5D1XB

Isdb neat2 bound by d4-30
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
217
structure length
212
Chain Sequence
b'QVQLVQSGSEVKKPGSSVTLSCKASGDTFNTHTYSWVRQAPGQRLEWIGGIMPIFAASKSAPHLQDRLTITANKATRTAYMELTSLTSDDSGVYYCARDGRGALQYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D4-30 Light Chain
molecule tags Immune system
source organism Homo sapiens
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
total genus 30
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1xB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1xB01
5GZOC 4F3FB 4Z7WF 4UDUB 2XWBA 3G6JF 3O9WC 3LIZL 1FNLA 1P6FA 2P5WE 1T80A 2ZUTA 5F96H 3R0NA 2ICWI 4PRHB 5DEZA 4IRSA 5E2UL 3ARFD 4FFYL 1JFQH 4RAVA 1M71A 2HJKA 4AYFA 1F42A 4TNVK 3VFUA 5KSAB 1BWWA 5FB8A 3SKJH 2VISB 2DMCA 3E6HB 3LPGA 1MCBA 1D6EA 1R5WA 3ARQA 1GC1C 1WSST 3LEVH 4E42A 1PSKL 4X98A 5DJAA 3O3DA 3RDTA 2FX9H 2BP3A 4LHQB 3RVVD 5DZLA 3EJJX 4KKAC 1JHKL 4MA7H 1I7TB 1YC8A 2P5WA 4ZFOA 2Q86B 1JPGA 3NN8A 1WISA 1IEHA 2W9DH 2PW2B 3OKOA 4G6ML 4PGBA 1WFNA 3C60C 4LLMB 5IMKB 3HMXL 3NA9H 2GSGB 1SM3L 3GRWH 4KUCF 4MB4A 3T0XA 3CPLA 4OM0H 1J0HA 2R4RH 2DL9A 4NQSA 1GGCL 2QL1A 1JJUA 5ESQB 5IOPA 4GRMB 2A1WH 2EC9T 2DTML 2F53B 2ENYA 4OLZH 3MV9B 4U49A 5JDSA 1KXQE 4XP9H 1N7MH 5D2NB 3KYKL 1Z9LA 3MRPB 3PL6C 3ZL4L 1KN2H 2GFBA 2YOCA 4OZHA 2UWEE 1H0DA 1AIFB 2R2EB 4E41E 4K3DL 3O6MH 3TF7C 2NLJA 5DJ6A 5CJ8A 5HD8C 1VGKB 1LP9B 4OF8A 4JCLA 4KK9C 5GHWL 1BD2B 4MMXC 3KVQA 3MRFA 3Q6FA 4I13B 4NJAH 1ZGLA 4PB9L 5CS7A 3LS5L 1KENH 2WWKT 3B9KC 4CL7A 4X99A 1FVCB 3QG6A 1NAKH 2O61A 5GPRA 3OJDB 3T1FB 2BSRB 1NLBL 1UZ6E 4CRPA 3B9AA 5JPMB 5DO2C 4IRZL 4XCCL 4Z9KB 3BPCB 3RWHB 3KPQA 3HCVA 1G9MC 2OM5A 1WCQA 1X5JA 3EJYC 4MNGA 2FD6L 3SGEI 5HYJD 1JMXA 5CHNA 2RBLA 4M8QB 3VJ6B 3WIFA 2H9GB 3O0RH 1IAOB 2Y6SD 2ZUYA 1S9WB 1J18A 3INUH 4OLVH 3LKNA 3ZYIA 1I7UB 3F7YB 4YDVA 1QO3B 2VLMD 3OB8A 3CVIH 1ZEAH 3D5OF 1KPUB 1MQKH 3FT2B 3RGVA 2X6MA 1NMAH 3LS4L 1IC7L 4U1JA 5E8EA 4IOIB 1F3JA 5MENB 4HZAA 4DOHE 2K3TA 2AK4D 3STZA 3WNOA 1H3XA 4KROD 3VJ6A 1UM5L 4KTYA 2JB5L 4P2OC 1F45A 4JFDD 1BZ9A 2BFVH 3MV7D 3UTTE 5IB3A 3GSWA 2R15A 3KYOA 4DUXA 4HJ0D 1J8KA 2P4AB 4YHIA 32C2B 4ZQKB 4M61B 2D3VA 3WO4B 3ALWA 1WZKA 1HH6A 3TM6A 5GGUA 1EERB 2CQVA 4U1IA 5GRVL 4Z7NE 3SJVD 3ULUD 1MHHB 3DUUA 4PLJC 4PS4L 5I1LB 1ZA3A 4X80L 3TVMD 2VTFA 4XPBL 4NUGL 3BDBA 3Q6FB 2V7NB 3RFZC 1FO0B 3H9SE 2WP3T 3E3QE 4IIQC 1QQDB 4JVWA 2BVUA 5L0QC 1UC6A 1KUMA 2AKRA 4NP4H 1U9KA 4HBCL 3CVHH 4XX1E 1FZMA 4R9HA 2Z31C 1B0WA 1WEJH 1ZWIA 2MFNA 4UMGA 5D7SH 4WFHD 2ARJQ 3M45A 4JFDB 1BVZA 5C71A 5BS0A 1T20A 4ZPVB 4XMPL 4DAGL 2EIDA 3C2AL 2I9LB 4U1NB 4Y16D 4M6NH 1TIUA 4MSWA 2YRZA 3NPSB 2BRQA 3ULVF 3WXVL 3IDMA 1YECL 2MQ0A 1U91B 4L8SC 1NC4D 3JTSA 4K94H 5E6IC 3TFKD 2AEPH 1Q9KA 1IFHL 3B5GA 3GIVB 5HPOA 1MHEA 2IMNA 4GW5B 4K7PX 3O3BB 4Q0XL 4PRPB 1NFDE 2H32B 1ZVSA 1G7QB 2CKBL 4JKPL 4PGBB 2EE9A 3N9GH 5JHLL 2D7QA 3GMNA 4XNUL 3MMEA 4HHAA 4JVPA 1XGRA 4XHJC 3ZTJG 3BDXA 3MOBH 5FUCE 3V4UL 2ZUXA 3PWVA 3RX7A 1DQQB 3LPWA 4H1LA 2HMIC 4N5EC 5DEFA 3AS1A 3O3DB 3VMPA 4XPAH 4NO2B 4QT5B 4JGMA 1QFPA 3BMVA 1A7RL 3T0DA 4KZDH 2O5YH 1UXSA 5IF0B 3ROOA 1PX4A 4M6NL 3FQNA 4OZ4B 1BVKB 1NGWB 3UTSA 1S3KL 4Z7VF 4W4OC 2GKIA 4R3SA 2NY5L 2DQHH 1RJLA 5I8KH 3HMXA 1QBMH 1ZVSB 2CGRL 3BXNA 3WUWB 3HPJB 1DBMH 2GEEA 2Y7QB 4WW2B 4TULH 3SCMD 3UMTA 3C9NB 4P2OD 5AWNH 1JE6A 2XWBB 3MNWA 4UDUA 1ZGLM 4XGZA 3WFZA 1VADA 4XRCA 1I9JH 4JPKH 4MJID 3RWIA 3TIEB 3V5KB 2Z0BA 2YKLL 4UQ3B 1WICA 3PP4L 3DVFA 5ABDE 1BIIB 2GI7A 2F53D 4PRID 5FHBL 1N4XL 3MRDB 1MIML 4X5XB 1IGTA 5E1HB 1RUMH 4HWEH 1X44A 3OG4B 4RCAA 4NQED 4BH8A 3BP5B 4Y4FA 2VLME 4DFHA 4K9EL 3QFJE 1JCKA 4XCNA 1KCVH 3LB6C 4CMMB 4MA8H 4ZG1A 3LKPA 3MA7B 4LBEB 4D8PB 1U8IB 1I3VA 4H88L 3IDIB 1Z0MA 4HKZA 1MAJA 4TSAL 3UYOD 1AY1L 1CXFA 4W81A 1QQDA 1Q9WB 2NY0B 1EX0A 4BM7A 3OX8A 4XB8A 3ZKMD 2XTLA 3P73B 4X5WA 5MP6L 3C08L 1C5BH 4NRYA 5DDHB 4S1SL 2VLJD 1KNOB 2XZZA 3IS1X 3QH3B 5A2IH 3EO9L 1F6AB 1PQZB 2VLKA 3TT3H 2FATH 5I1HL 3AXLB 2AABH 1G9MH 2VXSH 4AG4L 1Q0YL 2EICA 3QA3A 1S7QA 3ULVH 1OP5H 4PJHF 4PP2B 3A67L 2BNRE 4HUWB 3X3GL 2IPUK 4IEFB 4QLRA 1J8HA 1IC1A 1YJDL 3GIZL 4N1EA 4OD2B 5FM5M 1MCOH 3TO4C 1EXUA 3I84A 4JQVC 1KTKE 4K7FA 2NW2B 1K2DB 3OR7A 2QR0B 1H5BC 3VXQB 3W81A 1UB5A 4IRZH 4XCCH 3RWDA 5IR1A 3BP7A 4L4VA 4MJ6B 3FT2A 1W72L 3LQMA 5EU6A 5I8CA 3ARPA 4JO2L 1F58H 1G9EA 4ERSH 4KMTL 1MRCH 1ZXQA 2UWEF 4MAYC 3F6LA 4L4TA 3MBEB 1GHFL 2N56A 1BPVA 3BN9D 5DK0B 5FIEA 4HIIB 4L9LA 3KPRB 2Q7YB 2F19L 3G5YA 1G9NC 3PUCA 4K3DH 1SVZA 5GJSL 2WV3A 2VR5A 3S35L 2I25N 4KUZL 3ARTA 3I3EA 1TJIL 3D3VB 3T0EE 2DB8A 2NXZD 4LSQL 4D0CB 4ZUTA 1FFRA 2WIMA 4NDMA 4YK4B 3B4NA 4NRZB 5GGTL 1CXKA 4CKVX 3QXTA 2GUOB 1JF6A 2W9EH 1GCFA 3HFMH 4N0FB 3FFDB 4P5TA 4XWOD 1CR9H 1NSNL 1BD2A 3MSPA 3LN4B 3THML 5A43C 3X14B 4X4XB 5ICZB 3MLRL 3IXTA 3O45B 4XNMB 3BIBX 4B5EA 5SWQB 4OM0L 2G5BB 2YUZA 3QCUL 4JRXD 2R2EA 5HYSG 1KJ2H 1A21A 4KK8C 3F7PC 1ETZB 4I3GA 5KAQF 5JOEA 3PL6D 2X4NB 1U8OA 2HFEA 4PJIE 3AM8C 3QIBB 3RVWD 3NIGF 4DUWA 4H26B 3VWJB 3L1OL 1F58L 1FYTD 3VI4E 2J6EL 4C83A 3RA7H 5C08E 5CIPH 4Q6IA 5DUPH 4Q2ZB 1Q9OA 3G5XB 3N1FC 3B8YA 4OD1L 4X4ZA 4R2GC 5C0GB 1MH5B 2HJFA 5FYLH 1AJ7H 3MNZA 1JGDA 3FQWA 3UYPA 5KSBA 4BZ1L 4Y4KA 1K5NB 1NANH 4ZFOB 4HFUL 2Y1VA 1PY4A 3MRBB 2HT3C 3LIZH 2R9HD 2ZCLH 4U6HB 5M95B 4PJIA 3QJHA 1LD9B 1LDPL 4NFCA 1ADQL 1JTOA 3FMGL 5DLML 4UINL 1KIRA 4NM8L 1OAQL 3ARWA 3V0WL 3F65A 2ADIA 4GAGL 1IKNA 1CVRA 2Y4SA 3WHE0 4JRXE 3C8KB 4PTUB 5DVNA 3VH8A 1JF5A 4O51B 1A14H 1WBXA 2Q7NA 3OKLA 4N0RA 4AEIL 3BO8A 5DYOA 4D94A 5B39B 5JIPA 3QHZL 3WXWL 1U8MB 3U6RB 3WFEL 1KCVL 1IM9D 4XHQA 5IB4A 4P23A 1MIMH 5F6HI 3ZE0E 4AH2A 3DGCR 5C8JA 5D1QB 4OGZA 1PAMA 1ZT1B 1Q38A 1BOGA 1XF5B 4QOKB 5EB9A 5AWNL 1XCQB 1NFIA 2ERJC 2EE3A 4MD5B 4WI2A 3S4SB 3T77B 4IDJL 4EXKA 4QRPD 4GAJL 1VEOA 1JPSH 2XQYK 2DJ4A 4XVTL 5EU4B 5LVEA 5K9OA 1LE5B 2NY5H 3GI9L 3GJFK 4F7MB 4E0RB 3GK8L 2MNUA 3VRIB 5LWYL 4PJIF 1PG7L 1PD6A 3SE9H 4HKJA 4KTDL 5DK2A 4XXDA 1CE1L 2UZXB 2MQ3A 4LCCA 4XPAL 3HLAB 5D7LB 3BAEH 1JHTB 5IG7B 2AJ3B 3LDBB 3WCYA 2IALA 1J05B 2MKWA 5JHDB 1AGFA 2R0WH 2PO6C 1T89A 5IBLC 4F7PA 3FOLA 4WWKC 1YEHL 4NJ9H 3GJFB 5K9KB 1RFDH 4L29B 4HIEB 1KCRH 2CXKA 2JF1A 3PHSA 1W2KT 2YK1L 4OFYA 3T0WA 3E6FA 2MQCA 4APQA 5I1AB 1H3PH 1OAUH 4P23C 3AY4A 1I85A 3L5HA 43CAB 4O9HH 4QCIB 2E3VA 4LVNB 4TYUA 2CPCA 1KIQB 3D39D 3GJFA 2MCG1 1LE9A 1ZLSL 5HHNA 4LCIH 1BFTA 2XYCA 2ZCHL 5C08A 1U8NB 1H3GA 4LSRH 4Q6YA 1MCCA 4WHDA 2IBGA 3P3YA 4O58H 5C0NC 1YEFH 2FJFA 4JFPB 4AIZB 1C08B 5IMLB 1MCLA 1BGXL 4K7PY 2VXTH 1TTGA 3O11A 4NKMA 1X6NA 1FNSH 3Q5OA 3GO1H 4HC1H 5JW3H 4F7MA 3LSOB 4XI5C 4Y16C 1RK1B 1UJTA 5IQ9A 4BKLA 3VG0L 1FAIL 2A6JB 1XR9B 3LKRA 3OZ9L 4JHWH 4UQ2A 4BSVB 4JN1H 5GGRB 1U8JB 4ELKB 4PGEA 4K71C 3V5DB 5I73C 4QXTA 3UDWC 1CD0A 2DMKA 2PO6A 1Z9SA 4R4FH 4UUJB 3A6CL 3QPQC 5L2KB 3DMMC 3LH2H 5JR1L 4GSDL 3FJTA 3D2UA 2NPLX 4F2MB 5E03A 3QNZA 1UM5H 3IKKA 3IDJA 4YDKH 4Q9BA 1HKFA 1T66D 5SWZE 3KYNA 1I7ZB 3CD4A 4P46B 4U1LA 2Y72A 5D7JB 4HXBL 1WQVT 3QUZD 3ZKXC 5HTSA 3QHFH 2Z35B 3WFCH 1U8MA 5T1KA 4TOYL 2W65B 4DUVA 3WFBL 2OJZL 4ODWA 4YAQB 1HOCA 1NCDL 4NHUB 5JORA 3O0RL 1QSFB 5EU7C 5DQJB 3T2NH 5C0CB 5LCVH 3MZGB 3H7LA 4P5TC 1KIRB 1F5WA 1KV3A 3QCVH 1NQBA 4TNVF 4RIRB 3WIIH 4LNRA 2WNGA 1C1EH 3P4OA 1NBYB 1BLNB 4LPXA 4WO4A 5J6HB 4HQQH 5CP3A 3U0WH 3DRTA 5DQ9A 4ZUWB 3SDDB 5BS0E 5L7XH 1UH3A 2X7LA 3MLZH 4G7YL 2LV4A 3LV3B 2BMKB 3FT4B 4X7EC 3MNZB 2UV3A 4PB9H 4ZPTB 2AI0L 2GSIB 1AGCB 5EOTB 4PR5B 2X4UA 5DUML 4DW2L 2EYSB 1A4KA 2VJXA 2COQA 2FIRT 4XNYL 3CC5A 3FQUA 5CCKL 3GMPB 3CFCL 2Q20A 3VGHA 1T22A 4LLDA 5L7XL 2XKUA 2BXYA 5CUSH 2BHZA 3AAZB 4C83B 3WN5B 3KYKH 4DKFH 3PF2A 3PXJA 3PGDB 5DO2D 1N7ML 5TE6L 4PJ7F 4JFHE 3M8OH 4H26A 5IW1B 3JV6B 4QRUA 3VWJA 3VRJB 5IJKC 3PHQA 2EEAA 5J89A 2AJUH 1QLRA 2A9MH 2C3HA 3T3PE 1WIPA 1RZKL 4F8TA 2IG2L 3UROR 1GGCH 2Z31A 4HV8A 3DUHA 4FXLA 2J5LB 1FNEA 5I6XC 4YDIH 5DK3A 2M2DA 1MJ8L 5BZWB 1G1CA 2IBBA 5DR5L 4XNMA 4TOYH 2SEBA 1CDYA 2YEZA 1RSFA 3NCCB 5D7LD 1EUTA 2JCCA 5D96C 1V8HA 2Z9TA 4LLYA 4EN3B 4HXBH 1AD0B 4K8RH 4L1DA 1M6OA 1NDMB 2UWEB 4PG2A 5B22A 3VFVA 5IWLC 3TIDA 3IXAB 5GXBB 4UOW0 5ITFB 4OFPA 1BD2E 4LHUA 1QLRB 5CGYC 4YC2B 3T0VA 3QXVA 5ACZA 4NHCL 2GT9A 4ODHL 3JV6A 2Y36H 4QRUB 3G5YB 3QIWA 3U46A 1BQUA 3GMRA 5LXGH 4QHLA 4DW2H 4WEBH 3QUXA 4G6FB 2CDFA 2FL5B 1S8DA 4BFIA 3GSQB 4RAUB 4FQJH 4POZC 4CBPA 4OCNC 4PJAA 4DCQA 3QQ4B 3AREB 3HE6A 6CGTA 1CDBA 3RWFA 3HG1A 1LO5B 1YEGL 1CDUA 1J11A 1A6UH 4JDTL 2NY1D 4M7KH 1P7QA 2ADJA 4HIXL 2P8MA 1CGSL 1SEQH 4QO1A 3SDDA 4K3HA 4LF3B 2VXVL 1RZ7L 2X1XR 5F93C 5D7LE 4Z8FL 4GKOA 2X70B 5E00B 4ZXBA 4XP4H 1TZGL 4O2CB 3LEXA 3HC3H 4ZUSA 2G60L 2O5ZL 4AM0B 5D72H 1JN6A 5F72S 1UENA 5DQJA 1FIEA 3P11H 4YHOL 4OTXH 2YA1A 3VU2A 3DRQB 1I1YB 1ZTXL 2W60A 2PKDA 2XNAA 1HOCB 2I9TA 1RPQA 4HCRL 3W0WE 4R7NB 4WI7A 2QJDA 3WHE1 5JW4R 3VFWB 4PJBF 2ZCKL 1EPFA 1SJHB 5C6TL 2WINA 2GAZB 3VFRB 4LLWA 4B53A 3RU8L 1MCWW 2XG5A 5J6GB 2JB6B 3BKJL 4PYGA 4XBEL 3TH3T 1RHFA 2GJ6A 5D6DC 3P4MB 2DQTH 4Z7UF 4CMMA 2NY5C 5D5ME 5EO1B 4M7LT 4KVCH 2YWZA 5EA0L 4NN7B 4R8WL 3IS0X 1IGTB 5B8CA 4WHTA 4BZYA 5HVGB 1C8PA 3ECBB 3PQYB 4LKCA 3RWJA 4X6DB 4BSVA 4ELKA 3QEQD 1W72A 5TE7H 2ATPA 4ZAKD 4F9LA 2XQBL 4X6BA 4KY1H 2HH0H 2WM0A 3RZWA 3LSOA 3V7AE 3MJ8A 3U1SL 5MENE 2EECA 4GAJH 3QEQE 1MCIA 25C8L 4YHPB 4Z7VA 3VXSB 3EDJA 3HNTL 3MLUH 4FQXD 4QXUH 2OSLA 3HE7C 2FJFB 4H8WH 4OGXL 1EEYA 4PJ9B 4RA3A 1OCWH 2CLZB 4KI5E 3P30H 1A6WL 2KQMA 4DN3L 2JJSA 5F7MC 2J12B 5JOPD 4ZOCA 3S5LB 5HDQH 3MFFA 3D3VD 1J0JA 3ZKNC 4X9GA 5D7IA 4UZGA 3KS0H 2XN9A 3TN0B 2P24A 3IF1A 5IVXE 3O3AB 1ES0B 5DRWB 2IC2A 3PWVB 3TCXA 3QDJA 3F7VB 2FNBA 5DD6A 4XAKE 4OZGB 3FO1A 3AFLA 4WU7B 1MEXH 1OAKH 4U1GC 4O5LH 4MNQD 1BQLH 5IJVB 1CICA 1PZUB 4FNLH 1R0AL 3WEXA 5IGXL 3MCLH 3Q6GH 3QXAA 4MNHB 5FKPA 1E6OH 1MCJA 4NM8H 2HT3D 5DLMH 5KS9A 4ODUB 5C07E 3Q5TA 1RVFH 2ARJB 3OR6B 4PRNB 4AL8H 4HPOH 15C8L 1G0DA 1KGCE 4I3RL 4XC1L 2NZ9D 2PTTA 3D69A 5KANG 4M6AA 1JWSA 3CH1B 5LQBH 1II4E 3ULUH 5DRZB 3O8XA 5DK2B 1OTTC 3T4AB 1FSKC 1FBIL 2CIKA 1YQ2A 4BQBA 4QHUB 1INEL 3VRIA 2OYPA 1KIUA 4WJ5A 2XV6B 4KV5F 4ZUUB 2ED8A 2N7AA 3MUZ1 3MODL 1GPOH 4HDIA 4MJ5B 3TGXA 2PXYB 4Y1AA 2V7NA 5BXFB 5MEQA 1MCEA 4GS7C 4NQDB 2LE9A 2GITB 2CDGA 4ZO7A 4P2YA 1Z5LA 4QRRD 3NFNB 1F3RB 1ZT1A 3C5ZA 3BWUC 1QVOA 4FQ2L 4CVXA 4KKBD 4LK4A 1E4XI 3H42H 1FIGH 2FLRT 3UBXA 3H3BC 3MLVL 1WIOA 2Q76A 2APTA 2ZPKL 2I60H 4NQEB 5B39A 5MHSE 3MRKB 2FIKA 4LSSH 4D3CH 2BNQA 2V5RA 1I4FA 4MXVF 5EUOE 4C54A 2FO1A 4I18A 1TZIA 1VERA 1MOEA 4L4VE 1AQKL 1F3JB 1VGEL 5MENA 4LFHG 1YNTA 4A2MA 1S78C 5CGMA 4PJ8C 5DUBA 3EDEA 1IEBA 4GKNB 1EMTL 4OGAC 4ZDHA 1IGIH 3N85H 2IGFH 3NIDE 1VHPA 3O2WL 4YDVB 3FL7A 4JG1L 4OQ1A 3QJHB 1L6XA 1SYVA 5FYKD 4R90H 1HEZB 4G8GB 3EYUH 3FO2A 3RUGF 2R0ZH 3AMLA 3SDAC 4BUGA 1IJ9A 5DF0A 1FP5A 5EU5B 5EBWA 4RX4A 1JZ2A 4LPYA 2XN9E 4F58L 3LN5B 4NQCE 5ADPH 3ARDB 3UBXB 4KMTH 2D7NA 2MHAB 2J6EH 4MJ4A 4OCSL 5EWIH 1NL0H 2WIIA 3TA3D 1F8TL 4X99B 3QP3A 5ADPL 2DWDB 5JZ7C 4NZDA 4UIMB 2D4DA 1KPVA 2P45B 4WFED 4WHYH 2WBJD 1GAFL 2DM4A 4PRPD 1H8SA 3ULVL 1AKJD 1FE8L 2QKIB 1EJ6A 4OJFH 3U2SA 1AIFA 3O2WH 4HEME 1H0DB 4HUUB 5BVPH 1NC4B 1EVUA 3VGGA 1BP3B 3U0PB 2GIYA 4KHXH 4MXWL 3SDXF 1U58B 3V8CA 4G9FA 4KXZH 2WP3O 4KDWA 1C5BL 1FO0H 5HGAA 3C08H 2RCSL 1HILB 2FB4H 5EC1A 5EU3B 4CVUA 3I9GL 1C12B 4U33A 3B9KA 2W0KA 2WQ8A 1A7PH 4DOHB 2C3VA 2HG5A 5L6YH 2WIIB 5ETUB 2XQYG 3MV8A 2CLRA 4KFZC 4MXQD 4NPYB 5FKPB 5E8NB 4J23A 5D1ZC 5E2VL 2BVYA 5FF6B 1VSCA 3MACL 5IVNA 1IGYA 3VFPB 3KR3H 5I16B 1N4XH 4A6YH 4NOBA 5DMJB 3F7RA 4ODXB 5D6DA 1RU9L 5IFJA 2YKLH 1I7RB 3C60D 3IRZA 4TQEL 5DI8B 3RTQD 1AC0A 1YNLL 2Y25A 3D3VE 4U1MA 5DA0B 3T0EB 2YD4A 3VXUB 4MAYB 1X5GA 3RPKA 4X6DE 1CD1A 2AV7A 4PTTA 1JZ4A 3ULUF 4JR9L 1YEIL 4RMUA 4NC2B 1DBML 2DM2A 1G84A 3UZEA 3UJJH 5BO1L 3RZCA 1QBML 5FOJA 5DUBB 1ZA6A 3GSNA 4L4TE 5F7LB 4GMSL 3JBG7 1H5BB 3X3GH 5FUZL 4HG4J 4KROB 1DL7L 4PY7B 2Z92A 4GRLA 3VXSA 5FA3A 4NBZB 4NZJA 2E7CA 4L8BA 2F54D 5E5MA 1AO7D 3P0YL 3NFSL 4U2YA 5FO8A 3R0MA 3OAYH 4JKKA 2G9HA 4TVPL 3VD7A 3DMMD 1W72B 4MD0B 4U6XA 2A0LD 3MOBL 3QDJE 3PWLA 5IBLD 3LOWA 4S1QH 1RIHH 5JLZA 1A4JA 4PG2C 1E27A 1AY1H 4PBWD 4C59B 5EO1A 5C09B 4F7CB 1IGJB 1T7YA 3P73A 4M6MH 5DMKA 1TCRB 1S7TA 3EHBC 5EOCL 1MFEL 5LGJA 1UZ8A 3IJHA 3FONA 1C7TA 1JYNA 1F4YL 3QHTC 1RUML 4R96A 2FGWH 5E2WH 5AYUL 1OWRM 4R97C 5F88A 2YUXA 3CX5J 4XCNB 1CFQB 1A6WH 4FQHA 1RUQH 3P30L 4I48B 5C3TA 3SGKA 2FWOB 1MFCH 1NH6A 4JPKL 2VL5A 4QNPE 4X5XA 3MRDA 1M1SA 4MWFB 2VN7A 1CT8B 2C7UA 4UDTB 4UQ3A 1NCBL 4X6CE 2MMXA 1H9VA 1UEYA 2A0LC 1RUQL 1XIWB 1DUZB 5E94B 4X0KB 4YR6B 1HI6B 3K8MA 4X80H 2IQAA 2O5YL 2G75B 1RJLB 2ATKA 4LVHC 4KVCL 5EA0H 4OZGA 3X13B 2D31A 1FLRH 2E9IA 3TV3H 1IM3A 3HE6B 4QRRE 3MPCA 4X4ME 3RBGA 2FLBT 1B4RA 1CBVL 5FAAA 1U3JA 1P53A 5DEFB 1S8DB 1FFPA 2CKBH 5EIVA 3OKKA 2NXZC 2UY7A 4CAGA 2B4CC 4RBPH 4AIOA 2FH8A 4LLUB 3GDBA 2CLZA 4PJ9A 7FABL 5FFLA 1IGYB 3LEYL 2GJZA 4LHUB 1KG0B 1U3HC 2F53E 4G6AD 4FQPA 4NPYA 2BZDA 2HVJA 4HZLB 5D72L 2G60H 2OQJA 4JY4B 3JTSB 2AV1A 2XI9A 4XMPH 5JUEH 3MRRB 1A6PA 4IRJC 5T3XL 3EFDL 4XWGL 3I02B 1H15B 1DQLL 2E6QA 5E4EC 3PQYA 4LKCB 4MX7B 1Y18A 3UJJL 4XVJH 5I18L 5I15L 1XH3B 3OKYA 4H1LG 3LRGA 3V52L 2LU3A 2E7BA 1MLCB 3GSUA 5CEZD 4M1CC 2Z31B 1I8KA 1B6DA 1BMGA 1WTGT 3QO1B 4OJFL 3TO4D 4CMHC 4HJJL 2DM3A 5BW7C 1F4WH 2V2XB 4F57H 3NACL 4NJAL 2ZG3A 4JPVL 3VFWA 1HSBB 1VESA 4RGOL 2R0LH 1H3UA 1HNFA 2APFA 3AY4C 4F9PC 4XBGA 5BJTB 1KLFA 4XTRD 3DUUB 1O7SA 3TNNB 4P2RD 3CZFA 2AXJA 2HT4C 12E8L 4FA8A 3K8KA 4KK6D 2DI9A 3CK0L 3WNLA 4K23H 3TPUA 3ARDA 3I3DA 1TLKA 3PNWA 4I0PB 4NO0B 1S7UA 4O2CA 3HUJE 4I1NB 4HT1L 2A1WL 2CKBA 2R0ZL 3IDUA 2ITDA 3HC4L 4J1UA 4OM1H 1FVEA 1K8IA 4ZXBC 1HEZA 2GYSA 1U3HD 5DHVB 2I26N 4FQXB 4P5KA 4Z77A 5DA4A 3ARBB 5HGGS 4LSPH 2ICWA 4U1JB 3L5WA 2CO7B 5ANME 4AENA 4YDIL 4L3CB 3F8UB 4LFHD 1D9KB 2ESVE 3ZKQD 2YBRA 3D1MC 3UYRH 4R4NC 5HHMD 4EUPA 1OF2A 4RMTA 1VGEH 5F9AC 2AJUL 2AJSL 3DI3B 3SGJC 3GGWB 4RAUA 3WIFB 3MRKA 1OP3H 5T1KB 5DWUL 3H9SD 4F8QA 4QHLB 2EXYD 4PRDB 3U79A 4EI5C 5LBSH 4S0TD 3C6LD 1D5MA 5C09E 4U6VL 1I7ZA 4P46A 3R1GL 1NMBH 5DD5L 3B6SA 2EZ0D 3OJDA 3T1FA 1I85C 5I30L 5E99H 1R5VB 1LHZA 1QFWL 3KPSB 1IZJA 1CLZL 2UWEA 5E2UH 1OHQA 1BIHA 2CDGB 4KKLC 2E8ZA 5KVFL 5F6IC 2ZSWB 3MLZL 4K3EH 5IFAH 1LO2L 3UP1A 3MRLA 1BREA 4LPUA 5ADOL 5FV1L 3D25A 3WIIL 5BQ7A 1U8LB 5GQBA 3HRZB 5TH2A 1ZT4A 1NAMB 2OL3B 3IRPX 4GKSA 3LKOA 5D2LB 3Q1SL 4BSWA 3MRNA 5DTFA 3BYTA 4MB5A 4RDQF 3RY5A 1YC7A 4G8EB 3BVNA 1GYAA 2DQCH 3VCLB 1JK8B 1PG7X 1AFVL 1NAML 2OL3L 5JOFA 3V7MA 2DQDL 3EFFB 1MAML 3HPLB 1OTUD 3MYJB 3S36L 5ESQA 4UBDC 4Z0XA 1OTUC 1MLBB 1T2XA 4CNIB 2FJHB 3DX7A 5HYEA 1AHWA 1EO8H 4Q6IC 2AERT 3IAPA 2PW1B 2OZ4L 4X5LA 2GSGA 1JI2A 2MPAL 4JHBA 4QCIA 1N2RA 2BOBA 2VZSA 3MRGA 4JKWA 43CAA 4OCYL 2GSIA 5EOTA 1FLTX 1UXWB 3UTTA 1ZV5A 3OKDB 3VXRA 5MERA 3OKOB 3U9UA 5IMOB 3SDCD 4UT7L 3QFJD 1OGTA 3LH2L 2X05A 4Y5YA 2BMKA 1WK0A 2O5XH 1U8KA 4POUB 5DRWA 2PCPB 1F11B 3OKEA 1DN0B 4ZUWA 3BPLC 3C6SA 1K8DB 2IAMB 4EBQL 3RDTB 2DIBA 3TN0A 1UM4H 1MCFA 3LRSB 4JPWL 2AGJL 1D5BB 1RUAH 4RIRA 4WCYL 3ULUL 2XTJB 4FFYH 3VI4F 3S5LA 1UH4A 4G3YH 2Z93B 3OL2A 2ORBL 3BDYH 3JUZA 4DN3H 5FB8B 1MNUH 2BK8A 3G08B 3OXRB 2VDKH 5ELIA 1J0KA 4I3RH 4JHZA 4KJWC 4PJ5A 4FQCH 2C5DC 1TITA 4YGAB 4AL8L 2P7TA 1QRNA 2NY6B 3MLWL 5F97E 4QTIH 4FTVA 2VIRA 3OAUL 3JSSA 1RJYB 3ISWA 1WZLA 3NABL 1R0AH 2ZZUT 1MIEL 2YD8A 2ZUSA 3O6FD 4PJEB 1OM3L 5FOBB 1CG9B 3MX0A 4U1LB 5D7JA 2ATPB 4Q9QL 4YHLH 3S88H 3DURB 3NA4A 2ZNWA 3RIAF 5F7HA 4MXQC 1NFIB 1GGYA 4H20H 4JPWH 4XVSH 4PLKD 5B3JE 1OGAE 2FHFA 1T1YA 3QI9C 5HDQL 4XBEH 4AH2B 5IB1B 3MNVB 1HHGB 4ENEC 3UTQB 3CDYA 4BKLB 1ZSDB 3WS6A 3LPFA 4UT7H 4HH8A 1UFUA 2ARWA 4JQVA 4QXUL 1CU4H 5E08H 1BJ1J 2R0WL 2YS4A 1NBQA 3AC0A 3FT3B 4FMKA 5F7UA 5IIEA 1OTSC 1N8ZB 2W60B 1VFMA 5C9KA 3NZHL 3U1SH 5JO5A 1YN7B 2HH0L 4KY1L 3MLSH 5CGTA 2WBJC 4JGUA 3P4NA 2MOVA 3DROB 3WKML 1E4JA 3SE9L 1NGZA 2X4OB 3BHBB 3TC9A 3CDGA 4FQIL 1LE9B 2AQ3A 5GS0C 1SEBB 4XP6H 4P9HH 4E9LA 3NFPB 3DGGB 3IJYB 2P5EE 1BVLA 2IAMA 5IFHH 3C6SB 1ADQA 4JM2F 4PJAE 5ID0A 4IHOA 5HHXL 1MJUL 3B3IA 3O3EA 1MREH 4ALAH 4NO5B 2PR4L 4HUXB 3UPRA 1LO2H 3NIFE 1HHHB 4OI7A 3UTTB 2R4SH 2HJFB 3AREA 1MH5A 3QQ4A 1OAYL 5C0GA 2OZ4H 5FDWB 2X42A 3G5XA 4Y4HD 4JPIB 3BFOA 1AHWB 5I30H 2A9NL 2H8PA 4Y2OA 4EN3C 4ZMAT 2D03H 1IQWH 1XGTA 1AGFB 2WMPA 5DD5H 1AXSA 2WQRA 5HGHA 3HPLA 5JMOC 3EYVB 4NSKB 2Y36L 3KPSE 4JHAL 4XH2A 4G7VL 2HFGH 1A14L 3FO9A 5F1KC 3REVA 1CFNA 1U8OB 1F90H 4JFOB 5I6XB 2CRYA 3TIDB 2FGZA 3I50L 5ESVA 4OLXH 5CZVH 4F7TB 2IH1B 4GKSB 5E7BA 1OAQH 1U8LA 5TH2B 4ZS6D 1AD0A 2G5BA 4LLYB 2VLRD 4N8VB 3HE7A 1ZHNB 1A6UL 1HHJA 2O26U 5HY9B 3TBVA 1F3DJ 4DGVH 4CW1A 5I1IH 3RWEB 1X5AA 4MD5A 1QA9B 4JAMA 4MD4A 4XT1C 1RURL 5KG9B 4KK9D 3NAAH 4MA3B 1XF5A 4P3DB 4QOKA 3KPSA 2F15A 4YBQD 4ZYKB 1AGBB 4HV8B 4OM1L 4RAHA 3B6SB 1NGXA 3WFDH 4WEBL 4XNQA 3MZTA 1T1XB 2A9ML 2HT2C 2EO9A 2BERA 5DJXA 1D5MB 3AS3A 4J4PD 4U6VH 5HHOB 3VRJA 1L6ZA 3BSZL 2XICA 4NSKA 4M7ZC 4PGCB 1A6AB 5C2BL 3QXDB 4FRWA 2VR9A 4N0UE 1DLFH 3BSZH 3OKLB 4I2XB 3T3ME 3JTTB 4F37K 2AJSH 4EUPB 5EULV 4QRQA 2F9BT 2V5SA 2X4UB 2Y6SC 5GGVL 4LSUL 2ADIB 5I1EH 3NACH 4N8CL 3TZVA 4WGWB 2OZ4A 2JJUA 3V4VL 3TYFA 2ICWB 3CIQA 1EDQA 4XPGH 2X7LB 3OR7B 4B41A 1MF2L 3X12A 1K8IB 3ARFA 5HI4D 3BEWA 1RZKH 1FVEB 3SDXB 1BLNA 1NBYA 4RISH 4Q9RH 4NC0B 5IBTH 1K5NA 3QCVL 4MLSA 4M00A 4D0DA 5LCVL 3CDGB 3ARVA 1FG2A 1QFWM 2DIAA 3BISA 3K2UH 3CK0H 3BKCH 1ZVHA 3CLEL 5C07A 5JUEL 4R0LC 5H2BB 2K9UA 3MRQB 4OZIE 1NCAH 5JORB 3QH3A 3HKFA 1D3CA 5GJSH 3TH2T 4M5YL 3QIUD 2F19H 5GZND 43C9B 2EC8A 2A6DA 2HVKA 4UTBL 3Q48A 4GQPH 1HHIB 3DARA 3MLTA 5DUMH 1WC7B 3W2DL 1CD9B 4WUUA 4I0PC 5FGCE 5D1QD 4K07A 1QSED 3JVGC 2DYPB 4JY6B 3BD3A 2GQHA 3EJZD 2UYLB 3CVHA 1ERNA 1N64H 5EZIH 2AXHA 4NQEE 4F2MA 1FGVL 1RUPH 3U0WL 4ZYKA 4R4FL 4PRIE 1FL5A 3DX9B 3O2DL 5ESAA 4QGYA 2X4SA 2FBJL 4X4XA 5ICZA 4DTGH 3IAQA 1U8JA 1BIIA 1G6RH 1MPAL 2HN7A 2EYRA 1NKOA 3SBWA 1FCGA 1ZHNA 2VE6B 4JFFE 3MRRA 4NUJB 4PJEA 1VADB 3CX2A 4XB7A 1P4LB 4PGZA 4HZLA 4ZO9A 5HI3D 3C9NA 1EZVX 2AABL 4FFWC 1C08A 1Z9MA 2IBZX 1RZJL 2X40A 3V6FA 5CGYD 2B5IB 4N90E 4NQCB 4Z76A 5D70L 1EHLH 5HGHB 3KPRA 1NGYB 1HKLH 1PJ9A 4HUNB 3ROOB 5IF0A 2WLYA 3HR5A 1ZLSH 3O3UN 3CDFA 4NGHH 4JPIA 4HUVB 2DBLL 3LRSA 5HDOA 1T1ZA 4FG6D 3H9YA 3JWNC 5DZOA 3L3HB 1H3PL 1OAUL 2IFFH 4X7SL 4LHUG 4NBYB 3OZ9H 2JK5A 3LDBC 4Y5XB 2D2OA 1FNFA 3MMEB 3OB0H 4APQB 5I1AA 1XGYL 3O9WD 4IHOB 1SHMA 5TQ0H 3VXQA 2R1XA 4KKBC 5D7IE 1KCRL 3O3BA 1RFDL 4GW5A 3DXAD 1EXUB 5T1LD 3DV4A 3RPIB 4FFZL 3JUYA 4JZJA 5TFSL 2YN5A 2EDYA 1MI5D 3CFJB 3WKNA 1RIHL 3O4OC 1KYOJ 1TJGL 3IDMB 3GHBH 4XPTL 3PIQA 4JFYB 4C55A 1U3ZA 2VZVA 2DQJH 3ARBD 1HXMB 4YGVA 5GRXG 2VL5B 4ZOAA 3T0AA 3IGAA 5KVDH 3LQAC 5H37G 1L7TH 4K9EC 3OJMB 5BV7L 5LWYH 5GSVB 3FB5A 3LKOB 5BRZA 4G3YL 2YMXH 2DQGL 4NN6B 4KZDL 1KELH 3S35X 4GMSH 4GXUM 1YYLL 1Z6JT 3IJHB 3UTQA 3BKMH 2YK1H 1KIPA 1MFEH 4IDJH 1RY7B 4LBEA 4P57B 1EEUA 1XF1A 1KJ2B 2VWEE 5JW5A 3QUKB 4NKOA 4MNGE 5I73B 3EJYD 4GUPB 4N1HB 1RMFH 4B50A 5FUCC 5SWSD 3QQNA 5EBGA 2JJWA 3MV7E 5SV4A 4YHIB 3W11D 5K59E 4DEPC 4GQ9L 4PLNC 3SE4A 5FO8B 1R3LA 1UVQB 4WO4C 4BK5A 3MACH 4KVNH 3FFCE 3KWWA 3QHZH 3FB6A 4FTVB 5EUOF 1U8PB 3GMOA 2Z92B 4GRLB 1RZJC 5TGBB 1OT1A 3UBXI 5I75B 1S7WA 3Q3GA 1KJVB 2L0DA 4I18C 4J2XA 1I9IL 1R3JA 1T0NB 5FYJE 3TJHC 1QSVA 4N0YL 1C5CL 3O41A 3FQNB 4OFIA 4F15C 3GUTA 4UINH 2EXYC 1QO3A 3HUJA 4QT5A 2YRLA 4Z77B 3KXFD 5DHVA 4NM4L 5DI8A 4K3EL 3SDAD 2AQ2A 1I7RA 3MRBA 2R56H 4XPBH 4HHAB 4FMFA 5A3ID 1CLZH 2D7MA 3L5XL 3KR3L 4YXHL 5DHVH 3WS6C 1GAFH 3QIBC 1UXWA 4I4WA 5C70A 3QR2A 4G6JH 1NMCC 5E2VH 2BSRA 3ZYZA 2FECL 2DI8A 2N7BA 3LKQA 3DX7B 5IQ7H 1A5FH 4MMZC 4R2GD 1JZ3A 1JMZA 1I8MB 3DVGA 5KSUB 4Y2DA 4JQIH 4PJHE 1B2WH 4PRIB 4NQTA 1T20B 4G9FB 4ZPVA 1U58A 2XKNB 2X4NA 3SDYH 1YY9C 3QO1A 4MXWH 1FL6A 3O2DA 1C7SA 5FYJD 1N0XL 3RNQA 3SGEH 1TMCB 3HRZA 1HZHH 3U2SB 2QKIA 4LSPL 2KZWA 1QUNA 4ZUVB 4OLVL 5SWQA 3EYQD 2F53A 3DETD 3HN3A 5HD8D 4Y4FD 1HINH 4HT1H 2AV1B 4CN6A 1F8TH 4OUUB 1FNGB 2HLFC 4M61A 2E9JA 2K7PA 1OSPH 1NLDL 5SWZA 3KYOB 1AR1C 3UXFA 2ENSA 2YSSA 4TUJB 1VPOL 2EDEA 1ITBB 3SQOL 2R69L 1P2CA 4PJDA 5E4IA 4HKXB 2BNRB 1MRCL 3RGVB 5E0QA 3QWRD 3GUTB 2BNUA 2NY2D 2VISA 5KOVC 5A2KH 2EDTA 5EORH 3T0BA 3BP7B 1WLHA 4HF5L 2ESVD 4S1DD 4I18B 3MV11 5FCUL 4ZFGH 5I15H 1K2DA 3WL9B 2NW2A 4H5SA 1HI6A 1FBIH 1QLFB 2CLVB 3MCG1 1CGTA 2F54E 4X9BA 1MI5E 5DC4B 1MCQA 1BX2A 1FG9C 4Y19D 1R3LB 1UVQA 5HDLA 1INQB 3LN9A 3DTXB 5I17A 4AG4H 4OZFA 5A40E 1HZHL 5I1HH 3TT3L 4CVXB 1ZANL 4KTEH 4L4TD 3I6GA 3SJVE 3CZFB 4CVZA 1JYXA 3QG6B 4V1DE 2FWOA 2GITA 4D9QD 1KJ2A 4P2RE 1MCNA 4MA7L 4FXGB 2J8UB 5EDXA 5LGHL 3MJ9L 3MQIA 4IMKC 3VGFA 1KJMB 3RY4A 1O7VA 1W72H 4O4YH 2FO4A 3S37X 3W82A 1TCRA 4YE4L 2DDQH 1CGYA 3W39A 4KGLA 2R1YA 3EIFA 5C09A 3KNBB 1YJDH 3GIZH 1KELL 4YXHH 5I76A 2HTLC 1F6FB 2YMXL 1KXTB 4JFXB 2AK4B 1SJEB 5JLZB 3ZTJH 1TDQA 3BN3B 1Y18B 5E6ZA 4LGRB 4KRPC 2P47B 3PWUB 1L7TL 1NCCH 5CD5D 5T33L 1NPUA 2DQIL 3WFHA 2DL2A 5DHXB 3V95A 4JFFD 2VLLA 3V9FA 1CDJA 7CGTA 4JLRA 4QXGH 4TULL 5F3BB 1WAAF 3VXMA 2GCYB 3H7BB 5A2FA 3Q6GL 4I5BA 1C5CH 4LLMA 3FB7B 2MTPA 2EIBA 5E8DH 4PFEA 5TFSH 4PJ7B 1FYTA 1H8OA 3VGAB 3FO1B 4LLUA 4KH2A 1T21B 3IAGC 5FXCH 1T03H 5AYUH 4B7IA 3TA3B 4PRPE 1QBAA 1U3YA 3OAYK 5GZNC 4PTTB 3IDGA 3ZMRA 1UH2A 4K9EH 3L5JA 4HUVA 3IFOA 4X7SH 3RWGA 1SJXA 1Y6NR 2AS5M 4U1MB 3T0EA 2PYEE 5GGVY 4D9RE 2P46B 3CFKB 3V4UH 2OTUA 2NY0C 4ODXA 1YEJH 3EDFA 3HZMA 8FABA 1T21A 1IKNC 4AMKL 1M71B 4Z6AT 2ZUQC 3MXWH 2P5EA 1MHPH 3VFPA 4ZO6A 1EZVY 4PRHA 5F9DC 1XGPB 2R9HC 1UYWH 4KAQH 3BP4A 3PP3K 4PJCF 4OCRH 1KB9K 3N1QC 5C0DA 2FX7H 3BUTA 1CXEA 1OD7A 1A1MB 3GB7A 3EOTL 3MLYL 3ECBA 5K9JL 2W38A 3C2AH 2JELH 4XI5D 4EDXB 1WV7T 1N0LA 4Z8FH 5FA4A 1QPPA 1IM9A 2R1YB 2VXVH 4BK4A 5DD1H 2DQJL 3VWKD 5M7QA 2VQTA 5F6HJ 3GHBL 3QDHA 2JB6A 5J6GA 4NP4L 2J3SA 1MFDH 2AKRB 3CDCA 3AU1A 1KBGL 4QXWA 5DD0H 3GJEA 1KPVB 4R7NA 5JTWA 1VFOA 43C9A 4A6YL 1ZA3B 5I1LA 1FH5H 2DWDA 3HS0B 4JG0L 2DD8H 4CVZB 1I1YA 4PJHB 3W2DH 5H2BA 3VA2C 1YN6A 4BZ2H 1VFBA 1YECH 3MUJA 3PWLB 1AXTL 1JN6B 1J5OH 3D48R 1VFAB 1B0GB 4HIHA 1ZMYA 1A6VH 1A7PL 5I8OH 3LEXB 1YNKH 3CLFL 2BY1A 4RBPK 4YWGL 2JB5H 4AIXA 1HKLL 4G8GA 1AO7E 5FECB 1XGQB 5E1AB 1I3UA 1FO0L 2LFGA 1CGSH 4H1LH 5D70H 1EHLL 2JCCF 5E8EB 5KBNC 3LS4H 4EEEA 3KDMB 4RISL 2R2CA 1YQVH 1LO5A 3PJSB 3QEUB 4KI5F 4LEOB 1MF2H 5BV7C 4B7LA 4ZDHB 1ED3B 4DCQB 3SHSA 1GRWA 1ULVA 1YNTB 3C09B 1QR1A 3QXUA 4PJDB 5A2LH 2NY4C 2IG2H 3BQUA 2FIKB 4HGKC 1DBAH 3BH9A 3H3PH 1MPAH 2X9XA 2E27H 3QULB 5HDBF 4HFWA 2W0PA 4V1DB 4IMKA 5HHOA 5DJXB 1CD8A 4Y1AE 5TE6H 1T83C 5KW9H 2NZIA 5C2BH 5ITFA 1NGXB 2QQQA 1BZ7B 1ODAA 3RVXC 2BHYA 4YHMH 4F58H 4P9ML 3BW9A 2BY2A 2GTZA 3CU1A 5LGKA 2VDQL 1TCMA 2NX5D 2JTDA 2X1WL 1WT5A 4Z7WE 5BXFA 5MEQB 5EC1B 5EU3A 2VKXA 4ZNEE 3QBTB 1HHJB 1BQHB 4JG1H 1VGKA 3O6ML 2KQNA 4LLVB 3DLQR 1KN2L 1EO7A 1HH9B 1MI5B 5GRVK 2P49B 4JFOA 4P2QE 3OF6A 3MR9B 3O8XB 4G5ZH 3QZWA 3BH8A 3QEQB 1AQKH 3HMWL 2BCKB 3DXAB 3HTLX 4LPTA 4OB5H 2EIZA 2EEBA 4JRYA 4D3CL 2ZG1A 1F4AA 2PO6D 5IOPB 1AXSB 3T2NL 1DQTA 1WBYB 3M17A 3VWKC 4NNPH 3GSVB 4U0RC 4PLKC 5I66A 4LP4A 1Z9OA 3PDOB 2YPKA 2E6JA 3HMXH 3MV8E 3NA9L 3QXAB 3V6ZA 5IM7A 2J8OA 3QUZA 4F7EB 2MHAA 1AGCA 2R1WB 1N5AB 5GHWH 3ARGD 4OLUH 1BECA 2AI0H 1NGPH 2VQUA 2QEJA 3ULSA 1JHKH 3F7VA 4I2XE 2Q8AH 3WN5C 4NQCD 2CR3A 3BIAX 1JYVA 2P24B 2DQUL 2P8LA 1YJDC 3LEVL 5IW6B 1NBZA 3PWNB 3QNXB 3RJQB 3S7GA 1N5YL 3E6HA 3U83A 2ZJSL 2DLIA 4M43H 5FDYA 5ENWA 1BFOA 5CZXC 5F1IA 3V0AC 4PB0H 5JO5B 3HAEH 1WZMA 3L3OB 3NH7L 3NAAL 5TGBA 4Z7WA 2NXYC 1J0IA 4YAQA 3O6LL 1U8PA 5T5NF 3BZFA 3CMOH 4YHPA 2JJTA 2UUDH 5TF0A 2NY1B 3GRWL 3HAEA 1XFPA 3ARFC 4L3ED 5FO7A 2W91A 2HJLA 5C0BE 5LG1A 1CDCA 3VXOA 2PYEA 1FL3A 5C1MB 1ZSDA 2DJSA 3IDYC 3F12B 4C56A 3MBXH 5MI0B 2WWMD 4WVRA 3TT1L 5KANI 1QSEB 3IDJB 3T08A 4LKXA 4HCRA 3KLSA 5B8CB 4N0UB 3S34L 4BJLA 4GUPA 4RGNC 2EDRA 5EZJA 2F74B 1G7JA 2XOTA 4NQDA 3V5DA 4P57A 3HUJF 2XWJB 4U6YA 2DJUA 3OJ2C 1HYRC 3QAZC 3LVEA 4KQ4H 1FAIH 3O4LD 4QOKE 4JN2A 5GSRA 4J3XA 1RK0B 2ZOKA 1DBKH 3JVGA 3GO1L 1OWWA 1ZHBB 4XC3H 1JPST 4UT9L 4NZUH 3ZDYF 4EN3D 4OF7A 2V2TB 3DX6A 3GMLA 3DYMA 3CH1A 3IGAB 2PR4H 2HKHH 1BBJA 1H3WM 1V3MA 3RHWF 1YYML 5L8JB 4KJQD 4RFNC 4S2SA 4JM2B 1KJ3L 4J3WA 3FCTA 1KGCD 1KXVC 2EE2A 4KTDH 2XQBH 4ZSOE 3UTPD 3GI8L 3BT2L 4L9LC 5DQDH 5SX4I 3TYGH 4DKEL 4MDJB 5INCA 4UV7L 4NO3A 1WCBA 1MRDH 1CICB 3SOBL 4GH7B 5CSZB 1KN4L 4XVTH 2L7JA 5IMOA 5GS0H 1JPSL 5ITBL 3OKDA 3NIGE 1CLYH 3MO1B 5HYIA 2VSCA 3PV6B 3O3AA 1IE5A 1KEML 3QQ9C 3QWOA 4L29A 4N8VG 3RU8H 3CH8A 1FNHA 2HRPL 1ITCA 3L9RA 1MHPL 3ULVD 4KKNA 3FZUD 3HG1D 5DJ0B 2XY2A 1Y6MR 4Y5VC 3U30B 1KEGH 3U46B 1REIA 4WEUD 1JHTA 1EFXB 1JK8A 1LK2B 4AK1A 3BAEL 3PHOA 4BFBD 2NZ9C 5SX5K 3WFEH 1OARH 5CIPB 3WXWH 3IXAA 1MRDL 3HC3L 1CFSB 3KJ6L 1ZT4B 4YHLL 3BT2H 5DQDL 4PJ8A 1S7RA 1JP5A 1CN4A 1CZ8H 4PG9A 5K9OB 3TEUA 3ZZ1A 3P2TA 1QSFD 4UB0L 1DTUA 1RZ7H 3C2SA 3DO3A 1MVUA 3P40A 5J06A 4HIXH 3MV01 1G7JB 3LKSB 4QRSB 5ADOH 1FL5B 3GSXA 3QNYA 2DKSA 4J3TA 4M6OH 4AEHL 4JFQA 1OSZB 1TXKA 3OWEA 3QDGA 2R29H 2NW3A 4ORZC 4YZFE 4LLWB 5FGBA 4XCEB 2GJ6D 3OGCA 5IW1A 5FYLL 2FH6A 4LPVA 3VI3F 3UTPE 3STLB 3WN5A 4EBQH 5DC9B 3GKWL 4MGXA 1YPZE 3ROLA 5GGSA 5CEXB 5DJZA 3L3OA 4C56E 3MRQA 5I9QB 2ICEB 4WNQB 2WUBH 3MA9L 5ENWB 4S1DC 2OTPA 5DWUH 3BPOB 3W11C 3FFCB 4L3CA 5CEZE 5EU7E 2FZ3B 4RNRB 4L8CB 2B7DT 3MRJA 5IT2L 5D71L 1MFAH 4DK6A 3DVNA 3VFNA 3C87A 1DVFB 3UYRL 2WZPD 1A3LH 4PV8B 5BMFH 1SBSH 3P4OB 4WO4B 2APXA 4KRMB 5E6ID 5GGQH 3DVNB 1MJ8H 4DGYL 2YPVH 2HAZA 4Y5VB 3ZT6A 3HG1B 3TZVB 2X09A 3FFCA 2IADB 4U3CA 4ETQB 5C0CA 2OTWA 3HC4H 3DSFH 1S7XB 1L9NA 4QRQB 4AT6B 1JI1A 4OD1H 3MC0A 1TENA 4MCYA 3VDAA 3MRIB 4BYHA 4I2XA 3GSQA 1AQDA 5EORL 3S35H 1WBYA 3IU4H 3QXDA 4PGCA 1J10A 4KI5C 5C0BD 1CICD 2EIZB 4JRYB 2HLAB 2OI9B 3CFCH 3QIBA 5TF1L 1U0QA 1E4XL 5JW4Q 3KYNB 5FUOH 1J9CT 5A2JH 2WLZA 1E0OB 1VPOH 3QNZB 1IGCH 2PN5A 1GHFH 4F57L 1HH9A 3STBA 3R1GH 4P3DA 2FRGP 3P0GB 1F97A 4RZCB 5JHDD 4QYOB 3E2HB 3QCUH 4JZOB 2JCCB 5BOPA 5HHQA 1QA9A 2NY6D 1XH3A 3VXNA 4IRSD 2WWKO 1BF8A 4PGEB 5H37H 5EZOL 1QP1A 4Z7VE 4UAOB 1T7ZA 5B4MD 4X6CB 4D0CA 5ISZE 1CFSA 4WWKD 2BSTB 3O11B 4LQ1A 4NKMB 1DQDL 3L5IA 4Z7OE 4GRLC 1B4JH 2EXWC 2QHRH 3UPCA 1KG0A 1NUFA 3MRHA 4S1RH 1EEZA 3RDTD 4BQ8A 5IEHB 2AJXL 3FO9B 1OVZA 5CEZL 5IROA 2V9QA 4PJCA 5DC0A 4X9FA 1W8OA 2FATL 2HKFL 4DK3A 3H3KA 1AR1D 2AXGB 3LEYH 1ZAGA 1NFDF 3BZ4A 3L9RB 3MUHL 4WUKH 5FYJU 1FORH 1OP9A 1A0QL 1J0ZA 4RGMB 3C8HA 2OK0H 3IDYB 4AJ0A 3D85D 1WT5C 2CIIA 5GGRY 2KL6A 4GAYA 3VXPB 5D7KD 1S5HA 5E8PB 5TE4H 1FZOA 2BNQD 4LVHB 4ZD3H 5L8KB 2C4FU 4JN1L 4K7FB 3T3MF 4MDJA 5INCB 3PWJB 5K9KA 4KKLD 4HUWA 3NPZB 3L5XH 4JM2A 1FNSL 3S6CA 3D87B 2WANA 3SGDI 1TETH 4HJJH 3SN6N 3BHBA 4I9WE 3ILQC 4GKZB 2NX5E 5KVGL 1RUKH 3KPLA 4PJXA 3ZKND 5H8DA 2R8SL 1CE6B 4HJ0C 5AAWA 3QIUC 2BX5A 2DN7A 3MUGB 4ODWB 1CFQA 4FQHB 4LSRL 3V52H 1GL4B 4NRYB 4S1SH 1G7LA 4JFEA 2MWCA 3C5SA 2IPTH 4RX4D 2HWZH 4GLRH 2X1OA 2YC1A 5MP6H 2NNAB 4Z7NF 2BSED 3L95B 4ZS7H 4RWYH 2PTUA 3BWAA 3DUSB 1NCWH 5DRNA 2BHUA 4TVSa 1M05B 3T8XA 1MQ8A 5CWSA 3C6LB 3U4BH 1GZPB 1XCQA 2J8UE 5L2KA 1YY8A 1ZS8B 2VDNL 2WBJA 5EOCH 3U0TB 1RJCA 1FH5L 1DBBL 5EIIA 4U2ZA 1CVSC 3TIEA 2G9HB 3V5KA 5ALCH 4PRHE 5JPNA 2W0FB 4U31A 4Q0XH 4A6YA 4L8BB 5FYLD 4JRXB 5C0AA 4LARL 1FGNH 2IBZY 2VIRB 3BZFB 4IRSC 2Q8BL 4PD4K 4YUEH 3WUWA 3BZEA 1MCDA 1WBXB 1PKQA 2CGRH 4O51A 5TDOA 3P0YH 2P5EB 4YPJA 1K85A 5F1IB 1A7OL 3WXVH 1PFCA 2DQFB 4IOSD 3HZMB 4EQ2A 4IIQB 1NGWA 1S3KH 3UTSB 4OZ4A 3MLYH 3EOTH 4I0PD 4NO0D 5K9JH 1MCPH 1DL7H 1FVDA 4WHCA 5IVOA 4EUPG 3ARRA 1RQ5A 1JRHI 4KK8D 1J87A 5DD3L 3BEVA 5KVDL 1DJSA 3X11B 3IDGB 3CXHK 2LVEA 2FSEB 1FYHB 1K8DA 4P2RB 1Q72H 1NCBH 1YPZA 3EO1B 4AEEA 5FKAA 4Y5YB 5I16A 2DLTA 2H2SC 4R6UA 2AEQH 2LTQB 5FM5O 4K94C 3VXRB 1G7QA 1R3IH 4I5BB 1QPXA 4Z78B 2VQ1A 4OZIA 3CU7A 2AK1H 5D2LF 3RJDA 2PW1A 3DYPA 2FGWL 2AEPL 2RGSA 1RZIA 5B38B 3IFLH 4XP5H 3QUYD 1XGYH 2EDKA 5I66B 5IK3A 3MV9E 1JPFB 2NYYD 4MA1B 1J05A 2VZOA 1C12A 4JY5L 3MYJA 3W0WD 2R2BB 4MSWB 2DI7A 1A1OB 4AEIH 4PUBL 2AK4A 1T03L 2Y5TB 1S9VB 3B5HA 3TBYA 4HKJB 1AO7A 1UWGL 4OV6F 4FTVE 1UCBL 4QXGL 5D2LE 4LLVA 3QO0B 4OT1L 1IC7H 5D93C 1ADQH 4XVUD 5ISZB 3WS3A 1LE5A 1MQKL 1I1CA 4EI6B 2R8SH 1ZLWK 3FFDA 4P5TB 5GRWA 4UIMA 4PJAF 1UG9A 3QUXC 4JVUA 3MGTA 4LOUD 1G0XA 1NC2D 2QQNH 1R5VA 2RAMA 1VFUA 4GG6E 3NIFF 5C8JB 4OCLC 4V2BA 5E8OA 1D5ZA 3HC0B 1YEIH 5C0RH 4RDQG 5DUPL 3ZKXB 1HDMA 1QEWB 4JFEE 1BZ9B 2VUYA 4P46C 1LEIB 2DF3A 3MJ9H 5T5NG 5DK0A 3BO8B 4H5SB 5DYOB 3QB7C 4Y16A 1EO5A 3G5VB 4P3WA 1BHGA 3N0PB 4KRPD 1NMAL 1XF2B 4UAOC 1SBBA 4R0LA 2OP4L 1J8HE 2K7QA 5KTEH 3PJSA 2DLFL 4MJIA 1IEBB 1UACH 4L4VB 2BNRA 4HKXA 4K7PL 5IWLA 5CBAB 3GKZA 1TZIB 5BCAA 5D1ZD 3GBMH 4NQEA 4RRPG 5A3IC 3RHWK 3RVVC 2YD3A 1BEYL 2QBWA 3HCVB 1OPGL 1MELA 2HLFD 4HF5H 5JPMA 1OD9A 4U4BA 2IANB 2J8UF 2O61B 3C5ZB 5BVPL 1QFUL 1AHWC 3MGTB 1PKOA 4HD9A 4FQ2H 5D1XD 1NDGA 4LSUH 4Y1AB 5AUMA 1Q9WA 5FUOL 1W8NA 2PXYC 4YPGB 4BQ6A 4ERSL 1DZBA 1NL0L 3ABZA 4BA8A 3ARSA 4JO2H 1YY9D 4JFFB 4QHUA 4WFFD 1SMOA 3IU4L 1JNHA 5JXAL 1DANT 1AO7B 3CXDL 5L2JB 1J1XL 1G7PB 5KJRH 4RFNB 1DVFC 2YD2A 4PRIA 3D69B 3SKJL 1T89C 1ZLUH 4ESKA 3VFSB 5HJ3B 4PJBE 5LQBL 4KJPD 4M1GH 3VD5A 4XGZB 4P2QB 2VUOA 2OQJB 1MWAL 1Q0YH 1XCTB 2R39A 1SM3H 1DSFL 1XGPA 2J88L 4FP8L 4MAYD 5IMKA 3VXUD 3FHQA 3S3SA 3RTQB 2B2XH 2WUCH 4DQOL 4E5XB 1D6VH 2W9DL 4WU7A 2APVA 3H0TA 2C3GA 1HQ4A 1NCNA 5IGXH 4L9LB 3CFKA 5T3ZH 3IU3A 5JNYB 1I8IA 2NQCA 4MQSB 1JTTA 4OKVB 3MA9H 3E1F1 2WUBL 5DJAB 3QEGH 1FNAA 5D7IB 4GW4A 3O2VL 1V3KA 3HUJB 4H88H 4P2QD 2ITCB 2BXZA 3EO0B 4MA8L 1K4DA 4ORGA 3VFUB 2DQFA 5KSAA 2D31B 2HJKB 2EYTB 5AD0B 1KJVA 3GMNB 1J88A 3G6JA 4LHJB 5FO9A 4EOWH 4UU9B 3FB7A 5FHBH 4FXKB 1CK0L 3V4PH 1NEZG 1DUZA 1GOHA 3GHEL 1XIWA 4GG8A 5F3BA 1OTSD 4JLRB 3B2UC 4J3VA 5EU6D 2NY2B 4ALAL 3WFHB 5EUOA 1JF1B 3HNTH 3EKCA 3MROB 4JANA 3RGVD 5DT1H 3AXLA 4X6DA 1AKJB 4JFZH 5LKNA 3UEZA 4KQ3H 4ZFFB 2I9LA 2QSVA 4UB0H 5BS0B 1LO0L 2BVQA 1I3GH 5JW5B 1U36A 4JFDA 5TE7L 3NCMA 3EYOB 3KJ6H 1AI1H 2VLJE 1M05A 3T8XB 5KS9E 3JV4A 2C3XA 3DBXB 3DUSA 1MCSA 2IAND 4K3JH 1CGXA 3QT2A 3NZHH 2DQTL 1SJHA 5LGJB 1KJMA 4GQ9H 4YHNA 3TWCL 1FO0A 5BRZB 1IAIL 2NNAA 1E6OL 4FXGA 1IGJA 4R4BA 3ZDXE 1CU4L 4RFOH 4OD3L 1GGUA 1CL7H 4Y4FB 5C6TH 1E27B 4HK3N 4P5TD 4PJFA 1BD2D 2AEIT 3N06B 5GGUB 2BC4B 4YGVB 3T3PF 4CVWA 4KGJA 1D9KC 3B9VA 1DLHB 1T04A 1NGQL 4KJWD 2VDMH 5JXEC 2EKSB 1FJ1A 2OR8A 2QV2A 5E5MB 2ZUUA 1YPZF 3BXNB 2P8MB 3TYGL 4PY7A 2ADGA 3GI8H 3W0WB 1RZFL 1S5HB 3PP3H 5E8PA 1ZA6B 3GSNB 3JV0A 2EC9U 4HK0B 1WEJL 3WO3B 4FG6C 1CIDA 25C8H 3RIFK 3KPRE 1KPRA 1TJGH 4G9DA 1I7UA 3F7YA 5DJDA 4NIKB 4OLWL 5K33A 4RFEA 3PV7A 4QRPE 3HR5B 4H1LB 2AXGA 1DQQA 1S5IH 1NC2B 2X4RA 2VC2H 1AP2B 2JJVA 1HQ4B 5FV2A 3PWPE 2X1PA 5MI0C 2AW2A 1FZKB 4NQXB 4Y4KC 2H32A 5SV3A 2QQLL 4RWHA 3GSNH 2ILLA 1Q9KB 2CLRB 3VFVB 4BFEA 1GGIH 1ZK9A 2BFVL 4X6CA 3BUYA 3AM8A 3WLBA 5GJTH 1OW0A 2YEZB 3TJHD 5JHDE 2NR6C 1LP9A 4LGPB 1BM3L 4JZOA 1IGML 3ZTNL 1IVLA 1T4KA 1EO8L 3ILQD 1XAUA 3ARYA 3FQTB 2QSTA 4P2OA 5I1JH 1ZEAL 3QUYB 4LDOB 3QEHA 3CVHB 4U6TA 5D2NA 1GH7A 5F1NB 1LO4L 2UYLA 3EOYG 3LQAL 2O5ZH 3DIFB 5F3HA 3INUL 1IMHC 5SWSB 1G6RB 1W0VB 3D0LB 5F9JA 3LQAH 4PB0L 5AAMA 4KRLB 1NDGB 4LVOB 4M43L 1HHIA 2FECI 2NY4B 3PG2A 5J1AB 3T2OA 1I8MA 2E7LC 4LGSB 4MQXC 3QUML 2FBJH 1MHCA 1AD9B 1UQSB 4U1IB 3O2DH 3GMPA 3X17A 3CC5B 2O93L 3CMGA 4HJGB 1RD6A 4AT6A 4CU7A 1S7XA 4I4WB 2LTQC 1FG2B 1UB6B 4YFDB 1EUUA 4Y5VA 3GSWB 4JJHA 4PJGF 4FQJL 5C08D 4HXAL 1J86A 2P5WB 4H0IA 4LPCA 2VLJA 3V8OA 3AVEA 5DHYA 5DVKA 2VLKD 1F4HA 4G6AC 5LXGL 2YZ8A 4LVEA 3PQYE 3GNMH 3ZHDA 3PGFH 5T3XD 5E56A 3DVIA 2BRRH 4G6KH 3RZCC 5AZ2L 3GMQB 5E9DD 1R3JB 4LAJH 2W1NA 4XZUB 1J8HD 3CJJA 3HB3D 2VWEC 4Z7UB 4IRJB 2ICES 4K8RL 1G6VK 3MFGB 5I74C 1F13A 2IMMA 3AS2A 4WWID 1CXLA 1ORQA 4APQD 1LEGA 2F58L 4XTRC 3G6DH 1CI5A 1RI8A 4MQXD 5DR5H 5DVLA 1S9XB 5I2IB 2NW3B 2HFFB 2Z8RA 3WFCL 2K1MA 5I1CL 1S7VA 4LOUC 3NFNA 5FGSA 3EYFA 1L0QA 1LNUB 4J8RA 3GSXB 3QNYB 5KG9A 3WUZA 1NANI 4NNYB 4NNXB 1JTPA 5EUKB 2PXYA 5C0CE 5F7DB 4GSDH 3K4ZA 5ACMA 4UILL 3TNMA 1MFNA 4LAQH 5ISZA 2NLJB 5DJ6B 1CL7L 4ZUUA 4WJ5B 2QADB 4YO0B 2RR3A 4XNYH 1OT2A 4ZAKC 5ANMA 1SY6H 2GJJA 3MRPA 1L0XA 4X4YB 2C1PB 5HVWA 4HIJA 3MV9A 2BSSA 4JFPA 4C57C 4OLYL 1T5XA 5F96L 3SE3A 3OQ3B 5J7CC 4G7YH 1AI1L 5TDNA 2EDLA 5I1IL 4OV5A 5GRJL 3B2VH 1RJZB 1TPXC 4KKAD 1JGVL 1RZIB 3FO0L 1CFTA 3JWDL 5KS9B 4JO4H 1KIQA 4QF1B 5I1DA 4Z78A 4XVJL 2X89A 4HMCA 3WEXB 3IFPB 2R1XB 5DT1L 3EFDH 1I1FA 5EBMA 1KCSL 5T3XH 1QLEH 1QHOA 4HUXA 3VE0B 2Q86A 1YNKL 1FC2D 3E6FB 2JK5B 4Y5XA 1A6VL 5FKAB 2OJZH 4JHAH 2BDNL 3L3HA 4OAWA 3VFTA 3L6FA 3ZLQC 2DD8L 4NQUA 4PRAB 4DVBA 1U2CA 3ARUA 7FABH 4S2SB 3E8UH 3QDAA 4WWKB 1DCLA 1YMMB 1GSMA 4KDTC 1SMAA 1DP0A 1NGYA 3DROA 3P4NB 4M3KB 5EPMB 3SE4C 3SDXE 5DD0L 3TESA 3OXSA 2R4SL 4WO4D 1MCHA 3WDIA 5J1TC 5DJ2B 3QEGL 5JXED 3FQXB 5KVEH 1OQOA 3N1GC 4WU5B 1UWEH 4PJEF 1CBVH 1FZJB 3FT3A 4HULB 4WDIA 4MDIB 3K7UA 2W0FA 1FLRL 4YEFA 1CE1H 4Q97A 2JLLA 2VE6A 1IAKB 1TVHB 2IH3A 1HHGA 2JELL 3L3DB 5AG8A 4U7MA 3TFKC 3RWJB 2VMFA 1A6TA 3T77A 1DQMH 1T1YB 5HDBE 2ERJB 4GBXD 3S36X 1QACA 3HZKB 1KLUA 1PW3A 1MCWM 4WUUD 3P4MA 2KUTA 2X4QA 4N0UA 5FEBA 4XNXH 2GJ6B 5D1QA 3CXHJ 4X4MA 2ZCHH 4MHHG 5E5RB 3TBWA 4HS8L 5JQ6H 5IW3A 2DYPA 1IL1A 1B0RB 1F2QA 4ODBD 3CXDH 5GS1B 4AMKH 1X5XA 1RIVH 5FYJL 1RJYA 3BE1H 2XWTA 4XAWL 4O9HL 2I24N 4JZJC 4CUCA 4XCFL 5CLTA 3MUGA 5EOQL 1QRNB 4GXVH 3SDDD 3FAXA 5HVHC 1F4YH 2VXUL 4PTUA 4WI5A 1CF8L 1BFOB 2EDWA 3G08A 1GIGH 1FDLL 1TVBB 4FS0A 4QTHB 1WWCA 5GGTA 3SY0B 1KCLA 3S88L 3PWNA 3QNXA 4Q9QH 3Q0HA 4PRAA 4DVBB 4I9WD 1D5BA 4PJ5E 2NY7H 3BEWB 3JXAA 2PCPA 3QJFA 1A02N 5FYKH 4JO3H 4QTIL 2FDBP 4WTZA 4YBLB 2A74A 1OGTB 2RFXB 3S97C 2A83B 1V3JA 3WNKA 2ZCLL 3ZHKA 3MRGB 3QUZB 4F7EA 1OGAD 3GBML 3QI9D 5IM7B 2E7LA 4PJAB 1PG7H 2C1OB 3H9HB 3QQ3B 5DJCA 3GK8H 1PLGH 3PWPD 5DGQA 5FUZH 5F7EL 2PYFA 1UACL 1R3KA 1QNZL 1U8HA 2DLFH 4CNIA 4M93B 1MLBA 2D0GA 2IEPA 4GBXB 4KK5D 5B8CC 1A6AA 1P7QD 5IBUB 2G2RB 2DWEA 1I8LC 2O5XL 2GT9B 1UWXH 1CXIA 1QZ1A 2BVEA 4PJXE 3NTCH 2FEDD 3VXTB 3BVNB 3BH8B 3QEQA 3RA7L 3GFUA 4DN4L 4XNQB 2XXMB 3RAJH 3T4YA 1EAPA 5LGHH 5D2LA 4HW6A 3WIHL 4OKDA 1ND0B 4NFDA 2YN3A 4YO0A 3RL1A 5GS0D 3OBAA 4KKCD 2H6PA 2CSPA 4XPHH 1X4XA 2BJML 1EFXD 2XZQH 4KMLB 4TPRL 1ZANH 3UDWA 2AK4E 2GUOA 1KJ2L 1CL7I 1Q0XH 1MAMH 3CCHA 3QDMA 2YD7A 1ND0A 4PLOB 3S5LG 1EAPB 1PEWA 2NR6D 4HUMB 5EC2B 4XHJD 3ZKMC 5IV2B 1OQXA 1QFWI 5T1DL 3VXTA 1TJHH 2XRAH 3REVB 1NFDB 1JWMA 2HLAA 3FMGH 3K3QA 2G2RA 2Q7YA 5D8JL 3HRPA 3V6OE 4O2FA 3TN0C 1KTLB 4P5MA 3BH9B 2F5AH 4M4RA 5CAYB 2AXFA 3CFBA 2NY7L 4Q7DA 4M48L 1JIBA 1NBVH 2I07A 3GGWA 3MRIA 3FQUB 1T3FB 1A4KB 1QD0A 4F15B 1X5ZA 1ZKAA 2R69H 1AJ7L 4JY5H 4U1SB 5E2JA 1JUFB 3S9DB 1ED3A 5AEAA 4WV1B 2R2HA 4GS7B 1HHHA 5J57B 4AENB 2A83A 4XP5L 3O3EB 1A7BA 1E4WL 1NLDH 4GRWF 4OCSH 5E1AA 5EWIL 5LBSL 3RNKA 3HNVH 3CSPA 5B4MC 2R0KL 1HK6A 3PNWB 5JQ6L 2ICWJ 1F02I 5JW4M 3UJTH 2BVTA 1KB9J 3G5ZA 1T0PB 2B1AH 1PQZA 2VAJA 1CFVH 1JNLH 2V17L 3R8BB 1IKFL 2D7TH 3TNNA 1QSEE 1MHCB 5CJOH 5IIEB 1HCFX 1F3DH 5DMIH 2Z4QB 3S96A 1JPTH 1QYGL 3IFNL 3QFJB 4LIQH 2Z35A 4QRRA 1A7OH 5E95B 1G7HA 3OHXB 4H8WC 1HIMH 1CICC 1HSAA 4EI5D 5F3HB 2A73A 3QPQD 1TQBB 2OMBA 4LSQH 4HEPG 1U8IA 1IC5L 4PP1D 3V2AR 4CMHB 1T83A 2V9TA 4G8IA 4D8PA 1OSZA 1IM9B 4X9HA 2ZP0T 4L3EB 5EFIB 5FA4B 3RVUD 2ZSVA 2OJEB 4YH6A 1CLCA 3LKSA 1WFOA 3R8QA 4QHMB 4IRJD 4MX7A 4FABL 3O4OB 3I02A 3NVQA 2A6JA 3LKRB 3LD8C 3O8XD 3WLBB 5EZLB 4NQVA 1RZGA 1SJVA 1V3LA 3MNWB 2F8VA 5KSVA 4LRNL 1X6LA 2XFXB 2DBJA 3PP4H 2FEEL 3HPJA 3I2CH 3KYMB 1MCRA 4NM4H 1K4CB 6FABL 5DVMA 3PHOB 5IVZB 1BQSA 4PJ5B 1T7WA 4I77H 4WFHE 4TN9A 2P5WD 8FABB 5C08B 1Q1JL 2X4RB 1INEH 3WJLC 1XEDA 5CBEB 1YMMA 5HHNB 4PLJD 1DFBL 1KOAA 5DFVC 3MGOA 4YHYB 4WRLA 1MAKA 3I2CL 5CEYB 1FN4A 1G9ML 1A7RH 4XCYB 4HWNA 1D5IH 1RVFL 3QUXD 1JZ7A 2ADGB 1EGJH 4IOFC 5HHVL 4FQ1H 2IFGA 4HIEA 3W9EA 1H8NA 3HZVA 5TE4L 3JWOL 3L7EB 2VZUA 4PJGA 4FNLL 1CFTB 3RUGE 4OBRA 3N9GL 4W70A 4U1HA 2CK0H 4OV5B 1I1RA 3X3FL 4L5FL 2D7PA 1I1AA 3L3KA 1DE4A 3KJ4B 1A2YA 3BKML 2KZ1B 2J5LC 3CAFA 4PJBB 4HIJB 4NWUL 2V2TA 3Q5YA 1AGEA 3ELAT 2P1YA 5DTFB 4L9DA 4ZXBD 4R4BB 5ANMB 1P1ZB 2VLKE 3G9AB 4YHNB 4EUPH 2YD5A 4DGIL 5BV7H 3UTZB 1NUDA 4S10A 3V0VB 3BOVA 3WNPA 4S1RL 3MRLB 1TNMA 3ALPA 2B1AL 4Y5YC 1L7IL 1QG3A 1TTFA 3VGBA 3O4LE 3S4SA 4HGMA 4V1DD 2ZSWA 4JE4B 4KUCD 4OGYL 1UJ3A 3RVUC 1A3RL 1ZE3C 2WBKA 4U0RB 4X6EB 3PGCA 1M7DB 5HYJA 1QR4A 2R0KH 2HP4A 2DTSA 2V7HA 2Z8WC 3MBED 1AKJA 5HHPA 2HFFA 3F12A 4C56B 3QDGE 2H26A 1LGVA 5EUOB 2B1HH 4FN0A 3B43A 3BGMA 2X5PA 2XZCL 1OOAA 2UZIH 4M62L 3STZB 3K1KC 4FXKA 4PPTA 3QDME 2XA8L 3D0VA 2GHWB 4J3SA 3VH8B 4C58B 5DSCB 1WBZB 1AE6L 1PVHA 4ZS6C 4NOFA 4AZ8A 2F54A 2C9AA 1OAXL 2LU4A 3RZCB 3GMQA 1D9KA 2ITCA 1K3ZA 1BJ1H 1CD1B 2AV7B 1WJ3A 3LKNB 1TJHL 2W9LA 2P8LB 4OZGF 1VACA 5CJ5A 2H9GA 3SGJA 4JFHD 2LQRA 3T0EC 4HUKB 3F6IA 2VLJB 2YD9A 5DFTA 2EDBA 3BKYL 2APBA 3VFOB 4DAGH 1UB6A 3RKDD 4UBDD 1ACYH 1YEDA 1A3LL 2J7LA 3REWB 1G6RL 1FNGA 4QRTA 1ONQB 1MFBL 1SEQL 4LCWB 4JR9H 3PDOA 2HG5B 2NY3C 2C3VB 5IVXF 2IWGA 1AD9A 1UQSA 3CVHL 1MVFA 4OIBA 3QDJD 5BJTA 1CTOA 2ZKHL 3LHPH 1HXYB 3B9KB 2AJZA 3F5WA 3WLWD 5BS0D 5EZIL 1HSBA 4TTDC 2VB5A 3MRFB 5HGDB 3C5JA 1MWAA 5F9JB 1J0YA 1R3HB 5GGSY 3GSOB 1G7PA 2DKUA 3QZWB 2XXCB 2X9WA 2GFBB 4OZHB 2W0LA 2CK2A 1NC4A 4J12A 3UPAA 1FPTL 3WYRA 4OF6A 5I1GH 4HS3A 1MLCA 4YPGA 4X83A 1PYWB 5L6YL 3VMNA 3DOSA 2PTVA 1S5IL 2VDLL 3VDCA 1P84J 1DN2A 3MOAL 4Y2DB 2OS7A 4M6OL 4AEHH 2APWA 3K2UL 2RCSH 2VKWA 5F7NC 1RHHB 3VRLF 3CUPB 2GTZB 3LKQB 3ZDYE 4ZUTB 4JY4A 2JJTC 3CPLB 3EYSH 1BAFH 1N59B 4LSVL 4ONGL 4HC1A 2XT1B 3BP6B 4B0MM 4QGTA 1GGTA 5ICYA 2QTEA 2R4RL 1FE8H 3BN9C 3DJ9A 1QSZA 5EU5A 4KZEL 1RULL 4P48A 1FDLH 3RKDC 5GGVH 5I1EL 1JGUH 2VXUH 2UY6A 5CBAA 4HWBH 1P7KB 4DVRH 4G9DB 3DMMB 5DJDB 4OGAD 2DKMA 1T2QL 5CLWA 5I8CB 3RKPA 3RUGB 1Q94A 1ROWA 5IHUL 3MGAA 5FYKU 4NKDB 1JWUB 4Y16B 4OF3A 3GMOB 1KENL 3EYQC 1IAIH 2VITA 3B2UD 5E94A 5KN5B 1MUJB 2NY6C 3BGMB 4FZEL 4LLAA 5GS0L 4UTAH 2OLDA 35C8H 5BOZG 4PJDE 4WW2F 1KCUH 1DUYA 1G1YA 4X7FC 3WIHA 5KOMC 4UDTA 5E8OB 5KAQG 1CGVA 2C7UB 2EE6A 4X8XA 1T04B 2IGFL 1DLHA 1QVOB 3OV6A 3TPKA 1F6AA 4HQQL 5DGRA 5HGBA 2V7HB 3P9WB 1ZGLP 1KJ3H 3QUKA 4NKOB 5DDHA 4ODSL 3TVMB 2A6IA 3KLHD 3I50H 2I60L 1UWEL 1QFHA 1CFBA 2HKHL 4OFVA 5DEGB 1F90L 1A9EA 2AJVL 2AQ1A 2DIJA 5KSBF 1W0WB 3FONB 3CSYA 1UZ8B 3UTZA 4KK5C 4KPHH 1FIGL 3H42L 4PBVC 5JA9A 3LKPB 3MA7A 4FFVD 5JIKA 1DBKL 3QFDA 4XMLL 1F4XH 3QHFL 3EZ8A 3HR6A 1JBJA 5IHLB 4MHHI 2HTLD 2R2BA 1LILA 1MRFH 2ESVB 2IPUG 4L4VD 5IEKB 5T1MA 4ISVB 3RWIB 4XPFH 3VH8G 4GXUN 4JZJB 4PY8I 2BOCA 3TO4A 4YLQT 3TBSB 1QKZL 3BP4B 4G9FD 4MNHA 2V2WA 4JM4H 5BW7A 4E41B 3VG0H 5IJVA 1JGVH 2N1KA 4P4KA 4ONHA 1H5BA 4WHYG 4K55A 3B9KD 4JJ5A 5GRJH 2A6KB 4U1GB 4LMQE 4L3AA 3CZJA 4R2GB 4ORGB 1FCCA 2EDXA 3QDJB 1P4IL 2G5RA 2HT2D 1OY3B 4KV5E 4P2RA 3MLSL 4NCDA 3I6KA 3X11A 4M1GL 5IMMB 5EO9B 4D9RD 4EZMA 5DZNA 1I8IB 4GRWE 5JNYA 1SY6L 3SJVA 2DLGA 4LLQA 3MCLL 1CLOH 1HHKB 3OJVC 4K2UH 1OB1A 2DOCA 4TUOB 4JJ5B 3NIDF 3C60A 4LAQL 3SDAB 3V6FB 3WNNA 3RTQA 2DLEA 4TNWF 1U3HA 3KXFB 5CMAA 3QCTL 4E41A 3GZKA 4HBQA 4UNUA 3RL2A 1MHEB 3QPXH 2Z91A 4JKLA 5MEPB 3S37L 3TBSA 4DVRL 4LU5L 2V5TA 1CDIA 4HX1A 4F33B 1WWAX 3K46A 3RZCD 1BFSA 4NQVB 5CKGA 2CDEA 2W59A 5EZLA 1CXHA 4JM2C 4NYLA 1RULH 5JDJA 2JCCE 5L9DH 4WHTB 3RGHA 4GRLD 1KC5L 4PY8J 1J1OH 3VFMB 5IHZB 3T04D 3ARBC 1B9ZA 1QFUH 1YEHH 2CR6A 4NJ9L 5J13B 3KNBA 5HVHB 1LK3L 2AJVH 3NABH 3HI1A 2RQ8A 4MNQE 1UKTA 3EYSL 4HUUA 4C56D 4W6YB 4GG6B 2FO4B 3IT8D 3WNMA 4MQ7B 1G7HB 3VXRD 5LAXA 5HYSA 4QRRB 5AZ2H 3MLTB 1MNUL 4IOFD 2GTWB 4G42B 3S96B 1FYTE 3TVMA 3AS0A 3KPMB 2GJ6E 2I9TB 2J2ZA 1HYSD 4WCYH 1FPTH 4JDVB 4LRIC 2XTJE 1OLZA 4UTAL 5A16B 4JB9L 4KI5D 4ZQKA 5GS3A 1BBDL 1KULA 1IC4H 4G9FE 3DTXA 3WD5H 3BKJH 3LN5A 3UTSD 2X70A 5E00A 4IM8A 4ZXBB 3VG9B 5KN5A 4R4ND 5KW9L 3CFDA 1QLFA 3ARFB 4LF3A 5ICXB 1SYVB 2NY1C 3F58L 4WY7L 3BJ91 4FTVD 4HCRH 5F7YC 3GRWA 4L8DA 2LU7A 2WSKA 4UT6H 4PJEE 5HI3C 2CRZA 4GAYB 4POYA 5E4EB 3MUY1 3NCFB 2VDRL 4LASH 5IROC 3KAAA 1AR2A 3S36H 4GKNA 4OBSA 2BVOB 4L8SA 3VGEA 3ZSTA 2X1QA 3G5VA 5E70A 1S9WA 3BZ4B 4AQ1B 1HCVA 1X5YA 4JZNA 5D9SB 3SDCA 3H2WA 4XBPB 5DURD 4AEFA 3GMRB 4TUJA 5I1JL 1LVEA 1XF4B 3ULVE 3V0WH 3OKNA 3KPQB 1P5VA 1NFDA 3QRGL 2E8YA 4NRXB 4P3CH 1T6VN 4HH9A 1QFOA 2H2SD 3TN0D 1LDPH 3L3GA 1GGBH 2KKQA 2E9BA 5EC2A 1V05A 3MOAH 3MJ7B 4LSTL 4MAUH 2BSTA 4LNVA 4TSCH 1MJ7L 1FAKT 4PUBH 3HE6C 3HNSL 1AXTH 5D96B 1XF3B 3D9AL 2JIXB 1NMBL 1WF5A 1WZ1H 3HE7B 3TP4A 3U7YH 3WS3B 3ES6B 4X6FB 4ODHH 2HYMA 4HS3B 1FNEB 4EIZC 4M8VA 2J8HA 2YPLB 2P42B 3DO7B 1OAZH 1KBGH 4M9PA 4YHZH 3TBYB 1N6VA 4ZAKB 5DRZA 2LAGB 1Z3GL 4LEXL 5DJ8B 1EH9A 3PQYD 5FYLE 5E24E 4M7JL 2I5YL 4OGYH 4M7LL 3NCJL 4GRMA 2PTTB 5TQ2H 5HI5C 4ZODA 3HA0A 1XGTB 4M3JA 1PEZA 1ACYL 2VDPH 4Z7UE 3C8DA 4TNWK 1SY6A 1A7QL 4ODUA 1I9RL 4LCWA 3SKMA 4NC1C 1A6ZA 2VQ1B 3THMH 1CR9L 3W5NA 1YEDB 3LRHA 2IADA 4PV9B 4ETQA 4XMKH 5IVXA 1E6JL 1NUGA 2GW5A 3UPRB 4Y5XC 4OCXH 2B0SL 3L3IB 2VDML 5CZKA 3DSNA 3EO1A 3M8OL 4PV8A 1ES0A 4AY0A 4OZHF 5C92A 1J1PL 2GY5A 3DGGA 3NFPA 12E8H 1VKXB 3SCMC 5CUSL 2NCMA 1CWVA 4Z7OF 3KXFE 4GMTL 1IZKA