5D1IA

Structure of cyclic nucleotide-binding-like protein from brucella abortus bv. 1 str. 9-941
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
117
structure length
117
Chain Sequence
ALDDDIRILGTVGLFESFTPEQLRLLAFGAERLVLRAGRELFREGQSADCAYIIVTGTITLFHEGDEGRVTIRPVGPGAILGEMALIAQTTRLTGAVADVETEVIRISRSIFRRILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cyclic nucleotide-binding-like protein from Brucella abortus
pubmed doi rcsb
source organism Brucella abortus biovar 1
molecule tags Unknown function
molecule keywords Cyclic nucleotide-binding protein
total genus 30
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5d1iA00
1NYWA 1CAWB 4YSFA 3SMHA 5JCTA 5FQ0A 5I93A 2B9UA 2XHKA 2MPFA 2IXCA 5I0RA 4I02A 4N9HA 4Q0SA 4F8AA 4MGIE 4MV2A 5LRSA 3FZ3A 5J3UA 2Q30A 3ELNA 3NJZA 1G6NA 3U0ZA 3BB6A 4HVRA 4YYOA 1DGRA 5CVRA 3MPBA 4IEZA 3H8UA 4IEYA 1WGPA 3QOPA 1WLTA 4B29A 3HQXA 1O3TA 3TNPB 5AVPA 3I7DA 2OPKA 3JZVA 3M70A 4JTOA 5J48A 5JR7B 4X6RB 2PQQA 2GAUA 2XLGA 3OCPA 3UKTA 2PFWA 2UY8A 4ZU5A 1U12A 3S0MA 2H6CA 2VQAA 4PIXA 1EP0A 2V09A 5CADA 2QVSB 4XF4A 1X8EA 1X82A 2O8QA 1NE4A 2B8MA 2ET1A 3EO6A 2PA7A 3ES1A 1O3SA 1QY4A 4AXOA 2CAUA 3MZHA 2H0VA 2PYTA 3NVCA 5K8SA 2DCTA 1VJ2A 1CAVA 3D82A 3KCCA 4XF9A 5EZWA 1QXRA 3QACA 3I59B 3ZDSA 3SHRA 1RUNA 4IEUA 1UIJA 1FI2A 3NW4A 1O7FA 3LA7A 1VR3A 3ACLA 4BYYA 2OYZA 4IEQA 2GC0A 5EFUA 5JSRA 4E2GA 2QNKA 3D0SA 3NKTA 2VECA 3BPZA 4Z07A 3OGJA 1ZZ6A 3E5XA 4XF1A 5BV6A 1NE6A 3LWCA 3RYPA 1Y9QA 2IXLA 1ZVFA 1YFWA 1GQHA 2ETEA 4ZU7A 1CAUB 4HVOA 4HSJA 1ZZ7A 1ZRDA 3KGLA 4A2UA 2ATFA 4XFGA 4AQ2A 5BXXA 3PNAA 5JSOA 4YARA 4IESA 1OD5A 4I09A 2GC2A 3O14A 2CGPA 3IDCB 3E5QA 1UIKA 5LRRA 1YHFA 2EVXA 4BH9A 4LULA 1X8MA 4L2NA 1J1LA 1SFNA 2HJIA 3H3ZA 5FLJA 3KSCA 2PHDA 3OTFA 3DV8A 2PAKA 1L3JA 4QGLA 5FLIA 1O5UA 2QJVA 1I5ZA 2O1QA 3H7YA 5JSPA 4K8FA 2B5HA 3RPQA 1OI6A 1TQ5A 4UBHA 2IXIA 4AVCA 2MNGA 2D5HA 3E6BA 4X6QB 1ZRCA 3E6DA 1H1MA 4R8HA 4EWAA 5E16A 5E1RA 3LOIA 1RL3A 4UXAA 1VP6A 3N4MA 3KGZA 4J1XA 3VHRA 5I0UA 3G7DA 4CYDA 1CAVB 3IIAA 2EAAA 4IEPA 2Q4SA 3H7JA 5LEJA 5C8WA 5KHGA 1EPZA 5FPXA 4FT8A 2BNMA 3M3IA 3C3VA 3CJXA 2D93A 4FAHA 4MZUA 3DKWA 4LA3A 1J3PA 1J58A 3BCWA 3FJSA 1NXMA 2K9ZA 1ZZCA 2EA7A 3H50A 4MUVA 4EWEA 1CAWA 4IEVA 1YFYA 1DZRA 2KXLA 4QGNA 4IEOA 3OF1A 3PLQA 3L2HA 4O9EA 4HLTA 3WW2A 1XE8A 3CO2A 4I01A 2XLFA 2XKPA 1HW5A 1Q5OA 5C6CA 3S7IA 2UYBA 4HN0A 5D1IA 4MX3A 1I6XA 4GULA 2Z2SB 4O9GA 4QXKA 2GC3A 3GYDA 3DN7A 1X7NA 2OA2A 1Q43A 4QM9A 4I0BA 3E6CC 2XLAA 4XFBA 4JVAA 4XEZA 3OD0A 3ES4A 5FQ0B 1ZZ8A 1Q3EA 2K0GA 3FFQA 3FWEA 3HT1A 2QDRA 4HSLA 3EQEA 3RDIA 2BEOA 1J3QA 1O3RA 3CEWA 2WFPA 4I0AA 4LLOA 4EWDA 1YWKA 3TNQA 3RZZA 4ONUA 3HT2A 3EHKA 2PAMA 4KU8A 4LEJA 3GBFA 3LA2A 1RUOA 3RYKA 3LZZA 4EROA 1LB2A 4XFIA 1PM7A 5KHHA 3BALA 3CL1A 3WW1A 4IERA 3MYXA 4RD7A 4HVQA 5KHJA 4QMAA 2XL9A 4LUMA 4Q0UA 4E2QA 1RC6A 4TLFA 4LTAA 1XRUA 1SQ4A 2MHFA 4IEXA 1ZX5A 1YFUA 2BGCA 2BYVE 4IETA 4MGYE 1IPJA 2Y0OA 1UW8A 3RYRA 2OZJA 2BNNA 4XFFA 1H1IA 4J1WA 2QCSB 1ZZBA 3IWZA 3ROUA 1ZZ9A 1UPIA 2C0ZA 2Q1ZB 1OFNA 4PIZA 2D40A 3I59A 4HMZA 4QX5A 3B02A 5LEKA 3FHIB 4Q0PA 5FDBA 4FAGA 4LUKA 1CAXB 3H1MA 2Q0AA 3NSTA 1J59A 2GC1A 4I2OA 4IEWA 2IXHA 3KMHA 2UYAA 4BIFA 4KL1A 3MDPA 2XGXA 4KWLA 1UCXA 4P9GA 4JV4A 3LA3A 4ZU4A 2UY9A 1CAXA 1PMIA 3H3UA 1QXJA 4HN1A 1O5LA 4MGKE 3H1YA 2GH2A 4R52A 1O4TA 3CF6E 4WBBA 2WC2A 1CAUA 3CLPA 4YRDA 4D7SA 2ZKLA 4UBGA 2HKXA 3H1WA 3UKNA 4AVAA 5CU1A 1RGSA 4MH0E 5T3NA 1DGWA 1OMIA 2PTMA 4PIYA 1O3QA 3HIFA 1CX4A 4XF0A 2VPVA 1LR5A 1YFXA 2GU9A 2FQPA 1EYBA 3EBRA 2F4PA 5FPZA 1WA4A 3IDBB 5I0SA 5I8TA 4PJYA 2XKOA 3D0JA 4WZCA 4I3PA 4E2SA 5KHIA 1CGPA 2ET7A 1J3RA 3E5UA 1Y3TA 3I54A 2IXKA 4MGZE 5F1RA 4JTNA 1IPKA 3U10A 4QM8A 4YNIA 4Q0VA 4Z82A 2I45A 4OLLA 3WW4A 4AVBA 3USSA 5I8SA 1XE7A 3S7EA 1FXZA 3IBMA 4KWJA 2CAVA 4LA2A 4KWKA 3FX3A 1JUHA 4KU7A 2PHLA 1SEFA 5BUVA 2OZ6A 5FLHA 1V70A 1ZRRA 2PAEA 2XL7A 2Z69A 4XFAA 3R6SA 3WW3A 4WVZA 1YUDA 5BY5A 4XF3A 5FCCA 4QGMA 3SCFA 3NL1A 1GQGA 2E9QA 2H6BA 4AQ6A 3U11A 1ZRFA 3BU7A 3E97A 5BPXA 3UKVA 2ZCWA 4XETA 4BHPA 5I8YA 5KHKA 3SCGA 5HI0A 2GZWA 4DINB 4Q29A 3ETQA 4FBFA 3RNSA 1DZTA 4Q0QA 2BNOA 2N7GA 5JAXA 2D5FA 1RTVA 1YLLA 1UD1A 4XFCA 3SXWA 2CV6A 3EJKA 4EV0A 1ZNPA 4OFGA 5KBFA 4XFHA 4META 3H9AA 4H7LA 3FE5A 3PVBB 3ST7A 1EY2A 4HBNA 3DL3A 1QWRA 2P17A 4L11A 4NVPA 1ZREA 4ORFA 2IC1A 4F7ZA 4D7TA 1NZCA 4N9IA 3SCHA 1LKNA 2FMYA 2IXJA 1LRHA 5I0TA 5J7MA 3LAGA 5I91A 1FT9A 4HZFA
chains in the Genus database with same CATH superfamily
2XR4A 1F4HA 1UQXA 4YSFA 5DABA 2IFRA 2ZGSA 5D2AA 3SMHA 2FDGA 2L9LA 3BIEA 3UETA 1S55A 1VIWB 4JZRA 3URFA 1GWMA 1NCQA 1ULGA 3OG2A 4KI5M 1SLBA 4HG6B 4AI2A 4N9HA 3ZKYA 1JHNA 4MHRA 4YM1A 1UAIA 4OUMA 4D94A 4DXZA 1AF9A 5GZGA 2LUWA 2X05A 1UY4A 4OZOA 1KJRA 4Q4X2 3FZ3A 4QQLA 1H4HA 3MICA 4QQHA 2Q30A 1REDA 3NJZA 2CDOA 1N1SA 2JKXA 1XNCA 5FY1A 3HBKA 2OUHA 3RG0A 2ZACA 3I2GA 4JDMA 1MACA 4IEZA 4MHUA 4NAOA 1VAMA 4IEYA 3QOPA 1DQ1A 1WLTA 3VBOA 4B29A 3CMGA 4FOQA 1ULEA 2RDNA 5LK5A 4L92A 3AKSA 3TNPB 5LASA 2OPKA 3JZVA 1YC61 2Y38A 3JQXA 2XJPA 3KQRA 1JOPA 2WNUA 4XIOA 3C7GA 1FOD2 1E5IA 3WZ1A 4A45A 4Q4W1 1QNYA 3ZSEA 1PZ7A 1PGSA 4SBVA 5DDJ1 5FKBA 1J1TA 3FC0A 4CU8A 3R4UA 4O7XA 4PI0A 2H6CA 2VCMA 1EP0A 4H55A 4XF4A 3WG1A 1U5ZA 1UMHA 2O8QA 1COV1 1IOAA 3I3DA 1GANA 1UU6A 2PA7A 2ZAAA 3PUSA 1C8NA 1QY4A 4O65A 1O3SA 1JYWA 3AZZA 2DFBA 3MIBA 3MW3A 5DUUA 1O4YA 5K8SA 2DCTA 5FMOL 3HN3A 1ZBE3 2VC9A 3O1RA 3KCCA 1Y9GA 4MXWB 4R9AA 3LDKA 4NPMA 4JKLA 5FUIA 3ZDSA 1RUNA 4QT6A 3PJYA 3TYJA 2DVBA 5FY5A 3KT4A 4C90A 3O1MA 3DF0A 3P1IA 3ILFA 3I8TA 5F3CA 1W6NA 5CAZA 4A7KA 2XVKA 1J84A 1TNFA 5GALA 2E33A 3NWKA 1C5HA 1CJPA 3KCXA 1W6NB 4IEQA 2DU1A 1AXZA 4Q1RA 2GC0A 5DZFA 1R1ZA 5EFUA 4RGKA 2XJRA 3KV6A 1ONAA 3ZR5A 1RUE2 4C0HA 2OPWA 3CZUA 2Q8OA 1RJ8A 5F37A 1U0AA 2VL4A 2R30A 3OGJA 1ZBA2 1ZZ6A 2RS33 2WZR3 5BV6A 1NE6A 3LWCA 4QAWA 3BU0A 2GH8A 4Q4Y3 3SLIA 3ILRA 4IE7A 3QLQA 3MBWA 1YFWA 3K3OA 3KLSA 4DB5A 2X5IB 1W6PA 3VDDB 4N90A 1MVEA 5FZIA 1GOHA 4YVSC 3J7NA 2Y33A 2BJSA 3NKGA 5J09A 2DCJA 2JD4A 5E89A 2CGNA 5ABJB 3J7HA 3HAGA 3L9JT 1Q56A 1RUF3 5FYYA 2ZEYA 2ZGUA 3D6EA 3IZOA 1QOTA 3AMMA 4FOVA 3AMQA 1RUG1 4FFFA 4NWWA 2FHRA 3WUDA 3PNAA 3WNLA 5IAXA 5JSOA 3VL8A 4YARA 1O6UA 2WNUB 1OD5A 2A73B 4WVWA 3TWIA 2JDMA 2SLIA 3AP6A 3UT0A 2VMIA 4PBOA 4ES9A 3O14A 4RGGA 2CGPA 3IDCB 2JG8C 4Q4Y1 1Q8PA 2XUEA 3AB0A 3AMPA 5FP8A 1W3VA 2Y6LA 1FAYA 2JE8A 4UW4A 5APAA 1ZYBA 1B35A 3U14A 3OYWA 1AL21 3SEEA 4L2NA 2A3YA 2ZMLA 5H9SA 5T54A 3ZO0B 4YM2A 4XMAA 3POEA 4XTMA 2WNVB 1JODA 1BJQA 1S0CA 3I97A 3KSCA 4Z1VA 2JJ6A 4NRQA 4W65A 2PHDA 4FQ4A 4U36A 5FTTC 3OTFA 2WWJA 3UGFA 4FTBA 3DV8A 2PAKA 2VUCA 2JE7A 4NRPA 4EE2A 5LY1A 1OKQA 3BOPA 3T3YA 1PIV3 1AX2A 2ZHKA 3RGBA 2VZPA 4LE3A 4NPRA 3TN91 3H7YA 1JYTA 1FMD3 5FY8A 3RPQA 2Q5TA 5JMCA 3OBZA 1TQ5A 3ZMNA 4AEKA 2IXIA 1MS3A 3E6DA 1H1MA 4R8HA 3AKRA 5E1RA 3JBG3 1VBA3 3AL6A 1VP6A 2P6CA 4XABA 3CJIC 3JXSA 2R32A 3LEKA 2IVIB 4LIVA 3IPVB 2BGPA 2SBAA 3OGSA 1JZ6A 1JZ7A 2E7TA 3CKHA 3G7DA 4CYDA 1AR91 1BEV2 4PI2A 5FZ9A 1UOFA 2UWBA 3PU8A 5C8WA 1MPXA 2CTVA 5FPXA 5LA1A 2G9ZA 4AYUA 1JI6A 2BNMA 1RUF2 4Q4W3 4FAHA 2D93A 4M3CB 2FBEA 3ZFFB 3AZVA 1MZ6A 2UWCA 1HKDA 5J37A 3MFAA 2BU9A 4LK7A 1ODNA 4DXRA 3FJSA 3ACGA 1GWKA 2JICA 4BK5A 4DFSA 3LCPA 2EA7A 2VOKA 3H50A 4MUVA 5A1FA 3ZN6B 1XU1A 1YFYA 1H6XA 2FCTA 4DO0A 1QJX2 1OPMA 2ZTNA 1PK6C 4QGNA 3BTXA 2FD8A 4ZHNA 1WCQA 1DBNA 3L2HA 1BMV1 1AR83 4MOAA 2YC0A 1VAKA 3PUAA 1DQ6A 3HPNA 1XE8A 5A7WB 3CO2A 4I01A 2XLFA 2XKPA 1ST8A 4OI4A 4XJUA 1HW5A 5JIAA 3WCSA 4AI9A 3AZXA 3CBNA 2YUEA 4CPBD 4W6YA 3S7IA 1DYPA 2E31A 1KFXL 4CDWA 1NY72 1FYUA 2Z2SB 3ACHA 5FPBA 4CUGA 3LDRA 1HXS2 2XG3A 3M3CA 4DXTA 4RS5B 2W08A 4XXAA 2YBPA 3OPZA 1ZBE1 3VBSC 2HYKA 3FUOA 5FP9A 1V9U2 4LBOA 3ATGA 4YZ3A 3SH5A 3E6CC 2XLAA 5FKCA 1AR81 2NPIA 4W4ZA 4JVAA 1G9BA 1RINA 3ES4A 1RVF2 4JGYB 4UF0B 3RZLA 1EAH3 2VMDA 2ILMA 4Y5Z0 2K0GA 5AC92 2R6QA 2ZGOA 4CDWB 5C4WC 1YO8A 4HSLA 1AUYA 4ES8A 4E4SA 3QH6A 1OFSA 2WWUA 2HYXA 4QB6A 5JUVA 1U5XA 3R4SA 4HFSA 2AACA 2WWSA 1TEIA 5EYXA 3K75B 4LLOA 4OI2A 3A0KA 5FZ4A 3TNQA 1BEV3 4HONA 1T2XA 4K8RB 1OH4A 2QE3A 3VDCA 4V2VA 3MW4A 2Y60A 3WNKA 3M3OA 2JKBA 3D4KA 2YFUA 1Y7BA 1H4GA 1C3HA 4RL7A 1MEC2 2EXHA 3JUUA 2KD7A 4PDWB 5JI7A 4AVVA 4IV1C 4KMQA 5CFCB 3AC0A 4XFIA 1OQEA 5JWPA 1S0GA 2DFCA 3GALA 3HMYA 5FZOB 5KHHA 1FV3A 1R083 2YHJA 3A23A 1W99A 3WW1A 4EQVA 1FOD1 3CU7A 5F3EA 4NHLA 2R49A 4HVQA 1IG3A 4NIIA 5FIXA 5IW0A 2R1BA 1KITA 4AHZA 5JOZA 5KHJA 2W9XA 2B7YA 1GWLA 1W6QA 5DUVA 1RC6A 2Z42A 3MO4A 1FATA 1UU5A 3WLUA 2DVDA 2EXIA 4CCLA 5JXGA 2MHFA 2HWE1 1CR7A 2W39A 2BGCA 2C26A 2BYVE 4MGYE 5FMOS 4LKDA 3VN4A 4XUNA 3RZHA 5A6ZA 1JYVA 1CWPA 2WUHA 2BOJA 1FNYA 3OGRA 2XWBB 3T09A 1W8WA 4GKYA 4GMP3 3ROUA 3L2YA 4IV3A 5CEHA 3LD8A 2VCCA 1MS0A 2UWAA 1BXHA 2C0ZA 2ZKNA 4BPZA 1YIPA 3I59A 4HMZA 4QX5A 4CA9A 5LA9A 3I2FA 4FOYA 2XUMA 3UNPA 2ZX3A 1CAXB 2HWE3 1MR5A 4QWNA 4XJAA 2DUOA 2EXKA 2VUDA 5JXJA 2GN3A 5FMCA 1J59A 1Z0HA 3RS6A 4DUXA 3LOBA 4P5YA 3Q8FA 3VZJA 4XTPA 4IEWA 2VE1A 1IPSA 2IXHA 4MYEA 2BTVC 2UYAA 4YW1A 1LOAA 1ENQA 4HOOA 3FBMA 5LK7B 2XGXA 3KZ4C 1TVGA 2F6BA 3FHAA 4QQOA 5FYHA 1IHMA 1W9YA 3OJBA 3A21A 4Q4Y2 2GSYA 5A7PA 1JZ8A 3AL5A 4KGQA 3LA3A 2AEZA 1ND3A 1LGCA 1VMHA 1XNKA 2PMWB 3B9IA 4L8QA 4UFLA 4QX0A 2XVLA 4HN1A 2JG9C 4RQPB 3DPRB 2ZMNA 5HCFA 2GH2A 2RMU3 2CWMA 2VO5A 2Y34A 3CF6E 4WBBA 5IT6A 3WQ0A 4Y5TA 3CLPA 3A22A 2RV9A 2DDUA 4YZ4A 1I5PA 1W0PA 3K3NA 3ASIA 4M00A 4NR1A 3HD8B 1HQWA 1LHVA 4QKBA 4MH0E 3S5QA 4XDQA 3VBRB 1HN0A 1JH5A 2P3IA 4FOWA 5C70A 5EPAA 3M8LA 2QKDA 2ZX0A 3WSOA 3W21A 3VHOA 1O4ZA 1UOGA 1EYBA 3EMRA 5TSWA 1N47A 3OY8A 1WA4A 3HEIA 4YG3A 5LCWL 1VBC3 4QDRA 2RS51 4I3PA 3M2MA 3NAPC 5IHRA 2E6VA 1H6YA 1J3RA 2DV9A 3LIGA 2JDNA 2A6WA 4QXHA 1Y3TA 3I54A 4AE2A 2IXKA 3N7MA 4YNIA 4TTGA 2AZ5A 4LXLA 4UW3A 2GP3A 2WZR1 3DGTA 1OQDA 4YGEA 3WR0A 2WZPP 2DF7A 2OW4A 2HWF3 3Q8BA 2OQ6A 1CPMA 4ZXEA 5E8AA 3Q8CA 5LATA 3LGRA 1R1A1 4KWKA 5L36A 4CU9A 5A3NA 3NV1A 2XB6C 1GZCA 1SEFA 1IS5A 3LIHA 1A8MA 3G6JB 1D4VB 4TN7A 3SNMA 2OZ6A 1AX1A 3VUOA 2Z69A 3R6SA 1LOBA 2RG4A 4P9LA 4YZ1A 5CBLA 4M4RA 3SH4A 1DQ4A 1S0JA 5FZDA 1WW5A 4QGMA 2ZZQA 3WF1A 2EIDA 2FDKA 4BQWA 3NL1A 2E9QA 1ZRFA 1XPWA 5GKAC 4N53C 3E97A 3NRUA 4R9BA 2D6MA 2RJLA 4YW2A 3T4VA 3VD9A 3SCGA 1TME3 3OPTA 4FBFA 4Y4RA 3WP3A 2N7GA 1L7QA 5F5CA 1AR82 4JRLA 4CDQA 3N9PA 2GNDA 1C5IA 2FCUA 2NMNA 1QF3A 2F4LA 4XC9A 5EJ3A 2CV6A 3SXWA 2P3YA 5IVFA 1ZNPA 4S2GA 4Q2FA 5KBFA 4WM7C 4QPGB 2C24A 1WMXA 4OHWA 1UZVA 1VMJA 2EALA 3BYWA 4PLNA 1DG6A 3FE5A 3WX5A 3TOJA 4AHYA 2JDZA 4XCBA 4DIQA 3J7LA 4Y24A 4HBNA 5DDJ3 1D0GA 5HCBA 4NVPA 3FLTA 4AW7A 3PVEA 1REFA 4P9YA 4CCDA 5F6LB 4E4DX 5CFDB 1V9U3 2D6LX 4GWIA 2VGDA 3BODA 3RFRA 4OHYA 1ZM1A 3PURA 1AHSA 1QJX1 3R05A 5JVVA 5BNPA 3A0NA 4CRQA 4QD2A 1BMV2 4FPFA 5T55A 4A41A 1XC6A 2HBUA 3IDEA 5ACA1 5I0TA 2FDHA 3VKMA 3LAGA 3AJYA 3AK0A 3A7QA 3THCA 4YZ2A 1NYWA 4XE9A 3BKZA 3WY6A 2R043 4QKNA 3MV01 4QX3A 1H0BA 4UW5A 2BPA2 1DP0A 2WSUA 3CQOA 3WF3A 3ZN4A 5JCTA 4AGVA 1AR72 4MADA 3W5NA 2YU1A 1WW7A 2WNOA 5GJ6A 4EN9B 5L19A 2IXCA 5G04L 4I02A 1PIV2 1SLLA 3KHCA 3USUA 1HDKA 2XHNA 4MV2A 1R082 4BU2A 1IZ3A 5CKMA 3VL9A 5LRSA 2JIGA 1AJKA 5J3UA 3J8F3 3ELNA 2BV4A 4PDWC 3WDUA 4HVRA 2D7FA 1ZBA3 2R041 5C71A 1DGRA 1S1AA 4CCOA 4A42A 1HB1A 5GLWA 1RXFA 1WGPA 4IDZA 1OA4A 3TN92 3HQXA 1O3TA 4CUCA 5AVPA 2XBO3 3I7DA 1PGW1 3M70A 2JDPA 1QDCA 1LU1A 2VY0A 5JLVA 2ZZJA 1KDKA 1VPHA 4AFAA 3Q8AA 1DQ5A 1FV2A 4CDUB 2VMCA 4X6RB 2PQQA 4DQAA 1NCRC 5M0TA 3V0BB 1PK6B 1CD3G 2XLGA 1HIXA 2PFWA 2UY8A 1C8M1 1V6IA 4ZU5A 3S0MA 1NG0A 2VW1A 2NQYA 3ILNA 2BVVA 4PLMA 3WHTA 1UZ0A 4JCKA 1EPWA 5CADA 2QVSB 1X8EA 4BE3A 1X82A 2ZX1A 1TZOA 2B8MA 4ET7A 2ET1A 2HWF1 3EO6A 1AYM2 2TEPA 3KF3A 1GKBA 3ES1A 5AVAA 4P08A 1KXGA 4YW4A 1GP4A 1Z7S3 1VJ2A 1VRH2 2XXZA 3VBFA 3MUZ1 3D82A 1X33A 3KB5A 2A5ZA 3PMEA 5CG8A 5FYTA 1HN1A 4FPHA 4P00B 1JZ5A 4YW6A 2EIBA 1CPNA 1UIJA 4ASLA 1FI2A 2C4XA 5CZKA 3MF6A 3POWA 3T08A 1LU2A 4LLFA 1VR3A 2D6OX 1W8FA 3ACLA 5FZLA 3TB0A 5C9AC 4BYYA 2WR9A 4XZPA 3ENRA 4YPJA 2YBSA 2YYOA 3GHMA 2X29A 4QB2A 3ZYBA 1RUG3 5JI9A 3AKPA 3VKLA 5JSRA 2FDFA 2QNKA 4RQPA 4Y33A 5LBBA 1C57A 3AKQA 3BPZA 4A44A 1VBA2 1PZ8A 3OEAA 5AC93 2WT2A 1R092 5F2SA 3N9OA 4YWAA 3AZWA 1VBB2 3PVNA 2VZOA 5D21A 1B09A 1GYKA 5FYVA 1SLAA 3OUIA 5FZAA 1PO21 1OC1A 3I2HA 1H9WA 2QZ2A 3OYWB 1GQHA 2WNUC 4JRAA 4YFWA 5DZEA 4CP9B 3ZVXA 5C3RA 2G19A 3AP5A 3T2QA 2DBIA 1YQ6A 3K2OA 4WM8C 2ZXQA 4ZU7A 2WQ4A 2V4VA 5D8AB 2LTNA 4XPVA 3MLLA 1Y43B 2DTWA 4HSJA 1QJU2 2VTXJ 4IGPA 5JXHA 1ZRDA 4TLGA 4QXBA 3KGLA 4NHMA 1QQP2 4FP3A 2D3RA 2HLEA 4Y20A 3W59A 4AQ2A 1RB8G 4YVSB 1NY71 3M3EA 5C7GA 2YGLA 4XACA 2QQWA 4BLJA 3PDQA 3BTZA 2WLQA 1OPOA 4Q4V3 5K0UA 3W9AA 2GN7A 2VCBA 3T0DA 2JENA 2RS52 2TNFA 4YW5A 3E5QA 1ULCA 2UU8A 4AFCA 4WM8A 3D5OA 2ZEXA 5IVYA 3SITA 2EVXA 3ZXEA 2VVFA 2WA3A 5SV5A 4LO8A 1X8MA 2GNBA 4I0WB 1JU3A 1DGLA 2B46X 4CP9A 3FL7A 4LIUA 3SQOA 1J1LA 1VBD1 1SFNA 3U4XA 5FLJA 4CCKA 1F9KA 2P1BA 5A32B 3VBUB 2ORZA 4DXSA 4IUGA 3WDTA 1L3JA 5CFCA 4BIOA 4DRVA 1AR93 2WS92 4GALA 3ZM8A 3HJRA 1PK6A 1O5UA 3JB4C 3MUY1 4NRMA 4CU6A 2I2SA 3JQWA 1XBFA 4OHXA 4CEWB 2R7EB 2ZA9A 5EJ1B 5IWFA 2MNGA 2EAKA 1JYCA 2D5HA 3GM8A 1GNZA 1ZA7A 3JU9A 4K3UA 4X6QB 5E88A 5FP3A 3WUCA 2A6VA 1F35A 4EWAA 5FZ8A 3SC7X 4UXAA 1UX6A 2QDNA 1ASJ2 4J1XA 4B4RA 1AXYA 1TMF2 4BM8A 4LKFA 1KQRA 5E6HA 1BK0A 3VD7A 4XDPA 4XZUG 1LHUA 2XBO1 2VMGA 5K4LA 4FP2A 5A3PA 5JOWA 3WT3A 1HQLA 2EAAA 1IGOA 5A33A 1W3XA 1IQAA 4JX0A 3T0AA 4A7ZA 1PO22 5LEJA 4TWTA 1EPZA 4LKSA 2WYSA 4MO3M 2YC4A 4FT8A 4B1LA 3CJIA 1D7PM 1W9SA 4GJZA 3QCWA 4LA3A 3GDBA 5DAXA 3H8XA 4Y22B 1UL9A 2QQJA 1QJU1 3VLBB 3WXPA 2VD7A 2A3XA 3MIGA 3V0BA 4Z92B 2K9ZA 1QGLA 4M3CE 1NCRA 2VW0A 1W0NA 2JDHA 3CNAA 3DYPA 4GWJA 5DDJ2 4CZSA 1Z78A 2A6YA 1D4M2 1HRV2 1MVQA 2BERA 2VVDA 4IEVA 4IV3C 4XUOA 1DZRA 2WSVA 2XJSA 4NO4A 1ND3B 1LOFC 4COVA 5HBAA 4IEOA 3OF1A 4P02B 5A7WA 5IYYA 1T6BX 2VVEA 4AI3A 3K46A 1Z7S1 3ZFEB 2HBTA 2C6SA 1N3QA 1X50A 4LK6A 1DYOA 1OT5A 3B7MA 3MLJA 5JMOA 1Q5OA 2GNTA 1VAVA 4XAEA 4OUEA 4HPKA 3J9SA 1RUI3 4OMDA 3MIFA 4WVMB 4A6SA 1W2NA 2BVBA 1KD7A 3B5LB 4UFHA 5DAVA 1I6XA 4YLZA 4O9GA 4RYDA 4QXKA 1Q8OA 1UZZA 1BQPA 3WD5A 3GYDA 4XJWA 2ZPXA 3ORJA 2G9GA 5DPNA 3N7LA 2YV8A 3O1OA 1H2KA 1DFQA 4E4ZA 2VNOA 2JIJA 4IE5A 4XEZA 4ZS3A 2HWD1 2J1UA 3FLPA 3HWJA 1BYHA 3NNJA 3WNNA 1HX6A 3FFQA 5C5UA 3HT1A 2EIGA 2QDRA 3FUQA 4MGTA 2ADDA 1H9PA 2A71A 2BEOA 1BLZA 1J3QA 2BOIA 2CL2A 4WM8B 1G9AA 1O3RA 2VNGA 4N8MA 2R0HA 1SBDA 1KRIA 4Q27A 2QQKA 1YWKA 1W04A 4BWOA 1SBEA 1PX3A 1JW6A 1NCQC 4QDQA 3AXEA 4BOWA 3RZZA 4BXFA 1PVC1 1WCKA 3FBYA 4ONUA 1G7YA 1F8VA 3O0XA 1STMA 2XQRA 3KVAA 3GBFA 5C8CA 4NN0A 4NHYA 4IL7A 3GF6A 3KF5A 1OLMA 1SDWA 5D8AA 1V9U1 1PM7A 3SKVA 4ASMB 5IK7A 4KBZA 4AAXA 2JECA 4D7YA 3OGGA 1W8OA 3J8F2 4IERA 3VD4A 2WO3A 1D4M3 2A6ZA 1TG7A 3IMMA 2IZWA 4P9JA 4RD7A 4Y1ZA 4Z2WA 1OSGA 3HVDA 1TNRA 2XL9A 4QMAA 5FK8A 5JZGB 1IS4A 2Y64A 4LUMA 5GLVA 3RJ2X 1H2MA 4LITA 3VKFC 1US3A 2Y6GA 3AP4A 2CNAA 2O14A 1ZA4A 2CY6A 3WF0A 1F5JA 5FR3A 1OBNA 1PVXA 4HK8A 1QOSA 2RR11 1WMEA 3RYRA 3OPWA 1JZ4A 2VG9A 3UESA 3LEGA 3MFCA 3ZFEA 4HK9A 1QKQA 3INAA 4J1WA 2QCSB 4H2AA 4JGZA 4NE9A 5ANNA 2VZ3A 1COV3 1DLCA 4MGQA 4C0BA 4TZDA 4QHZA 4SLIA 1I3HA 1ND2C 3AJZA 4PIZA 4LHKA 4XAAA 3ZN5A 3MF9A 4AVSA 5A33B 4UAPA 4Y22A 1AYM3 5KXCA 4RS5A 1UWWA 4NUBA 5FYCA 3VDDA 3KWVA 1LULA 3WV6A 1LOEA 3H1MA 2Y6HA 3ZFGB 5JDBA 2YPDA 3NSTA 2XPJA 4GWMA 1PGL2 1LAJA 1D2QA 1QU0A 3WP4A 4I2OA 3DXUA 5GZDA 2BUKA 3ZFFC 3ZSJA 1N1TA 2DWRA 5A7QA 4AAPA 4CDXA 4W6WA 4UOJA 1I9RA 3MDPA 1FPN3 2BQPA 4C91A 2P3KA 2P37A 1UCXA 1G9DA 1BVP1 3I3BA 2AH2A 3M1HA 4JV4A 3ZR6A 5FZ3A 4I30A 4CCJA 1VBB1 3V64A 3JB8A 4D8MA 3BOWA 1PMIA 2XONA 3MIEA 3J4UH 1QXJA 2PXJA 1AR73 4LNVA 4LBQB 4NOTA 1EV11 3GBGA 4U2AA 2VXJA 1QXPA 1CAUA 1GZWB 3ZSLA 4YRDA 1LGNA 2VUJA 4D7SA 4QPIC 2HKXA 3H1WA 2DVAA 4EN7B 2P6HA 1W90A 1YJLA 5CU1A 4D6RA 1R093 1ULOA 5T3NA 1AVBA 1OMIA 4N43A 2RM21 1SZBA 2VNVA 3VBRC 4JHZA 2A3WA 3PTRB 5CIRA 3ZXLA 1O3QA 3HIFA 2GDFA 1RUH2 2W94A 4XF0A 2VPVA 2FCVA 3LF7A 4CCEA 5HXMA 1XE0A 3AX4A 5C8CC 1US2A 2QQLA 3ZXDA 4D0QA 2F4PA 5HCAA 5FPZA 3K48A 1O91A 2QUOA 4AGGA 3CDZB 4PJYA 4EZHA 2XKOA 5C3OA 3D0JA 3PUIA 5L9BA 2Y6JA 3PMSA 3O1PA 4AEDC 4NJ4A 1FOD3 4LJHA 1PMJX 2NLRA 1POV0 5DUWA 5F5QA 2G4IA 5FZEA 4AEJA 1S2EA 2DYCA 4B8EA 2WINB 1HXS1 1QH7A 4FFHA 3AYEA 4DUWA 1QEXA 3HN1A 4CVUA 2VMHA 4Q0VA 4Z82A 2I45A 4XQDA 1ND3C 5GZEA 1NT0A 4CCNA 1RIRA 4NIDA 1PIV1 1N1YA 3BPSA 1XE7A 5JZGA 1C1FA 3JD72 4Y1UA 1FXZA 5BNOA 3IBMA 1W6QB 3FN9A 4M0HA 4LA2A 1LGBA 4PF5A 3ZYHA 1JUHA 4KH9A 2Q1FA 3KHBA 5FXZA 3T2OA 5FPUA 3PTYA 1UY0A 1OF4A 2MEV1 1FMD1 2Z79A 3WF4A 2R042 3RZMA 3AKTA 5EHDA 1G9CA 5FLHA 1ZRRA 3BI3A 5CB7A 2WDBA 2XL7A 2RDSA 4LBKA 4XFAA 1MQTC 3UJOA 3IT8A 1V00A 4AQSA 5BY5A 4C1WA 4AL9A 2BBAA 4FPGA 5CKNA 1NUKA 3AZYA 4CE8A 5FP7A 3JCIA 4LOSA 2H6BA 1LOCA 3U11A 3ZFFA 5LZ6A 2PHWA 1CONA 5BPXA 2NM1A 1TMF3 4XUQA 1V6JA 4AG4A 5KHKA 4GD4A 4XOGA 3VD5A 1DZTA 2X5IA 1YQ2A 4OZXA 2BNOA 5HXVA 2WZEA 3PL0A 1H8TB 1KS4A 2OX0A 3M4FA 1VBB3 2RM22 5FYBA 1UD1A 4RGAA 4XFCA 1ODMA 2HWD2 4Y1XA 4OYUA 5FZFA 1SG3A 4B4PA 5DMYA 5I0DA 5IVEA 4FPKA 5A6QA 1GZ9A 2DBNA 1EV13 3NJXA 4OFGA 5L9VA 1DQ2A 4JGZC 4XFHA 2R073 5HCHA 1JTZX 5BNOC 3GJBA 4MLOA 4ZZ8A 2FZ2A 1GOGA 2HWB1 1SLIA 1RHI1 4UT5A 1UMIA 1R091 2O8OA 2X09A 5CG9A 1OOPC 3DL3A 4KG0A 1QQP3 1S2BA 2P17A 2ERFA 4L11A 4LBQD 3RMYA 4ATFA 4GXLA 2DTYA 1GNHA 5FXXA 4UFIA 3VBHA 1IS3A 1MS8A 1XJAA 4URAA 4QU1A 1UKRA 2IC1A 1PNFA 5FZMA 4F7ZA 1WLDA 2R063 4IGOA 1TME2 5DG1A 4D7TA 3W20A 1L7RA 1NZCA 1RXGA 5LBFA 3SCHA 3U37A 5A3UA 4YGCA 4R9DA 4CDQB 1VBC1 3MV11 3GCXA 1D2SA 3ZXFA 3K4ZA 1B35B 5FYIA 5FY9A 4QHOA 3RSJA 5A7NA 1DHKB 4CDXB 2W1SA 1UPSA 4ZPIA 1JN2P 1YQCA 3UJQA 2ARBA 3VBHB 5F39A 1GLHA 1E5SA 3N9MA 2MEV2 2CGOA 4CEYA 4S2DA 4COZA 5I93A 3ZXKA 1SCRA 3I2DA 5T5PA 1FPN1 2XHKA 2MPFA 1AR92 1BEV1 2GP5A 5I0RA 1MZ5A 1VLNA 4X8NA 3ZPOA 5JOYA 5T5JA 4F8AA 3B01A 4MGSA 4JC1A 4MGIE 4UFKA 4V2WA 3ETPA 4CU7A 2WFF3 4XHBA 1EUUA 1G6NA 3IPVA 3U0ZA 3RZKA 1KFUL 3BB6A 4KGGA 4YYOA 1JUIA 1WBFA 3JBG2 5FOJB 3POGA 4R4ZA 1S0DA 4N43B 1UNBA 1OLRA 3W5MA 4AK3A 2GNMA 4AHWA 2JD9A 2VBBA 1S0BA 4JDNA 4RR3C 4D6SA 2ZS6B 2LS6A 4JTOA 5DAQA 1CESA 2WL1A 2PHTA 1JOJA 5JR7B 4BMEA 2QQOA 1JU4A 1D0HA 1G9FA 3VHPA 2DCYA 4NWVA 5JOXA 4Q5OA 1W6OB 3OOXA 2GAUA 5C33A 3UKTA 1ENSA 1UO9A 3ZN6A 5T5OA 1XQNA 1U12A 4IW3A 1V6KA 2AGSA 3HQRA 4PIXA 4UWDA 1CX1A 1MZEA 2WQ8A 4S2FA 1YI7A 5FZGA 2RS53 3RZGA 3O7OA 1NE4A 1NLRA 1NQJA 2W95A 4GB33 2YXSA 1K42A 2JEMA 4AXOA 2PHFA 5GM0A 2IUWA 2PYTA 3NVCA 4GMP1 5G05L 3WVJA 1DYKA 2D44A 1J83A 4QPGC 5H9QA 3IM0A 4M0NA 5EZWA 1QXRA 3FLRA 3C7OA 3WDXA 2OXBA 3I59B 4Q8KA 1ASJ1 2RR12 2V5YA 3I2JA 3SHRA 1NLQA 1RUI2 4NROA 3MLKA 3U75A 4M3CF 1PHMA 2VZQA 3VBFC 1VBD2 5FWEA 3NW4A 1O7FA 3AP7A 1T6GC 1LHNA 3BVCA 3DYOA 3VZLA 3WG2A 2OYZA 2RS12 5J96B 2XDVA 3AVRA 3S5AA 2OS2A 1UY2A 5K7PA 1RVF3 1W2TA 2VBDA 4C1XA 3EB7A 3LKJA 3I3MA 4ATEA 2E7QA 4Z07A 2ZEZA 4OQ8A 2JXAA 4JGYC 3RYPA 4HPKB 2BBVA 4E8DA 2JB8A 2VZUA 4K20A 4PT6A 1UY1A 4GKXA 4EN0A 1GMMA 1XNTA 4RR3B 4M4PA 4BCUA 2VTFA 1TMF1 2ETEA 4B4QA 1PVC3 4HVOA 1WCSA 2KM2A 5FZBA 4NIAA 2LROA 5BNQA 4A2UA 1X9PA 3W58A 3CIHA 3NV4A 4LPLA 2J22A 4YGBA 4BJ0A 4IESA 1EAH1 1NCQB 4PDWA 1FMD2 1VRBA 2C1FA 1V6MA 2PLV2 3DXTA 2GC2A 1POQA 4I09A 4D3WA 2G1MA 3IMNA 1RUG2 1UYYA 2JX9A 4ARXA 1HRV3 4GMP0 3ZLIA 1UIKA 1MS5A 5LRRA 4COUA 3AFKA 2VMEA 1YHFA 4LULA 2NZ9A 3THDA 4HETA 4GWNA 1RYYA 5CA6A 2ID4A 3JD73 4JGYA 1RUH1 3AM2A 3NO8A 5GZCA 2HJIA 2R061 3I49A 4LBLA 2RR13 2VQTA 1AYN3 1YCIA 3LSEA 5EJZB 1SMVA 4YVWB 4CUAA 1KGYA 4N43C 5T52A 2VR4A 1W8TA 3RRDA 5LBCA 2JB4A 2RE9A 4Q4W2 4BQ4A 1WMFA 4K1ZA 4QGLA 5T50A 1LOFA 5ABJC 2QJVA 2VNRA 3PU3A 2ENRA 3WHUA 5BNPC 3IIIA 3KD4A 4WM7A 3PHMA 2BP6A 4K8FA 1OI6A 2RS13 2YROA 3B94A 4PLOA 4Q4V2 4XW3A 3WNOA 1QJFA 4AVCA 4CEWA 4CDUA 3F95A 3PUQA 3E6BA 1DGRN 5L9RA 3OD4A 1YRZA 3TEXA 3WQ7A 3D8CA 2VCAA 2QQPA 4RS5C 2ARAA 1RL3A 4TSVA 4RQPC 1WBLA 1WCDJ 4S2HA 3VDBA 5DN2A 4ZS2A 5J36A 4LQRA 3IAPA 4AWDA 3T2TA 1UKGA 3VHRA 5I0UA 2PN5A 4CDXC 1JZ3A 2YU2A 1FPN2 2Y8KA 4BQ5A 2Q4SA 3N7KA 4Y5SA 2VTXA 3OUHA 4JKMA 4QKDA 2RVAA 4OHVA 5IJRA 1AXKA 5FZKA 3M3IA 4CDQC 3C3VA 3CJXA 5FJKA 1F31A 2XWJB 1RUC2 3WOGA 4AR2A 1I1EA 1OUSA 1ULDA 3DKWA 1J3PA 1PM4A 2ZX2A 3GZUC 2LM3A 3BCWA 3NNFA 1CZVA 4MXVA 2PLV3 3WDWA 3U78A 1QJZA 4YW7A 5IK5A 3NV3A 1W39A 3PVOA 1UYPA 2OUJA 3CHXA 3I2KA 1OUXA 1VBE1 4FTEA 3KM5A 2GMEA 5EV7A 1W9WA 4O9EA 2RM23 1QDOA 3HOBA 1OHFA 4NAMA 4OULA 1Q8VA 4HLTA 1LNSA 5FXVA 3ZYRA 5FMDA 4G3YC 4EYUA 2VW2A 1EV12 2PQSA 1NX9A 2O0OA 3WG4A 3T2PA 5KXEA 2WN2A 1LEMA 5BNPB 1PO23 2UYBA 1DF0A 4N7UA 5D1IA 1SACA 1CJDA 4GULA 1JS9A 5FBJA 5A3LA 1AR61 1K5MC 3RQ0A 2GC3A 1UOJA 1VBC2 4KG8A 4CXXA 1COV2 1K12A 5C3PA 5FFOC 5FXWA 4RFRB 2OA2A 1Q43A 4QM9A 4I0BA 2ZGTA 3HQUA 2VZVA 3VBUA 4GA9A 5A32A 5HV4A 2DCZA 3LDBA 4XFBA 1FX5A 2CHHA 5FQ0B 2BGOA 2EXJA 4DPNA 1SDDB 1Q3EA 5FY7A 4WVMA 3POIA 4Q4V1 2ZGNA 1UYXA 1QHDA 2IWGB 3EQEA 3RDIA 2KR2A 1XYNA 3C2UA 1AYN1 2E63A 1C4RA 2GMPA 5LA2A 5JIUA 1R1A2 1UU4A 1PGW2 4H14A 4ITCA 4J6GA 4EN6B 5IFPA 2JG8A 3K4AA 1H8VA 4AFDA 1UX7A 2WLPA 3VGIA 1YQ5A 3MIHA 5DUXA 4LEJA 4KU8A 2AEYA 3ZYFA 2QBXA 4KNCA 2ZHMA 3U1XA 3WEZA 2VU9A 3F2ZA 1C8M2 1CIWA 1RUOA 2ZHLA 4YG6A 3RYKA 3LZZA 4EROA 1VALA 2VXRA 4AOCA 1LB2A 1WCUA 2AENA 3N9NA 1JYNA 5FBZA 3WINE 3BALA 4UFJA 1RUC1 4BXSV 2UURA 2WKKA 1OOPB 3DECA 3MYXA 2VJXA 5B4XA 3SH3A 4A3ZA 5C9AA 4RSUA 1A6CA 3ZIXA 2RDRA 1RUJ1 1K5MB 2NYYA 2W52A 4Q0UA 4YG0A 4QQ2A 2JDAA 4E2QA 4LTAA 1XRUA 1SQ4A 1RUH3 4LO4B 2W2IA 5EP9A 3TBDA 3IB3A 4AFBA 2Q8EA 5A6YA 2DCKA 2X5IC 4IETA 4LO5B 4GQ7A 3ZYPA 5B2GB 1RJ7A 1IPJA 3GHNA 2B9VA 2OZJA 2Y6FA 1VE0A 3POJA 1BVVA 1H1IA 4XFFA 1G8WA 3HNYM 4DUVA 5BNNA 1ZZBA 3BTYA 4LMFA 1Y9MA 1JHJA 1ZZ9A 2AR6A 3FMGA 5BNNC 1APNA 1IS6A 1KEXA 1N3OA 2HWB3 1VBE3 2Q1ZB 2Y26A 1VBD3 2FMDA 3LPFA 1AR62 3I2OA 1HV0A 2D40A 3LEIA 5LEKA 4LHSA 4W6XA 1V6OA 5LB6A 1POV1 5C3SA 4FAGA 4GB32 5GZFA 5A3MA 1AR71 3UGHA 4LUKA 4EJRA 2RJ2A 5IVBA 2IFWA 4ARYA 2Q0AA 4GAZA 1NAEA 5IATA 2GC1A 4CCMA 5F7UA 2VZTA 3T1MA 3KMHA 4BIFA 1KJLA 1PZ9A 2W1WA 3LB9A 4KL1A 2W1UA 5ACA2 1UXZA 4I3GA 3GGLA 1V0AA 4P14A 4L0PA 3B93A 1UZWA 4IV1B 5CFCC 4AQTA 1QOOA 2RDQA 2V4AA 4IE4A 3V0AB 2W5FA 2XJTA 3DPRA 3AYCA 3BTAA 1ALYA 4ZU4A 1W2OA 1DU3D 5BYNA 5F5IA 3DYMA 1C8M3 1VB2A 4FVVA 3H3UA 2ZGMA 3X29B 4BA6A 5FWJA 1VMFA 3P5BA 5FYMA 2ZGPA 4XIKA 1O4TA 3LEMA 4IQPA 2WC2A 1W03A 4P9WA 4OI0A 5FAXA 1S0EA 3H8OA 2X53S 1Q8QA 4OI1A 4GH4B 2ZKLA 4UBGA 4FI9A 3ZYGA 4AEDA 1ENRA 1QJX3 4RR3A 5GLZA 3UKNA 3RZJA 4NHXA 5KC5A 3J7MA 2WFF2 4LE4A 4QHBA 3VBOC 2W68A 1MS9A 2DUPA 1PNGA 1PGL1 2R16A 1EUTA 2PTMA 4PIYA 3VBOB 1CIYA 2W46A 3PIJA 2HWC3 3ZSKA 2PLV1 2W92A 4XILA 1YFXA 1W6MA 2GU9A 1JOBA 1WA6X 3ACFA 2VAUA 1DIWA 2OT7A 5I0SA 4NPLA 5K9YA 2D98A 3NAPA 4XBQA 4DEVA 1E5RA 2QZ3A 1W9TA 2XBO2 4V1PA 1O8SA 3TAYA 3MI8A 3R0RA 4P9IA 1F15A 5KHIA 1AX0A 2RMU2 3H42B 1CGPA 1VBE2 3ZSMA 4CUBA 1RHI3 1RUD2 1SCSA 2D6PA 3E5UA 3POSA 4Z8BA 4MGZE 5F1RA 4FPLA 1KS5A 3Q8EA 1RVF1 2XJUA 1DZQA 2JWPA 4FPEA 2LW8A 1BBT2 2YZ4A 3H3LA 4GIQA 1QJY1 4QM8A 3U10A 3VZMA 2TUNA 1R081 4CP2A 5EYYA 3GZAA 1W8UA 1WLWA 3IAQA 2Z5WA 4AVBA 1LHWA 4LORA 2ZEWA 3V0AA 4K1YA 5I8SA 3S7EA 1GU3A 1WMDA 4GZ9A 3OUJA 2CAVA 3FX3A 1JBCA 4KBBA 2AUYA 2IVJA 5FPAA 5AFBA 5FJHA 5CNAA 2JE9A 4XUPA 3WP6A 1QNWA 4W8JA 2ZGLA 1K5JA 2QQIA 3JBG1 2BRTA 3T30A 4AGRA 4BQ2A 1MEC3 1V70A 3AVSA 3ZYIB 1MS1A 2PAEA 2P5BA 4OHZA 1LODA 3ABZA 3VD3A 1PO11 1YUDA 3HNMA 5FUPA 1NKGA 4DEQA 2XJVA 4WVVA 2W0XA 1RUC3 3SCFA 4YFZA 4AI1A 3J26N 1LCLA 3IKWA 5FO9B 4FFGA 5H9RA 4COWA 4DS0A 5GLTA 1NXD1 2B39A 4AQ6A 3BU7A 1W6OA 4MXWA 3GNEA 4HKWA 5BNNB 3HNBM 3UKVA 4XETA 3ITQA 1JYIA 5FPVA 2HWF2 4BHPA 3CZJA 2GZWA 3J8F1 3KV9A 3ON7A 5F2WA 3ETQA 1GZTA 1ULPA 3GXUA 1V6LA 1XNAA 4L99A 2D5FA 1VRH1 3QD6A 5FO7B 5F9TA 1YLLA 5JAXA 1CVNA 1R64A 1FNZA 3ZXGA 4BB3A 2PHRA 3M7AA 3EJKA 5FYUA 1W0OA 3GJAA 4FO9A 4EV0A 1M06G 5FYZA 4AI8A 1XOYA 4UF0A 4YM0A 3H9AA 1GP5A 3C7EA 1GP6A 4CEYB 2H0BA 2WT0A 3WQBA 1S2KA 1WZXA 3H8RA 4PQ9A 2E7AA 4IGQA 5FZ0A 4E4HA 1WW6A 1PMHX 3NMBA 4IXLA 4CEWC 4Q4X3 4XJZA 2D6NA 2VZSA 3THTA 4D69A 3TEWA 4FXGB 1XYPA 4LKEA 1UXXX 1W2AX 1W06A 1HLCA 2FMYA 1LTEA 4XDOA 4ZKTB 1GFF2 1QJEA 4G9SB 1U5YA 2PHXA 2CU5A 1FT9A 2HWD3 4HT1T 5DZGA 1A8DA 3ZDVA 4F3JA 1CAWB 3TN93 4YZ5A 2RS31 2WIIB 3FFZA 5L73A 3ZXJA 2BWCA 4QPYA 5KXDA 3OBAA 1HB3A 2YDEA 2VQUA 4RHV2 4WM7B 2YMZA 3PUHA 5FV3A 4XHXA 5FQ0A 3SISA 3USUB 2B9UA 2WS91 4BQYA 5IFTA 4MVTA 4ISQA 2ZX4A 4Q0SA 4Q8LA 4QU2A 5C8CB 1ACCA 2NP0A 5EIYB 1HQNA 5L7OB 3N35A 4CP0A 3NV2A 2R062 4RN5A 2P2KA 1TME1 4JHTA 2VOXA 3EXUA 1LJ7A 2HWC1 3V65A 3V56A 4B3NA 5CVRA 1SFPA 1U5IA 3M3QA 1YI9A 3MPBA 3VBRA 2A1XA 5DAPA 2VOVA 3H8UA 1UMZA 2WJSA 2YG0A 3K51A 4QPIB 4GB31 5A80A 3VBUC 1PX4A 5A3WA 4DMIA 4A4AA 2VOTA 1YYNA 3VBSA 2LRPA 1XNDA 3KVBA 1S4CA 5IVVA 5J48A 3AYAA 3UV9A 2MEV3 2QTWB 3ZPYA 2ORXA 4LHNA 1W28A 4DY5A 3OCPA 4AFMA 3VZNA 4FXKB 5A70A 1GSLA 4BISA 3WQ1A 2D97A 2WNVA 4JQRA 2DVGA 1JMUB 2VQAA 4KQ7A 2V09A 4MSVA 5FZOA 1WUVA 3SKJE 5AFEA 5FYSA 4JAAA 1RUE3 2JG9B 3NNMA 4BQXA 5DAWA 1HRV1 2OKXA 2J1RA 2DU0A 3LQCA 4UI9L 1AL0G 3OB8A 1CZTA 1CQ9A 2YBKA 2CAUA 3O0WA 4QQPA 4QX2A 3ZIWA 3MZHA 2H0VA 4QDSA 1CAVA 4URTA 4COYA 1LESA 1AYM1 3P6BA 5FPLA 3JD71 1WKYA 4XF9A 2FDJA 4FQZA 1ND2B 1H8TC 3QACA 1DDLA 4AEDB 2A7AA 4LBMA 1MEC1 4CSWA 4IEUA 3MEPA 3RVHA 2OVUA 5A6XA 1BBT1 4FPJA 4RHV3 1QJU3 4PF1A 4RA0A 4N53B 1A78A 3LA7A 1SLTA 5FUNA 2XH6A 1UYZA 1HRI1 3N3HA 5CYYA 3H0OA 4QXCA 1IKPA 3MHZA 4XJ9A 1OLQA 4E2GA 3NKTA 3D0SA 4AHXA 2WA4A 1ZRIA 4W50A 2VECA 4IV1A 4CCCA 5JPNB 1YNAA 3E5XA 4AVTA 4XF1A 3S30A 1W6PB 2ZAHA 4AF9A 1Z7S2 2FDIA 1BZWA 1VRH3 2A70A 2WNEA 4CDUC 1Y9QA 2J1EA 3D3AA 2IXLA 2XJQA 1ZVFA 5IK4A 4JKKA 2ZGQA 1UF2C 2DURA 4XQ4A 5KC6A 1SLCA 1LHOA 1R1A3 2BDRA 1JXNA 1W8ZA 3OBTA 4DRRA 3PIGA 2QQMA 5HV0A 1CAUB 1GZWA 3HR9A 3VZKA 2BW8A 1ZZ7A 3C8XA 1YJKA 3UK9A 4A6OA 1URXA 1O59A 1YEWA 5FY4A 2ATFA 5C4WA 3ZYJB 4XFGA 5BXXA 3DUIA 2LALA 1W2UA 4PHZA 4LR4A 1F2NA 1OLME 2DUQA 1B35C 1RHI2 1RUD3 2XQXA 4YM3A 3ECQA 1L7LA 4CPBA 2R071 4UYBA 3ACIA 2HEWF 3T1LA 5F32A 4O61A 1DCSA 3OY8B 2KA3A 4UW6A 4BH9A 2QQUA 4DNYA 4FPYA 1HJGA 1K5MA 2EIEA 4K6BA 5H9PA 4BMBA 1AZDA 1OKOA 2E53A 3VKOA 2TBVA 2JG9A 2BZDA 4Z2AA 2JDKA 4Q4X1 3H3ZA 4X8PA 1IG0A 1PVC2 1N3PA 3LFMA 3WF2A 1OOPA 2VBPA 3AMNA 1YXWA 4KWUA 2I07B 4ISRA 4TXWA 2J42A 5HPOA 5C5TA 1RUJ2 5FLIA 4YVSA 4XYXA 3NQHA 4YVWA 4JGZB 2ARCA 2GMMA 4XBNA 3UL2A 3U4SA 1C1LA 2EICA 1XYOA 3WP5A 1I5ZA 2O1QA 5JSPA 2B5HA 3WG3A 4UBHA 3MIDA 1XSQA 1JYXA 2ZABA 1NQDA 5DG2A 2ADEA 2QFEA 5F6KA 4BZ4A 3O1TA 3BGAA 3RI9A 4XBLA 1ZRCA 3VHNA 2AREA 2A75A 5EWSA 1GUIA 4Y3OA 1WW4A 5E16A 2YC2A 4HL0A 3LOIA 4HXCA 1XSRA 4YW3A 2RS32 1H8TA 5FK7A 5F8PA 4QX8A 4A3XA 3N4MA 1UN1A 3KGZA 2V5DA 1SPPA 3RMXA 1F4AA 1W05A 5FREA 4WV8A 5T5LA 4R4XA 2PELA 1UZYA 4HKLA 5ACA3 4Q1PA 1CAVB 3IIAA 4PQQA 1AYN2 1XU2A 3O12A 4IEPA 5CFDA 3UGGA 3H7JA 5ISLA 3NJYA 5KHGA 4Y1VA 1IQDC 1HRI3 2NMOA 1O8PA 1VB4A 2BWAA 1HXS3 1OF3A 2JDUA 4OCTA 3ZFGC 2RJKA 4MZUA 3GZTB 4M3CA 2WNVC 1ULFA 1J58A 1W8HA 3PJQA 4QPGA 5KR7A 1NXMA 1ZZCA 4R9CA 1OXCA 2C5DA 3RWNA 4EWEA 5CFDC 4ZXKA 5FZ7A 1CAWA 1BCXA 3EYPA 3N36A 2KXLA 1WD4A 3FHQA 4BDVB 5IK8A 2VM9A 4OUSA 3QH7A 3PLQA 3N9QA 3DKQA 3NJVA 1M4WA 2I74A 2K46A 1E57A 5DQ0A 5SV8A 1K45A 3VBFB 4ASKA 3WW2A 1MQTA 5L7OC 2QQNA 3RJRA 1WLCA 2DVFA 3IDAA 1RUE1 5C6CA 4HN0A 4QX1A 1MS4A 2ZMKA 4MX3A 1NA1B 4Q26A 3SEPA 1S0FA 1XNBA 2V73A 4CTEA 1GR3A 2W47A 2YPJA 3ALQA 1H2LA 4LO6B 4P9XA 2BFUS 3DN7A 2VH9A 3AYDA 3O0VA 3OEBA 1X7NA 2WT1A 5DXDA 4PBPA 4C8DA 1V6NA 4Y20B 1TE1B 3NNGA 3S6PA 1RMU2 4BLIA 4NIHA 5F3IA 5IVJA 3OD0A 5LA0A 1POV3 2XVGA 5A3TA 1REEA 1BBT3 1ZZ8A 4RHV1 2WZ8A 1DLLA 3BUCA 1RITA 3FWEA 3NAPB 1A34A 3KT1A 1N1VA 3ZX7A 2Z4FA 1NLSA 3KV5A 3CEWA 4FFIA 3IN9A 2WFPA 4L97A 4I0AA 2WFF1 4K7JA 4OMCA 5FZHA 4EWDA 3O1SA 2D3PA 5EXOA 2ZHNA 4BQ3A 2WO2A 1UY3A 3HT2A 2E51A 4N7IA 3POFA 4XMIA 3EHKA 2ZBJA 2PAMA 4CEYC 4CDWC 5ERLA 1GICA 5FY0A 5C4WB 4J25A 4IE0A 3LA2A 4NHKA 5FP4A 2BFUL 3POBA 4QPWA 3N7JA 1MZFA 5LY2A 2ZJCA 3CL1A 3U07A 1YQ8A 3ZXAC 1OURA 1A3KA 1C28A 2Y0IA 4YGDA 3CJIB 5JXIA 1G86A 3RI8A 2RS11 2RHPA 3AMHA 4D6QA 4XURA 3A4UA 5FMBA 2VUAA 4TLFA 1F5FA 3VBHC 1QJY2 2HWC2 1GQPA 3WDVA 4IEXA 1ZX5A 1WD3A 3VDDC 4B7KA 2YB7A 1YFUA 2Y6KA 3B9CA 1RUI1 1Y4WA 2VMFA 3VV1A 1AJOA 2Y0OA 3K77A 1CZSA 1UW8A 4FPCA 4CP1A 1ZBE2 3NNLA 4XUTA 3KS7A 2BNNA 3BIWE 1WWYA 1OD3A 3T0BA 4QB1A 2E26A 3B69A 4N53A 4ZONA 2WS93 2W1QA 4XQWA 2GALA 3IWZA 3O5SA 5LW9A 2XOMA 2R072 2QQVA 2X10A 3LE0A 1UPIA 1GBGA 4LBQA 1OFNA 2WBKA 3I4IA 1RMU3 3B02A 5JR2A 5KWRA 3FHIB 3KV4A 4Q0PA 3WNPA 1HV1A 3MPPG 1QIQA 5FDBA 4UFMA 1X9TA 1NOVA 4FPOB 3B3QE 1PO12 1EAH2 1OQ1A 1W8NA 2F17A 2Q1MA 4GJYA 4WZFA 5JPMB 4LHLA 2CSGA 3ME2A 1ASJ3 2X8KA 1ND2A 2P3JA 1SPPB 1P8JA 2HEYF 2YY1A 3AFGA 4AZZA 5IUQA 2JDYA 2CYFA 2R0FA 3C7FA 4AEMA 1DQ0A 4H7MA 1K3IA 3VDAA 2OIIA 4KWLA 4P9GA 4FSJA 1E5HA 2WAAA 5ANQA 4K21A 1LECA 3P3PA 2UY9A 5D8AC 4LBJA 4PCRA 4B7EA 4L9BA 1CAXA 3THPA 2NN8A 2J1AA 3C7HA 4K40A 1O5LA 4MGKE 4LOTA 3H1YA 1AR63 2HWB2 3GBWA 4Y4YA 5F5AA 1OVSA 1BKZA 5A3OA 4R52A 4ZY9A 4OQ9A 4OVEA 5FO8B 1GNYA 4XXPA 2HH9A 4QX7A 1NZIA 1NA1A 2VZRA 1D4M1 2Q8CA 5ABJA 2ARXA 4M01A 5F3GA 4BK4A 3KCYA 2ZGKA 4P5HA 5EQUA 4AVAA 1RGSA 2J1VA 1HJFA 2WAOA 2WZR2 1DGWA 4NMIA 4XCAA 3UYJA 3O1VA 4INDA 1LEDA 1MQTB 1W6MB 2D43A 2WQZC 5J98B 2B4KA 3O1UA 2D3SA 3LPGA 4XVHA 1QJY3 3VZOA 3ZKUA 1CX4A 3APBA 1SHWB 4LT5A 1VBA1 1LR5A 4QKFA 3GZEA 3QBQA 2P4EA 2J1TA 4GH4C 2FQPA 2OQ7A 2YGMA 4H3WA 5FZ6A 4DOUA 1CN1A 4Y26A 2W87A 3EBRA 4CXYA 2AYHA 3IDBB 5I8TA 1XXNA 3I2IA 5B4NA 1H1AA 4EZ4A 3P3NA 3KQ4B 3WDYA 4WZCA 1SBFA 4E2SA 1YIFA 2CWSA 2VOWA 5C3QA 4NIGA 3ZMOA 2ET7A 2AC1A 3DEMA 1XB9A 1BK1A 4GH4A 3KT7A 4TYSA 1RUJ3 1ENXA 1QQP1 4JTNA 2VQ0A 1IPKA 5GLUA 1AL22 3POYA 1PO13 2WO1A 1QMJA 2W91A 2HWE2 4OLLA 4BQ1A 3WW4A 3DPRC 3Q9OA 4FCAA 2R1DA 3USSA 5BNOB 2WABA 3VBSB 5FRAA 3VKNA 4KWJA 4QPIA 4B1MA 4LBNA 5IVCA 1NA1C 4KU7A 3OBRA 3VB9A 4DZGA 5C9AB 2PHLA 1ZBA1 5K0UB 2ES3A 5BUVA 1NCRB 4Y1YA 5A7SA 2G9FA 2EF6A 4XJ8A 4HKOA 2VULA 3GCWA 5FZ1A 3WNXA 1RMU1 1LOGA 4AI0A 3ZFGA 5KXBA 3WW3A 5L7OA 5CKQA 2W3JA 3E1F1 4WVZA 2WO7A 3DCQA 2RMU1 5LWBA 4XF3A 5A1LA 3R4DB 4F83A 1RUD1 2B45X 2C9KA 3LFIA 5FCCA 1HB4A 2XMLA 1SFYA 1OA3A 4JDOA 1GQGA 4MG2A 1OH3A 3AP9A 2ZCWA 2VZ1A 2WRAA 3TEZA 2K2SA 2P34A 1BHGA 3RWKX 5HI0A 5I8YA 4DINB 4Q29A 3RNSA 4E8CA 2J7MA 3AXDA 4IE6A 2WN3A 4Q0QA 3TRSB 1RUF1 2Q8DA 3HBZA 5LBEA 1RTVA 4K9SA 4FTSA 2ZGRA 1UOBA 2D6KA 5CISA 5FOBB 4E27A 1HRI2 3MW2A 1GOFA 1GV9A 3ZOIA 5A1AA 5J1XA 4RFT0 1HB2A 3WNMA 4YVWC 4DY3A 2FZ1A 1S0IA 4A7YA 4META 1DGWX 1H30A 1Q8SA 3S57A 4ZZ5A 3ZFEC 1H2NA 4H7LA 5JZGC 1JZ2A 2WYFA 3PVBB 3ST7A 3TEYA 3BN6A 4HANA 1EY2A 1QWRA 1OVPA 4IV3B 1ZREA 2J1SA 3I3EA 3I3QA 4ORFA 1AL23 1X36A 2ZOEB 3OSDA 5A7OA 3T4HB 3K4DA 2A6XA 2PHUA 3LSDA 4LO7A 5AC91 4E9KA 4EN8B 4G4FA 1OA2A 2E32A 4JQTA 1KDMA 2V72A 2B42B 2CDPA 4N9IA 1LENA 4CXWA 5IAVA 1LKNA 2HEVF 3MGUA 1W9FA 2IXJA 3B00A 2YFZA 3N9LA 1LRHA 3OGVA 1QH6A 5FZCA 2C9AA 5J7MA 5I91A 2JG8B 1IKQA 3WCRA 4HZFA 5K0UC
chains in the Genus database with same CATH topology
4YSFA 2IFRA 2ZGSA 3SMHA 1S55A 1VIWB 3URFA 1NCQA 1ULGA 1SLBA 4AI2A 4N9HA 1JHNA 4YM1A 1UAIA 4OUMA 4D94A 4DXZA 1AF9A 2LUWA 4Q4X2 1KJRA 4QQLA 3FZ3A 1H4HA 3MICA 4QQHA 2Q30A 1REDA 3NJZA 1N1SA 1XNCA 2OUHA 3RG0A 2ZACA 4JDMA 1MACA 4IEZA 1VAMA 4IEYA 3QOPA 1DQ1A 1WLTA 3VBOA 4B29A 4FOQA 1ULEA 5LK5A 4L92A 3AKSA 3TNPB 2OPKA 3JZVA 2Y38A 3JQXA 2XJPA 3KQRA 2WNUA 4XIOA 1FOD2 3WZ1A 4Q4W1 1QNYA 3ZSEA 1PZ7A 1PGSA 4SBVA 5DDJ1 1J1TA 3FC0A 3R4UA 2H6CA 1EP0A 4H55A 4XF4A 3WG1A 1U5ZA 2O8QA 1COV1 1IOAA 1GANA 1UU6A 2PA7A 2ZAAA 1O3SA 1C8NA 1QY4A 3AZZA 2DFBA 3MIBA 3MW3A 5DUUA 1O4YA 5K8SA 2DCTA 5FMOL 1ZBE3 3KCCA 4MXWB 4R9AA 3ZDSA 1RUNA 4QT6A 3PJYA 3TYJA 2DVBA 3KT4A 4C90A 3DF0A 3ILFA 3I8TA 1W6NA 5CAZA 4A7KA 2XVKA 1TNFA 5GALA 3NWKA 1C5HA 1CJPA 3KCXA 1W6NB 4IEQA 2DU1A 1AXZA 4Q1RA 2GC0A 5DZFA 1R1ZA 5EFUA 2XJRA 1ONAA 4C0HA 1RUE2 2Q8OA 1RJ8A 1U0AA 2R30A 3OGJA 1ZBA2 1ZZ6A 2RS33 2WZR3 5BV6A 1NE6A 3LWCA 2GH8A 4Q4Y3 3SLIA 3ILRA 3QLQA 1YFWA 3KLSA 4DB5A 2X5IB 1W6PA 3VDDB 4N90A 1MVEA 4YVSC 5J09A 3NKGA 2DCJA 2JD4A 5E89A 2CGNA 5ABJB 3HAGA 3L9JT 1Q56A 1RUF3 2ZGUA 3D6EA 1QOTA 3AMMA 4FOVA 3AMQA 1RUG1 4NWWA 2FHRA 3WUDA 3PNAA 5JSOA 3VL8A 4YARA 2WNUB 1OD5A 2A73B 4WVWA 3TWIA 2SLIA 3AP6A 2VMIA 4PBOA 4ES9A 3O14A 4RGGA 2CGPA 3IDCB 2JG8C 4Q4Y1 1Q8PA 3AMPA 3AB0A 1FAYA 4UW4A 1ZYBA 1B35A 3OYWA 1AL21 4L2NA 2A3YA 2ZMLA 5H9SA 5T54A 3ZO0B 4YM2A 4XMAA 4XTMA 2WNVB 1BJQA 1S0CA 3KSCA 4Z1VA 2JJ6A 4W65A 2PHDA 4FQ4A 4U36A 5FTTC 3OTFA 4FTBA 3DV8A 2PAKA 2JE7A 1OKQA 3BOPA 1PIV3 1AX2A 2ZHKA 4LE3A 4NPRA 3TN91 3H7YA 1FMD3 3RPQA 2Q5TA 5JMCA 4AEKA 1TQ5A 2IXIA 1MS3A 3E6DA 1H1MA 4R8HA 3AKRA 5E1RA 3JBG3 1VBA3 1VP6A 3CJIC 2R32A 3IPVB 2SBAA 2E7TA 3G7DA 4CYDA 1AR91 1BEV2 2UWBA 5C8WA 2CTVA 5FPXA 4AYUA 2BNMA 1RUF2 4Q4W3 4FAHA 2D93A 4M3CB 2FBEA 3ZFFB 3AZVA 1MZ6A 2UWCA 1HKDA 5J37A 3MFAA 3FJSA 4DFSA 2JICA 3LCPA 2EA7A 2VOKA 3H50A 4MUVA 3ZN6B 1XU1A 1YFYA 1QJX2 1OPMA 2ZTNA 1PK6C 4QGNA 1BMV1 1DBNA 3L2HA 1AR83 2YC0A 1VAKA 1DQ6A 1XE8A 3CO2A 4I01A 2XLFA 2XKPA 4OI4A 5JIAA 4XJUA 1HW5A 3WCSA 3AZXA 2YUEA 4W6YA 3S7IA 1DYPA 1KFXL 4CDWA 1NY72 1FYUA 2Z2SB 1HXS2 2XG3A 3M3CA 4RS5B 2W08A 4XXAA 3OPZA 3VBSC 1ZBE1 2HYKA 3FUOA 1V9U2 4LBOA 3ATGA 4YZ3A 3SH5A 3E6CC 2XLAA 1AR81 2NPIA 4JVAA 1G9BA 1RINA 3ES4A 1RVF2 4JGYB 1EAH3 4Y5Z0 2ILMA 2K0GA 5AC92 2R6QA 2ZGOA 4CDWB 5C4WC 1YO8A 4HSLA 1AUYA 4ES8A 4E4SA 3QH6A 1OFSA 1U5XA 3R4SA 4HFSA 2WWSA 1TEIA 5EYXA 4LLOA 4OI2A 3A0KA 3TNQA 1BEV3 2QE3A 3MW4A 3M3OA 2JKBA 3D4KA 1Y7BA 1H4GA 1C3HA 4RL7A 1MEC2 2EXHA 3JUUA 4PDWB 5JI7A 4AVVA 4IV1C 5CFCB 4XFIA 1OQEA 5JWPA 1S0GA 2DFCA 3GALA 3HMYA 5KHHA 1FV3A 1R083 2YHJA 3WW1A 1FOD1 3CU7A 4NHLA 2R49A 4HVQA 5KHJA 2R1BA 1KITA 4AHZA 5JOZA 2B7YA 1W6QA 5DUVA 1RC6A 2Z42A 1FATA 1UU5A 3WLUA 2DVDA 2EXIA 2MHFA 2HWE1 1CR7A 2W39A 2BGCA 2BYVE 4MGYE 5FMOS 3VN4A 1FNYA 2XWBB 4GKYA 4GMP3 3ROUA 3L2YA 4IV3A 1MS0A 2UWAA 1BXHA 2C0ZA 2ZKNA 4BPZA 1YIPA 3I59A 4HMZA 4QX5A 4FOYA 2XUMA 2ZX3A 1CAXB 2HWE3 1MR5A 4XJAA 2DUOA 2EXKA 1J59A 2GN3A 1Z0HA 3RS6A 3LOBA 3VZJA 4XTPA 4IEWA 2IXHA 4MYEA 2BTVC 2UYAA 4YW1A 1LOAA 1ENQA 3FBMA 5LK7B 2XGXA 3KZ4C 2F6BA 4QQOA 1IHMA 3OJBA 4Q4Y2 2GSYA 4KGQA 3LA3A 1ND3A 1LGCA 1XNKA 3B9IA 4L8QA 2XVLA 4HN1A 2JG9C 4RQPB 3DPRB 2ZMNA 5HCFA 2GH2A 2RMU3 2CWMA 3CF6E 4WBBA 5IT6A 3WQ0A 3CLPA 4YZ4A 1W0PA 3ASIA 4M00A 4NR1A 3HD8B 1HQWA 1LHVA 4MH0E 4XDQA 3VBRB 1JH5A 2P3IA 4FOWA 3M8LA 2QKDA 2ZX0A 3VHOA 1O4ZA 1EYBA 5TSWA 1N47A 3OY8A 1WA4A 4YG3A 1VBC3 2RS51 4I3PA 3M2MA 3NAPC 2E6VA 1J3RA 2DV9A 2A6WA 1Y3TA 3I54A 4AE2A 2IXKA 3N7MA 4YNIA 2AZ5A 4UW3A 2WZR1 3DGTA 1OQDA 4YGEA 3WR0A 2WZPP 2DF7A 2OW4A 2HWF3 1CPMA 5E8AA 3LGRA 1R1A1 4KWKA 5L36A 3NV1A 2XB6C 1GZCA 1SEFA 1IS5A 1A8MA 3G6JB 1D4VB 3SNMA 2OZ6A 1AX1A 3VUOA 2Z69A 3R6SA 1LOBA 4P9LA 4YZ1A 5CBLA 3SH4A 1DQ4A 1S0JA 1WW5A 4QGMA 2ZZQA 3NL1A 2E9QA 1ZRFA 5GKAC 4N53C 3E97A 4R9BA 2D6MA 2RJLA 4YW2A 3SCGA 1TME3 4FBFA 3WP3A 2N7GA 1AR82 4JRLA 4CDQA 1C5IA 2GNDA 5EJ3A 1QF3A 2NMNA 3SXWA 2CV6A 1ZNPA 4S2GA 4Q2FA 5KBFA 4WM7C 4QPGB 4OHWA 2EALA 4PLNA 1DG6A 3FE5A 3WX5A 3TOJA 4AHYA 2JDZA 4Y24A 4HBNA 5DDJ3 1D0GA 5HCBA 4NVPA 3FLTA 4AW7A 3PVEA 1REFA 4P9YA 5CFDB 5F6LB 4E4DX 1V9U3 2D6LX 2VGDA 3BODA 4OHYA 1ZM1A 1AHSA 1QJX1 3R05A 5JVVA 5BNPA 3A0NA 4CRQA 4QD2A 1BMV2 4FPFA 5T55A 3IDEA 5ACA1 5I0TA 3VKMA 3LAGA 3AJYA 3AK0A 4YZ2A 1NYWA 4XE9A 3WY6A 2R043 1H0BA 4UW5A 2BPA2 2WSUA 3ZN4A 5JCTA 4AGVA 1AR72 1WW7A 5GJ6A 4EN9B 5L19A 2IXCA 4I02A 1PIV2 1SLLA 3USUA 1HDKA 4MV2A 1R082 1IZ3A 3VL9A 5LRSA 1AJKA 5J3UA 3J8F3 3ELNA 4PDWC 3WDUA 4HVRA 2D7FA 1ZBA3 2R041 1DGRA 1S1AA 5GLWA 1WGPA 1OA4A 3TN92 3HQXA 1O3TA 5AVPA 2XBO3 3I7DA 1PGW1 3M70A 1QDCA 1LU1A 2VY0A 5JLVA 2ZZJA 1KDKA 4AFAA 4CDUB 1DQ5A 1FV2A 4DQAA 4X6RB 2PQQA 1NCRC 3V0BB 1PK6B 1CD3G 2XLGA 1HIXA 2PFWA 2UY8A 1C8M1 1V6IA 4ZU5A 3S0MA 1NG0A 2VW1A 2NQYA 3ILNA 2BVVA 4PLMA 3WHTA 4JCKA 1EPWA 5CADA 2QVSB 1X8EA 4BE3A 1X82A 2ZX1A 2B8MA 2ET1A 2HWF1 3EO6A 1AYM2 2TEPA 1GKBA 3ES1A 5AVAA 1KXGA 4YW4A 1Z7S3 1VJ2A 1VRH2 3VBFA 3D82A 1X33A 3KB5A 2A5ZA 3PMEA 5CG8A 4FPHA 1CPNA 1UIJA 4ASLA 1FI2A 3MF6A 3POWA 1LU2A 4LLFA 1VR3A 2D6OX 3ACLA 3TB0A 5C9AC 4BYYA 4XZPA 3ENRA 2YYOA 3GHMA 2X29A 5JSRA 1RUG3 5JI9A 3AKPA 3VKLA 2QNKA 4RQPA 1C57A 3AKQA 3BPZA 1VBA2 1PZ8A 5AC93 2WT2A 1R092 3AZWA 1VBB2 3PVNA 1B09A 1GYKA 1SLAA 1PO21 1H9WA 2QZ2A 3OYWB 1GQHA 2WNUC 4JRAA 4YFWA 5DZEA 3ZVXA 3AP5A 4WM8C 4ZU7A 2WQ4A 5D8AB 2LTNA 4XPVA 3MLLA 1Y43B 2DTWA 4HSJA 1QJU2 1ZRDA 3KGLA 4NHMA 1QQP2 4FP3A 2D3RA 4Y20A 3W59A 4AQ2A 1RB8G 4YVSB 1NY71 3M3EA 2YGLA 4BLJA 2WLQA 1OPOA 4Q4V3 5K0UA 3W9AA 2GN7A 2JENA 2RS52 2TNFA 4YW5A 3E5QA 1ULCA 2UU8A 4AFCA 4WM8A 3D5OA 3SITA 2EVXA 3ZXEA 2VVFA 2WA3A 5SV5A 4LO8A 1X8MA 2GNBA 4I0WB 1DGLA 2B46X 1J1LA 1VBD1 1SFNA 3U4XA 5FLJA 1F9KA 5A32B 3VBUB 3WDTA 1L3JA 5CFCA 4BIOA 4DRVA 1AR93 2WS92 4GALA 1PK6A 1O5UA 3JB4C 2I2SA 3JQWA 4CEWB 4OHXA 2ZA9A 2MNGA 2EAKA 1JYCA 2D5HA 4X6QB 1GNZA 3JU9A 4K3UA 5E88A 4AFDA 3WUCA 2A6VA 4EWAA 4UXAA 1UX6A 2QDNA 1ASJ2 4J1XA 4B4RA 1AXYA 1TMF2 4BM8A 1KQRA 1LHUA 2XBO1 2VMGA 5JOWA 4FP2A 3WT3A 1HQLA 2EAAA 1IGOA 5A33A 4A7ZA 1IQAA 1PO22 5LEJA 4TWTA 1EPZA 4FT8A 3CJIA 3QCWA 4LA3A 4Y22B 1UL9A 1QJU1 3VLBB 3WXPA 3MIGA 2A3XA 3V0BA 4Z92B 2K9ZA 1QGLA 4M3CE 1NCRA 2VW0A 3CNAA 5DDJ2 4CZSA 1Z78A 2A6YA 1D4M2 1HRV2 1MVQA 2VVDA 4IEVA 4IV3C 3V0AA 1DZRA 2WSVA 2XJSA 4NO4A 1ND3B 1LOFC 4COVA 5HBAA 4IEOA 3OF1A 2VVEA 4AI3A 1Z7S1 3ZFEB 1N3QA 1X50A 3B7MA 3MLJA 1Q5OA 2GNTA 1VAVA 4HPKA 3J9SA 1RUI3 3MIFA 4WVMB 2BVBA 1KD7A 3B5LB 1I6XA 4YLZA 4O9GA 4QXKA 1Q8OA 1UZZA 1BQPA 3WD5A 3GYDA 4XJWA 2ZPXA 2G9GA 3N7LA 2YV8A 1H2KA 1DFQA 4E4ZA 2VNOA 4XEZA 2HWD1 3FLPA 3HWJA 1BYHA 1HX6A 3FFQA 3HT1A 2EIGA 2QDRA 3FUQA 1H9PA 2A71A 2BEOA 1J3QA 4WM8B 2CL2A 1O3RA 1G9AA 2VNGA 2R0HA 1SBDA 1KRIA 4Q27A 1YWKA 4BWOA 5K0UB 1SBEA 1JW6A 1NCQC 3AXEA 4BOWA 3RZZA 1PVC1 1WCKA 3FBYA 4ONUA 1G7YA 1F8VA 3O0XA 3GBFA 5C8CA 4NN0A 4IL7A 3GF6A 1SDWA 5D8AA 1V9U1 1PM7A 4ASMB 5IK7A 2JECA 4D7YA 3OGGA 3J8F2 4IERA 1D4M3 2A6ZA 4P9JA 2IZWA 4RD7A 4Y1ZA 4Z2WA 1OSGA 1TNRA 2XL9A 4QMAA 5JZGB 1IS4A 4LUMA 5GLVA 3RJ2X 3VKFC 1H2MA 3AP4A 2CNAA 1ZA4A 2CY6A 1F5JA 1PVXA 4HK8A 1QOSA 2RR11 1WMEA 3RYRA 2VG9A 3MFCA 3ZFEA 4HK9A 1QKQA 3INAA 4J1WA 2QCSB 4JGZA 1COV3 4C0BA 4TZDA 4SLIA 1I3HA 1ND2C 3AJZA 4PIZA 4LHKA 3ZN5A 3MF9A 4AVSA 5A33B 4Y22A 1AYM3 5KXCA 4RS5A 3WV6A 3ZMNA 3VDDA 1LULA 3ZFGB 1LOEA 3H1MA 5JDBA 3NSTA 2XPJA 4GWMA 1PGL2 1D2QA 1QU0A 3WP4A 4I2OA 5GZDA 2BUKA 3ZFFC 3ZSJA 1N1TA 2DWRA 4CDXA 4W6WA 1I9RA 3MDPA 1FPN3 2BQPA 4C91A 2P3KA 2P37A 1UCXA 1G9DA 1BVP1 2AH2A 3M1HA 4JV4A 4I30A 1VBB1 3V64A 3JB8A 3BOWA 1PMIA 3MIEA 3J4UH 1QXJA 4LNVA 1AR73 4LBQB 4NOTA 1EV11 3GBGA 4U2AA 1QXPA 1CAUA 1GZWB 3ZSLA 4YRDA 1LGNA 2VUJA 4D7SA 4QPIC 2HKXA 3H1WA 2DVAA 4EN7B 1YJLA 5CU1A 1R093 5T3NA 1AVBA 1OMIA 4N43A 2RM21 3VBRC 2A3WA 5CIRA 1O3QA 3ZXLA 3HIFA 2GDFA 1RUH2 4XF0A 2VPVA 3AX4A 5C8CC 3ZXDA 5HCAA 2F4PA 5FPZA 3K48A 1O91A 2QUOA 4AGGA 4PJYA 2XKOA 3D0JA 3PMSA 4AEDC 5F5QA 1FOD3 2NLRA 1POV0 5DUWA 4B8EA 2G4IA 4AEJA 2DYCA 2WINB 1HXS1 1QH7A 3AYEA 3HN1A 2VMHA 4Q0VA 4Z82A 2I45A 4XQDA 1ND3C 5GZEA 1RIRA 1PIV1 1N1YA 1XE7A 5JZGA 1C1FA 3JD72 4Y1UA 1FXZA 5BNOA 3IBMA 1W6QB 4M0HA 4LA2A 1LGBA 4PF5A 1JUHA 4KH9A 3PTYA 2MEV1 1FMD1 2Z79A 2R042 3AKTA 1G9CA 5FLHA 1ZRRA 5CB7A 2XL7A 4XFAA 4LBKA 3UJOA 1MQTC 3IT8A 1V00A 4AQSA 5BY5A 4C1WA 4FPGA 3AZYA 3JCIA 2H6BA 1LOCA 3U11A 3ZFFA 2PHWA 1CONA 5BPXA 2NM1A 1TMF3 1V6JA 4AG4A 5KHKA 4XOGA 1DZTA 2X5IA 4OZXA 2BNOA 5HXVA 1H8TB 1KS4A 3M4FA 1VBB3 2RM22 1UD1A 4RGAA 4XFCA 4Y1XA 2HWD2 5KWRA 4B4PA 4FPKA 1GZ9A 1EV13 4OFGA 1DQ2A 4JGZC 4XFHA 2R073 1JTZX 5BNOC 4MLOA 2FZ2A 2HWB1 1SLIA 1RHI1 1R091 2O8OA 5CG9A 1OOPC 3DL3A 4KG0A 1QQP3 1S2BA 2P17A 2ERFA 4L11A 4LBQD 3RMYA 4ATFA 4GXLA 2DTYA 1GNHA 3VBHA 1IS3A 1MS8A 1UKRA 2IC1A 1PNFA 4F7ZA 1WLDA 2R063 1TME2 5DG1A 4D7TA 1NZCA 3SCHA 4YGCA 4R9DA 4CDQB 1VBC1 1D2SA 3ZXFA 1B35B 3RSJA 1DHKB 4CDXB 1UPSA 1JN2P 3UJQA 2ARBA 3VBHB 1GLHA 2MEV2 2CGOA 4CEYA 4S2DA 4COZA 5I93A 3ZXKA 1SCRA 3I2DA 5T5PA 1FPN1 2XHKA 2MPFA 1AR92 1BEV1 5I0RA 1MZ5A 1VLNA 4X8NA 5JOYA 5T5JA 4F8AA 3B01A 4MGIE 4JC1A 2WFF3 4XHBA 1G6NA 3IPVA 3U0ZA 1KFUL 3BB6A 4KGGA 4YYOA 1JUIA 1WBFA 3JBG2 5FOJB 4R4ZA 1S0DA 4N43B 1OLRA 4AK3A 2GNMA 4AHWA 4JDNA 1S0BA 4RR3C 2ZS6B 4JTOA 1CESA 2WL1A 2PHTA 1JOJA 5JR7B 4BMEA 5JOXA 3VHPA 1D0HA 1G9FA 2DCYA 4NWVA 1W6OB 2GAUA 5C33A 3UKTA 1ENSA 3ZN6A 5T5OA 1XQNA 1U12A 1V6KA 2AGSA 4PIXA 1MZEA 4S2FA 1YI7A 2RS53 3O7OA 1NE4A 1NLRA 1NQJA 4GB33 2YXSA 2JEMA 4AXOA 2PHFA 5GM0A 4GMP1 2PYTA 3NVCA 3WVJA 1DYKA 2D44A 4QPGC 5H9QA 3IM0A 4M0NA 5EZWA 1QXRA 3FLRA 3WDXA 4Q8KA 3I59B 1ASJ1 2RR12 2V5YA 3SHRA 1RUI2 3MLKA 4M3CF 1PHMA 3VBFC 1VBD2 3NW4A 1O7FA 3AP7A 1T6GC 1LHNA 3VZLA 3WG2A 2OYZA 2RS12 5J96B 5K7PA 1RVF3 4C1XA 3LKJA 4ATEA 2E7QA 4Z07A 2JXAA 4JGYC 3RYPA 4HPKB 2BBVA 4K20A 4GKXA 4EN0A 4RR3B 4BCUA 1TMF1 2ETEA 4B4QA 1PVC3 4HVOA 1WCSA 2KM2A 5BNQA 4A2UA 3W58A 3NV4A 4YGBA 4IESA 1EAH1 1NCQB 4PDWA 1FMD2 2C1FA 1V6MA 2PLV2 4I09A 2GC2A 4D3WA 3IMNA 1RUG2 2JX9A 1HRV3 4GMP0 1UIKA 1MS5A 5LRRA 4COUA 3AFKA 1YHFA 4LULA 2NZ9A 4HETA 4GWNA 5CA6A 3JD73 4JGYA 1RUH1 3AM2A 3NO8A 5GZCA 2HJIA 2R061 4LBLA 2RR13 1AYN3 1YCIA 3LSEA 1SMVA 4YVWB 4N43C 5T52A 3RRDA 2RE9A 4Q4W2 1WMFA 4K1Z