5D14A

The atomic resolution crystal structure of human il-8
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
KELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-8
publication title The atomic resolution crystal structure of human IL-8
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2015-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d14A00
1C8CA 4O42A 1B53A 2MP1A 4UAIA 1NAPA 5AFWA 3N52A 1WTVA 2FINB 2J7ZA 1MGSA 4CJ2C 1WTXA 5E4XA 4HSVA 1HA6A 1U4LA 2RSOA 2B2WA 2IL8A 1IKLA 1WD1A 1X32A 4IUUA 1G2SA 3H91A 2MJ8A 2B2TC 3I91A 1DONA 3SVMA 1O7YA 3KUPA 5EQ0A 2HCIA 1JE4A 4HCSA 1EL0A 3FDTA 2FFKB 4HAEA 1G2TA 1U4PA 2L1BA 4RA8A 1M8AA 1J9OA 1XX8A 1S4ZA 2K28A 2NYZD 5CORA 1BBXC 1RHPA 5EKIA 3DEPA 5T1GA 2XIWA 2JYOA 3MTSA 1QE6A 1KNAA 2MGSA 1VMPA 1MSGA 4X3SA 1WVLA 2FMMA 2KEDA 1CM9A 4MN3A 1MSHA 1F9PA 1ILPA 1E0BA 4ZAIA 2EE1A 2M2LA 2N55A 1HRJA 4OIKA 1J8IA 4X3TA 3I3CA 1U4MA 2KVMA 1QG7A 1GUWA 1RTNA 1SAPA 2EOTA 2DY7A 3IL8A 1EIGA 1EOTA 2NWGA 1SDFA 5D14A 2BDNA 2K05A 3IFDA 3P7JA 2L4NA 3DEOA 4XT3B 2HCCA 1Q3LA 1AP0A 1MI2A 3MWYW 1O7ZA 2B2WC 2KUMA 4QUCA 1DOMA 3D6WA 2KEEA 5EPKA 3LWEA 1WTQA 1B2TA 1A15A 4IUPA 5EPLA 1PDQA 2R3ZA 1ESRA 4MHEA 1HFGA 1ICWA 2VXWA 5DNFA 3ONAB 4U68A 3Q6SA 1QNKA 2DY8A 1F9QA 1ZXTA 2N88A 5T1IA 2JP1A 1RTOA 2K1BA 2X69A 1F2LA 2SDFA 3QO2A 4IUVA 3G7LA 3FPUB 4HEDA 1HUMA 1WTOA 1WTPA 1HHVA 2B2YA 1NR4A 1PFMA 4ZKBB 2X6LA 1VMCA 2X6GA 4R9WA 4LMQD 3I8ZA 1DOLA 1IL8A 2FHTA 4XT1B 1WD0A 1AZQA 2K01A 2HDLA 1ML0D 2EPBA 3HP3A 1RJTA 4OIJA 3KBXA 4QUFA 2MPMA 1BO0A 2K04A 1O80A 5E4WC 1B50A 2B2YC 4DN4M 4ZKCB 1AZPA 1KNEA 1IKMA 4RWSC 2B2VA 1ILQA 4NW2A 1PFNA 1B4OA 1B3AA 3DM1A 1PFBA 2D9UA 2NZ1D 4CJ0B 5CBEE 1RODA 1CA5A 1U4RA 2B2UA 3TN2A 1F9SA 2H1EA 1PLFA 3GV3A 2HDMA 3I90A 4IURA 1WTWA 4XDXA 1BF4A 1DZ1A 1HFNA 1HUNA 4IUTA 2Q8TA 4CJ1B 1XYIA 4ZLTF 2KECA 2K03A 5D65A 1X3QA 5CBAE 1G91A 1X3PA 2B2VC 1BNZA 3GV6A 1F9RA 2KOLA 1EIHA 1EQTA 4X3KA 5JJZA 1WTRA 3R93A 2L11A 5COYA 5EJWA 2CVRA 1TVXA 2B2UC 1JICA 1DOKA 4IUQA 3UI2A 4R8IA 1CA6A 2RVLA 2HUGA 2RSNA 4RAUC 5EPJA 2FJ2A 5CMDA 1G6ZA 2B2TA 2RA4A 3F2UA 4X3UA 3TZDA 1NCVA 2L12A 2Q8RE 1LV9A 2L9HA 4ZK9B 1SSOA 1NR2A
chains in the Genus database with same CATH superfamily
1BCPF 2FMCA 4KK7A 1K9MC 1GXDC 3QOJA 5ELEA 1HTLD 4EVOA 3HOUG 1CQFA 1K0RA 3E0JA 5L37A 4C3IH 4DPGA 2JEAI 2RDHA 2WINB 4HCSA 2AKWB 2MO0A 5F2DA 2E2IH 2FFKB 4LK1C 4DXFA 3J7ZC 1MD2D 3GO5A 1E24A 4KJOA 3T1HL 4BBRH 3Q23A 2K32A 3R2IA 3PIPA 2JYOA 3MTSA 4B9WA 1PH7A 4HIKA 5I2XA 2I5LX 4A3DB 5A2QL 4KY5A 5DM73 2VW9A 4V0BA 4ZAIA 3PMFA 1HRJA 3L3OC 5JJKA 1QVFA 2OTJA 1LTAD 4DV4L 2YV5A 3IL8A 2LY7A 1VQ6A 1IW7C 1SDFA 3S1RH 2BDNA 2K05A 3K7UC 2OEOA 3GTLH 2R7ZB 1ENAA 2CQAA 3D6WA 5GAHC 2BDOA 4ZYSA 1Y1VH 3I4NB 5DEHA 1NSNS 1PDQA 1LTSD 4JK1C 2IW3A 4DV7Q 4JV5L 2XTIA 2N88A 4KD3A 1RTOA 2I07B 2SDFA 1HQMC 5IWAL 4A3EG 1HUMA 2F3WA 2ES2A 2B2YA 1NR4A 5M5XH 5LL6X 4R9WA 1TY2A 3EFXD 1O7LA 1IL8A 2OTLA 1TXYA 3HOZB 4IOAA 4N8X1 3KBXA 4K5VA 3CC4A 4JYAL 2SEBD 3K0XA 5G3LD 1B50A 2OQKA 3HKZE 4A93G 3T1HQ 1CA5A 4DV6L 2R7FA 2EYJA 4QB4A 3A8KE 4Z9CB 2YTXA 4RGMA 4O2DA 2PO4A 1ET9A 2I0QA 2OWOA 4A4IA 1JICA 2VL6A 4DV4Q 1EQQA 1N34L 2E2HH 2K5QA 3TREA 1VQ9A 2F4VL 1EY0A 1I4HA 1Y8OB 5FLMH 4RGOS 4O0AA 1L1OC 1LT5D 4HSPA 1NJIC 4EX5A 5IT9c 1QB5D 4IO9A 3Q24A 1VQ5A 3GDEA 3H91A 4HCEA 1STBA 2EQSA 3OMCA 1UE1A 3KUPA 4LF5L 4WFN3 1JE4A 4HJ5A 1TWCH 2XRSD 1NUCA 1XXGA 2F52A 1K73C 1OXXK 2HQLA 2ZTCA 2EJFC 1KRSA 1S4ZA 3RN2A 1PH2A 1J6QA 4G7ZC 1EYGA 3AB9A 1QWYA 3ULJA 3S1QB 3VR4A 5JEAH 3NWTA 4JYAQ 1CHQD 3G48A 1LYLA 2JA8G 1ZYRC 4AYBE 1G8ZD 2A19A 2YTVA 4DNTB 1QG7A 1X9NA 1I6HH 4DV6Q 3TBIB 1EOTA 3CU7A 1DXMA 1E2WA 2WB1E 4CHTB 2CWPA 1Q3LA 4C1NI 2ZTDA 2F0UA 1CFMA 1VQOA 3GD7A 3K6OA 1SYDA 5EKLA 5EPLA 2F0MA 3Q22A 1E7ZA 4L8JA 4P74A 1N34Q 3QIAA 2F4VQ 4IUNA 4LUZA 5EGTA 5T1IA 1EEFD 4B9XA 2YU9B 2NVQH 2XRQD 4YWMA 4K6DA 1FYCA 4R1JA 4QL5A 4B3SL 4N9PA 2VB2X 4LF5Q 4K5WA 4DAVA 3V96A 1ONLA 1Q1EA 1QUQB 1X54A 1AZPA 1D5XC 3PUWA 2ENBA 1LT4D 1B4OA 2BOSA 1PTOH 4HR7B 3J7AV 2KQ3A 4L63B 3TZUA 3VDYA 3U4VA 5A2QE 1I6VC 2JA7H 4LF4L 2ZXRA 1EY9A 1QJOA 5COYA 2B2UC 2ID0A 1AH9A 4JG2A 2R7DA 2FJ2A 1Q7YC 4BS9A 4U673 1I5FA 3QR8A 3M7GA 1NR2A 4R4CA 2MP1A 2PZTA 1L0XB 3CD6A 3NK9A 1OXSC 2FINB 5GAGC 3CCJA 2Z9HA 3I91A 3M3YB 1SE3A 1RIPA 3KFUA 2KA7A 3BVZA 3FDTA 3O13A 4WRDA 1VQNA 2B39A 4PG3A 1G2TA 2L1BA 2K5HA 1XMOL 1IZ6A 4JI4Q 2E76C 1GJXA 1GUGA 4B3SQ 1KHIA 1IBKL 1KQSA 4RFBA 4OGQC 2NVTH 4NXML 5C44B 2NN6G 3AU7A 3BDOA 3CAMA 5DM63 1E2ZA 3NUCA 1K8AC 2K52A 4GOPC 3S14B 3K8AA 2JN4A 1JOQA 3HGBA 1FNWA 3PQIA 1GUTA 3EROA 3H09A 1MJCA 1TQOA 5IGBA 3TDQA 3QWNA 2UUCQ 4HJ8A 5LMUL 2O5JC 3GTKH 4IPCA 4EQNA 2HQEA 4ILWA 2DY8A 1XPUA 3TP5A 4JBMA 2F0TA 1M1KC 1C0AA 1Q1BA 4QJFA 1CSQA 5FOBB 1TWFH 2NVYB 2X6LA 4JC0A 1QNUA 2ZJQA 2F0EA 1AE3A 1VQJA 2ALYB 2HDLA 2K75A 1O80A 5E4WC 3HEJA 2F0LA 3DM3A 1ASZA 5IYBH 3IFTA 1K83B 1XMOQ 4XYOA 1EOVA 1TT2A 4JI5L 4DR4L 1PFBA 2QW7A 3DWQA 3GV3A 1WTWA 2A6HD 4A3KG 1IBKQ 2Q8TA 1V9PA 2LSSA 1XYIA 4NXMQ 1CUKA 4BY1G 3WDNA 4AIMA 1G51A 1EZ6A 4A3FB 2H5XA 2TSSA 4N8FA 3TSSA 1K8GA 3J80c 2HUGA 4K2LA 1G6ZA 3ER0A 2K7VA 1LV9A 2RBMA 3C1EA 1NNXA 4UAIA 5KRUA 3D31A 2Z6KA 4NMZA 1F2MA 2SNMA 2Z0SA 4G7HC 2JA7G 2O5IC 2A6EC 3PUVA 5LMUQ 3CXCA 3RLNA 1BUVT 1XNRQ 4A3LH 4DV2L 2IY5B 5TSSA 2VUMH 3ULPA 4GNXB 2GN5A 4IPDA 1VQEA 3TS2A 2VY3A 3ICEA 2E75C 1LTRD 5EKIA 1S5ED 3U9SA 4C2MB 1EYAA 1SFOH 3FKIG 5EBCA 4A3MB 3U50C 2Q8IB 4DUZL 4XQJA 2IX1A 2ZXPA 4X3TA 4JI5Q 4DR4Q 4JOIC 2DY7A 1EIGA 2RDGA 1YI2A 3BYYB 5EKKA 3VYTA 3AEVA 3GTJB 1D7QA 3PUZA 1YVCA 2IT1A 4DU9A 2MQHA 4MHEA 2VXWA 1PHJA 4K6LA 3NP8A 2K1BA 1JC7A 2C9OA 3E3XA 4Y7NB 3FHWA 1HCZA 1EIFA 4DFAA 4JI0L 3TMEA 1Y8NB 1PFSA 5C4HA 2WKCA 5I2YA 2PPBC 1LTLA 4MIUA 3IKJA 4RKBA 4A3IB 4RKLA 4C56C 4DV2Q 4FXGC 4CKEA 4DR2L 3S2DB 4X62L 4A3DG 3A8JE 4KN4C 3R2TA 2ATWA 2A73B 5AJ3L 1JWMD 3PUYA 2CW0C 1HZ9A 5CGKA 3GTOH 3CHBD 2HDMA 3IRBA 2PMZB 4ZLTF 2YU9H 1PZJD 1BNZA 3GV6A 3H0GB 4X6AH 4BBSH 1WTRA 3E5SA 5K36H 3E9IA 3ZJYC 2F0GA 1SN8A 2RVLA 1SMYD 3OPOA 4CBVA 4EQ5A 3I4NG 4WORA 1M4VA 1YNJC 3MHBA 2JQOA 4F87A 1NAPA 4KI0A 3FVQA 2A6ED 5I6WA 2MJ8A 1TS4A 4DAYA 1VQ8A 2MHVA 2HCIA 1AE2A 1A8VA 3HOUH 2F0JA 2Z4HA 3HOZG 2E2JH 1EZ8A 4JI0Q 4NB3A 1HR0Q 4NXNL 1CKNB 2NTTA 5IP9G 1XNQL 1S72A 4NP5A 1IXRA 3K7AB 3D0FA 4A75A 4KHPL 2R93B 2WACA 4O1NA 1SBBB 2K5WA 3I70A 4CDFC 2KBNA 5IGFA 4DR2Q 1Q81C 1L1OB 4X62Q 5ELOA 5C0XJ 5CR3A 3AFPA 2N3SA 1S3OA 5AJ3Q 3HKZB 1PYBA 4IALA 3M3YH 1JT8A 1B44D 4OWWB 2O4XA 1UWVA 3PO3B 2BE5C 3ND8A 1TU2B 4DF7A 3S1MH 2L5TA 1JCKB 4J15A 3LWEA 5IE8A 3HOVB 1RF2D 2HD3A 4K5XA 1ESRA 3A56A 3I55A 4A3CH 5CYUA 2EY2A 4H44C 1Q46A 4RMFA 3S16B 1IYJB 1L0YB 1YBYA 1X3FA 4YCVA 2CQOA 1VCIA 2H4OA 5ELNA 4KHVA 3W2DA 4IFDG 4I65A 2QF7A 4QF4A 2B2VA 1BBWA 1UAPA 4NXNQ 4HIDA 3BS1A 2D9UA 4IN3A 1U4RA 2CW0D 3TN2A 2PQAB 1WJJA 1JOKA 3EBEA 4KHPQ 4X65L 1HUNA 2PW5A 4DR5L 3L0OA 1QOHA 1X3QA 1X3PA 1SYEA 1F9RA 3F2BA 1SJED 3MXNA 2RKSA 2K5NA 2AUKA 2Z6BA 1J5EL 4EGVA 2EYHA 5M5YH 2ZJRA 4AYBB 1TS2A 1G291 4K8JA 3SK4A 2XNAC 2F0QA 4CDCC 1K83H 2J7ZA 1I4GA 2NZHA 3Q0AA 3I4OA 4IUUA 2M00A 1DONA 2JA5B 1HXYD 5ELDA 4LF7Q 1HZCA 1YITA 5K36G 3NBHB 1A2TA 4XIGS 1VQIA 5G3LF 1SNQA 2JA9A 3NPPA 5FKAC 1SYCA 4IJLA 4JI6L 1EU3A 2VQEL 1FVIA 5A35A 4JI3L 1I4XA 3KJOA 1BQQT 2XIWA 4KLKA 4DV7L 4JBWA 3M4OB 5K5PA 1PRTC 4GN4B 1ILPA 3S2HB 1EWHA 3OTOQ 2K6AA 2N55A 4XXEA 1SAPA 1FL0A 5LMNW 1L2FA 1QVCA 2EXZA 3UDIA 1M90C 2JA8H 3GP7A 1DCZA 4X65Q 3HOYB 3NBHA 4DR5Q 2V1CC 4ZQ3A 5KIXA 5C4JB 2PMZE 4R4TA 1K8MA 1B2TA 4YIJA 2F1MA 1J5EQ 1Y1WB 5M3FB 4ODGA 2JP1A 4DR7L 4RHRA 4HEDA 2JJQA 1H9SB 1SNPA 1GUNA 1YHBA 5FO9B 3CCQA 1GOZA 3STBC 5IT9L 1ZKOA 1W6KA 1I94L 2B63H 5IYCG 5J1ZA 4GOPB 2OXPA 2A8VA 1IBML 1EFID 1RJTA 4QUFA 3LWUA 3MXGA 2EZVA 3A74A 5D3IB 4K14A 4JI6Q 4A3CG 4RWSC 2VQEQ 1XPRA 1PFNA 3Q8DA 5C44G 4JI3Q 1IYUA 4LF8L 1RODA 1HFNA 4CKCA 1U9RA 4NPSA 4A76A 3GTMB 5C5LA 1GKHA 1G91A 1KAWA 1EYCA 1STNA 3H3VH 1SMXA 1WI5A 5EJWA 3HZXA 3MZ5A 4PMCA 4G4KA 1PH5A 1K0SA 5I4DA 4B3TL 3RZDH 2JA6B 2B2TA 1VQFA 4A3IH 1BVSA 4J6HA 4R4OA 3VR3A 2AQ3B 4FF4A 3N52A 1WTVA 1Y69U 3S2DH 1AEXA 2C5CA 2EJMA 1XWEA 4B3MQ 3GQBA 3A5UA 3K5NA 3I4MB 3PF4A 3KF8B 4HAEA 3JAMc 4DR7Q 1PVOA 2NYZD 2NVXB 1HH2P 2KHIA 3ERSX 1SEBD 1HPCA 3K59A 3MEFA 1I94Q 1R9TH 1CQVA 3D4WA 1YJNA 1IBMQ 1WVLA 5CV7A 2DNEA 2BH8A 1J8IA 4I7AA 2A68C 3P1HA 1RTNA 2IWHA 4LF8Q 1N32L 3CC2A 3HOWB 2NN6H 3BYTB 1TWAH 4A3FG 3T53B 4H13C 1D5MC 3CCUA 2HCCA 1VF7A 1AP0A 4K8IA 1TWHH 2B2WC 1W2BA 4X64L 1LTTD 3AYHB 5GQOA 4B3TQ 1PH6A 2BA0A 2N78A 2JXMB 3OOCA 2RHSB 1WTPA 4L5SA 1HHVA 1W6JA 1FR3A 1CI3M 3CCEA 2HT1A 1Q90A 1HNWL 1PYWD 1IW7D 1AZQA 1JMCA 3DLLA 1T5XD 4RG1A 3NQIA 4N9TA 4GKKL 2QGQA 1PZID 3S17H 1V1OA 2P5ZX 5GAEC 4Q5VA 4LAAA 4MZ9A 2Y0SG 4IPHA 1KTKA 1F77A 2KCNA 2B8GA 4A3MG 5CBEE 3GTPB 3PCOB 2H1EA 5M3MH 1PLFA 5KEEA 1S5FD 2HIXA 5JPMC 4XQQA 3OIPA 4GN3B 2B63G 1LTBD 4CDDC 1H9KA 4JI4L 1PTOC 3JAMi 4A3KH 3CCRA 3PSIA 4IUQA 2WAQB 3V2TA 4HMIA 1N32Q 4BY1H 1SROA 2EYFA 5CV8A 3KF6B 2L9HA 3SK5A 4M8AA 4OO1H 4TQUS 2IX3A 1BKBA 1HNXL 2Z1CA 3L9AX 2E74C 1Z9FA 3NELA 2NTSA 4CJ2C 2R92B 4KKTA 4X64Q 2RSOA 1C4QA 2IL8A 1X32A 1NBWA 1O7IA 2DNCA 2AWOA 1CHPD 2JEBI 5C6AA 1EFWA 1GO3E 4A3IG 1STGA 2UUCL 3CP0A 5IT9E 1HNWQ 2JK8A 5CORA 5JEAJ 3TP8A 5IP7G 5IGEA 3K5MA 5EAYA 4C3HB 5GROA 3RZOB 1DGSA 4GKKQ 1QUQA 3PV0A 2NZOA 1F9PA 2EYOA 2M2LA 3CCLA 3OW7A 5C3XA 2KVMA 3MFYA 3R8BA 2XGTA 3H0GG 2F03A 4DKAC 2E2DC 3EIVA 4DNIA 5HGTA 3FKIH 4HJ9A 2JA5H 2L4NA 3MVVA 1I50H 4IPGA 3GTQB 4Y52H 2KUMA 5FK9C 4J1MA 3MC0B 1KABA 3S24A 5C3EB 1HFGA 4OX9L 4FF1A 4U68A 1SLJA 1QNKA 2CH4A 2PYKA 1K28A 2DJFC 3J80L 1WCMB 4DK6C 1ZYRD 1HNXQ 1E3PA 3S2HH 4ZKBB 3J81c 1EIYB 4ABNA 1Q8IA 2FHTA 5IGCA 3D4RA 1GM5A 1YIJA 4TKOB 5IOCA 3VA7A 1SNDA 3F2DA 2RF4A 2B2YC 3DUZA 4ZKCB 4UP9A 3I56A 1H9RA 2R93G 2I5MX 2HHHQ 2EDGA 1ILQA 4ULLA 3VYUA 2BA1A 4POFA 3QG1A 1SRUA 1DJRD 3J7YW 1XNRL 1F9SA 3I90A 1DZ1A 3UE1A 3VYRA 1VQAA 4A3EB 5M3FH 4A3DH 1BXTA 3HKZG 1EUJA 2DN8A 4FXDA 4JVZA 4YHHL 3F1ZA 4LFCL 4ZUJA 2OQ0A 1LO5D 2GVAA 3PO3G 3R93A 2ZXOA 2EJGC 4H02A 2UXDL 2UXCL 4JPBW 3F2UA 2RA4A 3HOVG 1Y14B 2LXJA 5M3MG 1T5EA 5ISRA 3DMUA 2R7ZH 5H1SE 1HNZL 2K33A 3T56B 3MAQA 4A3BB 2NUCA 1ET6A 4HSVA 4RH6A 3HG9A 3KDFB 3I4NH 1D5ZC 3NTKA 2TMPA 4OX9Q 1OO9B 4DR3L 3NSWA 3PO2B 5CC4A 2F0KA 3S1NB 3G4SA 5KNBA 3N6RA 3SHLA 1M8AA 1YNNC 1XX8A 2C35B 1STYA 1IL2A 3D8GA 2GA4B 4OO1G 2IHFA 2G9HD 3URYA 1A2UA 5T1GA 2OF1A 3SK6A 2F3IA 3HOZH 3NTIA 5M5WB 1MSGA 4KJNA 2KEDA 5IP9H 1QVGA 4IJHA 2DUDA 1X3GA 1GUWA 1CZGA 4BY7B 1VQ4A 1LABA 3HS0C 5D14A 3SDZA 3G6EA 3CPFA 3KLWA 3I4MH 5EBDA 2RDFA 4YHHQ 3FP9A 4AYBG 4LNQA 5BN3A 4LFCQ 1OXUA 3NBIA 4FXKC 5EPKA 2LXKA 2NVXH 5M9OA 2XWBB 4C3IB 5FLXc 4A3JB 1EEID 2UXDQ 2UXCQ 1SYFA 2WB1G 1ZXTA 1C7YA 1EU4A 2WAQE 1SXTA 2JA5G 3NXWA 2A69C 2YYZA 1HNZQ 4LMQD 3VA5A 4BBRB 1DOLA 4P2CB 3S15B 2EY5A 2MO1A 4DR3Q 4OEMB 4RCOA 1O78A 4DN4M 2L0CA 1IKMA 4GNXA 5KGUA 2XN9C 4DV3L 3KJPA 5E3FA 2NZ1D 2UU9Q 4IFDH 3EQLC 1HZAA 3S1QH 3UDFA 2Q2IA 1Y8PB 3S1RB 1LLRD 1KDCA 1HR0L 3GTLB 1ZEQX 4DK3C 3H15A 3HOYG 2L11A 2LKVA 1Y1VB 4EQPA 4R8IA 1QZGA 3M4YA 1JJCB 1XTCD 4LFAL 2QEJC 4P71A 3J80i 3EN2A 2F4IA 2Z8LA 1KLUD 4KN7C 4O42A 1Y1WG 5M3FG 1HTPA 3CW2C 2QEXA 3I4LA 1MGSA 2E5LL 4FO2A 5M5XB 5E4XA 1RCVD 4B3RL 5ELBA 3I2ZA 1TS3A 3J80E 5LMNL 3OW2A 3GTPH 5EQ0A 4DR1L 2EY6A 2B29A 1EY8A 3J7A5 5HURA 2WP8J 5C0XH 4YY3L 3A7LA 1E22A 1N8RC 2G5DA 1YNND 1J9OA 2N49A 1FGBD 2K28A 4HJAA 3BZCA 2R7ZG 2EYLA 1WYDA 3D6CA 5IYDG 1KNAA 3X3NA 1E0BA 3TEHB 1TIID 4DV3Q 4ME3A 3QOLA 2Q2HA 2ZJPA 5I9OA 4J8QA 2E2HB 3ITPA 2VQFL 1V1PB 4TSSA 3G71A 3CMAA 2UUBL 3A55A 2JA6G 3FMCA 1S5CD 2PNHA 1DYQA 1KD1C 3HRZC 1P16A 4DK0A 1ENFA 2ICEC 4QIWB 1TR5A 4LFAQ 2KENA 2AUJD 1Q82C 4FNFA 1B3QA 4IUVA 1KIXA 1JJ2A 3BDCA 3AFQA 5DLQE 2A69D 4DAPA 3I4MG 4KTAA 2E5LQ 2AWNA 2QKIC 4B3RQ 2D2CC 1CTMA 2K01A 5LMNQ 3GTGB 4DR1Q 3HP3A 1E2VA 3WWVA 2UXBL 4YY3Q 1KNEA 3NEMA 5IYCH 1CKNA 1RD9D 3J81j 2F0NA 2QCPX 2XWJB 1EQVA 1JE5A 1NE3A 1YZ6A 4LF7L 4DNRB 1A6XA 4CJ1B 3BU2A 1PH1A 1IBLL 3HOWG 1VF5C 2AMCB 3KLSA 1C48A 2BCOA 5C44H 1WCMH 4DV0L 1K8OA 1BOSA 2KOLA 1L1OA 4JCVE 4FF2A 1L0WA 2CVRA 3UI2A 3OMGA 3S14H 1CA6A 4LUVA 4RAUC 5EPJA 2VQFQ 4R4IA 4FP5D 4JI8L 3TZDA 2BH2A 4M1UB 4WJWA 3OTOL 2NVQB 2UUBQ 1C8CA 2V4DA 4G7OC 2B2WA 1WD1A 2ZT9C 4HMJA 2KHSA 3BZKA 1EL0A 3D3RA 4WJ3M 5C4XB 2Z6KC 2NVYH 1BR9A 1PXUA 1PTOB 3K0YA 1Q86C 3K5OA 4DV1L 1QE6A 3VYSA 1PYSB 1ICFB 1YNJD 1VMPA 5C3WA 1S5DD 2FMMA 2AHOB 3OWEB 3W3AA 2UXBQ 3EA6A 4BA1I 1OTCA 5C0XG 1GUOA 2NB0A 4S3SA 1SE4A 1SE8A 2EOTA 3TP6A 4KD4A 2PQAA 1GHJA 3K80C 2NWGA 3CCSA 1TWGB 1IBLQ 3A54A 4DV0Q 1AFPA 3RLOA 4OONA 3PF5A 1LT3D 1STHA 2QDLA 5JAVA 2HIVA 4A3FH 2IPKD 1WTQA 4IUPA 2R6GA 1LTID 4DV5Q 4QCLA 2R92G 1UE7A 1E1OA 4K0KL 4JI8Q 3C2PA 1Q8KA 1PH4A 2ASBA 3QB3A 3A0JA 3FEWX 4LF9L 3F2CA 3FPUB 1BCPC 1GD7A 3T51B 1PFMA 1YNXA 5JVG3 5BR8L 3I8ZA 1WD0A 4PV1C 1ML0D 4OIJA 5FJ8G 3CQZB 2BE5D 4NDXA 1LT6D 1MJEA 1PRTF 1JWUD 5HGQA 2NVTB 4HIMA 3JAML 1AW7A 3DM1A 4B3ML 5CV9A 3HOXB 2B2UA 1TKWB 4A3JH 4IURA 1BF4A 3E0EA 1SNMA 2PI2E 4DV1Q 2A74C 5I6YA 2XSCA 4C2MH 2F0WA 3K58A 2XVSA 1MKHA 2K03A 5CBAE 4DUYL 4A3GB 3H3VI 4A3MH 4B08A 1UE5A 4IOCA 3RR5A 4KMUC 1V43A 3WOFA 1EY4A 3TS0A 1PV4A 2J0TD 1K3BC 1YJWA 1G6PA 4MTKA 3GTKB 2DGYA 3R3OA 2WKDA 3S15H 4RHSA 3HKSA 4X3UA 5C3EG 3BG3A 1JOOA 1B3AA 2CKZB 3GTJH 4ZK9B 1SSOA 1B53A 3H3VC 2NBFA 1R4PB 1VQBA 1GUSA 1TWFB 5HY6A 1WCMG 3KLSX 1LM0A 3NQTA 2O2LD 2F0OA 3AMUA 3C3LA 4K0KQ 2L55A 4Y7NH 2K14A 1QCBD 4LF9Q 4QIWE 1U4PA 1H9SA 4RA8A 1X6OA 1VQPA 5BR8Q 4GLVB 4XTCS 4GOPA 2RCNA 1VQMA 5IP7H 3OYYA 1JB3A 4HTHA 5KYIA 2Q2UA 1YJ9A 3K81C 3PIP3 2F0IA 1QZHA 1ENCA 2NN6I 4L5QA 1VS0A 4LF6L 3CCVA 3P7JA 3DEOA 2D0PA 4XT3B 4YCWA 1ASYA 4R8NA 4DUYQ 3HFZB 4MTNA 3H0GH 3MWYW 1O7ZA 1SYBA 2A1AA 3DXJC 1A15A 3CC7A 5J39A 1U5KA 3KOJA 4A3BG 5DNFA 1W3SA 3Q6SA 3W1GA 1PRTD 4F88A 1KXLA 1X55A 1BCPD 2WFWA 3PO2G 2VUMB 3PGZA 1FD7D 2FXQA 1VMCA 4F8MA 4V190 1DD2A 5C4ZA 5IODA 2IJ0A 3G6JB 1PH8A 1A0IA 1JJGA 3KF8A 3U9OA 5I9PA 1DM0B 3RUZA 1SFOB 3T4AC 3VR6A 2F0VA 2K5DA 3FRPB 1SR3A 1H9MA 1RKNA 3K7AH 4QMGA 2R93H 2E8GA 4BY7G 1Z47A 2KECA 3MA2B 4JV5Q 4PMWA 2B2VC 5IWAQ 2CWAA 2K4KA 3STBD 1NMGA 3W1BA 1A3TA 3RN5A 3SGIA 2JSOA 5NUCA 1KDAA 4IQZA 4UP7A 1CK1A 4HJ7A 1YHAA 2AQ2B 4LF6Q 4XQNA 3GTGH 1NCVA 4C3JB 3PO3H 4C3IG 4A3JG 4OO1I 3H6MA 3OWFA 1II3A 2PW7A 3SXHA 1WTXA 2LS01 3HOVH 4DR6L 1KLGD 4QGUA 1UNSA 1XTDA 2PCFB 1G2SA 3P75A 1GVPA 4DA2A 1B7YB 2RCFA 3FPPA 4BBRG 1OXTA 4GS3A 1BDOA 5IGGA 3CPWA 3S16H 1UEBA 4LJZC 2A5HA 5BN4A 1WFQA 2DJGC 4LUOA 3RLFA 1JB7A 4JOIA 1VQ7A 3J81L 4KHZA 3GTOB 1N9WA 3ULLA 3ERQA 2MGSA 3A7AB 4X3SA 1EY6A 3TRZA 3C1FA 1I4RA 5E7NA 3JAME 4MN3A 3SR1A 2EE1A 2VZAA 4KY6A 4OIKA 4GN5A 1PTOF 4BBSB 1HJPA 3A5ZB 3BVGA 3MEHA 4BWGB 3KK7A 4PQXA 1VQGA 2PQEA 1Y1VG 1LACA 2I5HA 5IIFA 4DK1A 1FJGL 2HHHL 5C4XH 1JWSD 3A8IE 1N36L 3I73A 1DOMA 1EY5A 3BJUA 3U58A 3L7ZC 1D8LA 3ONAB 1CT1D 3KF6A 1R4QB 4ZRZA 3QO2A 2A6HC 3HOUB 1WTOA 2E2JB 4DXGA 2A68D 2EVBA 3CF5A 2EYPA 1KRTA 4DR6Q 1X56A 3SEBA 4JW0A 3E6ZX 2MPMA 2K04A 3OSOA 3RMHA 1TWGH 4NKLA 1IHZA 3IAYA 3PUXA 1I4QA 5IY0A 1STAA 2OCEA 2Z4IA 3M4OH 3QJYA 2ZM6L 1NTGA 4GZYC 3I7FA 3S1MB 5FLMG 1IYVA 1V8QA 5IGDA 4XYQA 1CKMA 1DOKA 2RSNA 5CMDA 4IZ8A 1I4PA 3HOYH 4OWTB 4G57A 1ESFA 3CQZH 5LHY1 1CSPA 3B6YA 1FJGQ 5C4JH 3BDLA 2N8NA 1N36Q 4BXXH 4AH6A 3KBGA 3K57A 1U4LA 3D4DA 1KL9A 1VDZA 1IKLA 3KLRA 4E6IA 1LTGD 5LL6S 2B2TC 3HOXH 1Y1WH 1O7YA 5FLXL 3OIQA 1FNUA 4JBKA 2AQ1B 2PNRC 4OELB 4UDUC 3AQQA 3RNUA 1VQLA 1PTOD 4A3GH 3U4ZA 3MXPA 5JEAG 4ALPA 1PH3A 2K5VA 4LF4Q 2J4XA 3DEPA 1UUPA 1VQCA 4KV6A 3CCMA 2PZUA 1C9OA 1FNVA 4UHVA 2F0FA 5KNDA 4OWXB 4A93B 1YHQA 4R4QA 5IYDH 1CM9A 2CHBD 1UEAB 1QILA 3I3CA 1U4MA 4GLXA 2EIFA 5M5YB 3GTMH 2ICIA 2GVBA 1TY0A 2WV6D 2ZM6Q 4PZ6A 2L15A 1MI2A 4YWLA 5JVH3 1F2YA 2KEEA 2UU9L 1SYGA 3L2PA 4X66L 4JI7L 4MNOA 1ICWA 1D2BA 2JA6H 1JQYD 1MIUA 3G7LA 3MXUA 3H94A 3KDFA 4C1NK 5C4XG 1H9JA 2B3GA 3NE5B 4AQYL 3OHXC 1I3QB 3J81i 1B1ZA 3M7NA 2Q2TA 1SMYC 3M9BA 3DWAA 4PNYA 3X3MA 3PIOA 5CV6A 1VQKA 4YCUA 3DWPA 4UPAA 3MFGA 1EYDA 1EWIA 1PH9A 3UDXA 4IFDI 5ELFA 4APVA 3J81E 2RHQB 3BVMA 2E2IB 2JA8B 4XDXA 4FVMA 4L6TB 2EYMA 5D65A 1PRTB 1RL2A 4X3KA 4RCNA 5JJZA 1BCPB 2PZWA 3EJIA 1TVXA 4Q0FA 2MNAA 5FO7B 3HOWH 2SOBA 3DHQA 3M85A 4K2KA 2L12A 3CKIB 4WJ4A 1B9NA 2F0HA 2Y0SB 5AFWA 4RGNA 1E1TA 2JE6I 1A3UA 1CKOA 5JJLA 1SE2A 4X66Q 4JI7Q 3PIO3 2QILA 2B63B 4GKJL 2IHEA 5C0XI 4HIOA 3I72A 2RQXA 1BBXC 3TP7A 3ZYYX 4AQYQ 1S40A 4BXXG 4ID6A 1EQRA 5BN5A 4FYDA 3HOXG 4C3JH 4PMBA 1A63A 1JR0D 2F3VA 5D3DA 3WOEA 1B70B 2ZTEA 1FGUA 2CH4W 1AN8A 4A3GG 3E9HA 3KYHC 2SNSA 3NTHA 4HN7A 4KY7A 1HQRD 3SE0A 2K50A 4L5RC 3RZDB 3IFDA 5JOBA 1XMQL 1LUZA 1U0LA 1D1KA 4ME5A 1UE6A 4RGTA 3ND9A 3CRKC 2R3ZA 4JI1L 4DAYB 2R61A 1B8AA 1F9QA 4I7ZC 1F2LA 1K3RA 4P75A 4P73A 1KAAA 1KDBA 1D6EC 2R92H 4DUZQ 5IYBG 3M4PA 4PZ8A 5FLXE 2WIIB 3CRLC 3LX0A 4UP8A 1R9TB 2EPBA 4GKJQ 4LW1A 5JJIA 2VS1A 4YWKA 3SK8A 1JORA 3T1YL 2IX0A 3W5OA 1N33L 4IFDJ 1STEA 2PI2A 4NW2A 3K5LA 3C46A 1EWCA 5FJ8H 3V05A 4H7BA 2LFNA 2EY1A 3UDGA 4OXPA 1TWCB 1A3VA 4C3HH 1TWAB 4CDEC 4UY8C 3RZOH 2LMCB 3CMEA 5C5MA 5KNCA 1NMFA 2QDBA 1TWHB 1Z7TA 2KHJA 3LNNA 3TQYA 4JBJA 5GADC 3RD4A 1V1PA 2CCZA 4POGA 4GLAC 3NHHA 1XMQQ 3GTQH 1CZWA 2YTYA 3VR5A 4A3LG 4FF3A 1Q12A 3LGJA 4H0LC 1I6HB 1HA6A 1RDPD 2VUMG 5C3EH 3NWSA 4JI2L 4JI1Q 2M9VA 2MUYA 3VR2A 3SVMA 4CKBA 2MFIA 4LFBL 2F0PA 3T13A 1MHWC 3S17B 1WTHA 1A62A 2EXDA 1RHPA 2KJXA 4DV5L 5J3BA 5M3MB 1T9HA 2G9DA 1SNOA 1TS5A 4BA2I 1MBYA 3T1YQ 2UUAL 1N33Q 1MSHA 1SJHD 3F8TA 5E1FA 2F0SA 3BZDB 1WOCA 5J22A 3MXNB 1BBUA 2CFMA 4A3KB 4ZCKA 4BY1B 1X65A 4A3EH 4KKUA 3P20A 4QY7A 5DAUA 4CGYB 4KKSA 5ELCA 4QUCA 3S9WA 1PA6A 4C3JG 4C3HG 1EY7A 1D1IA 1F2ZA 1VQDA 1NY4A 5FO8B 1H95A 1KC8C 1XNQQ 2KCTA 1B9MA 1YEZA 2X69A 4L5TA 4A93H 2JA7B 3EVQA 4F7XA 4OL7A 4A3BH 4DGZA 1XPOA 3NENA 1XJVA 2X6GA 4OHJA 2Y0SE 4JI2Q 4XT1B 3UE0A 3J7AF 4ZUIA 4TRDA 3PO2H 2WAQG 1Z6HA 3S1NH 4LFBQ 1BO0A 1OXVA 1S5BD 1X3EA 2VNUD 4DAMA 1V1QA 2KCMA 1PZKD 4EQOA 1SNCA 2I46A 5KYLA 1P8LA 4CJ0B 2WB1B 5CV4A 4BBSG 4P72A 5M5WH 2D62A 3FKIB 4IUTA 2OT2A 2QA4A 2KCCA 1GHKA 5CV5A 4GNXC 4PZ7A 2UUAQ 3M4QA 1I50B 2B8FA 1HR0W 1EIHA 1EQTA 4LWCA 2VB3X 1HZBA 2D0OA 4BY7H 1PMRA 1VQHA 5JPNC 1I3QH 4QQBX 2D5DA 1HA5A 3T16A 4FDBA 3JC66 4TVAB 2Q8RE 2F0DA
chains in the Genus database with same CATH topology
1BCPF 2FMCA 4KK7A 1GXDC 3QOJA 5ELEA 1HTLD 4EVOA 1CQFA 3E0JA 2JEAI 2RDHA 2WINB 4HCSA 5F2DA 2FFKB 4LK1C 4DXFA 1MD2D 3GO5A 4KJOA 3Q23A 2K32A 3R2IA 2JYOA 3MTSA 4B9WA 5I2XA 4A3DB 5A2QL 4KY5A 5DM73 4V0BA 4ZAIA 3PMFA 1HRJA 3L3OC 1LTAD 3IL8A 2LY7A 1IW7C 1SDFA 2BDNA 2K05A 2OEOA 2R7ZB 1ENAA 2CQAA 3D6WA 2BDOA 4ZYSA 3I4NB 5DEHA 1NSNS 1PDQA 1LTSD 4JK1C 2IW3A 2N88A 4KD3A 1RTOA 2I07B 2SDFA 1HQMC 1HUMA 2F3WA 2B2YA 1NR4A 5LL6X 4R9WA 1TY2A 3EFXD 1O7LA 1IL8A 3HOZB 3KBXA 4K5VA 2SEBD 5G3LD 1B50A 1CA5A 2EYJA 4QB4A 3A8KE 4Z9CB 4RGMA 2PO4A 1ET9A 1JICA 2K5QA 1EY0A 1I4HA 1Y8OB 4RGOS 1LT5D 4HSPA 1QB5D 3Q24A 3H91A 4HCEA 1STBA 3OMCA 3KUPA 4WFN3 1JE4A 2XRSD 1NUCA 1XXGA 1OXXK 2EJFC 1S4ZA 4G7ZC 3AB9A 1QWYA 3S1QB 3VR4A 5JEAH 3NWTA 1CHQD 1ZYRC 1G8ZD 4DNTB 1QG7A 3TBIB 1EOTA 3CU7A 1DXMA 1E2WA 4CHTB 1Q3LA 4C1NI 2F0UA 1CFMA 3GD7A 3K6OA 1SYDA 5EKLA 5EPLA 2F0MA 3Q22A 4L8JA 3QIAA 4IUNA 5EGTA 5T1IA 1EEFD 4B9XA 2YU9B 2XRQD 4K6DA 1FYCA 4N9PA 2VB2X 4K5WA 4DAVA 3V96A 1ONLA 1Q1EA 1AZPA 1D5XC 3PUWA 2ENBA 1LT4D 1B4OA 2BOSA 1PTOH 4HR7B 3J7AV 2KQ3A 4L63B 3TZUA 5A2QE 1I6VC 2ZXRA 1EY9A 1QJOA 5COYA 2B2UC 2ID0A 2FJ2A 4BS9A 4U673 3M7GA 1NR2A 2MP1A 2PZTA 1L0XB 3NK9A 1OXSC 2FINB 3I91A 3M3YB 1SE3A 2KA7A 3BVZA 3FDTA 3O13A 4WRDA 2B39A 1G2TA 2L1BA 2E76C 1GJXA 1GUGA 4RFBA 4OGQC 5C44B 2NN6G 3AU7A 3BDOA 5DM63 1E2ZA 3NUCA 3S14B 1JOQA 3HGBA 1FNWA 1GUTA 3EROA 3H09A 1TQOA 5IGBA 3TDQA 3QWNA 2O5JC 4EQNA 2HQEA 4ILWA 2DY8A 3TP5A 2F0TA 1Q1BA 5FOBB 2NVYB 2X6LA 1QNUA 2F0EA 2HDLA 1O80A 5E4WC 3HEJA 2F0LA 3IFTA 1K83B 4XYOA 1TT2A 1PFBA 3DWQA 3GV3A 1WTWA 2A6HD 2Q8TA 1XYIA 3WDNA 1EZ6A 4A3FB 2TSSA 3TSSA 2HUGA 4K2LA 1G6ZA 2K7VA 1LV9A 2RBMA 3C1EA 4UAIA 5KRUA 3D31A 4NMZA 1F2MA 2SNMA 4G7HC 2O5IC 2A6EC 3PUVA 1BUVT 5TSSA 2E75C 1LTRD 5EKIA 1S5ED 3U9SA 4C2MB 1EYAA 4A3MB 5EBCA 2Q8IB 4XQJA 2IX1A 2ZXPA 4X3TA 2DY7A 1EIGA 2RDGA 3BYYB 5EKKA 3VYTA 3GTJB 3PUZA 2IT1A 4DU9A 4MHEA 2VXWA 4K6LA 3NP8A 2K1BA 1JC7A 2C9OA 4Y7NB 1HCZA 4DFAA 3TMEA 1Y8NB 5C4HA 2WKCA 5I2YA 2PPBC 4MIUA 3IKJA 4RKBA 4A3IB 4RKLA 4C56C 4FXGC 4CKEA 3S2DB 3A8JE 4KN4C 3R2TA 2A73B 1JWMD 3PUYA 2CW0C 5CGKA 3CHBD 2HDMA 2PMZB 4ZLTF 1PZJD 1BNZA 3GV6A 3H0GB 1WTRA 3E5SA 5K36H 2F0GA 2RVLA 3OPOA 1SMYD 4CBVA 4WORA 1M4VA 1YNJC 3MHBA 4F87A 1NAPA 4KI0A 3FVQA 2A6ED 5I6WA 2MJ8A 1TS4A 4DAYA 2MHVA 2HCIA 2F0JA 2Z4HA 1EZ8A 2NTTA 4NP5A 3K7AB 2R93B 2WACA 4O1NA 1SBBB 2K5WA 3I70A 5IGFA 5C0XJ 5CR3A 3HKZB 4IALA 1B44D 2O4XA 3PO3B 2BE5C 3ND8A 1TU2B 4DF7A 2L5TA 1JCKB 3LWEA 3HOVB 1RF2D 4K5XA 1ESRA 3A56A 5CYUA 2EY2A 4H44C 3S16B 1L0YB 1VCIA 2H4OA 4KHVA 3W2DA 4IFDG 4I65A 2QF7A 4QF4A 2B2VA 1UAPA 3BS1A 2D9UA 4IN3A 1U4RA 2CW0D 3TN2A 1JOKA 1HUNA 2PW5A 1QOHA 1X3QA 1X3PA 1SYEA 1F9RA 1SJED 3MXNA 2RKSA 2AUKA 4EGVA 2EYHA 4AYBB 1TS2A 1G291 4K8JA 3SK4A 2XNAC 2F0QA 2J7ZA 1I4GA 3Q0AA 4IUUA 2M00A 1DONA 2JA5B 1HXYD 5ELDA 5K36G 1A2TA 4XIGS 5G3LF 1SNQA 3NPPA 5FKAC 1SYCA 1EU3A 5A35A 1I4XA 1BQQT 2XIWA 4JBWA 3M4OB 5K5PA 1PRTC 1ILPA 3S2HB 1EWHA 2K6AA 2N55A 4XXEA 1SAPA 2EXZA 3GP7A 1DCZA 3HOYB 3NBHA 4ZQ3A 5KIXA 5C4JB 1K8MA 1B2TA 4YIJA 2F1MA 1Y1WB 5M3FB 4ODGA 2JP1A 4RHRA 4HEDA 1H9SB 1SNPA 1GUNA 5FO9B 1GOZA 5IT9L 1ZKOA 1W6KA 5J1ZA 2OXPA 1EFID 1RJTA 4QUFA 3LWUA 3MXGA 2EZVA 5D3IB 4K14A 4RWSC 1PFNA 1IYUA 1RODA 1HFNA 4CKCA 1U9RA 3GTMB 5C5LA 1G91A 1EYCA 1STNA 5EJWA 3HZXA 3MZ5A 4PMCA 4G4KA 5I4DA 2JA6B 2B2TA 4J6HA 3VR3A 2AQ3B 4FF4A 3N52A 1WTVA 1Y69U 1AEXA 2C5CA 2EJMA 1XWEA 3GQBA 3K5NA 3I4MB 4HAEA 2NYZD 2NVXB 1SEBD 1HPCA 3K59A 1CQVA 3D4WA 1WVLA 5CV7A 2DNEA 1J8IA 2A68C 3P1HA 1RTNA 2IWHA 3HOWB 2NN6H 3BYTB 3T53B 4H13C 1D5MC 2HCCA 1VF7A 1AP0A 4K8IA 2B2WC 1LTTD 2BA0A 2JXMB 3OOCA 1WTPA 1HHVA 1W6JA 1FR3A 1CI3M 1Q90A 1PYWD 1IW7D 1AZQA 1T5XD 3NQIA 4N9TA 1PZID 1V1OA 4Q5VA 4LAAA 1KTKA 1F77A 2KCNA 2B8GA 5CBEE 3GTPB 2H1EA 1PLFA 5KEEA 1S5FD 5JPMC 4XQQA 3OIPA 1LTBD 1H9KA 1PTOC 4IUQA 2WAQB 3V2TA 4HMIA 2EYFA 5CV8A 2L9HA 3SK5A 4M8AA 4OO1H 4TQUS 2IX3A 2Z1CA 2E74C 2NTSA 3L9AX 4CJ2C 2R92B 4KKTA 2RSOA 1C4QA 2IL8A 1X32A 2DNCA 2AWOA 1CHPD 2JEBI 5C6AA 1STGA 5IT9E 5CORA 5JEAJ 3TP8A 5IGEA 3K5MA 4C3HB 3RZOB 3PV0A 1F9PA 2EYOA 2M2LA 3OW7A 5C3XA 2KVMA 3MFYA 3R8BA 2F03A 2E2DC 5HGTA 2L4NA 3MVVA 3GTQB 2KUMA 5FK9C 4J1MA 2F0DA 3MC0B 1KABA 5C3EB 1HFGA 4FF1A 4U68A 1QNKA 2PYKA 3J80L 1WCMB 1ZYRD 4ZKBB 4ABNA 1Q8IA 2FHTA 5IGCA 3D4RA 4TKOB 5IOCA 3VA7A 1SNDA 2B2YC 3DUZA 4ZKCB 1H9RA 2EDGA 1ILQA 4ULLA 3VYUA 2BA1A 3QG1A 1DJRD 3J7YW 1F9SA 3I90A 1DZ1A 3VYRA 4A3EB 1BXTA 2DN8A 4FXDA 4ZUJA 1LO5D 3R93A 2ZXOA 2EJGC 3F2UA 2RA4A 1T5EA 5ISRA 3DMUA 2K33A 3T56B 3MAQA 4A3BB 2NUCA 1ET6A 4HSVA 4RH6A 3HG9A 1D5ZC 3NTKA 2TMPA 1OO9B 3NSWA 3PO2B 5CC4A 2F0KA 3S1NB 5KNBA 3N6RA 3SHLA 1M8AA 1YNNC 1XX8A 1STYA 3D8GA 2GA4B 4OO1G 2G9HD 3URYA 1A2UA 5T1GA 2OF1A 3SK6A 3NTIA 5M5WB 1MSGA 4KJNA 2KEDA 1GUWA 1CZGA 4BY7B 1LABA 3HS0C 5D14A 3SDZA 5EBDA 2RDFA 5BN3A 1OXUA 3NBIA 4FXKC 5EPKA 5M9OA 2XWBB 4C3IB 4A3JB 1EEID 1SYFA 1ZXTA 1EU4A 1SXTA 3NXWA 2A69C 2YYZA 4LMQD 3VA5A 4BBRB 1DOLA 4P2CB 3S15B 2EY5A 4RCOA 1O78A 4DN4M 2L0CA 1IKMA 5KGUA 2XN9C 5E3FA 2NZ1D 4IFDH 3EQLC 1Y8PB 3S1RB 1LLRD 1KDCA 3GTLB 1ZEQX 2L11A 2LKVA 1Y1VB 4EQPA 4R8IA 3M4YA 1XTCD 2QEJC 2F4IA 2Z8LA 1KLUD 4KN7C 4O42A 1HTPA 3I4LA 1MGSA 4FO2A 5M5XB 5E4XA 1RCVD 5ELBA 1TS3A 3J80E 5EQ0A 2EY6A 1EY8A 5HURA 2WP8J 5C0XH 3A7LA 1YNND 1J9OA 1FGBD 2K28A 2EYLA 3D6CA 1KNAA 3X3NA 1E0BA 1TIID 3QOLA 5I9OA 4J8QA 2E2HB 3ITPA 1V1PB 4TSSA 3A55A 3FMCA 1S5CD 1DYQA 3HRZC 4DK0A 1ENFA 2ICEC 4QIWB 1TR5A 2AUJD 4FNFA 4IUVA 3BDCA 2A69D 4DAPA 4KTAA 2AWNA 2QKIC 2D2CC 1CTMA 2K01A 3GTGB 3HP3A 1E2VA 1KNEA 1RD9D 2F0NA 2QCPX 2XWJB 1EQVA 4DNRB 1A6XA 4CJ1B 1VF5C 2BCOA 1C48A 3KLSA 1K8OA 1BOSA 2KOLA 4FF2A 2CVRA 3UI2A 3OMGA 1CA6A 4RAUC 5EPJA 4FP5D 3TZDA 4M1UB 4WJWA 2NVQB 1C8CA 2V4DA 4G7OC 2B2WA 1WD1A 2ZT9C 4HMJA 2KHSA 1EL0A 3D3RA 5C4XB 1BR9A 1PXUA 1PTOB 3K0YA 3K5OA 1QE6A 3VYSA 1YNJD 1VMPA 5C3WA 1S5DD 2FMMA 3W3AA 3OWEB 3EA6A 4BA1I 5C0XG 1GUOA 2NB0A 4S3SA 1SE4A 2EOTA 3TP6A 4KD4A 1GHJA 2NWGA 1TWGB 3A54A 1AFPA 1LT3D 1STHA 5JAVA 2IPKD 1WTQA 4IUPA 2R6GA 1LTID 4QCLA 3C2PA 3QB3A 3FEWX 3FPUB 1BCPC 3T51B 1PFMA 5JVG3 3I8ZA 1WD0A 4PV1C 1ML0D 4OIJA 3CQZB 2BE5D 4NDXA 1LT6D 1PRTF 1JWUD 2NVTB 3JAML 1AW7A 3DM1A 5CV9A 3HOXB 2B2UA 1TKWB 4IURA 1BF4A 1SNMA 2A74C 5I6YA 2XSCA 2F0WA 3K58A 2XVSA 2K03A 5CBAE 4A3GB 4B08A 4KMUC 1V43A 3WOFA 1EY4A 2J0TD 3GTKB 3R3OA 2WKDA 4RHSA 4X3UA 3BG3A 1JOOA 1B3AA 4ZK9B 1SSOA 1B53A 3H3VC 2NBFA 1R4PB 1GUSA 1TWFB 3KLSX 3NQTA 2O2LD 2F0OA 3AMUA 3C3LA 2L55A 1QCBD 1U4PA 1H9SA 4RA8A 4XTCS 1JB3A 4HTHA 5KYIA 3PIP3 2F0IA 1ENCA 2NN6I 3P7JA 3DEOA 4XT3B 4R8NA 3MWYW 1O7ZA 1SYBA 3DXJC 1A15A 5J39A 5DNFA 3Q6SA 1PRTD 4F88A 1BCPD 2VUMB 1FD7D 1VMCA 4F8MA 4V190 1DD2A 5C4ZA 5IODA 2IJ0A 3G6JB 3KF8A 3U9OA 5I9PA 1DM0B 3RUZA 1SFOB 3T4AC 3VR6A 2F0VA 2K5DA 3FRPB 1H9MA 1RKNA 4QMGA 1Z47A 2KECA 3MA2B 4PMWA 2B2VC 1A3TA 2JSOA 5NUCA 1KDAA 4IQZA 1CK1A 2AQ2B 4XQNA 1NCVA 4C3JB 4C3IG 4OO1I 3H6MA 3OWFA 1II3A 2PW7A 3SXHA 1WTXA 2LS01 1KLGD 1UNSA 2PCFB 1G2SA 3P75A 4DA2A 3FPPA 1OXTA 1BDOA 5IGGA 4LJZC 2A5HA 5BN4A 3RLFA 3J81L 4KHZA 3GTOB 3ERQA 2MGSA 3A7AB 4X3SA 1EY6A 3C1FA 1I4RA 3JAME 4MN3A 3SR1A 2EE1A 4KY6A 4OIKA 1PTOF 4BBSB 3BVGA 3MEHA 4BWGB 3KK7A 4PQXA 2PQEA 1LACA 5IIFA 4DK1A 1JWSD 3A8IE 3I73A 1DOMA 1EY5A 3L7ZC 3ONAB 1CT1D 1R4QB 4ZRZA 3QO2A 2A6HC 3HOUB 1WTOA 2E2JB 4DXGA 2A68D 2EVBA 2EYPA 3SEBA 3E6ZX 2MPMA 2K04A 3OSOA 3RMHA 4NKLA 1IHZA 3IAYA 3PUXA 1I4QA 1STAA 2Z4IA 3QJYA 4GZYC 3S1MB 1IYVA 1V8QA 5IGDA 4XYQA 1DOKA 2RSNA 5CMDA 4IZ8A 1I4PA 4G57A 1ESFA 5LHY1 3BDLA 3KBGA 3K57A 1U4LA 3D4DA 1VDZA 1IKLA 3KLRA 4E6IA 1LTGD 5LL6S 2B2TC 1O7YA 5FLXL 3OIQA 1FNUA 2AQ1B 2PNRC 4UDUC 1PTOD 3MXPA 5JEAG 2J4XA 3DEPA 1UUPA 4KV6A 2PZUA 1FNVA 2F0FA 5KNDA 4A93B 1CM9A 2CHBD 1UEAB 1QILA 3I3CA 1U4MA 5M5YB 2ICIA 1TY0A 2WV6D 1MI2A 5JVH3 1F2YA 2KEEA 1SYGA 1D2BA 1ICWA 1JQYD 3G7LA 3MXUA 3H94A 4C1NK 1H9JA 3NE5B 3OHXC 1I3QB 1B1ZA 3M7NA 1SMYC 3DWAA 4PNYA 3X3MA 5CV6A 3DWPA 3MFGA 1EYDA 4IFDI 5ELFA 3J81E 3BVMA 2E2IB 2JA8B 4XDXA 4FVMA 4L6TB 2EYMA 5D65A 1PRTB 4X3KA 4RCNA 5JJZA 1BCPB 2PZWA 3EJIA 1TVXA 4Q0FA 5FO7B 2SOBA 3DHQA 3M85A 4K2KA 2L12A 3CKIB 1B9NA 2F0HA 2Y0SB 5AFWA 4RGNA 2JE6I 1A3UA 1SE2A 3PIO3 2QILA 2B63B 5C0XI 3I72A 2RQXA 1BBXC 3TP7A 3ZYYX 4ID6A 5BN5A 4FYDA 4PMBA 1JR0D 2F3VA 5D3DA 3WOEA 1AN8A 3NTHA 2SNSA 4HN7A 4KY7A 1HQRD 3SE0A 3RZDB 3IFDA 5JOBA 1D1KA 4ME5A 4RGTA 3ND9A 3CRKC 2R3ZA 2R61A 1F9QA 4I7ZC 1F2LA 1KAAA 1KDBA 1D6EC 5FLXE 2WIIB 3CRLC 3LX0A 1R9TB 2EPBA 3SK8A 1JORA 2IX0A 4IFDJ 1STEA 4NW2A 3K5LA 3C46A 1EWCA 3V05A 4H7BA 2LFNA 2EY1A 1TWCB 1A3VA 1TWAB 2LMCB 5C5MA 5KNCA 2QDBA 1TWHB 1Z7TA 3LNNA 3RD4A 1V1PA 3NHHA 1CZWA 3VR5A 4FF3A 1Q12A 4H0LC 1I6HB 1HA6A 1RDPD 3NWSA 2M9VA 2MUYA 3VR2A 3SVMA 4CKBA 2F0PA 3T13A 3S17B 1RHPA 2KJXA 5M3MB 2G9DA 1SNOA 1TS5A 4BA2I 1MBYA 1MSHA 1SJHD 5E1FA 2F0SA 3BZDB 5J22A 4A3KB 4BY1B 4KKUA 3P20A 5DAUA 4CGYB 4KKSA 5ELCA 4QUCA 3S9WA 4C3JG 1EY7A 1D1IA 1F2ZA 5FO8B 1B9MA 2X69A 2JA7B 3EVQA 4F7XA 4OL7A 4DGZA 2X6GA 4OHJA 4XT1B 3J7AF 4ZUIA 4TRDA 1Z6HA 1BO0A 1OXVA 1S5BD 2VNUD 1PZKD 4EQOA 1SNCA 2I46A 5KYLA 4CJ0B 2WB1B 5CV4A 2D62A 3FKIB 4IUTA 2OT2A 2KCCA 1GHKA 5CV5A 1I50B 2B8FA 1EIHA 1EQTA 2VB3X 1PMRA 5JPNC 2D5DA 1HA5A 3T16A 2Q8RE 4C3HG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C8C A;  4O42 A;  1B53 A;  2MP1 A;  4UAI A;  1NAP A;  5AFW A;  3N52 A;  1WTV A;  2FIN B;  2J7Z A;  1MGS A;  4CJ2 C;  1WTX A;  5E4X A;  4HSV A;  1HA6 A;  1U4L A;  2RSO A;  2B2W A;  2IL8 A;  1IKL A;  1WD1 A;  1X32 A;  4IUU A;  1G2S A;  3H91 A;  2MJ8 A;  2B2T C;  3I91 A;  1DON A;  3SVM A;  1O7Y A;  3KUP A;  5EQ0 A;  2HCI A;  1JE4 A;  4HCS A;  1EL0 A;  3FDT A;  2FFK B;  4HAE A;  1G2T A;  1U4P A;  2L1B A;  4RA8 A;  1M8A A;  1J9O A;  1XX8 A;  1S4Z A;  2K28 A;  2NYZ D;  5COR A;  1BBX C;  1RHP A;  5EKI A;  3DEP A;  5T1G A;  2XIW A;  2JYO A;  3MTS A;  1QE6 A;  1KNA A;  2MGS A;  1VMP A;  1MSG A;  4X3S A;  1WVL A;  2FMM A;  2KED A;  1CM9 A;  4MN3 A;  1MSH A;  1F9P A;  1ILP A;  1E0B A;  4ZAI A;  2EE1 A;  2M2L A;  2N55 A;  1HRJ A;  4OIK A;  1J8I A;  4X3T A;  3I3C A;  1U4M A;  2KVM A;  1QG7 A;  1GUW A;  1RTN A;  1SAP A;  2EOT A;  2DY7 A;  3IL8 A;  1EIG A;  1EOT A;  2NWG A;  1SDF A;  5D14 A;  2BDN A;  2K05 A;  3IFD A;  3P7J A;  2L4N A;  3DEO A;  4XT3 B;  2HCC A;  1Q3L A;  1AP0 A;  1MI2 A;  3MWY W;  1O7Z A;  2B2W C;  2KUM A;  4QUC A;  1DOM A;  3D6W A;  2KEE A;  5EPK A;  3LWE A;  1WTQ A;  1B2T A;  1A15 A;  4IUP A;  5EPL A;  1PDQ A;  2R3Z A;  1ESR A;  4MHE A;  1HFG A;  1ICW A;  2VXW A;  5DNF A;  3ONA B;  4U68 A;  3Q6S A;  1QNK A;  2DY8 A;  1F9Q A;  1ZXT A;  2N88 A;  5T1I A;  2JP1 A;  1RTO A;  2K1B A;  2X69 A;  1F2L A;  2SDF A;  3QO2 A;  4IUV A;  3G7L A;  3FPU B;  4HED A;  1HUM A;  1WTO A;  1WTP A;  1HHV A;  2B2Y A;  1NR4 A;  1PFM A;  4ZKB B;  2X6L A;  1VMC A;  2X6G A;  4R9W A;  4LMQ D;  3I8Z A;  1DOL A;  1IL8 A;  2FHT A;  4XT1 B;  1WD0 A;  1AZQ A;  2K01 A;  2HDL A;  1ML0 D;  2EPB A;  3HP3 A;  1RJT A;  4OIJ A;  3KBX A;  4QUF A;  2MPM A;  1BO0 A;  2K04 A;  1O80 A;  5E4W C;  1B50 A;  2B2Y C;  4DN4 M;  4ZKC B;  1AZP A;  1KNE A;  1IKM A;  4RWS C;  2B2V A;  1ILQ A;  4NW2 A;  1PFN A;  1B4O A;  1B3A A;  3DM1 A;  1PFB A;  2D9U A;  2NZ1 D;  4CJ0 B;  5CBE E;  1ROD A;  1CA5 A;  1U4R A;  2B2U A;  3TN2 A;  1F9S A;  2H1E A;  1PLF A;  3GV3 A;  2HDM A;  3I90 A;  4IUR A;  1WTW A;  4XDX A;  1BF4 A;  1DZ1 A;  1HFN A;  1HUN A;  4IUT A;  2Q8T A;  4CJ1 B;  1XYI A;  4ZLT F;  2KEC A;  2K03 A;  5D65 A;  1X3Q A;  5CBA E;  1G91 A;  1X3P A;  2B2V C;  1BNZ A;  3GV6 A;  1F9R A;  2KOL A;  1EIH A;  1EQT A;  4X3K A;  5JJZ A;  1WTR A;  3R93 A;  2L11 A;  5COY A;  5EJW A;  2CVR A;  1TVX A;  2B2U C;  1JIC A;  1DOK A;  4IUQ A;  3UI2 A;  4R8I A;  1CA6 A;  2RVL A;  2HUG A;  2RSN A;  4RAU C;  5EPJ A;  2FJ2 A;  5CMD A;  1G6Z A;  2B2T A;  2RA4 A;  3F2U A;  4X3U A;  3TZD A;  1NCV A;  2L12 A;  2Q8R E;  1LV9 A;  2L9H A;  4ZK9 B;  1SSO A;  1NR2 A; 
#chains in the Genus database with same CATH topology
 1BCP F;  2FMC A;  4KK7 A;  1K9M C;  1GXD C;  3QOJ A;  5ELE A;  1HTL D;  4EVO A;  3HOU G;  1CQF A;  1K0R A;  3E0J A;  5L37 A;  4C3I H;  4DPG A;  2JEA I;  2RDH A;  2WIN B;  4HCS A;  2AKW B;  2MO0 A;  5F2D A;  2E2I H;  2FFK B;  4LK1 C;  4DXF A;  3J7Z C;  1MD2 D;  3GO5 A;  1E24 A;  4KJO A;  3T1H L;  4BBR H;  3Q23 A;  2K32 A;  3R2I A;  3PIP A;  2JYO A;  3MTS A;  4B9W A;  1PH7 A;  4HIK A;  5I2X A;  2I5L X;  4A3D B;  5A2Q L;  4KY5 A;  5DM7 3;  2VW9 A;  4V0B A;  4ZAI A;  3PMF A;  1HRJ A;  3L3O C;  5JJK A;  1QVF A;  2OTJ A;  1LTA D;  4DV4 L;  2YV5 A;  3IL8 A;  2LY7 A;  1VQ6 A;  1IW7 C;  1SDF A;  3S1R H;  2BDN A;  2K05 A;  3K7U C;  2OEO A;  3GTL H;  2R7Z B;  1ENA A;  2CQA A;  3D6W A;  5GAH C;  2BDO A;  4ZYS A;  1Y1V H;  3I4N B;  5DEH A;  1NSN S;  1PDQ A;  1LTS D;  4JK1 C;  2IW3 A;  4DV7 Q;  4JV5 L;  2XTI A;  2N88 A;  4KD3 A;  1RTO A;  2I07 B;  2SDF A;  1HQM C;  5IWA L;  4A3E G;  1HUM A;  2F3W A;  2ES2 A;  2B2Y A;  1NR4 A;  5M5X H;  5LL6 X;  4R9W A;  1TY2 A;  3EFX D;  1O7L A;  1IL8 A;  2OTL A;  1TXY A;  3HOZ B;  4IOA A;  4N8X 1;  3KBX A;  4K5V A;  3CC4 A;  4JYA L;  2SEB D;  3K0X A;  5G3L D;  1B50 A;  2OQK A;  3HKZ E;  4A93 G;  3T1H Q;  1CA5 A;  4DV6 L;  2R7F A;  2EYJ A;  4QB4 A;  3A8K E;  4Z9C B;  2YTX A;  4RGM A;  4O2D A;  2PO4 A;  1ET9 A;  2I0Q A;  2OWO A;  4A4I A;  1JIC A;  2VL6 A;  4DV4 Q;  1EQQ A;  1N34 L;  2E2H H;  2K5Q A;  3TRE A;  1VQ9 A;  2F4V L;  1EY0 A;  1I4H A;  1Y8O B;  5FLM H;  4RGO S;  4O0A A;  1L1O C;  1LT5 D;  4HSP A;  1NJI C;  4EX5 A;  5IT9 c;  1QB5 D;  4IO9 A;  3Q24 A;  1VQ5 A;  3GDE A;  3H91 A;  4HCE A;  1STB A;  2EQS A;  3OMC A;  1UE1 A;  3KUP A;  4LF5 L;  4WFN 3;  1JE4 A;  4HJ5 A;  1TWC H;  2XRS D;  1NUC A;  1XXG A;  2F52 A;  1K73 C;  1OXX K;  2HQL A;  2ZTC A;  2EJF C;  1KRS A;  1S4Z A;  3RN2 A;  1PH2 A;  1J6Q A;  4G7Z C;  1EYG A;  3AB9 A;  1QWY A;  3ULJ A;  3S1Q B;  3VR4 A;  5JEA H;  3NWT A;  4JYA Q;  1CHQ D;  3G48 A;  1LYL A;  2JA8 G;  1ZYR C;  4AYB E;  1G8Z D;  2A19 A;  2YTV A;  4DNT B;  1QG7 A;  1X9N A;  1I6H H;  4DV6 Q;  3TBI B;  1EOT A;  3CU7 A;  1DXM A;  1E2W A;  2WB1 E;  4CHT B;  2CWP A;  1Q3L A;  4C1N I;  2ZTD A;  2F0U A;  1CFM A;  1VQO A;  3GD7 A;  3K6O A;  1SYD A;  5EKL A;  5EPL A;  2F0M A;  3Q22 A;  1E7Z A;  4L8J A;  4P74 A;  1N34 Q;  3QIA A;  2F4V Q;  4IUN A;  4LUZ A;  5EGT A;  5T1I A;  1EEF D;  4B9X A;  2YU9 B;  2NVQ H;  2XRQ D;  4YWM A;  4K6D A;  1FYC A;  4R1J A;  4QL5 A;  4B3S L;  4N9P A;  2VB2 X;  4LF5 Q;  4K5W A;  4DAV A;  3V96 A;  1ONL A;  1Q1E A;  1QUQ B;  1X54 A;  1AZP A;  1D5X C;  3PUW A;  2ENB A;  1LT4 D;  1B4O A;  2BOS A;  1PTO H;  4HR7 B;  3J7A V;  2KQ3 A;  4L63 B;  3TZU A;  3VDY A;  3U4V A;  5A2Q E;  1I6V C;  2JA7 H;  4LF4 L;  2ZXR A;  1EY9 A;  1QJO A;  5COY A;  2B2U C;  2ID0 A;  1AH9 A;  4JG2 A;  2R7D A;  2FJ2 A;  1Q7Y C;  4BS9 A;  4U67 3;  1I5F A;  3QR8 A;  3M7G A;  1NR2 A;  4R4C A;  2MP1 A;  2PZT A;  1L0X B;  3CD6 A;  3NK9 A;  1OXS C;  2FIN B;  5GAG C;  3CCJ A;  2Z9H A;  3I91 A;  3M3Y B;  1SE3 A;  1RIP A;  3KFU A;  2KA7 A;  3BVZ A;  3FDT A;  3O13 A;  4WRD A;  1VQN A;  2B39 A;  4PG3 A;  1G2T A;  2L1B A;  2K5H A;  1XMO L;  1IZ6 A;  4JI4 Q;  2E76 C;  1GJX A;  1GUG A;  4B3S Q;  1KHI A;  1IBK L;  1KQS A;  4RFB A;  4OGQ C;  2NVT H;  4NXM L;  5C44 B;  2NN6 G;  3AU7 A;  3BDO A;  3CAM A;  5DM6 3;  1E2Z A;  3NUC A;  1K8A C;  2K52 A;  4GOP C;  3S14 B;  3K8A A;  2JN4 A;  1JOQ A;  3HGB A;  1FNW A;  3PQI A;  1GUT A;  3ERO A;  3H09 A;  1MJC A;  1TQO A;  5IGB A;  3TDQ A;  3QWN A;  2UUC Q;  4HJ8 A;  5LMU L;  2O5J C;  3GTK H;  4IPC A;  4EQN A;  2HQE A;  4ILW A;  2DY8 A;  1XPU A;  3TP5 A;  4JBM A;  2F0T A;  1M1K C;  1C0A A;  1Q1B A;  4QJF A;  1CSQ A;  5FOB B;  1TWF H;  2NVY B;  2X6L A;  4JC0 A;  1QNU A;  2ZJQ A;  2F0E A;  1AE3 A;  1VQJ A;  2ALY B;  2HDL A;  2K75 A;  1O80 A;  5E4W C;  3HEJ A;  2F0L A;  3DM3 A;  1ASZ A;  5IYB H;  3IFT A;  1K83 B;  1XMO Q;  4XYO A;  1EOV A;  1TT2 A;  4JI5 L;  4DR4 L;  1PFB A;  2QW7 A;  3DWQ A;  3GV3 A;  1WTW A;  2A6H D;  4A3K G;  1IBK Q;  2Q8T A;  1V9P A;  2LSS A;  1XYI A;  4NXM Q;  1CUK A;  4BY1 G;  3WDN A;  4AIM A;  1G51 A;  1EZ6 A;  4A3F B;  2H5X A;  2TSS A;  4N8F A;  3TSS A;  1K8G A;  3J80 c;  2HUG A;  4K2L A;  1G6Z A;  3ER0 A;  2K7V A;  1LV9 A;  2RBM A;  3C1E A;  1NNX A;  4UAI A;  5KRU A;  3D31 A;  2Z6K A;  4NMZ A;  1F2M A;  2SNM A;  2Z0S A;  4G7H C;  2JA7 G;  2O5I C;  2A6E C;  3PUV A;  5LMU Q;  3CXC A;  3RLN A;  1BUV T;  1XNR Q;  4A3L H;  4DV2 L;  2IY5 B;  5TSS A;  2VUM H;  3ULP A;  4GNX B;  2GN5 A;  4IPD A;  1VQE A;  3TS2 A;  2VY3 A;  3ICE A;  2E75 C;  1LTR D;  5EKI A;  1S5E D;  3U9S A;  4C2M B;  1EYA A;  1SFO H;  3FKI G;  5EBC A;  4A3M B;  3U50 C;  2Q8I B;  4DUZ L;  4XQJ A;  2IX1 A;  2ZXP A;  4X3T A;  4JI5 Q;  4DR4 Q;  4JOI C;  2DY7 A;  1EIG A;  2RDG A;  1YI2 A;  3BYY B;  5EKK A;  3VYT A;  3AEV A;  3GTJ B;  1D7Q A;  3PUZ A;  1YVC A;  2IT1 A;  4DU9 A;  2MQH A;  4MHE A;  2VXW A;  1PHJ A;  4K6L A;  3NP8 A;  2K1B A;  1JC7 A;  2C9O A;  3E3X A;  4Y7N B;  3FHW A;  1HCZ A;  1EIF A;  4DFA A;  4JI0 L;  3TME A;  1Y8N B;  1PFS A;  5C4H A;  2WKC A;  5I2Y A;  2PPB C;  1LTL A;  4MIU A;  3IKJ A;  4RKB A;  4A3I B;  4RKL A;  4C56 C;  4DV2 Q;  4FXG C;  4CKE A;  4DR2 L;  3S2D B;  4X62 L;  4A3D G;  3A8J E;  4KN4 C;  3R2T A;  2ATW A;  2A73 B;  5AJ3 L;  1JWM D;  3PUY A;  2CW0 C;  1HZ9 A;  5CGK A;  3GTO H;  3CHB D;  2HDM A;  3IRB A;  2PMZ B;  4ZLT F;  2YU9 H;  1PZJ D;  1BNZ A;  3GV6 A;  3H0G B;  4X6A H;  4BBS H;  1WTR A;  3E5S A;  5K36 H;  3E9I A;  3ZJY C;  2F0G A;  1SN8 A;  2RVL A;  1SMY D;  3OPO A;  4CBV A;  4EQ5 A;  3I4N G;  4WOR A;  1M4V A;  1YNJ C;  3MHB A;  2JQO A;  4F87 A;  1NAP A;  4KI0 A;  3FVQ A;  2A6E D;  5I6W A;  2MJ8 A;  1TS4 A;  4DAY A;  1VQ8 A;  2MHV A;  2HCI A;  1AE2 A;  1A8V A;  3HOU H;  2F0J A;  2Z4H A;  3HOZ G;  2E2J H;  1EZ8 A;  4JI0 Q;  4NB3 A;  1HR0 Q;  4NXN L;  1CKN B;  2NTT A;  5IP9 G;  1XNQ L;  1S72 A;  4NP5 A;  1IXR A;  3K7A B;  3D0F A;  4A75 A;  4KHP L;  2R93 B;  2WAC A;  4O1N A;  1SBB B;  2K5W A;  3I70 A;  4CDF C;  2KBN A;  5IGF A;  4DR2 Q;  1Q81 C;  1L1O B;  4X62 Q;  5ELO A;  5C0X J;  5CR3 A;  3AFP A;  2N3S A;  1S3O A;  5AJ3 Q;  3HKZ B;  1PYB A;  4IAL A;  3M3Y H;  1JT8 A;  1B44 D;  4OWW B;  2O4X A;  1UWV A;  3PO3 B;  2BE5 C;  3ND8 A;  1TU2 B;  4DF7 A;  3S1M H;  2L5T A;  1JCK B;  4J15 A;  3LWE A;  5IE8 A;  3HOV B;  1RF2 D;  2HD3 A;  4K5X A;  1ESR A;  3A56 A;  3I55 A;  4A3C H;  5CYU A;  2EY2 A;  4H44 C;  1Q46 A;  4RMF A;  3S16 B;  1IYJ B;  1L0Y B;  1YBY A;  1X3F A;  4YCV A;  2CQO A;  1VCI A;  2H4O A;  5ELN A;  4KHV A;  3W2D A;  4IFD G;  4I65 A;  2QF7 A;  4QF4 A;  2B2V A;  1BBW A;  1UAP A;  4NXN Q;  4HID A;  3BS1 A;  2D9U A;  4IN3 A;  1U4R A;  2CW0 D;  3TN2 A;  2PQA B;  1WJJ A;  1JOK A;  3EBE A;  4KHP Q;  4X65 L;  1HUN A;  2PW5 A;  4DR5 L;  3L0O A;  1QOH A;  1X3Q A;  1X3P A;  1SYE A;  1F9R A;  3F2B A;  1SJE D;  3MXN A;  2RKS A;  2K5N A;  2AUK A;  2Z6B A;  1J5E L;  4EGV A;  2EYH A;  5M5Y H;  2ZJR A;  4AYB B;  1TS2 A;  1G29 1;  4K8J A;  3SK4 A;  2XNA C;  2F0Q A;  4CDC C;  1K83 H;  2J7Z A;  1I4G A;  2NZH A;  3Q0A A;  3I4O A;  4IUU A;  2M00 A;  1DON A;  2JA5 B;  1HXY D;  5ELD A;  4LF7 Q;  1HZC A;  1YIT A;  5K36 G;  3NBH B;  1A2T A;  4XIG S;  1VQI A;  5G3L F;  1SNQ A;  2JA9 A;  3NPP A;  5FKA C;  1SYC A;  4IJL A;  4JI6 L;  1EU3 A;  2VQE L;  1FVI A;  5A35 A;  4JI3 L;  1I4X A;  3KJO A;  1BQQ T;  2XIW A;  4KLK A;  4DV7 L;  4JBW A;  3M4O B;  5K5P A;  1PRT C;  4GN4 B;  1ILP A;  3S2H B;  1EWH A;  3OTO Q;  2K6A A;  2N55 A;  4XXE A;  1SAP A;  1FL0 A;  5LMN W;  1L2F A;  1QVC A;  2EXZ A;  3UDI A;  1M90 C;  2JA8 H;  3GP7 A;  1DCZ A;  4X65 Q;  3HOY B;  3NBH A;  4DR5 Q;  2V1C C;  4ZQ3 A;  5KIX A;  5C4J B;  2PMZ E;  4R4T A;  1K8M A;  1B2T A;  4YIJ A;  2F1M A;  1J5E Q;  1Y1W B;  5M3F B;  4ODG A;  2JP1 A;  4DR7 L;  4RHR A;  4HED A;  2JJQ A;  1H9S B;  1SNP A;  1GUN A;  1YHB A;  5FO9 B;  3CCQ A;  1GOZ A;  3STB C;  5IT9 L;  1ZKO A;  1W6K A;  1I94 L;  2B63 H;  5IYC G;  5J1Z A;  4GOP B;  2OXP A;  2A8V A;  1IBM L;  1EFI D;  1RJT A;  4QUF A;  3LWU A;  3MXG A;  2EZV A;  3A74 A;  5D3I B;  4K14 A;  4JI6 Q;  4A3C G;  4RWS C;  2VQE Q;  1XPR A;  1PFN A;  3Q8D A;  5C44 G;  4JI3 Q;  1IYU A;  4LF8 L;  1ROD A;  1HFN A;  4CKC A;  1U9R A;  4NPS A;  4A76 A;  3GTM B;  5C5L A;  1GKH A;  1G91 A;  1KAW A;  1EYC A;  1STN A;  3H3V H;  1SMX A;  1WI5 A;  5EJW A;  3HZX A;  3MZ5 A;  4PMC A;  4G4K A;  1PH5 A;  1K0S A;  5I4D A;  4B3T L;  3RZD H;  2JA6 B;  2B2T A;  1VQF A;  4A3I H;  1BVS A;  4J6H A;  4R4O A;  3VR3 A;  2AQ3 B;  4FF4 A;  3N52 A;  1WTV A;  1Y69 U;  3S2D H;  1AEX A;  2C5C A;  2EJM A;  1XWE A;  4B3M Q;  3GQB A;  3A5U A;  3K5N A;  3I4M B;  3PF4 A;  3KF8 B;  4HAE A;  3JAM c;  4DR7 Q;  1PVO A;  2NYZ D;  2NVX B;  1HH2 P;  2KHI A;  3ERS X;  1SEB D;  1HPC A;  3K59 A;  3MEF A;  1I94 Q;  1R9T H;  1CQV A;  3D4W A;  1YJN A;  1IBM Q;  1WVL A;  5CV7 A;  2DNE A;  2BH8 A;  1J8I A;  4I7A A;  2A68 C;  3P1H A;  1RTN A;  2IWH A;  4LF8 Q;  1N32 L;  3CC2 A;  3HOW B;  2NN6 H;  3BYT B;  1TWA H;  4A3F G;  3T53 B;  4H13 C;  1D5M C;  3CCU A;  2HCC A;  1VF7 A;  1AP0 A;  4K8I A;  1TWH H;  2B2W C;  1W2B A;  4X64 L;  1LTT D;  3AYH B;  5GQO A;  4B3T Q;  1PH6 A;  2BA0 A;  2N78 A;  2JXM B;  3OOC A;  2RHS B;  1WTP A;  4L5S A;  1HHV A;  1W6J A;  1FR3 A;  1CI3 M;  3CCE A;  2HT1 A;  1Q90 A;  1HNW L;  1PYW D;  1IW7 D;  1AZQ A;  1JMC A;  3DLL A;  1T5X D;  4RG1 A;  3NQI A;  4N9T A;  4GKK L;  2QGQ A;  1PZI D;  3S17 H;  1V1O A;  2P5Z X;  5GAE C;  4Q5V A;  4LAA A;  4MZ9 A;  2Y0S G;  4IPH A;  1KTK A;  1F77 A;  2KCN A;  2B8G A;  4A3M G;  5CBE E;  3GTP B;  3PCO B;  2H1E A;  5M3M H;  1PLF A;  5KEE A;  1S5F D;  2HIX A;  5JPM C;  4XQQ A;  3OIP A;  4GN3 B;  2B63 G;  1LTB D;  4CDD C;  1H9K A;  4JI4 L;  1PTO C;  3JAM i;  4A3K H;  3CCR A;  3PSI A;  4IUQ A;  2WAQ B;  3V2T A;  4HMI A;  1N32 Q;  4BY1 H;  1SRO A;  2EYF A;  5CV8 A;  3KF6 B;  2L9H A;  3SK5 A;  4M8A A;  4OO1 H;  4TQU S;  2IX3 A;  1BKB A;  1HNX L;  2Z1C A;  3L9A X;  2E74 C;  1Z9F A;  3NEL A;  2NTS A;  4CJ2 C;  2R92 B;  4KKT A;  4X64 Q;  2RSO A;  1C4Q A;  2IL8 A;  1X32 A;  1NBW A;  1O7I A;  2DNC A;  2AWO A;  1CHP D;  2JEB I;  5C6A A;  1EFW A;  1GO3 E;  4A3I G;  1STG A;  2UUC L;  3CP0 A;  5IT9 E;  1HNW Q;  2JK8 A;  5COR A;  5JEA J;  3TP8 A;  5IP7 G;  5IGE A;  3K5M A;  5EAY A;  4C3H B;  5GRO A;  3RZO B;  1DGS A;  4GKK Q;  1QUQ A;  3PV0 A;  2NZO A;  1F9P A;  2EYO A;  2M2L A;  3CCL A;  3OW7 A;  5C3X A;  2KVM A;  3MFY A;  3R8B A;  2XGT A;  3H0G G;  2F03 A;  4DKA C;  2E2D C;  3EIV A;  4DNI A;  5HGT A;  3FKI H;  4HJ9 A;  2JA5 H;  2L4N A;  3MVV A;  1I50 H;  4IPG A;  3GTQ B;  4Y52 H;  2KUM A;  5FK9 C;  4J1M A;  3MC0 B;  1KAB A;  3S24 A;  5C3E B;  1HFG A;  4OX9 L;  4FF1 A;  4U68 A;  1SLJ A;  1QNK A;  2CH4 A;  2PYK A;  1K28 A;  2DJF C;  3J80 L;  1WCM B;  4DK6 C;  1ZYR D;  1HNX Q;  1E3P A;  3S2H H;  4ZKB B;  3J81 c;  1EIY B;  4ABN A;  1Q8I A;  2FHT A;  5IGC A;  3D4R A;  1GM5 A;  1YIJ A;  4TKO B;  5IOC A;  3VA7 A;  1SND A;  3F2D A;  2RF4 A;  2B2Y C;  3DUZ A;  4ZKC B;  4UP9 A;  3I56 A;  1H9R A;  2R93 G;  2I5M X;  2HHH Q;  2EDG A;  1ILQ A;  4ULL A;  3VYU A;  2BA1 A;  4POF A;  3QG1 A;  1SRU A;  1DJR D;  3J7Y W;  1XNR L;  1F9S A;  3I90 A;  1DZ1 A;  3UE1 A;  3VYR A;  1VQA A;  4A3E B;  5M3F H;  4A3D H;  1BXT A;  3HKZ G;  1EUJ A;  2DN8 A;  4FXD A;  4JVZ A;  4YHH L;  3F1Z A;  4LFC L;  4ZUJ A;  2OQ0 A;  1LO5 D;  2GVA A;  3PO3 G;  3R93 A;  2ZXO A;  2EJG C;  4H02 A;  2UXD L;  2UXC L;  4JPB W;  3F2U A;  2RA4 A;  3HOV G;  1Y14 B;  2LXJ A;  5M3M G;  1T5E A;  5ISR A;  3DMU A;  2R7Z H;  5H1S E;  1HNZ L;  2K33 A;  3T56 B;  3MAQ A;  4A3B B;  2NUC A;  1ET6 A;  4HSV A;  4RH6 A;  3HG9 A;  3KDF B;  3I4N H;  1D5Z C;  3NTK A;  2TMP A;  4OX9 Q;  1OO9 B;  4DR3 L;  3NSW A;  3PO2 B;  5CC4 A;  2F0K A;  3S1N B;  3G4S A;  5KNB A;  3N6R A;  3SHL A;  1M8A A;  1YNN C;  1XX8 A;  2C35 B;  1STY A;  1IL2 A;  3D8G A;  2GA4 B;  4OO1 G;  2IHF A;  2G9H D;  3URY A;  1A2U A;  5T1G A;  2OF1 A;  3SK6 A;  2F3I A;  3HOZ H;  3NTI A;  5M5W B;  1MSG A;  4KJN A;  2KED A;  5IP9 H;  1QVG A;  4IJH A;  2DUD A;  1X3G A;  1GUW A;  1CZG A;  4BY7 B;  1VQ4 A;  1LAB A;  3HS0 C;  5D14 A;  3SDZ A;  3G6E A;  3CPF A;  3KLW A;  3I4M H;  5EBD A;  2RDF A;  4YHH Q;  3FP9 A;  4AYB G;  4LNQ A;  5BN3 A;  4LFC Q;  1OXU A;  3NBI A;  4FXK C;  5EPK A;  2LXK A;  2NVX H;  5M9O A;  2XWB B;  4C3I B;  5FLX c;  4A3J B;  1EEI D;  2UXD Q;  2UXC Q;  1SYF A;  2WB1 G;  1ZXT A;  1C7Y A;  1EU4 A;  2WAQ E;  1SXT A;  2JA5 G;  3NXW A;  2A69 C;  2YYZ A;  1HNZ Q;  4LMQ D;  3VA5 A;  4BBR B;  1DOL A;  4P2C B;  3S15 B;  2EY5 A;  2MO1 A;  4DR3 Q;  4OEM B;  4RCO A;  1O78 A;  4DN4 M;  2L0C A;  1IKM A;  4GNX A;  5KGU A;  2XN9 C;  4DV3 L;  3KJP A;  5E3F A;  2NZ1 D;  2UU9 Q;  4IFD H;  3EQL C;  1HZA A;  3S1Q H;  3UDF A;  2Q2I A;  1Y8P B;  3S1R B;  1LLR D;  1KDC A;  1HR0 L;  3GTL B;  1ZEQ X;  4DK3 C;  3H15 A;  3HOY G;  2L11 A;  2LKV A;  1Y1V B;  4EQP A;  4R8I A;  1QZG A;  3M4Y A;  1JJC B;  1XTC D;  4LFA L;  2QEJ C;  4P71 A;  3J80 i;  3EN2 A;  2F4I A;  2Z8L A;  1KLU D;  4KN7 C;  4O42 A;  1Y1W G;  5M3F G;  1HTP A;  3CW2 C;  2QEX A;  3I4L A;  1MGS A;  2E5L L;  4FO2 A;  5M5X B;  5E4X A;  1RCV D;  4B3R L;  5ELB A;  3I2Z A;  1TS3 A;  3J80 E;  5LMN L;  3OW2 A;  3GTP H;  5EQ0 A;  4DR1 L;  2EY6 A;  2B29 A;  1EY8 A;  3J7A 5;  5HUR A;  2WP8 J;  5C0X H;  4YY3 L;  3A7L A;  1E22 A;  1N8R C;  2G5D A;  1YNN D;  1J9O A;  2N49 A;  1FGB D;  2K28 A;  4HJA A;  3BZC A;  2R7Z G;  2EYL A;  1WYD A;  3D6C A;  5IYD G;  1KNA A;  3X3N A;  1E0B A;  3TEH B;  1TII D;  4DV3 Q;  4ME3 A;  3QOL A;  2Q2H A;  2ZJP A;  5I9O A;  4J8Q A;  2E2H B;  3ITP A;  2VQF L;  1V1P B;  4TSS A;  3G71 A;  3CMA A;  2UUB L;  3A55 A;  2JA6 G;  3FMC A;  1S5C D;  2PNH A;  1DYQ A;  1KD1 C;  3HRZ C;  1P16 A;  4DK0 A;  1ENF A;  2ICE C;  4QIW B;  1TR5 A;  4LFA Q;  2KEN A;  2AUJ D;  1Q82 C;  4FNF A;  1B3Q A;  4IUV A;  1KIX A;  1JJ2 A;  3BDC A;  3AFQ A;  5DLQ E;  2A69 D;  4DAP A;  3I4M G;  4KTA A;  2E5L Q;  2AWN A;  2QKI C;  4B3R Q;  2D2C C;  1CTM A;  2K01 A;  5LMN Q;  3GTG B;  4DR1 Q;  3HP3 A;  1E2V A;  3WWV A;  2UXB L;  4YY3 Q;  1KNE A;  3NEM A;  5IYC H;  1CKN A;  1RD9 D;  3J81 j;  2F0N A;  2QCP X;  2XWJ B;  1EQV A;  1JE5 A;  1NE3 A;  1YZ6 A;  4LF7 L;  4DNR B;  1A6X A;  4CJ1 B;  3BU2 A;  1PH1 A;  1IBL L;  3HOW G;  1VF5 C;  2AMC B;  3KLS A;  1C48 A;  2BCO A;  5C44 H;  1WCM H;  4DV0 L;  1K8O A;  1BOS A;  2KOL A;  1L1O A;  4JCV E;  4FF2 A;  1L0W A;  2CVR A;  3UI2 A;  3OMG A;  3S14 H;  1CA6 A;  4LUV A;  4RAU C;  5EPJ A;  2VQF Q;  4R4I A;  4FP5 D;  4JI8 L;  3TZD A;  2BH2 A;  4M1U B;  4WJW A;  3OTO L;  2NVQ B;  2UUB Q;  1C8C A;  2V4D A;  4G7O C;  2B2W A;  1WD1 A;  2ZT9 C;  4HMJ A;  2KHS A;  3BZK A;  1EL0 A;  3D3R A;  4WJ3 M;  5C4X B;  2Z6K C;  2NVY H;  1BR9 A;  1PXU A;  1PTO B;  3K0Y A;  1Q86 C;  3K5O A;  4DV1 L;  1QE6 A;  3VYS A;  1PYS B;  1ICF B;  1YNJ D;  1VMP A;  5C3W A;  1S5D D;  2FMM A;  2AHO B;  3OWE B;  3W3A A;  2UXB Q;  3EA6 A;  4BA1 I;  1OTC A;  5C0X G;  1GUO A;  2NB0 A;  4S3S A;  1SE4 A;  1SE8 A;  2EOT A;  3TP6 A;  4KD4 A;  2PQA A;  1GHJ A;  3K80 C;  2NWG A;  3CCS A;  1TWG B;  1IBL Q;  3A54 A;  4DV0 Q;  1AFP A;  3RLO A;  4OON A;  3PF5 A;  1LT3 D;  1STH A;  2QDL A;  5JAV A;  2HIV A;  4A3F H;  2IPK D;  1WTQ A;  4IUP A;  2R6G A;  1LTI D;  4DV5 Q;  4QCL A;  2R92 G;  1UE7 A;  1E1O A;  4K0K L;  4JI8 Q;  3C2P A;  1Q8K A;  1PH4 A;  2ASB A;  3QB3 A;  3A0J A;  3FEW X;  4LF9 L;  3F2C A;  3FPU B;  1BCP C;  1GD7 A;  3T51 B;  1PFM A;  1YNX A;  5JVG 3;  5BR8 L;  3I8Z A;  1WD0 A;  4PV1 C;  1ML0 D;  4OIJ A;  5FJ8 G;  3CQZ B;  2BE5 D;  4NDX A;  1LT6 D;  1MJE A;  1PRT F;  1JWU D;  5HGQ A;  2NVT B;  4HIM A;  3JAM L;  1AW7 A;  3DM1 A;  4B3M L;  5CV9 A;  3HOX B;  2B2U A;  1TKW B;  4A3J H;  4IUR A;  1BF4 A;  3E0E A;  1SNM A;  2PI2 E;  4DV1 Q;  2A74 C;  5I6Y A;  2XSC A;  4C2M H;  2F0W A;  3K58 A;  2XVS A;  1MKH A;  2K03 A;  5CBA E;  4DUY L;  4A3G B;  3H3V I;  4A3M H;  4B08 A;  1UE5 A;  4IOC A;  3RR5 A;  4KMU C;  1V43 A;  3WOF A;  1EY4 A;  3TS0 A;  1PV4 A;  2J0T D;  1K3B C;  1YJW A;  1G6P A;  4MTK A;  3GTK B;  2DGY A;  3R3O A;  2WKD A;  3S15 H;  4RHS A;  3HKS A;  4X3U A;  5C3E G;  3BG3 A;  1JOO A;  1B3A A;  2CKZ B;  3GTJ H;  4ZK9 B;  1SSO A;  1B53 A;  3H3V C;  2NBF A;  1R4P B;  1VQB A;  1GUS A;  1TWF B;  5HY6 A;  1WCM G;  3KLS X;  1LM0 A;  3NQT A;  2O2L D;  2F0O A;  3AMU A;  3C3L A;  4K0K Q;  2L55 A;  4Y7N H;  2K14 A;  1QCB D;  4LF9 Q;  4QIW E;  1U4P A;  1H9S A;  4RA8 A;  1X6O A;  1VQP A;  5BR8 Q;  4GLV B;  4XTC S;  4GOP A;  2RCN A;  1VQM A;  5IP7 H;  3OYY A;  1JB3 A;  4HTH A;  5KYI A;  2Q2U A;  1YJ9 A;  3K81 C;  3PIP 3;  2F0I A;  1QZH A;  1ENC A;  2NN6 I;  4L5Q A;  1VS0 A;  4LF6 L;  3CCV A;  3P7J A;  3DEO A;  2D0P A;  4XT3 B;  4YCW A;  1ASY A;  4R8N A;  4DUY Q;  3HFZ B;  4MTN A;  3H0G H;  3MWY W;  1O7Z A;  1SYB A;  2A1A A;  3DXJ C;  1A15 A;  3CC7 A;  5J39 A;  1U5K A;  3KOJ A;  4A3B G;  5DNF A;  1W3S A;  3Q6S A;  3W1G A;  1PRT D;  4F88 A;  1KXL A;  1X55 A;  1BCP D;  2WFW A;  3PO2 G;  2VUM B;  3PGZ A;  1FD7 D;  2FXQ A;  1VMC A;  4F8M A;  4V19 0;  1DD2 A;  5C4Z A;  5IOD A;  2IJ0 A;  3G6J B;  1PH8 A;  1A0I A;  1JJG A;  3KF8 A;  3U9O A;  5I9P A;  1DM0 B;  3RUZ A;  1SFO B;  3T4A C;  3VR6 A;  2F0V A;  2K5D A;  3FRP B;  1SR3 A;  1H9M A;  1RKN A;  3K7A H;  4QMG A;  2R93 H;  2E8G A;  4BY7 G;  1Z47 A;  2KEC A;  3MA2 B;  4JV5 Q;  4PMW A;  2B2V C;  5IWA Q;  2CWA A;  2K4K A;  3STB D;  1NMG A;  3W1B A;  1A3T A;  3RN5 A;  3SGI A;  2JSO A;  5NUC A;  1KDA A;  4IQZ A;  4UP7 A;  1CK1 A;  4HJ7 A;  1YHA A;  2AQ2 B;  4LF6 Q;  4XQN A;  3GTG H;  1NCV A;  4C3J B;  3PO3 H;  4C3I G;  4A3J G;  4OO1 I;  3H6M A;  3OWF A;  1II3 A;  2PW7 A;  3SXH A;  1WTX A;  2LS0 1;  3HOV H;  4DR6 L;  1KLG D;  4QGU A;  1UNS A;  1XTD A;  2PCF B;  1G2S A;  3P75 A;  1GVP A;  4DA2 A;  1B7Y B;  2RCF A;  3FPP A;  4BBR G;  1OXT A;  4GS3 A;  1BDO A;  5IGG A;  3CPW A;  3S16 H;  1UEB A;  4LJZ C;  2A5H A;  5BN4 A;  1WFQ A;  2DJG C;  4LUO A;  3RLF A;  1JB7 A;  4JOI A;  1VQ7 A;  3J81 L;  4KHZ A;  3GTO B;  1N9W A;  3ULL A;  3ERQ A;  2MGS A;  3A7A B;  4X3S A;  1EY6 A;  3TRZ A;  3C1F A;  1I4R A;  5E7N A;  3JAM E;  4MN3 A;  3SR1 A;  2EE1 A;  2VZA A;  4KY6 A;  4OIK A;  4GN5 A;  1PTO F;  4BBS B;  1HJP A;  3A5Z B;  3BVG A;  3MEH A;  4BWG B;  3KK7 A;  4PQX A;  1VQG A;  2PQE A;  1Y1V G;  1LAC A;  2I5H A;  5IIF A;  4DK1 A;  1FJG L;  2HHH L;  5C4X H;  1JWS D;  3A8I E;  1N36 L;  3I73 A;  1DOM A;  1EY5 A;  3BJU A;  3U58 A;  3L7Z C;  1D8L A;  3ONA B;  1CT1 D;  3KF6 A;  1R4Q B;  4ZRZ A;  3QO2 A;  2A6H C;  3HOU B;  1WTO A;  2E2J B;  4DXG A;  2A68 D;  2EVB A;  3CF5 A;  2EYP A;  1KRT A;  4DR6 Q;  1X56 A;  3SEB A;  4JW0 A;  3E6Z X;  2MPM A;  2K04 A;  3OSO A;  3RMH A;  1TWG H;  4NKL A;  1IHZ A;  3IAY A;  3PUX A;  1I4Q A;  5IY0 A;  1STA A;  2OCE A;  2Z4I A;  3M4O H;  3QJY A;  2ZM6 L;  1NTG A;  4GZY C;  3I7F A;  3S1M B;  5FLM G;  1IYV A;  1V8Q A;  5IGD A;  4XYQ A;  1CKM A;  1DOK A;  2RSN A;  5CMD A;  4IZ8 A;  1I4P A;  3HOY H;  4OWT B;  4G57 A;  1ESF A;  3CQZ H;  5LHY 1;  1CSP A;  3B6Y A;  1FJG Q;  5C4J H;  3BDL A;  2N8N A;  1N36 Q;  4BXX H;  4AH6 A;  3KBG A;  3K57 A;  1U4L A;  3D4D A;  1KL9 A;  1VDZ A;  1IKL A;  3KLR A;  4E6I A;  1LTG D;  5LL6 S;  2B2T C;  3HOX H;  1Y1W H;  1O7Y A;  5FLX L;  3OIQ A;  1FNU A;  4JBK A;  2AQ1 B;  2PNR C;  4OEL B;  4UDU C;  3AQQ A;  3RNU A;  1VQL A;  1PTO D;  4A3G H;  3U4Z A;  3MXP A;  5JEA G;  4ALP A;  1PH3 A;  2K5V A;  4LF4 Q;  2J4X A;  3DEP A;  1UUP A;  1VQC A;  4KV6 A;  3CCM A;  2PZU A;  1C9O A;  1FNV A;  4UHV A;  2F0F A;  5KND A;  4OWX B;  4A93 B;  1YHQ A;  4R4Q A;  5IYD H;  1CM9 A;  2CHB D;  1UEA B;  1QIL A;  3I3C A;  1U4M A;  4GLX A;  2EIF A;  5M5Y B;  3GTM H;  2ICI A;  2GVB A;  1TY0 A;  2WV6 D;  2ZM6 Q;  4PZ6 A;  2L15 A;  1MI2 A;  4YWL A;  5JVH 3;  1F2Y A;  2KEE A;  2UU9 L;  1SYG A;  3L2P A;  4X66 L;  4JI7 L;  4MNO A;  1ICW A;  1D2B A;  2JA6 H;  1JQY D;  1MIU A;  3G7L A;  3MXU A;  3H94 A;  3KDF A;  4C1N K;  5C4X G;  1H9J A;  2B3G A;  3NE5 B;  4AQY L;  3OHX C;  1I3Q B;  3J81 i;  1B1Z A;  3M7N A;  2Q2T A;  1SMY C;  3M9B A;  3DWA A;  4PNY A;  3X3M A;  3PIO A;  5CV6 A;  1VQK A;  4YCU A;  3DWP A;  4UPA A;  3MFG A;  1EYD A;  1EWI A;  1PH9 A;  3UDX A;  4IFD I;  5ELF A;  4APV A;  3J81 E;  2RHQ B;  3BVM A;  2E2I B;  2JA8 B;  4XDX A;  4FVM A;  4L6T B;  2EYM A;  5D65 A;  1PRT B;  1RL2 A;  4X3K A;  4RCN A;  5JJZ A;  1BCP B;  2PZW A;  3EJI A;  1TVX A;  4Q0F A;  2MNA A;  5FO7 B;  3HOW H;  2SOB A;  3DHQ A;  3M85 A;  4K2K A;  2L12 A;  3CKI B;  4WJ4 A;  1B9N A;  2F0H A;  2Y0S B;  5AFW A;  4RGN A;  1E1T A;  2JE6 I;  1A3U A;  1CKO A;  5JJL A;  1SE2 A;  4X66 Q;  4JI7 Q;  3PIO 3;  2QIL A;  2B63 B;  4GKJ L;  2IHE A;  5C0X I;  4HIO A;  3I72 A;  2RQX A;  1BBX C;  3TP7 A;  3ZYY X;  4AQY Q;  1S40 A;  4BXX G;  4ID6 A;  1EQR A;  5BN5 A;  4FYD A;  3HOX G;  4C3J H;  4PMB A;  1A63 A;  1JR0 D;  2F3V A;  5D3D A;  3WOE A;  1B70 B;  2ZTE A;  1FGU A;  2CH4 W;  1AN8 A;  4A3G G;  3E9H A;  3KYH C;  2SNS A;  3NTH A;  4HN7 A;  4KY7 A;  1HQR D;  3SE0 A;  2K50 A;  4L5R C;  3RZD B;  3IFD A;  5JOB A;  1XMQ L;  1LUZ A;  1U0L A;  1D1K A;  4ME5 A;  1UE6 A;  4RGT A;  3ND9 A;  3CRK C;  2R3Z A;  4JI1 L;  4DAY B;  2R61 A;  1B8A A;  1F9Q A;  4I7Z C;  1F2L A;  1K3R A;  4P75 A;  4P73 A;  1KAA A;  1KDB A;  1D6E C;  2R92 H;  4DUZ Q;  5IYB G;  3M4P A;  4PZ8 A;  5FLX E;  2WII B;  3CRL C;  3LX0 A;  4UP8 A;  1R9T B;  2EPB A;  4GKJ Q;  4LW1 A;  5JJI A;  2VS1 A;  4YWK A;  3SK8 A;  1JOR A;  3T1Y L;  2IX0 A;  3W5O A;  1N33 L;  4IFD J;  1STE A;  2PI2 A;  4NW2 A;  3K5L A;  3C46 A;  1EWC A;  5FJ8 H;  3V05 A;  4H7B A;  2LFN A;  2EY1 A;  3UDG A;  4OXP A;  1TWC B;  1A3V A;  4C3H H;  1TWA B;  4CDE C;  4UY8 C;  3RZO H;  2LMC B;  3CME A;  5C5M A;  5KNC A;  1NMF A;  2QDB A;  1TWH B;  1Z7T A;  2KHJ A;  3LNN A;  3TQY A;  4JBJ A;  5GAD C;  3RD4 A;  1V1P A;  2CCZ A;  4POG A;  4GLA C;  3NHH A;  1XMQ Q;  3GTQ H;  1CZW A;  2YTY A;  3VR5 A;  4A3L G;  4FF3 A;  1Q12 A;  3LGJ A;  4H0L C;  1I6H B;  1HA6 A;  1RDP D;  2VUM G;  5C3E H;  3NWS A;  4JI2 L;  4JI1 Q;  2M9V A;  2MUY A;  3VR2 A;  3SVM A;  4CKB A;  2MFI A;  4LFB L;  2F0P A;  3T13 A;  1MHW C;  3S17 B;  1WTH A;  1A62 A;  2EXD A;  1RHP A;  2KJX A;  4DV5 L;  5J3B A;  5M3M B;  1T9H A;  2G9D A;  1SNO A;  1TS5 A;  4BA2 I;  1MBY A;  3T1Y Q;  2UUA L;  1N33 Q;  1MSH A;  1SJH D;  3F8T A;  5E1F A;  2F0S A;  3BZD B;  1WOC A;  5J22 A;  3MXN B;  1BBU A;  2CFM A;  4A3K B;  4ZCK A;  4BY1 B;  1X65 A;  4A3E H;  4KKU A;  3P20 A;  4QY7 A;  5DAU A;  4CGY B;  4KKS A;  5ELC A;  4QUC A;  3S9W A;  1PA6 A;  4C3J G;  4C3H G;  1EY7 A;  1D1I A;  1F2Z A;  1VQD A;  1NY4 A;  5FO8 B;  1H95 A;  1KC8 C;  1XNQ Q;  2KCT A;  1B9M A;  1YEZ A;  2X69 A;  4L5T A;  4A93 H;  2JA7 B;  3EVQ A;  4F7X A;  4OL7 A;  4A3B H;  4DGZ A;  1XPO A;  3NEN A;  1XJV A;  2X6G A;  4OHJ A;  2Y0S E;  4JI2 Q;  4XT1 B;  3UE0 A;  3J7A F;  4ZUI A;  4TRD A;  3PO2 H;  2WAQ G;  1Z6H A;  3S1N H;  4LFB Q;  1BO0 A;  1OXV A;  1S5B D;  1X3E A;  2VNU D;  4DAM A;  1V1Q A;  2KCM A;  1PZK D;  4EQO A;  1SNC A;  2I46 A;  5KYL A;  1P8L A;  4CJ0 B;  2WB1 B;  5CV4 A;  4BBS G;  4P72 A;  5M5W H;  2D62 A;  3FKI B;  4IUT A;  2OT2 A;  2QA4 A;  2KCC A;  1GHK A;  5CV5 A;  4GNX C;  4PZ7 A;  2UUA Q;  3M4Q A;  1I50 B;  2B8F A;  1HR0 W;  1EIH A;  1EQT A;  4LWC A;  2VB3 X;  1HZB A;  2D0O A;  4BY7 H;  1PMR A;  1VQH A;  5JPN C;  1I3Q H;  4QQB X;  2D5D A;  1HA5 A;  3T16 A;  4FDB A;  3JC6 6;  4TVA B;  2Q8R E;  2F0D A; 
#chains in the Genus database with same CATH homology
 1BCP F;  2FMC A;  4KK7 A;  1GXD C;  3QOJ A;  5ELE A;  1HTL D;  4EVO A;  1CQF A;  3E0J A;  2JEA I;  2RDH A;  2WIN B;  4HCS A;  5F2D A;  2FFK B;  4LK1 C;  4DXF A;  1MD2 D;  3GO5 A;  4KJO A;  3Q23 A;  2K32 A;  3R2I A;  2JYO A;  3MTS A;  4B9W A;  5I2X A;  4A3D B;  5A2Q L;  4KY5 A;  5DM7 3;  4V0B A;  4ZAI A;  3PMF A;  1HRJ A;  3L3O C;  1LTA D;  3IL8 A;  2LY7 A;  1IW7 C;  1SDF A;  2BDN A;  2K05 A;  2OEO A;  2R7Z B;  1ENA A;  2CQA A;  3D6W A;  2BDO A;  4ZYS A;  3I4N B;  5DEH A;  1NSN S;  1PDQ A;  1LTS D;  4JK1 C;  2IW3 A;  2N88 A;  4KD3 A;  1RTO A;  2I07 B;  2SDF A;  1HQM C;  1HUM A;  2F3W A;  2B2Y A;  1NR4 A;  5LL6 X;  4R9W A;  1TY2 A;  3EFX D;  1O7L A;  1IL8 A;  3HOZ B;  3KBX A;  4K5V A;  2SEB D;  5G3L D;  1B50 A;  1CA5 A;  2EYJ A;  4QB4 A;  3A8K E;  4Z9C B;  4RGM A;  2PO4 A;  1ET9 A;  1JIC A;  2K5Q A;  1EY0 A;  1I4H A;  1Y8O B;  4RGO S;  1LT5 D;  4HSP A;  1QB5 D;  3Q24 A;  3H91 A;  4HCE A;  1STB A;  3OMC A;  3KUP A;  4WFN 3;  1JE4 A;  2XRS D;  1NUC A;  1XXG A;  1OXX K;  2EJF C;  1S4Z A;  4G7Z C;  3AB9 A;  1QWY A;  3S1Q B;  3VR4 A;  5JEA H;  3NWT A;  1CHQ D;  1ZYR C;  1G8Z D;  4DNT B;  1QG7 A;  3TBI B;  1EOT A;  3CU7 A;  1DXM A;  1E2W A;  4CHT B;  1Q3L A;  4C1N I;  2F0U A;  1CFM A;  3GD7 A;  3K6O A;  1SYD A;  5EKL A;  5EPL A;  2F0M A;  3Q22 A;  4L8J A;  3QIA A;  4IUN A;  5EGT A;  5T1I A;  1EEF D;  4B9X A;  2YU9 B;  2XRQ D;  4K6D A;  1FYC A;  4N9P A;  2VB2 X;  4K5W A;  4DAV A;  3V96 A;  1ONL A;  1Q1E A;  1AZP A;  1D5X C;  3PUW A;  2ENB A;  1LT4 D;  1B4O A;  2BOS A;  1PTO H;  4HR7 B;  3J7A V;  2KQ3 A;  4L63 B;  3TZU A;  5A2Q E;  1I6V C;  2ZXR A;  1EY9 A;  1QJO A;  5COY A;  2B2U C;  2ID0 A;  2FJ2 A;  4BS9 A;  4U67 3;  3M7G A;  1NR2 A;  2MP1 A;  2PZT A;  1L0X B;  3NK9 A;  1OXS C;  2FIN B;  3I91 A;  3M3Y B;  1SE3 A;  2KA7 A;  3BVZ A;  3FDT A;  3O13 A;  4WRD A;  2B39 A;  1G2T A;  2L1B A;  2E76 C;  1GJX A;  1GUG A;  4RFB A;  4OGQ C;  5C44 B;  2NN6 G;  3AU7 A;  3BDO A;  5DM6 3;  1E2Z A;  3NUC A;  3S14 B;  1JOQ A;  3HGB A;  1FNW A;  1GUT A;  3ERO A;  3H09 A;  1TQO A;  5IGB A;  3TDQ A;  3QWN A;  2O5J C;  4EQN A;  2HQE A;  4ILW A;  2DY8 A;  3TP5 A;  2F0T A;  1Q1B A;  5FOB B;  2NVY B;  2X6L A;  1QNU A;  2F0E A;  2HDL A;  1O80 A;  5E4W C;  3HEJ A;  2F0L A;  3IFT A;  1K83 B;  4XYO A;  1TT2 A;  1PFB A;  3DWQ A;  3GV3 A;  1WTW A;  2A6H D;  2Q8T A;  1XYI A;  3WDN A;  1EZ6 A;  4A3F B;  2TSS A;  3TSS A;  2HUG A;  4K2L A;  1G6Z A;  2K7V A;  1LV9 A;  2RBM A;  3C1E A;  4UAI A;  5KRU A;  3D31 A;  4NMZ A;  1F2M A;  2SNM A;  4G7H C;  2O5I C;  2A6E C;  3PUV A;  1BUV T;  5TSS A;  2E75 C;  1LTR D;  5EKI A;  1S5E D;  3U9S A;  4C2M B;  1EYA A;  4A3M B;  5EBC A;  2Q8I B;  4XQJ A;  2IX1 A;  2ZXP A;  4X3T A;  2DY7 A;  1EIG A;  2RDG A;  3BYY B;  5EKK A;  3VYT A;  3GTJ B;  3PUZ A;  2IT1 A;  4DU9 A;  4MHE A;  2VXW A;  4K6L A;  3NP8 A;  2K1B A;  1JC7 A;  2C9O A;  4Y7N B;  1HCZ A;  4DFA A;  3TME A;  1Y8N B;  5C4H A;  2WKC A;  5I2Y A;  2PPB C;  4MIU A;  3IKJ A;  4RKB A;  4A3I B;  4RKL A;  4C56 C;  4FXG C;  4CKE A;  3S2D B;  3A8J E;  4KN4 C;  3R2T A;  2A73 B;  1JWM D;  3PUY A;  2CW0 C;  5CGK A;  3CHB D;  2HDM A;  2PMZ B;  4ZLT F;  1PZJ D;  1BNZ A;  3GV6 A;  3H0G B;  1WTR A;  3E5S A;  5K36 H;  2F0G A;  2RVL A;  3OPO A;  1SMY D;  4CBV A;  4WOR A;  1M4V A;  1YNJ C;  3MHB A;  4F87 A;  1NAP A;  4KI0 A;  3FVQ A;  2A6E D;  5I6W A;  2MJ8 A;  1TS4 A;  4DAY A;  2MHV A;  2HCI A;  2F0J A;  2Z4H A;  1EZ8 A;  2NTT A;  4NP5 A;  3K7A B;  2R93 B;  2WAC A;  4O1N A;  1SBB B;  2K5W A;  3I70 A;  5IGF A;  5C0X J;  5CR3 A;  3HKZ B;  4IAL A;  1B44 D;  2O4X A;  3PO3 B;  2BE5 C;  3ND8 A;  1TU2 B;  4DF7 A;  2L5T A;  1JCK B;  3LWE A;  3HOV B;  1RF2 D;  4K5X A;  1ESR A;  3A56 A;  5CYU A;  2EY2 A;  4H44 C;  3S16 B;  1L0Y B;  1VCI A;  2H4O A;  4KHV A;  3W2D A;  4IFD G;  4I65 A;  2QF7 A;  4QF4 A;  2B2V A;  1UAP A;  3BS1 A;  2D9U A;  4IN3 A;  1U4R A;  2CW0 D;  3TN2 A;  1JOK A;  1HUN A;  2PW5 A;  1QOH A;  1X3Q A;  1X3P A;  1SYE A;  1F9R A;  1SJE D;  3MXN A;  2RKS A;  2AUK A;  4EGV A;  2EYH A;  4AYB B;  1TS2 A;  1G29 1;  4K8J A;  3SK4 A;  2XNA C;  2F0Q A;  2J7Z A;  1I4G A;  3Q0A A;  4IUU A;  2M00 A;  1DON A;  2JA5 B;  1HXY D;  5ELD A;  5K36 G;  1A2T A;  4XIG S;  5G3L F;  1SNQ A;  3NPP A;  5FKA C;  1SYC A;  1EU3 A;  5A35 A;  1I4X A;  1BQQ T;  2XIW A;  4JBW A;  3M4O B;  5K5P A;  1PRT C;  1ILP A;  3S2H B;  1EWH A;  2K6A A;  2N55 A;  4XXE A;  1SAP A;  2EXZ A;  3GP7 A;  1DCZ A;  3HOY B;  3NBH A;  4ZQ3 A;  5KIX A;  5C4J B;  1K8M A;  1B2T A;  4YIJ A;  2F1M A;  1Y1W B;  5M3F B;  4ODG A;  2JP1 A;  4RHR A;  4HED A;  1H9S B;  1SNP A;  1GUN A;  5FO9 B;  1GOZ A;  5IT9 L;  1ZKO A;  1W6K A;  5J1Z A;  2OXP A;  1EFI D;  1RJT A;  4QUF A;  3LWU A;  3MXG A;  2EZV A;  5D3I B;  4K14 A;  4RWS C;  1PFN A;  1IYU A;  1ROD A;  1HFN A;  4CKC A;  1U9R A;  3GTM B;  5C5L A;  1G91 A;  1EYC A;  1STN A;  5EJW A;  3HZX A;  3MZ5 A;  4PMC A;  4G4K A;  5I4D A;  2JA6 B;  2B2T A;  4J6H A;  3VR3 A;  2AQ3 B;  4FF4 A;  3N52 A;  1WTV A;  1Y69 U;  1AEX A;  2C5C A;  2EJM A;  1XWE A;  3GQB A;  3K5N A;  3I4M B;  4HAE A;  2NYZ D;  2NVX B;  1SEB D;  1HPC A;  3K59 A;  1CQV A;  3D4W A;  1WVL A;  5CV7 A;  2DNE A;  1J8I A;  2A68 C;  3P1H A;  1RTN A;  2IWH A;  3HOW B;  2NN6 H;  3BYT B;  3T53 B;  4H13 C;  1D5M C;  2HCC A;  1VF7 A;  1AP0 A;  4K8I A;  2B2W C;  1LTT D;  2BA0 A;  2JXM B;  3OOC A;  1WTP A;  1HHV A;  1W6J A;  1FR3 A;  1CI3 M;  1Q90 A;  1PYW D;  1IW7 D;  1AZQ A;  1T5X D;  3NQI A;  4N9T A;  1PZI D;  1V1O A;  4Q5V A;  4LAA A;  1KTK A;  1F77 A;  2KCN A;  2B8G A;  5CBE E;  3GTP B;  2H1E A;  1PLF A;  5KEE A;  1S5F D;  5JPM C;  4XQQ A;  3OIP A;  1LTB D;  1H9K A;  1PTO C;  4IUQ A;  2WAQ B;  3V2T A;  4HMI A;  2EYF A;  5CV8 A;  2L9H A;  3SK5 A;  4M8A A;  4OO1 H;  4TQU S;  2IX3 A;  2Z1C A;  2E74 C;  2NTS A;  3L9A X;  4CJ2 C;  2R92 B;  4KKT A;  2RSO A;  1C4Q A;  2IL8 A;  1X32 A;  2DNC A;  2AWO A;  1CHP D;  2JEB I;  5C6A A;  1STG A;  5IT9 E;  5COR A;  5JEA J;  3TP8 A;  5IGE A;  3K5M A;  4C3H B;  3RZO B;  3PV0 A;  1F9P A;  2EYO A;  2M2L A;  3OW7 A;  5C3X A;  2KVM A;  3MFY A;  3R8B A;  2F03 A;  2E2D C;  5HGT A;  2L4N A;  3MVV A;  3GTQ B;  2KUM A;  5FK9 C;  4J1M A;  2F0D A;  3MC0 B;  1KAB A;  5C3E B;  1HFG A;  4FF1 A;  4U68 A;  1QNK A;  2PYK A;  3J80 L;  1WCM B;  1ZYR D;  4ZKB B;  4ABN A;  1Q8I A;  2FHT A;  5IGC A;  3D4R A;  4TKO B;  5IOC A;  3VA7 A;  1SND A;  2B2Y C;  3DUZ A;  4ZKC B;  1H9R A;  2EDG A;  1ILQ A;  4ULL A;  3VYU A;  2BA1 A;  3QG1 A;  1DJR D;  3J7Y W;  1F9S A;  3I90 A;  1DZ1 A;  3VYR A;  4A3E B;  1BXT A;  2DN8 A;  4FXD A;  4ZUJ A;  1LO5 D;  3R93 A;  2ZXO A;  2EJG C;  3F2U A;  2RA4 A;  1T5E A;  5ISR A;  3DMU A;  2K33 A;  3T56 B;  3MAQ A;  4A3B B;  2NUC A;  1ET6 A;  4HSV A;  4RH6 A;  3HG9 A;  1D5Z C;  3NTK A;  2TMP A;  1OO9 B;  3NSW A;  3PO2 B;  5CC4 A;  2F0K A;  3S1N B;  5KNB A;  3N6R A;  3SHL A;  1M8A A;  1YNN C;  1XX8 A;  1STY A;  3D8G A;  2GA4 B;  4OO1 G;  2G9H D;  3URY A;  1A2U A;  5T1G A;  2OF1 A;  3SK6 A;  3NTI A;  5M5W B;  1MSG A;  4KJN A;  2KED A;  1GUW A;  1CZG A;  4BY7 B;  1LAB A;  3HS0 C;  5D14 A;  3SDZ A;  5EBD A;  2RDF A;  5BN3 A;  1OXU A;  3NBI A;  4FXK C;  5EPK A;  5M9O A;  2XWB B;  4C3I B;  4A3J B;  1EEI D;  1SYF A;  1ZXT A;  1EU4 A;  1SXT A;  3NXW A;  2A69 C;  2YYZ A;  4LMQ D;  3VA5 A;  4BBR B;  1DOL A;  4P2C B;  3S15 B;  2EY5 A;  4RCO A;  1O78 A;  4DN4 M;  2L0C A;  1IKM A;  5KGU A;  2XN9 C;  5E3F A;  2NZ1 D;  4IFD H;  3EQL C;  1Y8P B;  3S1R B;  1LLR D;  1KDC A;  3GTL B;  1ZEQ X;  2L11 A;  2LKV A;  1Y1V B;  4EQP A;  4R8I A;  3M4Y A;  1XTC D;  2QEJ C;  2F4I A;  2Z8L A;  1KLU D;  4KN7 C;  4O42 A;  1HTP A;  3I4L A;  1MGS A;  4FO2 A;  5M5X B;  5E4X A;  1RCV D;  5ELB A;  1TS3 A;  3J80 E;  5EQ0 A;  2EY6 A;  1EY8 A;  5HUR A;  2WP8 J;  5C0X H;  3A7L A;  1YNN D;  1J9O A;  1FGB D;  2K28 A;  2EYL A;  3D6C A;  1KNA A;  3X3N A;  1E0B A;  1TII D;  3QOL A;  5I9O A;  4J8Q A;  2E2H B;  3ITP A;  1V1P B;  4TSS A;  3A55 A;  3FMC A;  1S5C D;  1DYQ A;  3HRZ C;  4DK0 A;  1ENF A;  2ICE C;  4QIW B;  1TR5 A;  2AUJ D;  4FNF A;  4IUV A;  3BDC A;  2A69 D;  4DAP A;  4KTA A;  2AWN A;  2QKI C;  2D2C C;  1CTM A;  2K01 A;  3GTG B;  3HP3 A;  1E2V A;  1KNE A;  1RD9 D;  2F0N A;  2QCP X;  2XWJ B;  1EQV A;  4DNR B;  1A6X A;  4CJ1 B;  1VF5 C;  2BCO A;  1C48 A;  3KLS A;  1K8O A;  1BOS A;  2KOL A;  4FF2 A;  2CVR A;  3UI2 A;  3OMG A;  1CA6 A;  4RAU C;  5EPJ A;  4FP5 D;  3TZD A;  4M1U B;  4WJW A;  2NVQ B;  1C8C A;  2V4D A;  4G7O C;  2B2W A;  1WD1 A;  2ZT9 C;  4HMJ A;  2KHS A;  1EL0 A;  3D3R A;  5C4X B;  1BR9 A;  1PXU A;  1PTO B;  3K0Y A;  3K5O A;  1QE6 A;  3VYS A;  1YNJ D;  1VMP A;  5C3W A;  1S5D D;  2FMM A;  3W3A A;  3OWE B;  3EA6 A;  4BA1 I;  5C0X G;  1GUO A;  2NB0 A;  4S3S A;  1SE4 A;  2EOT A;  3TP6 A;  4KD4 A;  1GHJ A;  2NWG A;  1TWG B;  3A54 A;  1AFP A;  1LT3 D;  1STH A;  5JAV A;  2IPK D;  1WTQ A;  4IUP A;  2R6G A;  1LTI D;  4QCL A;  3C2P A;  3QB3 A;  3FEW X;  3FPU B;  1BCP C;  3T51 B;  1PFM A;  5JVG 3;  3I8Z A;  1WD0 A;  4PV1 C;  1ML0 D;  4OIJ A;  3CQZ B;  2BE5 D;  4NDX A;  1LT6 D;  1PRT F;  1JWU D;  2NVT B;  3JAM L;  1AW7 A;  3DM1 A;  5CV9 A;  3HOX B;  2B2U A;  1TKW B;  4IUR A;  1BF4 A;  1SNM A;  2A74 C;  5I6Y A;  2XSC A;  2F0W A;  3K58 A;  2XVS A;  2K03 A;  5CBA E;  4A3G B;  4B08 A;  4KMU C;  1V43 A;  3WOF A;  1EY4 A;  2J0T D;  3GTK B;  3R3O A;  2WKD A;  4RHS A;  4X3U A;  3BG3 A;  1JOO A;  1B3A A;  4ZK9 B;  1SSO A;  1B53 A;  3H3V C;  2NBF A;  1R4P B;  1GUS A;  1TWF B;  3KLS X;  3NQT A;  2O2L D;  2F0O A;  3AMU A;  3C3L A;  2L55 A;  1QCB D;  1U4P A;  1H9S A;  4RA8 A;  4XTC S;  1JB3 A;  4HTH A;  5KYI A;  3PIP 3;  2F0I A;  1ENC A;  2NN6 I;  3P7J A;  3DEO A;  4XT3 B;  4R8N A;  3MWY W;  1O7Z A;  1SYB A;  3DXJ C;  1A15 A;  5J39 A;  5DNF A;  3Q6S A;  1PRT D;  4F88 A;  1BCP D;  2VUM B;  1FD7 D;  1VMC A;  4F8M A;  4V19 0;  1DD2 A;  5C4Z A;  5IOD A;  2IJ0 A;  3G6J B;  3KF8 A;  3U9O A;  5I9P A;  1DM0 B;  3RUZ A;  1SFO B;  3T4A C;  3VR6 A;  2F0V A;  2K5D A;  3FRP B;  1H9M A;  1RKN A;  4QMG A;  1Z47 A;  2KEC A;  3MA2 B;  4PMW A;  2B2V C;  1A3T A;  2JSO A;  5NUC A;  1KDA A;  4IQZ A;  1CK1 A;  2AQ2 B;  4XQN A;  1NCV A;  4C3J B;  4C3I G;  4OO1 I;  3H6M A;  3OWF A;  1II3 A;  2PW7 A;  3SXH A;  1WTX A;  2LS0 1;  1KLG D;  1UNS A;  2PCF B;  1G2S A;  3P75 A;  4DA2 A;  3FPP A;  1OXT A;  1BDO A;  5IGG A;  4LJZ C;  2A5H A;  5BN4 A;  3RLF A;  3J81 L;  4KHZ A;  3GTO B;  3ERQ A;  2MGS A;  3A7A B;  4X3S A;  1EY6 A;  3C1F A;  1I4R A;  3JAM E;  4MN3 A;  3SR1 A;  2EE1 A;  4KY6 A;  4OIK A;  1PTO F;  4BBS B;  3BVG A;  3MEH A;  4BWG B;  3KK7 A;  4PQX A;  2PQE A;  1LAC A;  5IIF A;  4DK1 A;  1JWS D;  3A8I E;  3I73 A;  1DOM A;  1EY5 A;  3L7Z C;  3ONA B;  1CT1 D;  1R4Q B;  4ZRZ A;  3QO2 A;  2A6H C;  3HOU B;  1WTO A;  2E2J B;  4DXG A;  2A68 D;  2EVB A;  2EYP A;  3SEB A;  3E6Z X;  2MPM A;  2K04 A;  3OSO A;  3RMH A;  4NKL A;  1IHZ A;  3IAY A;  3PUX A;  1I4Q A;  1STA A;  2Z4I A;  3QJY A;  4GZY C;  3S1M B;  1IYV A;  1V8Q A;  5IGD A;  4XYQ A;  1DOK A;  2RSN A;  5CMD A;  4IZ8 A;  1I4P A;  4G57 A;  1ESF A;  5LHY 1;  3BDL A;  3KBG A;  3K57 A;  1U4L A;  3D4D A;  1VDZ A;  1IKL A;  3KLR A;  4E6I A;  1LTG D;  5LL6 S;  2B2T C;  1O7Y A;  5FLX L;  3OIQ A;  1FNU A;  2AQ1 B;  2PNR C;  4UDU C;  1PTO D;  3MXP A;  5JEA G;  2J4X A;  3DEP A;  1UUP A;  4KV6 A;  2PZU A;  1FNV A;  2F0F A;  5KND A;  4A93 B;  1CM9 A;  2CHB D;  1UEA B;  1QIL A;  3I3C A;  1U4M A;  5M5Y B;  2ICI A;  1TY0 A;  2WV6 D;  1MI2 A;  5JVH 3;  1F2Y A;  2KEE A;  1SYG A;  1D2B A;  1ICW A;  1JQY D;  3G7L A;  3MXU A;  3H94 A;  4C1N K;  1H9J A;  3NE5 B;  3OHX C;  1I3Q B;  1B1Z A;  3M7N A;  1SMY C;  3DWA A;  4PNY A;  3X3M A;  5CV6 A;  3DWP A;  3MFG A;  1EYD A;  4IFD I;  5ELF A;  3J81 E;  3BVM A;  2E2I B;  2JA8 B;  4XDX A;  4FVM A;  4L6T B;  2EYM A;  5D65 A;  1PRT B;  4X3K A;  4RCN A;  5JJZ A;  1BCP B;  2PZW A;  3EJI A;  1TVX A;  4Q0F A;  5FO7 B;  2SOB A;  3DHQ A;  3M85 A;  4K2K A;  2L12 A;  3CKI B;  1B9N A;  2F0H A;  2Y0S B;  5AFW A;  4RGN A;  2JE6 I;  1A3U A;  1SE2 A;  3PIO 3;  2QIL A;  2B63 B;  5C0X I;  3I72 A;  2RQX A;  1BBX C;  3TP7 A;  3ZYY X;  4ID6 A;  5BN5 A;  4FYD A;  4PMB A;  1JR0 D;  2F3V A;  5D3D A;  3WOE A;  1AN8 A;  3NTH A;  2SNS A;  4HN7 A;  4KY7 A;  1HQR D;  3SE0 A;  3RZD B;  3IFD A;  5JOB A;  1D1K A;  4ME5 A;  4RGT A;  3ND9 A;  3CRK C;  2R3Z A;  2R61 A;  1F9Q A;  4I7Z C;  1F2L A;  1KAA A;  1KDB A;  1D6E C;  5FLX E;  2WII B;  3CRL C;  3LX0 A;  1R9T B;  2EPB A;  3SK8 A;  1JOR A;  2IX0 A;  4IFD J;  1STE A;  4NW2 A;  3K5L A;  3C46 A;  1EWC A;  3V05 A;  4H7B A;  2LFN A;  2EY1 A;  1TWC B;  1A3V A;  1TWA B;  2LMC B;  5C5M A;  5KNC A;  2QDB A;  1TWH B;  1Z7T A;  3LNN A;  3RD4 A;  1V1P A;  3NHH A;  1CZW A;  3VR5 A;  4FF3 A;  1Q12 A;  4H0L C;  1I6H B;  1HA6 A;  1RDP D;  3NWS A;  2M9V A;  2MUY A;  3VR2 A;  3SVM A;  4CKB A;  2F0P A;  3T13 A;  3S17 B;  1RHP A;  2KJX A;  5M3M B;  2G9D A;  1SNO A;  1TS5 A;  4BA2 I;  1MBY A;  1MSH A;  1SJH D;  5E1F A;  2F0S A;  3BZD B;  5J22 A;  4A3K B;  4BY1 B;  4KKU A;  3P20 A;  5DAU A;  4CGY B;  4KKS A;  5ELC A;  4QUC A;  3S9W A;  4C3J G;  1EY7 A;  1D1I A;  1F2Z A;  5FO8 B;  1B9M A;  2X69 A;  2JA7 B;  3EVQ A;  4F7X A;  4OL7 A;  4DGZ A;  2X6G A;  4OHJ A;  4XT1 B;  3J7A F;  4ZUI A;  4TRD A;  1Z6H A;  1BO0 A;  1OXV A;  1S5B D;  2VNU D;  1PZK D;  4EQO A;  1SNC A;  2I46 A;  5KYL A;  4CJ0 B;  2WB1 B;  5CV4 A;  2D62 A;  3FKI B;  4IUT A;  2OT2 A;  2KCC A;  1GHK A;  5CV5 A;  1I50 B;  2B8F A;  1EIH A;  1EQT A;  2VB3 X;  1PMR A;  5JPN C;  2D5D A;  1HA5 A;  3T16 A;  2Q8R E;  4C3H G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...