXU A;  4QIW B;  1RJT A;  4WJW A;  1H9K A;  4ZUJ A;  4G4K A;  3SVM A;  4R8I A;  4WRD A;  5BN5 A;  2B2T C;  3S1Q B;  3SEB A;  4KY7 A;  1IW7 D;  3VR2 A;  2DNE A;  4EQP A;  4IUQ A;  1JB3 A;  3CQZ B;  5JAV A;  5C5M A;  4RAU C;  3FVQ A;  1V1O A;  4KKT A;  3DWP A;  4FO2 A;  3PO3 B;  3I3C A;  1K8M A;  4PNY A;  1BUV T;  1OXT A;  4KI0 A;  5EBD A;  2VUM B;  2L5T A;  3N52 A;  3A54 A;  3VR5 A;  1PTO F;  3Q23 A;  2XNA C;  4EVO A;  5J39 A;  2B2V A;  5EGT A;  2E74 C;  3TP6 A;  3URY A;  5I2Y A;  3C3L A;  2WKD A;  1R4Q B;  5DM6 3;  2BA1 A;  1H9M A;  1BDO A;  1LTS D;  3QOJ A;  2NVY B;  1XYI A;  1LT5 D;  2EVB A;  2PQE A;  3OOC A;  4A3J B;  1AW7 A;  1D1K A;  2NWG A;  3DWA A;  3EJI A;  2K28 A;  1Y69 U;  4C1N K;  2SOB A;  1A2U A;  5C4X B;  3VR6 A;  4NDX A;  2RQX A;  4F87 A;  1PDQ A;  1TS4 A;  3MXP A;  2K1B A;  1QJO A;  3O13 A;  3BZD B;  2JA5 B;  1ET6 A;  2JXM B;  5COY A;  1STE A;  2IW3 A;  2FJ2 A;  3NSW A;  1JIC A;  2VXW A;  1KNE A;  2XVS A;  2EXZ A;  5CYU A;  1LTR D;  1Q1E A;  1TT2 A;  1HA6 A;  1O78 A;  5IOD A;  3RMH A;  1ILP A;  3OIQ A;  2KOL A;  1RKN A;  3BVM A;  2A6E C;  1GJX A;  5CV6 A;  3X3N A;  1OO9 B;  5K36 G;  1X3Q A;  3J80 E;  3DEO A;  2VNU D;  2JYO A;  3U9O A;  2Q8R E;  3HZX A;  5JEA H;  1QNK A;  3R2I A;  3IL8 A;  2NTS A;  4DAY A;  1W6J A;  1W6K A;  3T53 B;  3NWT A;  3S2H B;  1BBX C;  1MD2 D;  3K0Y A;  3K7A B;  2EPB A;  2X69 A;  1S5C D;  5I6W A;  3OMG A;  3BVZ A;  3MWY W;  1UUP A;  1ZYR D;  2QDB A;  3QOL A;  3GQB A;  4E6I A;  1S5F D;  3NBH A;  5ELB A;  4B08 A;  2H1E A;  4S3S A;  3NBI A;  2DN8 A;  4R8N A;  5D3D A;  3FPU B;  2WAC A;  2NVX B;  4IQZ A;  5CV9 A;  4J1M A;  3WOF A;  2K32 A;  5K5P A;  1ICW A;  1L0X B;  4FXK C;  2FMM A;  2Z4H A;  5A35 A;  2DY7 A;  2HQE A;  2RA4 A;  5I6Y A;  1AZQ A;  2E2J B;  2LS0 1;  4F88 A;  3SE0 A;  5IGC A;  2HUG A;  4OIJ A;  3ND8 A;  2FFK B;  4XYO A;  2RBM A;  2X6G A;  1QWY A;  2FMC A;  3OHX C;  4BY7 B;  1GUG A;  5FKA C;  2AQ1 B;  1EY8 A;  2FIN B;  1S5B D;  4XDX A;  1QNU A;  4XT3 B;  4NW2 A;  1I4P A;  5E4X A;  2J4X A;  3T4A C;  1HA5 A;  4QUF A;  3CRL C;  1EQT A;  3K59 A;  1GUW A;  3C1E A;  3I90 A;  4I7Z C;  1TS3 A;  1Y8P B;  1LT3 D;  1D5X C;  2SNS A;  2B2U A;  5E4W C;  3V2T A;  2WII B;  5FK9 C;  1TY2 A;  2XIW A;  1S5E D;  2NTT A;  3TSS A;  4A3F B;  3HOX B;  3ERO A;  1EEF D;  4DFA A;  4IUP A;  2E75 C;  1Q8I A;  4ZKC B;  3Q6S A;  2F1M A;  1NR2 A;  3H94 A;  1GUN A;  1LTA D;  3J81 L;  2XWJ B;  4KHV A;  3ONA B;  2F3W A;  3OW7 A;  3FMC A;  3V96 A;  2KHS A;  5KNC A;  2NVQ B;  5C6A A;  4C3J B;  1A15 A;  3J7A V;  2KA7 A;  5C44 B;  3PIO 3;  3HKZ B;  4M8A A;  1ILQ A;  1VCI A;  1D6E C;  4C3I G;  1CT1 D;  3I73 A;  2E76 C;  1PRT C;  2L4N A;  4L6T B;  1SYG A;  3VYT A;  4J6H A;  1EY0 A;  4RKB A;  2PCF B;  1CHP D;  1SYE A;  4H0L C;  3PMF A;  3IFD A;  1PRT B;  3L3O C;  3CU7 A;  4O42 A;  1DJR D;  3BYY B;  2EJF C;  2ID0 A;  3HOY B;  1E0B A;  2RSO A;  4FXG C;  3NTK A;  3IKJ A;  4C3I B;  3RLF A;  1X32 A;  2ZXR A;  2EYP A;  5A2Q L;  1AP0 A;  1T5E A;  2SNM A;  1QOH A;  1CI3 M;  3RUZ A;  2Q8I B;  1HUN A;  2PZW A;  5KGU A;  5ELC A;  5KYL A;  2MPM A;  1SEB D;  4ILW A;  1CTM A;  2TMP A;  3W3A A;  1B53 A;  1ZXT A;  1UAP A;  2M2L A;  4QF4 A;  4OO1 G;  4CBV A;  1JOR A;  5C0X I;  1BCP F;  2HDL A;  3HP3 A;  2JE6 I;  5DNF A;  5NUC A;  3A8K E;  2R3Z A;  4XYQ A;  1EWH A;  1V1P A;  4R9W A;  1WD1 A;  4JK1 C;  2F0I A;  5DAU A;  1VF5 C;  4N9P A;  4HMI A;  1H9S B;  1LV9 A;  2HCI A;  4KJO A;  1HHV A;  3I70 A;  5JVG 3;  2KUM A;  1WTV A;  4HSP A;  3SXH A;  2AUK A;  4RCO A;  5G3L F;  2RDG A;  3MAQ A;  1TWF B;  2F0P A;  3SK8 A;  3PUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...