5D1XB

Isdb neat2 bound by d4-30
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
217
structure length
212
Chain Sequence
QVQLVQSGSEVKKPGSSVTLSCKASGDTFNTHTYSWVRQAPGQRLEWIGGIMPIFAASKSAPHLQDRLTITANKATRTAYMELTSLTSDDSGVYYCARDGRGALQYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords D4-30 Light Chain
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1xB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1xB01
1NANH 5EWIH 3L5WA 3TVMC 3HLAA 3MZGB 4Z7QE 4DKEH 3MRKA 2Q7YA 3P0VL 4PREB 1ETZB 5DF0A 4B5EA 1MUJA 1JWUB 4P2YA 3D9AH 2C5DC 3GIVB 3EFDH 2BERA 1E4JA 3DMMB 1A2YB 4OD3L 3HAEA 1YEKH 3HFMH 1K4CA 5DVNA 2VQUA 4YO0A 1JNLL 3QZWA 3MV8E 3P2TA 1MWAB 4OCYL 1YY8B 4OI8A 4F9LA 5GS0C 2P8MA 3QH3B 1B0RB 8CGTA 1WBZB 3EUUA 4HGWB 2OTWB 1WV7T 4PRPA 3VI3F 5T1LB 3RY6A 3ZDZF 2VE6B 1B2WH 1JVKA 3NZHL 3O2VH 4C57C 1T20A 4OQTH 1NCCL 5FHBL 5F7FA 4LCUA 4ZFZA 1A7RH 5DSCB 5DQJA 5JMOC 1CDUA 1MJJA 1D9KC 3IGAA 3R06A 3MV11 5JW3H 2FZ3B 3IJHA 4X5XB 1EJOL 3MLZL 2X89A 1BLNA 3ARDD 4FA8A 4OCLC 4H0IA 4YHPB 3V7AE 1NFDF 2HFTA 4M7ZB 4IIQC 2EDWA 4P5MA 1L0XA 5C08A 3SDCB 5JR1L 2J5LC 3I6GB 3KLSA 2BNRB 1KJ3H 3FB5A 3VD5A 2WUBL 1MSPA 1MHEA 2BVOB 1FNEB 3L3JA 5C0BE 1BIIB 4YHOH 5D6DA 3NA9H 4WW2A 4FS0A 2EDYA 3UROR 4PJXA 4M1GL 3SO3B 3WO4B 3TF7C 4Y5XA 4JZJC 2XFXB 2XZAL 2YPLB 5T5FL 4PLJC 1MH5B 4HX1A 5IKCB 5GGSA 4DKFL 1PEWA 3B4NA 5I8EA 4OB5H 3HI6H 4QHMA 3UDWC 4XPAL 4X6BB 1C5CL 5I19H 2VKWA 3NIGF 5I30L 1XF1A 4OLXL 5I16A 1RUKH 3RWHB 4HFWB 5E8PB 3U0TA 1KLGB 1OAYH 3SJVB 4WJ5B 1E4XH 1N4XL 1WISA 1KJMA 4H1LA 1HHHA 3LKPA 3VWJD 4JPWH 1XF5B 4FQIH 1E4KA 3O8XB 1JUFA 1QUNA 2YHGA 4O9HH 2D03L 3MRNA 3ZYOA 3QAZC 4NBXB 4QRPD 1NMAL 4OZGF 5EN2A 1ZS8A 2GJZB 1X7QA 1YMMA 4P2QA 4M6OL 5CAYB 1P4LB 3BAEL 3VXRE 1LE5A 3BIAX 5SX4I 2NXYC 4K7FA 2WWMD 5BXFA 1U42A 4YDLB 4V1DE 2NY6C 1X44A 3I6KA 4GSDH 4G43B 3U0PA 5LCVH 3ZL4H 3MV7E 1TTUA 1QQDB 2EIDA 3EYSL 3GK8H 1WBXA 1KJVB 4I0PB 4HUUB 3H9SD 1YEDB 5DJ6A 4NO3A 2O5YH 3I3BA 3MGTA 1NC4B 1MFAH 1RURL 3PWNA 3RL2A 1KJ2B 3AC0A 2OR8A 1J7VR 2LAAA 3OKMA 1NMBL 5MI0B 4F33B 2E8ZA 3ARTA 5SX5H 2E7LA 5FM5M 1L7IH 1NGXA 5SWZA 1K5NB 1OM3L 4EN3A 3GI9L 1KXQE 1ZXQA 3U9UA 2A2QT 5EPMB 4NDMA 1ZANH 4PV8A 1NFKA 1RQ5A 4ZFGL 1DQTA 4MAUL 4ZAKA 3WHXB 1XF2B 3FQXA 1QBML 2DYPD 3IU4H 5EOQH 2YA0A 4R4NC 1JPFA 4YHML 1FIGL 2EDBA 5A16B 3BISA 4YQXL 3BKML 3IJSA 1XCQA 4IRSC 1YMHB 2YN3A 4DN3L 2CRYA 3CLFH 3HNVL 4HDIA 5D9SB 3ZT7A 4OLWL 4K55A 5E6ID 1KG0B 4BSWA 2AKRB 4AIOA 5MEPB 5E70A 1KTRL 4JDZB 1A8JH 4NQEE 5CUSL 5IV2A 5HHOD 1PLGH 2Z31D 3SKMB 3KJ6H 5IVXB 4LVNB 3CSBA 4KI5C 1FHGA 3MXVH 2AJXH 2K1MA 1YJDH 4M7LL 4H88H 2KZ1B 1PJ9A 3DIFB 3ARZA 4OT1L 3M8OH 1NBYA 1L6XA 2B0SH 1MREL 1YNKH 1B9ZA 5E9DD 4GQPH 2R2EB 2FD6L 4P46C 4U0RB 1Z3GH 4Z7VB 4QXWA 4ELKB 5DD1L 5DYOA 2W9DH 4Z77B 4ZUVB 2D0FA 2AJ3A 5D6CA 3AS0A 1B6UA 1MY7A 3P4MB 2FIKA 4WHCA 1FZOB 3NABL 3QG6B 2PO6A 1BFVH 3LN4B 3NFSH 4G6JL 4XWGH 1U91B 5LAXB 4Y4KD 3PWPD 4IDLA 1I7TB 1NCUA 3GKZA 2F54B 4OGAC 1FFNA 4L4TD 4MCYB 2QLVB 4AG4H 4DVBB 3H42H 3LDBC 4OFYA 2BRRL 1AXTH 1FORH 3HR5A 3KPSA 3E3QC 5E8NB 1NBVL 1NFIA 1A3LH 1NKRA 1QHOA 5FO8B 1J8HA 2AXFA 3Q6FA 5FDWA 4ZUWB 1UEMA 1FAIL 1YEFH 3OHXB 1J12A 5ETUB 4PJAE 3BP6A 3LH2H 3GSWA 3DHMA 4A6YL 2AEQL 3ZKMD 4JREC 4TVPE 3BPNC 1D6VH 1U8QA 1MF2L 3L3GA 4WUUB 1PGRB 1LO2L 4JY6A 4M7KL 1YY9C 4NNPH 4Y4FA 3F58H 3QYCA 1XH3A 2PW1A 1A1OA 1JK8B 4WWKB 5KSAD 4LPCA 4FQ1L 4PJBE 3GFUA 1NMCB 3MJGX 5IHUL 1UADC 2BNQB 2QHLA 1X5AA 4HWEH 2C4FT 4BZ1L 1UJ3A 1FN4A 2B5IC 2FEEL 3KG5A 1T3FA 3OKDB 4RMRA 2ICWA 3DURB 2ATPB 1C08B 2C3VA 4OGXL 1VGKB 4IRZH 1QLRB 4HLJA 8FABA 4EI6B 5E8OA 4Z7UF 5IB5A 1QFWH 3C6SA 1GIGL 3L3OB 5SWSA 4Z7WE 1R3LA 2D7PA 4LHUG 4WW1B 2EH8H 3VH8G 3LQZA 1Q9LB 5HTSA 5DHYA 2SEBB 5JNYB 3NIFF 1S7QB 3RGVC 2WWKO 4U1IA 4CN6A 2HH0L 1HE7A 3JSSA 3SKJH 3CNKA 3HE7B 1LILA 2HJKA 3NPSC 2CR6A 1A14H 3LKQA 4OIIL 2P7TB 2DTSA 4I4WB 4G8FB 2EDXA 3F7YA 1OAXH 4L8BB 4U6VH 3RWEB 1NUDA 5C92A 3S5LG 3TO4C 5ALCL 4OF8A 4F7PB 1R0AL 5E7BA 3O9WD 1DQQA 1KTDB 1XR9B 5DD3H 4HLZH 1PKQB 3RU8H 3WIFA 5EFIA 2UUDH 3K4AA 2CDEB 3T2PA 2X4NB 1JZ2A 1EHNA 4P5TA 1I8MA 4OAWA 4GAJH 1KACB 1RZKC 2YD4A 4PJGB 5L2KE 1U8MB 4W6XB 1U8HB 4F9LC 5AUMB 4HKXA 1W0WB 4NM8L 2V2WA 3QIUB 1RZGB 1DE4A 1Y6KR 4LKCA 4MD0B 2MQ0A 1KC5H 4L4VB 1CICD 3RY6C 4X7CC 4CADA 1WZ1H 4KRPC 4I77L 3NAAH 5D5MA 4UOJA 1ZT1B 3RVWD 4ZTPH 2NQCA 4O2CA 4QRRB 3UBXA 4E41B 2GTZB 4BZ2L 1X6LA 1PYWA 1S78D 4G6ML 5F1OB 5DD6B 3I6LE 4KJWD 3VGAC 1FJ1A 4HIIA 4UNVA 1QRNE 3MUGB 3L7FA 4Q9BA 1S7UB 1BEYL 3DUUA 5DTFA 4Y4HC 5J56B 1D7FA 1S3KH 4TSCH 3WIHA 5JO5A 4L29A 1GGIL 2NX5A 1NCAL 4JFZL 4X9BA 1P4BH 4PLOB 3SE3A 4L8CB 1ADQL 2ZUQB 1HSAA 4NRZB 3W0WE 1LO3L 1A6VH 4CW1B 5JDSA 3QCVL 5ITFA 1LD9B 1TJIL 2R1YA 3H3PH 5T1KA 5EA0L 4XBPA 2Y36H 5D6DC 3C5JA 3B6SA 4FFVC 4HWBH 2HT4D 4H0HB 3TJEH 4K23H 3ZYJA 1ZE3C 3QWRA 1DDHA 4Y5XC 5D1ZB 2BNRD 2BSTA 1DFBH 4KY1H 1HI6B 2HKHH 2IPUK 1IGCL 5F7WC 5D7SL 2PYFA 3RVTD 1BFOA 1SJXA 2YPLD 1IZJA 1S7TA 3FOMB 3NZ8B 1T7XA 1MVUA 1U93B 3I3EA 1QFOA 4ODTL 1E4KC 1OF2A 3Q1SL 5AD0B 3NCJH 5GSVB 1FYTB 2HAZA 2R4SH 3CH1A 3DBXA 1IC4L 1UB5B 2X70A 1SBSH 2VDQH 3VXPB 2D4FA 3O8XD 1NKOA 4D0CB 3Q5YA 4PJCF 1X5FA 1XF4B 5C6WH 1BFSA 3CFIC 4S1DC 4C56B 3S97C 4WHDA 1UM5L 1UWEH 3H0TA 1P7HL 1J0ZA 5F3BB 4DEPC 4IDJL 3MRPA 4OV6F 5CHNB 4JHWL 1U6AL 4PJDB 4YBLC 3TGXA 1JJUA 1XR8A 5I2IA 3BKJH 3R0MA 5KSBA 2DQGL 3GJFA 1YEJL 3LD8B 1YUHA 2E7LC 2BRQA 5KVFH 3V5DB 3PGCA 3OXRA 1AJ7L 4YHIB 2EE2A 1J1OL 4RFNC 4EN3C 3D85B 3PV7A 3FONB 2X10A 4QEGA 3P9LA 5E2JA 4GXVH 4JFOA 1T1XA 1WFNA 2OTPA 2O5XL 2X4OB 3L3HB 4ZAKC 4MDJB 1G6RA 4DK3A 4G9DB 1CQYA 3CFJB 3DRTB 3WKNA 1N64L 4OD2B 2DQJH 1AGBB 2ADGB 1EIBA 2VXUH 1HEZA 3RAJL 5EBMB 2OI9C 5HGAA 5ICZA 4U1KB 1WZMA 3SDAA 4ZS6C 4AIXA 4JFEB 5K59F 1GHFH 4R2GC 4LRNL 5IGXL 3EOTL 3Q48A 4QOKA 3N85L 5FK9B 4KGLA 4N0YL 1ORQB 1M4KA 1G7HA 4PIRF 1JGUL 3FN0H 5IVXF 1IGYA 3PHSA 5IM7A 2HTLC 1CXKA 3OKEA 4WFGE 5EB9A 4Q9QL 2JCCB 1A7NL 5AZEL 1LVEA 5HSFA 4HEPG 4LGPB 2Y06L 4HUVA 5TDPB 3QIBB 4JPKH 4GH7B 5H94B 1LP9F 1YEHH 5DVMA 3MLUH 4X99B 3SOBL 3ZYIA 3OG6B 5IJVB 3MLXH 1GGCH 5DK0A 2BOCB 3T0AA 4U6XB 2AK4D 3CFBA 1D5MB 3EJYD 1IAIL 1P4IH 4EUPA 2NR6D 1R24B 3O3EB 1IFHL 3PABA 5IG7B 1I8KB 3GSNL 3PXJA 5LKNA 1QLEL 2PO6C 4M93B 4OBRA 2HRLA 2EDKA 1OB1A 1WIPA 1QYGL 3MTRA 2R29H 5DC9B 4MQTB 2EO9A 3WSQL 1FV1B 1PY9A 5D71L 2F19H 5T1MA 1HH6A 4Y1AE 4LAQL 2FL5A 1IGFH 4FXKA 4OCSH 1T1YB 1X5HA 3MREB 4TTGA 1P9MA 5L7XL 4MMZC 5EUOB 3CXDL 4PJ7B 5ICYA 2ITCB 3IDMA 3IDGB 5F6IB 3W81A 1WC7A 3RWIA 4I2XA 1GPOL 5C6PB 4OGYH 4OF0A 3EZ8A 4QRTA 3F7PC 1M71B 5TE4H 1BVLB 3S6CA 2HVKB 4Y4FC 1IKNA 2F53B 3PGFL 4ISVB 1JNHB 4QCIB 1FL5B 3P4LA 2CKBB 4BQ9A 5DEFB 4YBHA 5D7JB 3FZUC 5T3XL 5FFLA 4NHCL 3S3PA 2VN7A 5K9QI 2X4PB 1RVFH 1UJ3C 3DUSB 3WEXA 4KHTL 1F00I 4HBCH 1SMOA 5HYSG 4HG4K 3ARGA 2L0DA 4I3GA 3BDYH 4U7SA 4WWKD 3RY5A 3NACL 2BNQD 7FABL 2QQQA 3LQAC 4R97B 1QFPA 1DCLA 5GGQL 4Y7MA 4H5SB 4G8GA 1QLFB 3EKCA 3FT4A 2VAAA 4L8DB 2W9EH 4MJ6B 2LTQC 4YHYC 2UYLB 3TBTA 1UM4H 5EU6D 2VLJE 4NJAH 1N5YH 4FZ8H 2PYEE 4XAWH 1VFAA 4HH8A 1IM3B 3MA9H 3CUPB 5T3ZL 3HB3C 1RJLA 3DXAD 3UJJH 3EZJB 2GYSA 5HXMA 4XWOD 2PNDA 3V4UL 5L6YH 4MZ3A 1BOGB 4AH2B 3HE7D 4JRXA 3U1SL 3DROA 4DUVA 1YQ2A 5GSRA 2DQCH 2J8OA 4P5TC 1EXUB 3SCMD 4CRPA 1JPSH 1T22A 1CIUA 4MWFB 4ODUA 4YIQB 3OPZL 3VFTA 1JZ7A 3LSOA 3GM8A 1WCBB 1QSFB 2X1XR 3WJLA 2HKFL 3MV8B 2XQYK 3MA7B 1IAII 1MJ8H 2FHFA 1SVZA 3QUMH 1I7ZB 4R7DA 3CC5B 5IMKB 4N8PA 1AGFA 3LMJL 1FFOA 3HE6D 3S34L 1RZKL 3VXUE 3ZE1F 5FAAA 3WNNA 3F12B 1OAKL 1IQDB 1CIDA 2WBJB 3CFKA 4XNYH 1Z0NA 1IGTB 2B4CC 2Y23A 4HWZB 3FQTB 1PX4A 3DARA 4DW2L 1MEXH 3MYJA 3HZYA 4B50A 2J4WH 4L4VD 1Q94A 4N8VA 3RNQA 1MHHA 4LNVA 1DQJB 1CWVA 1ULVA 1FNGA 1TIUA 3GRWA 4YHNA 3TJHD 4NWTH 5E1HB 4E41D 1RHHA 1X5XA 3SE3C 3MRHB 2R69H 4MJIA 2N7AA 2NY0D 1JE6A 3RP1A 4F9PA 3CMGA 2C9AA 3P4NB 3B9KC 5JA8B 3KPQA 4GQ9H 4JDTL 3VFWA 1SMAA 1CR9L 1YNLL 2NZ9C 4PRDB 1V3JA 4QHLA 3P77B 3VFMB 4APQB 5C0BB 3V6FB 2VR5A 2H6PB 4PJ5E 1OD9A 3SE9L 4X7DC 3FFCD 2XI9A 3BP5B 4JM2A 4PLKD 2QV2A 3F7VA 3R8BB 5FKAB 1OGTA 2A6KA 2VOTA 5TPWL 3Q5TA 4L3EE 4XP5L 4NQCE 2LE9A 1CD0A 5C6TH 3U4EB 2YPKB 4O2FB 4KMTL 3MJ7A 4FP8L 5DURB 5JXED 4JY4A 4DZBB 4MHHI 5MHSE 4PJ9B 3MV9A 3RI5K 1MCPH 1TENA 5E0QA 1R5IB 1BJ1H 3QCUH 4TN9A 1U2HA 1EA9C 2QQLH 3MMEA 1U58A 5EBWA 1A21A 3BN9C 3FQUB 3NCMA 2GUOA 3WS6A 4YUEL 5LGHH 4HIEB 4RAVB 5EO9A 3JV4A 4PPTA 4Y88A 4NM4H 4TPRH 4YPGB 4X6EB 3VXRB 1A1NB 4MCZB 5FYKD 1FSKB 4NUJB 4OGZA 1A3RL 5CP3H 1FYTD 3IVKB 3FRPG 4WDIA 1LO4H 4LOUC 5CJOL 1RI8A 3MV7B 4H25B 4JFXA 4NZUH 5F7NC 3U0WH 1RD6A 3TPKA 5L2JB 2EDNA 3VXSE 1MHPL 4KDVA 4DVRL 1XZ0A 2AJYL 2ICEA 2VZ1A 1KN4H 4HS3B 1D5XA 4LCWA 1QO3B 2XACC 2X4TB 4RWHA 1DLFL 1RIUH 1G7PB 4FQPA 5F72S 1R5WB 1UYWH 2Q8AH 2IH3B 3MPCA 4ONHA 3QEHB 2OTUB 5I1AB 3DSFL 1CXHA 2NMSA 3CX5K 2HJFA 5CSZA 4PB9H 3QO1A 5D7LA 2FEDC 3P11L 3D85D 3MR9A 3DPBA 5TE6L 3S35H 2E8YA 2GITB 4S1RH 3SDAC 2AJSH 4P2RA 3EIFA 1WBYA 2VLRB 2DWDA 4H8WH 4ZOBA 2HT2C 1EHAA 3S4SG 4F7CB 4G7VH 1HHKA 2L4OA 3KR3H 2EXYC 5CINL 4OUUB 3L95B 2B2XL 3TV3H 2X4RB 1YA5A 5JZ7C 3AU1B 5HDOA 4NQEB 5B3NA 1QD0A 2X7LB 1H3GA 3KPPB 1BBJA 3IFLL 4W68A 4JJ5B 3V4PL 3KPMA 5J6GA 1U8LA 5SWQA 1OSPH 4DJMA 2JCCF 3MRFB 1OCWL 4FQCL 5C0IB 3NVQA 3HPJA 3SPVB 3VRIA 5IESH 1NAMH 1XGUB 3BZDA 1RJZA 3OAZK 3ECBA 4HKZA 4JGMA 1FH5H 5F9JB 4BH8A 3IU3A 1FVEB 5EZLB 5H37H 2W0KA 5HVHB 2EH7H 3BHBA 4Y2DA 5JORB 3TNNA 4MDIA 3KPNA 5DMKA 3L5IA 2H8PB 1S9VA 3V6OA 3ES6B 2EXWC 2JIXA 4R8WL 4P23A 1EEQA 1F11B 3GGWA 5D96B 3ARPA 4LVHC 1V05A 4QRQB 4QHKI 4XRCA 5DK2B 5EC1A 4OD1L 1JTOA 3KJ4C 4CAGA 1QVOB 1KTLA 1Y18B 1KV3A 3WHE0 2H9GA 1JRHL 2X4SB 3QEUA 1P9MC 1GOHA 5CILL 1EK3A 3G6DL 4GKZA 2DWEB 1BZ7B 2H1PH 5CJQL 1MQKH 1KCVL 3PQYD 4LASH 4PJAB 2EYTB 5CLWA 5EOCH 4WGWB 4Q6IB 3NCFB 1F6FB 5AZ2L 4ZNCD 1P1ZA 3X14A 3O3AB 1IKNC 1DANU 3BPLB 3K8MA 1W72H 4KI5E 1F6AA 5CGYC 5ALBH 3TZVA 4MJ2A 1N5AA 1HK6A 3RWGB 4P2OB 5BV7H 4RBPK 3E6FB 1AFVH 3NFPA 2R9HD 1INQA 4PJBB 4EI5A 5FGBC 4OFDA 4WU5B 4LLWA 4X7TA 3O6MH 5HDBE 3QWOB 1RZ8B 4ENED 1BBDL 3ARGC 1TJHL 3KPLA 1QA9B 4M6ML 4HKJB 2BY0A 2XWTB 5D7JD 3CSPA 1B0WA 4NQTA 1GJIA 1JHTB 5E8DL 2YA2A 2R0ZH 4Z7WB 2XYCA 4PY8I 4OZIB 3VA6A 5C9JB 3GSXA 4LLAA 1XCTA 1EDQA 3T09A 1ITCA 5JIHA 1MHCB 2XN9E 1FQ9C 3Q6GH 3VG0H 1EEUA 1RZ7H 2IGFH 3I50H 4HK3J 3EGSA 4DTGL 2AV1B 2W65A 3LQAL 3WN5B 4PBXA 1WCQA 1PG7X 4Z7QF 1N0XL 3E3QE 4HIJA 3RTQB 2F58H 3RWFA 4JHBA 4PTTA 2DL2A 5HGHB 3AREB 3VGHA 3TNMB 3A67H 4UUJB 1AXSA 1A6UL 1A6WH 3KYAA 3OX8A 1ND0B 1I7RB 3L9RA 3LKRA 1INDL 4G42A 5SV4A 3RUGA 3P40A 3LV3B 3OKLA 5DT1H 3IJYB 3WJLC 3H7LA 5L2KB 3ILQD 2P47B 2A6IA 2P8LA 4TULH 2DQIH 1NL0H 2EDEA 4PRHA 1ERNA 4BA8A 5J8OA 1LK3L 5J9PA 4K8RD 3QEQA 5C07E 1OAQL 2VUYA 3S37X 4NHUB 1QSFD 3IFPB 3B9AA 1P7KA 2BSED 5JHLL 2ZOLB 4DUXA 4P48A 1RULL 4LHJB 2DQTL 1NGWA 5DJDB 1JRHI 4NNXB 5T3ZE 4CN1A 4IJ3B 3W11C 2WLZA 5FO9A 1BAFL 3CLEH 3BEVA 1QRNB 5ID1B 1BZ9B 1F02I 1A4KA 1J0IA 2B4CL 5I15H 2O26U 3LQMA 4XPBL 3QI9B 1JIBA 3KYNB 5CBAB 3LIZL 3C60A 1TCRA 5LWYL 3X12B 5I1JL 3W0WB 1IGJA 2HP4A 3OJDB 1ACYH 3QQ3A 3T2NL 3T65A 3UTPD 2W0PA 4KJQD 5KSVA 3BGMA 2Z4QB 4R7NA 3IDYB 2MPAL 4JM2C 4XNZB 4AQ1B 2UV3A 1LEIB 2O61B 2QJDA 3UTQA 1MFCL 3L3IB 5BRZB 3NFNB 5D93B 4XC3H 5F7EH 3TIDB 3F62A 3ZE2E 4P3DA 3SBWA 2VRAA 3MRRB 4APQD 2XZQH 4GAFB 4HZLA 5C0BD 1M7IB 1LE9B 4P9HH 1DBAH 1Q72L 3IS0X 3L5XH 1BJ1J 4J1UA 2L7JA 4XXCC 2VABB 1DBJL 4JCMA 3BZFB 2FO4A 3CXHK 4JO2H 3A6BH 5I6XB 1A1MB 3C09B 3PIQB 1A4JB 3R0NA 5DWUH 3PWLA 5DURD 1BZQK 4RGNC 5FYKU 2CJUL 1RU9H 1TPXB 3W9DB 4U1JB 4CKVX 4FQLH 3WS6C 3DVIA 1G9NH 4YWGH 3C5SA 1I1FA 4RCAA 2CUHA 4GKNA 1FO0H 1OP9A 5JHDA 1Z9MA 4HFUL 3RL1A 2QQKL 1ZGLB 1BECA 1FG9C 5I76B 3NN8B 3WUWB 4Z76B 3UC0L 2R56H 5C08E 4MX7A 2VLKA 5CIPH 4PGEA 4M7JH 3BPOC 1BVKA 3KYMB 3ILPB 1MCIA 3G04B 2R0KH 4PGBB 4BUHA 1N7ML 5J11B 1NLBH 3ROOB 4PY7A 3MO1B 3VXRD 4YHZL 3IDJA 3NH7L 3TT1L 1U0QA 4PJXE 5I1HH 3M45A 1K2DB 5TQ2L 12E8L 4ODVH 4EBQH 4GMTL 3ABZA 3MCG1 3VW3H 5CCKL 2IFFH 1FAKT 3G5ZB 4XGZA 4U1GC 4CUCA 3FO1A 3STLA 3RVUD 4ALAH 1P53A 1ZEAL 3MJ8B 5BCAA 1AE6H 4JDVB 4Z78B 1UGNA 1C16B 4ONFL 4I0KA 4F7TA 3S5LA 3DECA 3WNPA 4UBDC 3OAYH 3TBVB 3X13B 2EZ0D 2IPTH 1C5DA 1G7LB 1U3HB 1YJDC 3OJMB 1FDLL 1G6RL 3T3ME 1YMME 4P2QE 4XP6H 2VDLL 3ZT6A 4GRLA 1D5ZA 2OL3H 2YC1B 4WO4C 4JANA 3MOAL 2ZOKA 4CVXB 4S2SA 4MXWH 25C8L 4ZTOL 2VLRD 4JZNA 1RPQA 2CO6B 3EOBB 2R4RL 4HMEA 4OI9A 2F74A 3BH9B 4WTZA 4K7PX 5IEHA 4FNLL 4NO0D 1BWMA 1LK2B 2H32A 5I1CH 1NBZA 4E5XA 4EDWL 2QBWA 4Y16A 2Q7NA 5JW4N 1U92A 1GL4B 5CJ5A 2NW3B 5HHVL 3MLRH 5TFSH 3HI1A 4Y2DC 5SWZE 5IFJA 3V6OC 1K6QH 2H2PD 2ZSWB 1AGEB 2VYRE 2AVGA 4PJ8B 4OM0H 1G7MB 4P23C 5GRUL 4KK5C 5HJ3B 4JVWA 2JB5L 3MNWA 2VDOL 1T0PB 2IMNA 1DVFB 4IOSD 5J4MA 1C12A 1CT8A 1L9NA 1J05B 1GGUA 4K94H 4Y1AB 2KZWA 1ZT7B 1HH9B 4U1LA 5F89A 4GRWE 4PRBB 5CJXA 1FZJB 3PE9A 1RJYA 3QUZA 1F8TH 1HKLL 3PDGA 1ZLSL 3ZE0E 5EOCJ 3S88L 5MEND 5F71A 2YS4A 3OKKA 4Z5RA 4DQOL 2CIIA 2CLRB 4KKAD 3WYRA 4PR5B 3JUZA 4PJAF 1T0MA 1Q9OB 1TZIA 4NKOB 3MXWH 3RBSA 5EU5B 2NZIA 5BW7A 3TZVC 3I9GL 4P5KB 5C0GB 3MRCA 3CPLB 4P9ML 2D2OA 5KJRL 4EI5C 3DVNA 4J4PD 3Q2CA 1EO8H 1H5BA 2R0WL 4CJ0A 1YYMH 5BVJB 1H3PL 1F5WA 4BSVB 1INEH 1A9BA 5E5UB 4EIGB 2WAHA 5HHQA 4Q2ZB 1OGAA 2G2RA 6CGTA 1KLUB 5DRNA 4HJJH 5C2BL 4L3CA 1CGSL 4QGYA 3DO7B 1DJSA 2I07B 4YXHH 5IVZB 3S3SA 1VFMA 3U9PL 3P0VH 4M43H 1U8PA 5D2LA 2WIIB 1EVTC 2CRIA 4Z7WF 1OLZA 2X1OA 3U36B 4OZIF 4E0RA 1F4HA 5DQ9B 5A2FA 2EEDA 5SX4H 3UTSA 1ZHLA 2FECL 1M7DA 1HILB 5EWIL 4HUMB 4JG1H 3O41A 4FXGA 2R2HB 1CL7L 2F8VA 3DETC 5C09A 2VLJB 3B2UC 2Y07H 2C3WA 4A6YB 1NSNH 2XIDA 3TH3T 3KPSE 2PYEB 4MVBC 3D9AL 3QUYD 1LQSR 3IDIB 1J8HE 2NY5H 3REVB 3VXOB 1IEHA 1YEKL 3JWDH 3HFML 4J3OC 3AFLA 3QRFM 1AQDB 2FB4H 3QQ9D 1U9KA 3JWOL 4PGCA 4MD5B 3LAFA 1IJ9A 1H0DB 5FHBH 2VLME 1J87A 1AKJA 5HD8D 1JNNH 4CMMA 3E8UH 3BESR 4RGMB 3BGFC 1LO0H 3KPRA 2NY4B 1S7SA 3HUJF 3JTSB 1NGQH 3MCKA 4X6DA 3BQUB 1I3RA 4FN0A 3HCVA 1B2WL 2Z91B 4PTUB 3O2VL 1S7VA 3VXUB 4OQTL 3WFCH 2FR4A 1A7RL 5SWSE 4UDTA 1OVZA 1M05B 5IB2A 3UYOD 5DUBA 4KJPD 3EOAB 5JW3L 5DFVC 1AY1H 4QXGH 3QDGD 1A9EA 1FNSH 2ZCHH 4G6AC 1D5BA 1UB6B 3E1F1 1FVDB 3RDTD 3TVMB 3AS2A 3GHEH 2FBOJ 3C60C 4MQXC 1KJ3L 4DKFH 2XNAA 3I6LD 4M1CD 4XB8A 2O5ZH 3D0VA 5D2NB 1EFXB 3S36X 1I1CA 5EC2B 1QRND 2IADA 1CF8H 4ZQKB 4YHOL 4OF3A 3NA9L 1U41A 4TUOB 5I30H 4OLXH 3MRIB 1YEIH 3P73A 3QI9D 3LEXA 4DFIA 4PJ5B 2P46B 2IF7A 1VFUA 1UT9A 1DBMH 2HJLA 4OB5L 5CP7A 3SBWC 3PNWB 2EYRA 4YDVB 4NQCB 2V2TA 3KPTA 3MNVA 3CCHB 4BH7A 5I19L 3ZKQD 1RUKL 3N9GH 5E5MB 2J12B 4EVNB 1OAYL 5JPMA 3G6JF 5BRZD 3U79A 3IAGC 1E4XL 5C0CA 3TA3D 3TO2A 5D5ME 3QRGH 3ZKSD 4JPWL 4WEUD 5F88A 4JHAH 4FQIL 1CL7I 1KJ2H 1RY7B 4O9HL 1MAKA 3QA3B 3T0EA 2BSRB 4U31A 5CJ8A 3C8KB 1JGVH 3BEWA 3V6ZA 3VGEA 1DZBA 3TH4T 4OZFB 5E95B 1KXVC 4XNMB 4XCNA 5IROA 1F58L 4GSDL 2NX5E 3ZL4L 3KNBB 4MLIA 4J3UA 5DJ0B 4HH9A 4FMFA 5DRWA 5FECB 3NIDE 4ZOAA 2J5LB 3GK8L 5F96H 3LS4H 3SKUD 1VGEL 2AQ2A 2B8OT 4UNTA 4Z7OF 1J0KA 2O5YL 5ERWA 1MFAL 5CZKA 3U2SA 3TPUA 1U95A 4W70A 1PX3A 4EOWL 1WAAF 1IILE 3PL6A 3VXSB 3BSZH 4WHYG 2HMIC 4FFZH 4U1HB 3QJFA 5DJYB 4KK6D 1FIGH 4JZJB 3RA7H 2VL4A 5J89A 2F5AH 3WFEH 3MROB 1R3KB 4Y0GA 4DN3H 4N9GB 3HNVH 4NQDA 5JOPD 4RFEA 1WIOA 4S10A 3FO9B 1V7NH 1TVBA 3TBSA 2AS5M 3KLAB 4LLYA 3IU4L 5EOQL 1QBBA 3MGOB 4U7KA 5CUSH 2DIJA 4OM1H 4OFKA 2ENYA 4G3YH 3VDAA 4PP1D 1KB5L 3K1DA 1IC5H 3R4DA 3CLFL 1AD9A 2DI8A 4HS6A 4YR6B 5EU3B 4OT1H 4UAOC 4F80A 4RRPG 4GRLC 1AGCB 1SYVA 1NAMA 1YDPA 1PLGL 2W1NA 3KJ6L 2HFGL 2NXYB 4PRAB 2V7NB 3LPWA 2KDGA 5DD1H 1FVCB 3MXVL 1I3UA 1U3HD 2AJXL 1YJDL 2COQA 3GHBL 4GRMA 2NY6B 5F9OH 4H88L 5C3TA 4UTBL 4R96A 3LKNA 3ARFD 4RQQA 2E9JA 1FPTH 1HHGB 3M8OL 1SEBB 2A0LC 1EAPB 5F7MC 5DJ2B 1OTTD 1ZLUH 2B0SL 1DR9A 1YNKL 4ZO7A 3WFHA 2Z0BA 2R0LH 5KSBE 4KTDH 2R39A 1FE8H 2W9DL 1N6UA 5JPNA 3BIKB 4FOMA 4NZTH 4R0LA 4UOW1 5F7DB 1T0NA 4G6FB 3I02A 2FLBT 5DMGC 5CD5D 5EBLB 5FF6B 2XA3A 1KPVB 1BFVL 4K3EH 3NFSL 4XWGL 5FGRA 3QFDA 4YC2C 4P3CH 1T21B 4QWWD 3A0OA 1ZSDA 4ZXBA 3F5WB 4AG4L 4MQ7B 1I4FB 1O0VA 3B9EA 3H42L 4QY8B 2CR3A 4UIKH 2DIBA 2A6DB 1FORL 2YRZA 2ZSVA 4LQFH 5KTEH 4KKBC 4FTVD 1A3LL 2GTWB 4NZJA 1W72A 3QUZC 1ZVSB 4IRSB 1YEFL 2F8OA 1NUFA 1O7SA 1OAZL 1DVFD 1QBLH 3VGFA 5IR1B 3DI3B 4QOKE 3ARXA 1OTUD 2EKJA 3T4YB 3FT3B 5KN5B 4OGXH 1A6ZA 4NNPL 5J12B 3F58L 5F1SA 4K7PY 1JWMA 3GMLA 5BW7C 2IG2H 2VISA 1OARL 2Z8VC 5AYUH 1GZPA 5GZOD 2H45A 1TZHB 1H5BC 4HWEL 2YZ8A 2W9LA 2P49B 2Y5TB 3QDJD 2XY2A 5HPMA 1XGPA 3GMRB 5I71B 4HKBA 4XI5D 4P46B 1QFWL 1HCFX 1N3NA 5I1GH 2J3SA 2P42B 2EH8L 2OJEB 1FBIH 1HHJA 4DKDC 1IBGH 2XPGA 3CZJA 1HXMA 3GB7A 4BSJA 1T66C 3ARDA 4JLRA 2V7HA 3SKJL 3X3GH 4NRXA 4BUGA 5D1QC 2E7HA 3FRPA 2XN9B 4F7MA 1S7RA 5FIEA 4N68A 4NYLB 2A38A 1K4DB 4J3TA 2OSLA 3FL7A 2ICCA 1QRKA 2OX5A 4LCCA 1Y0LB 1PZUB 2VB5A 4QXUH 2GSGB 4S1QH 1NFDA 3GMQB 1KYOK 3TC9A 4U1MB 4BKLA 1JF1A 1IZKA 5DD3L 1P7QB 3RU8L 4FRWA 2QADD 3BRFA 3QBTB 5CS7A 2AAVA 1KEMH 4GAJL 4F2MA 2BCKB 5D8JH 4I77H 1D3CA 2CDGB 3BPNB 4N5UA 4X5WA 3QCTL 4DN4L 4CNIB 4WHYH 2QR0A 2OQJA 4LKXA 4G6MH 5F8RC 5DHVB 3QNYA 4CU8A 3MZTA 4YFEA 5ABDE 3QSKB 1KC5L 2Y1VA 1RUMH 1ZLVH 1KIRB 1WZ1L 1YN7B 1E6OL 5C07B 4WV1A 2KKQA 3NAAL 5EIQA 3VWJA 4ZTPL 3MOQA 1GGIH 5IWLC 2NY4D 5IB1B 5I75B 5E00A 4G8GE 2YSSA 1S9XA 1TZGH 2IH1B 2A73B 1UXWB 3BQUD 1HOCB 1TJIH 4LVOB 1DEEB 4FG6D 3L6FA 2YXMA 2HWZH 1PFCA 3CVHA 4XP4H 4TSCL 1S3KL 3HC3H 4GAYB 3L5WB 2X1PA 4OZGA 3NPSB 2IQ9H 3HLAB 4P4KA 2VDNH 4M61B 3MRKB 2Q7YB 1U3ZA 3ESUF 4QTHA 3OAUH 5IQ9A 5DXWA 1A6VL 5E2VL 1SY6A 1VDGA 1MUJB 4G6KL 1IGCH 4J23A 3H9SA 4X0KA 1DLHA 4KUZH 3H3PL 4OFPA 5BZWA 3RPKA 1ZVYA 4JRXE 1LEGA 2VLLA 5CFHA 5FYKH 3HNTH 4HWBL 5D7SH 5I18H 3TJEL 4K23L 3HAEB 1K4CB 4NCC2 2NXZC 1TQCC 4YO0B 1DFBL 2Y25A 3QZWB 4KY1L 5JDJA 2HKHL 3TH2T 2AJUH 1QFWI 1PDKA 2F8XC 2P8MB 2C1OB 4Q74A 3VJ6A 1IC4H 4XPFH 3OTTA 4PJ5D 4PRPB 2QKIA 2IAND 2NLJA 4KRPB 3QPQD 1T20B 1ODAA 4NQCD 5GZNC 5BZDA 2MHAA 4ZFZB 4LCUB 2IWGA 3NCJL 5DQJB 5HY9A 5FM5O 1S7XA 4D0DA 2R4SL 3T0EC 1UM5H 2V5MA 3SKNA 5CIPA 1SBSL 1A7BA 2VDQL 3N0PB 3WS3A 4K3GA 1MJJB 3IGAB 3R06B 3VGAB 5MHSD 3IJHB 2ENSA 5KANG 1BLNB 3U4BH 9CGTA 4C55A 5HHOA 2Z31A 5TF1H 4NQUA 5GS2D 1DBKH 4P5MB 3RIAF 4MJIE 4XHQA 5C08B 1RV6X 3FB5B 5D70H 4XTRC 4IRJD 1CTOA 3KDMA 1MHEB 1MY5A 2IAMB 1OWRM 3L3JB 3BKJL 3PL6C 4G9FD 3W2DH 1CE6A 4WW2B 4F3FA 2PCPA 4PJXB 4F15C 5EIIA 3V7AG 5KVFL 4Y5XB 2I25N 2G60H 5GGSB 4GG8A 3RAJH 4GXUN 5I8EB 1R3IH 4ZFOA 4QHMB 4QRSA 4GXVL 1ZLWK 5CZXD 4Y4KA 3PWPA 3C5ZA 4XNQA 4H8WC 4LRNH 5ENWA 3RVVC 5I16B 2A74A 3WNKA 4L4TA 4XBGA 3U0TB 4XAKE 1MCHA 3MV9E 4TUJA 4DAGH 3UEZA 4PLJD 2DQJL 1UWXK 3FRUA 4N5EC 1KJMB 4H1LB 1HHHB 3LKPB 4OCWH 1T04A 4Y8AA 4F7EA 1JUFB 4RGNE 5B39A 3OR6A 3MRNB 1GHFL 3GJFK 3FO2A 1ZS8B 1X7QB 3C87A 1N0LA 1YMMB 4P2QB 5DUPH 4AK1A 5C0EA 1LE5B 4R90H 4XX1E 4PG9B 3CK0H 4K7FB 1I9JH 3C08H 3FN0L 5BXFB 2VERN 1MLBB 2WM0A 5DRXA 5KSAA 3I6KB 3U0PB 1ZWIA 3EHBD 3BWUC 4JPKL 4MJ4A 1WBXB 1YEHL 3MLUL 4A2LA 3MLXL 4DEPB 5DJ6B 1FFPA 3MGTB 4NO3B 5IK3A 2IPUG 4OI7A 1CDYA 2OXGA 3N06B 3PWNB 4MXVE 2VQTA 15C8H 3RL2B 4YBLB 4LCWE 2CGRH 5D71H 3BE1L 1P4IL 3QUXD 3OKMB 2HLFC 4R0LC 2NY3C 3PJSA 1NGXB 5I8CA 1JYWA 2LQRA 3DJ9A 5L8KB 4I48A 4OV5A 1CZ8H 3U9UB 2R29L 4Z7UA 5EO0A 1GPOH 2CKBH 4NDMB 4PV8B 2F19L 2KQNA 4N8CH 5D7LE 4ZAKB 3F6LA 3W5MA 5H2BA 1IGFL 3FQXB 3BN3B 2APWA 4OCSL 2I60H 1JPFB 4M7LT 3PGFH 2A9NH 1WWBX 4N9OB 4P2RE 3IJSB 2OI9B 3NTCH 4GRWB 4YE4L 1XCQB 2RJMA 4J3SA 3O9WA 4C58B 4GW5A 3N1MC 1NCBH 5BV7C 2EDOA 2L7UA 5IFAL 1EGJH 1BP3B 4HDIB 1W2KT 5GGVH 4PUBH 3VWKA 4BSWB 1J88A 3MUJA 4PREA 1ETZA 5FA4A 5TE4L 4BFEA 2P4AB 3MCLH 1QPXA 3K81A 1A2YA 5IIEA 5L0QB 1RVFL 3NCCB 1T03H 1TTGA 4LLVA 1NBYB 1CDJA 5L88H 1CICA 2G5BA 4LPXA 4HBCL 5J1AA 1MCNA 1DTUA 1QSZA 1YY8A 3BDYL 1F2XK 2EE9A 2E27H 3K1KC 4Z0XA 5DYOB 4NFBA 1DANT 2IEPA 2FJGA 1E4WH 2AJ3B 5D6CB 3LEYH 4HGWA 3V6OE 1A22B 4QRUA 4K8RH 4EEEA 4ZUUA 2FIKB 3ARDC 3RWDA 3KWWA 3V4UH 2PO6B 1U8JA 2W9EL 2CIKA 2ED9A 3SGKC 4MNQA 1UM4L 1C7SA 4NJAL 1SQ2N 1N5YL 4FZ8L 1FFNB 5AG9A 4XAWL 4UU9A 1N2RA 5E99H 4LCCC 1WITA 3U7AA 2XTJD 5I1KH 3HR5B 2AABH 3KPSB 3UJJL 5IJKA 1NFIB 5C70A 5L6YL 4NQXA 5CEXA 1IL1A 5F1IA 1DN2A 4B41A 1J8HB 3Q6FB 5FDWB 2XN9D 3IKCA 2NNAA 3TWCH 3UYPA 1MIEH 1UH4A 2DQCL 3BP6B 3GSWB 1I1RA 3CDFA 1JPSL 2BNRA 3S34H 5ACLA 3X11A 5BVPH 2EDFA 1U8QB 3L3GB 3T3PF 1G7IA 4JY6B 4KKCD 2D0HA 4Y4FB 2CD0A 1XH3B 2PW1B 1A1OB 1P7QD 3CU1A 1JZ6A 1U3JA 1MJ8L 2BFVH 3MX0A 3QUML 1JPGA 4JPVH 2FBJH 1F4WH 3QXWA 1UJ3B 3VI4F 3B83A 5D7KD 1FN4B 1T3FB 4WV1C 2ICWB 3MJ6A 4NFDA 1YY9D 2C3VB 3VWJC 5JIIA 4XNYL 3WUZA 8FABB 4LEOA 4LSRH 4P99A 3D2UA 3MRDA 4M6AA 5E8OB 5HVFB 1QHPA 5IB5B 3C6SB 5SWSB 3UMTA 5ELIA 3G08A 1AR1C 1R3LB 3RWHA 1ACZA 4UT9H 4Q58C 2J4WL 2UVEA 3LQZB 5DHYB 3IDUA 1ZV5A 1CR9H 3STZA 3EYFB 5C07D 1NEZA 3RX5A 5LGJA 2X1QA 4MLSA 4YHYB 2HJKB 1Z5LA 3DX6A 2R69L 5IW3A 2EYSA 3VFOA 2ARJQ 1MCQA 3MJ9H 3F7YB 4PJFF 3RZCD 2OR7A 3A6CH 4GQ9L 5E94A 1WK0A 4BJLA 1BQSA 1GGTA 1MCJA 3BKYH 4ZO6A 1DQQB 1FG2A 4PJCA 1M1SA 3WIFB 5EFIB 3RUGE 4P5TB 1I8MB 3FO0H 4OAWB 2X9WA 4S0SD 5C0RL 2QHRH 3ZLQC 2FWOA 4EKXA 4PRHE 2WANA 1I8LA 3ZE2F 4TSAH 4G8EA 3C6LB 1HSBA 4HKXB 3QEQE 2B1AL 2V2WB 1JNJA 1G9NC 4JFPA 1DE4B 4LKCB 4OZHF 5I0DA 4CADB 1MCPL 4FQ2H 2HVJA 1CXEA 3BD4A 1T7ZA 5JXAL 2YD1A 4NCC1 5D5MB 2QQLL 4KVNH 2PKDA 4O2CB 4JO1H 3UBXB 5DEGA 1PYWB 5E6IC 3IAQA 4W81A 4OTXH 5LGHL 4PRPD 4L9DA 4QT5A 1FJ1B 4HIIB 5FUOH 4NM4L 3KAAA 3L7FB 4D9QE 1MELA 2Z31C 2B1HH 3DUUB 5DTFB 3DYMA 1GGBH 5JO5B 1A7QH 2X4QA 1LO4L 4L29B 1QEWA 1EEZA 4NN6C 2Q6WA 1OP5H 1A7OH 3WLWC 1HSAB 4MA7H 4JAMA 3U0WL 3W82A 2X89D 1KBGH 5JDSB 5ITFB 4AM0A 5EDXA 1MFEH 2R1YB 5T1KB 1QACA 4XBPB 1XIWB 3W9EA 5F7UA 3C5JB 3B6SB 5C0FA 4WW2F 1X5LA 3BXNA 2AK4A 5C08D 1DDHB 3QO0A 1RIUL 2BSTB 1LP9A 3OKOA 5GGTH 2IAMD 5IW6A 3UPRA 3QIWA 1UYWL 4NNYB 1CBVH 1EO5A 2Q8AL 3SDDD 2FO1A 4Y4KC 4M48H 2GJJA 4LARH 2PYFB 1BFOB 4PB9L 5CINH 5SX5K 1S7TB 3D3VD 4WFED 4Q6YA 2GSIA 1MVUB 3QG6A 2XRAH 3S35L 4S1RL 4G7YH 1MRCH 2AJSL 3VA2C 1OF2B 4MB5A 4C4KO 4H8WL 1UJTA 4XH2A 1KCSH 4FQCH 3CH1B 3DBXB 5C86A 2X70B 4G7VL 5DD0H 4I13B 1HZHH 5JHDE 4KC3B 5GRXG 3RIFK 1T1ZA 3TV3L 1Y6MR 3C8HA 1DSFH 4ETQB 3HC0A 1FP5A 5E4IA 4LU5H 2B7DT 4LHUD 3IRZA 1A3QA 1W0YT 5KSAC 1NC2A 2VLKE 5DI8A 5FYJE 1S5IH 4R26L 5D7IA 1OSPL 1D5IH 5ETUA 5FCSH 4GLRH 3H0TB 5IESL 1YMMD 1NAML 5AWNH 5F44A 2ZNWA 2A83A 1HYRC 3MRPB 3D69A 3VD7A 4X6FA 1XR8B 5I2IB 5KSBB 3MFGB 2P5WD 3GJFB 1YUHB 2EH7L 4KZDL 4L8SA 5HVWA 4K94C 5HI4D 3WUWG 3PGCB 3OXRB 5E2TH 4Q9CA 1A6TA 5J06A 5CILH 3P9LB 3FAWA 3JXAA 3ELAT 5BMFH 1GXEA 4JFOB 2C3GA 1T1XB 1VACA 5EU6A 3UTZA 3HZKA 3CD4A 1G6RB 1UG9A 3WFBH 4RAUA 5AZ2H 3VMOA 4Y5VA 2GJ6D 2WINB 1MJ7H 2GAZA 4YK4C 4KK8C 1HEZB 3DXAA 5ICZB 5HGAB 3O9WC 3SDAB 4GRWF 4LNRA 2H1PL 2FHBA 2CDFA 2EIBA 1MQKL 2AK1L 3ALWA 4LASL 3WXVH 1W8NA 5EOCL 3SCMA 3BIBX 3ZKND 2EDDA 5C0AA 5AAMA 3OMZA 1G7HB 1TJHH 3ALXA 1URLA 1W72L 3DRQB 2OJZL 3MSPA 4OKVA 1IGYB 1CG9B 3SKOA 5BV7L 1GOFA 2NW2A 1CGUA 2RFXA 3OKEB 2H3NB 4PRNA 1AFVL 2CDEA 1VFOA 5E8DH 3G6AA 4UT6H 4HUVB 2PXYD 1CICC 1JI2A 3HE6A 4Q97A 4YXLH 3IETA 5B8CA 1CLOH 3ARBB 3TEUA 1F90H 4FFWD 1UH2A 5DK0B 1CGWA 1S9YA 4JKWA 2BHZA 3RVWC 4Q7DA 4XB7A 3CFBB 4EUPB 4PB0H 1HIMH 3I75A 5ESVA 1J11A 2R0ZL 5FYLE 3GMPA 5J1TC 4KJWC 3GSOA 3PABB 4ZSOA 1T1WA 5B3JE 2IFGA 2ZUSA 3EOYG 1ZA3A 3SQOH 3V6BR 4FQJH 5DJZA 2NY5C 1OB1B 5EBGA 3VG0L 2FGWH 1RZ7L 3B9VA 3I50L 4RSVA 3JWDC 3OG4B 1WVZA 2WWKT 4LVHB 5T1MB 2Y7QA 1HH6B 1PG7L 2HT3D 2FL5B 2UWEB 3U6RA 1H3TA 1TITA 2VDKH 1XGRA 4FXKB 3OB0H 3VD3A 1HDMA 4JQXC 3KJ4B 4JFFB 3VXNA 5IJKC 4L3EA 4ZYKB 4K3DH 5BS0D 1S7UA 2FX7H 2W91A 5ICYB 3IDMB 5B38A 3A67L 2HT4C 3RWIB 1A6WL 4I2XB 3FFCA 4QRTB 1VPOH 3TLRA 2HA1A 4OFYD 5DT1L 2VZSA 1VB9A 4UMGA 3U30B 4YX2H 2VDPH 4Z0BH 1NL0L 2YD5A 4QO1A 3SO3C 2ZUWA 3G5XA 2UUDK 1D9KA 3RVTC 3TCLA 1B88A 5GGRA 4NBZB 4KTYA 3WEXB 3S37L 1J10A 1OGAE 2P5EA 3NCYP 2DDQH 3GJEA 1MAMH 4RIRA 1JPTL 4IIQA 3ARGB 5ICXA 2BVQA 1PG7W 5D2LE 2X42A 1MNUH 4MD4A 2UZXB 2DL9A 3BZ4A 3UTSE 3T2NH 5EUKA 1PEZA 3E6HA 3EO0A 3ZKXC 4KDTA 3FT4B 2VAAB 4LSDA 5EZIH 3WCYA 4OLVH 4JRYA 3E0GA 1KULA 3TBTB 4LF3A 4XCYA 5C09E 5I15L 3BZEA 3MBED 3VFRA 1H3VA 1FYTA 2YUWA 5TE7H 3QXAA 1KELH 2F15A 1VFAB 3JTTA 1EJ6A 1RJLB 1ACYL 4HMDA 2DTMH 2V9QA 1MRDL 2ATKA 5DZOA 5HHMD 4JRXB 3QXUA 3DROB 5GSRB 3FTGA 2VO5A 1CD8A 5I1IH 2AJVL 1T22B 3SN6N 1JFQL 2N7BA 4XC3L 2Q3ZA 4ODUB 5F7EL 3HB3D 3VFTB 3BH8A 3LSOB 1P5VA 1VFBA 3O0RH 4QHKJ 4CMHB 2XZQL 3ZT5A 3KPRE 4MQSB 2VC2H 4P9HL 3V0WH 1DBAL 4R7DB 3L5XL 4X6DE 1MCEA 4P5TD 1FFOB 4CL7A 4LSUH 1ZHKA 4URTB 3O45A 3QP3A 4HFUH 2K9UA 2QQKH 4JO2L 3A6BL 1OWWA 3CFKB 5DWUL 4O5LH 2BY3A 1RU9L 3C6LD 1G9NL 1JI1A 3L5HA 3EFFA 3MYJB 5HGBA 4YWGL 3HZYB 4YXKH 2AI0H 4LHQB 4N8VB 5M95B 3RNQB 1FO0L 4YHZH 1MHHB 4HUXA 1FNGB 4X7FC 3ULVL 2Z8RA 4XZUA 4YHNB 1KPRA 2R56L 1RHHB 3LRSA 4WEBH 3O4LB 3MACH 2Z35A 1K8IA 4MJIB 3ULUL 5CCKH 1JYNA 3VRJA 4NN7C 2BVEA 3KPQB 4UNUA 2ADFH 3FQNA 3O3DA 5CJBA 5I1HL 4QHLB 1KGCE 5F9AC 1ZEAH 3UO1H 5FUZL 4ODVL 4EBQL 4IHOA 1L4IA 5HI5C 4JM2B 2NR6C 1OHQA 3F7VB 3VW3L 1DQDH 2IFFL 3K8LA 1OGTB 2A6KB 4M6NH 5LBSH 3EYOA 4MA8H 1AHWA 2BOCA 3AUVA 3HRZA 4NT6A 5GRVL 4ALAL 1XIWD 3RVXD 3MJ7B 4U6XA 4KAQH 4FXLA 4JY4B 1AE6L 1P84J 1S8DA 3QWRD 2JTDA 1RIVL 5C2UB 3WIIH 5IBTH 4CU7A 3MV9B 3DNKA 1Q9KA 1I85A 2YA1A 4RMQA 1BQHA 5FGCE 2IPTL 1REIA 3T0EE 3E2HC 1AO7A 4O4YH 4Q9RH 3MMEB 4PJEF 5EBWB 3RJQB 1FV1A 4XP6L 4FNLH 2UY6A 4HT1H 2GUOB 2OL3L 2CO7B 3GSNA 3PQYA 5IMMA 5I1DA 2VXSL 5EO9B 4ACPA 3JV4B 3MREA 3QG7H 3SGDI 4MXWL 1TVHA 4Y19D 4JE4B 4D8PA 3GBNH 5E6YA 4DUWA 1YECH 4XP9H 4WDIB 4K7PL 3BPOB 3T77A 4JFXB 1MI5D 3LEVH 2NCMA 5I1CL 2AQ1A 4WTWA 2HVKA 1CVRA 1HYSD 2P44B 1WJ3A 1JNHA 1P69B 4OZFG 4WWKC 1XZ0B 1WFUA 2MJWA 2ICEB 1ONQA 3MLRL 3D48R 5TFSL 1NMCC 4L8SC 1U8IA 1D5XB 2V5TA 4LCWB 3B5HA 5JQ6H 4PJIA 2A6JA 5FV1L 4L9LA 4NO5A 3PWJA 5I8KH 1K6QL 1EX0A 4UB0H 4FQXD 2JK5A 4OM0L 1FGVH 4U1GB 4NQDE 4FQHA 4ONHB 4MNGB 3DI2B 4X4YA 1NGPH 4XVTH 1MPAH 1DP0A 4K94L 5CSZB 3F7RA 5JW4M 3QO1B 5D7LB 2R1XA 2J8UF 4HK0A 3REWA 1KEGH 2I9TA 5CKGA 2GQHA 1FNFA 4WFHE 3I9GH 2AXGA 4XWOC 4NIKB 2C1PA 4WFFD 1F8TL 4WEMB 4P2RB 3HE7C 1WBYB 5KVEL 1KENH 2DWDB 1EO7A 1NUGA 2R0WH 1MFBL 2YN5A 2G9HA 2CXGA 1HHKB 3SCMC 4S1SH 3SHSA 1B6DA 1ZHBA 3MXWL 3QDMD 1QNZL 2DN7A 5ESQA 1G6VK 4LPUA 3IFNH 1BBJB 3KPMB 4WRLA 1U8LB 5J6GB 1ORSA 5SWQB 1EO8L 3RWCA 1YYML 2E5EA 4KDWA 3I2CH 1IGIL 3HPJB 3HE6C 1INEL 5AEAA 3VRIB 3RGVA 1RJZB 4B53A 5B8CC 3ECBB 1BGXH 4MWFA 4HKZB 4HJJL 4BH8B 1QSFA 3IU3B 3F65A 3RBGA 4XNUH 1NGYA 1CL7H 5GRYA 5HVGB 4YXHL 5DJ8A 3BHBB 1HWHB 4M43L 4Y2DB 4LLUA 2NY7H 5IMKA 3FN9A 3TNNB 4MDIB 3D5OF 3KPNB 5DMKB 3CAFA 4BFGA 1S9VB 2YBRA 1XF3A 3ARBD 3TO4A 2H2SD 2XQBH 2JIXB 3VRLE 4P23B 2VR4A 4GBXA 3GGWB 4JG1L 3TJHC 1NQBA 3WNOA 4XVUD 5E08H 2GEEA 2Y07L 2ZUTA 2YD6A 4XRCB 1NSNL 4QHUA 5EC1B 2G75A 3JWOH 2NY0C 1SM3H 2UWEF 3O6FB 1KTLB 2H9GB 3H7BA 4FQQB 2NY5L 2F9BT 4GKZB 4M8QA 3AB0C 4JY5H 2RQ8A 5HPOA 5EIVA 1JZ8A 3DOSA 3JWDL 2DRUA 2NY1B 4UDUA 3UZQA 5D1XA 2FB4L 4PLKC 1CDBA 4RX4A 2ZUQC 3T4AA 3MLSH 4JFFD 1P1ZB 1CD1A 3H9YA 2IQAA 5J13B 1KNOA 1BF8A 1MQ8A 1F6AB 1JNNL 4HJGA 1IM9A 3E8UL 3TZVB 1OL0A 1N5AB 1LO0L 1AC0A 2H6PA 4V2CB 1GC1H 1INQB 1NGQL 1NCNA 4LLWB 4UOW0 2PTTA 4Y4HA 3WFCL 3AS3A 3KPLB 3MODH 3VI3E 3BGAA 4YBQD 3ZDZE 1AY1L 3MJ9A 4QXGL 3GSXB 2DI9A 1OT2A 1XCTB 4M03A 1I9RH 4KDTC 4MSWA 4X7SH 1FNSL 2ZCHL 1Z9OA 5B4MD 3GHEL 3EGSB 1CD9B 4QHNA 2W65B 3KS0H 1FFQA 3VFUA 5E2UH 2QSVA 1U8OA 1JGEA 3IRPX 4U6YA 1NFDE 2O5ZL 4HIJB 3RWFB 4BFBD 1WSST 4PTTB 1CF8L 1QPPA 3RWJA 3OKYA 2CPCA 1YEIL 5GS2H 3AXLB 2ED7A 1AXSB 1U8KA 4PJHA 3OX8B 3LKRB 1I1AD 5E6ZA 4G42B 3RUGB 1XGTA 5A43C 1DBML 3OKLB 4PGDA 3HG1D 4OZFH 1KT2A 4M1DH 3VFPA 5KS9F 2A6IB 2P8LB 2XV6B 4JRXD 5JW4Q 4PRHB 3BGFB 4PRID 4F37F 3N9GL 5J9PB 2RAMA 3QEQB 1FNAA 1UZ8A 5JQHC 1CU4H 2NY2D 3CGTA 3QRGL 4JHAL 5DFTA 2GCYA 1P7KB 3NIGE 1F58H 1KJ2L 2K7PA 2IH3A 5LG1A 3QNZA 4JPIA 5I1AA 1F3RB 1J0JA 1NGWB 1JGVL 1VGEH 4HIHA 4HBQA 5FO9B 4EOWH 3FB8A 4OZGE 1A4KB 2GITA 2R2BB 4JR9H 2VLRA 5FM8A 4WVRA 4D0BA 2XKUA 3C60B 1TCRB 2JF1A 5F96L 3LS4L 4DZ8A 4M3KB 4NO0A 4OLUH 5HHNA 3H9SE 5GGTA 3W11D 1IGJB 4AYFA 3QQ3B 1GAFH 3ULVF 3T65B 1RZJL 4JZOA 5TQ0H 4TRPH 3BSZL 5KSVB 5CEZE 3BGMB 4R7NB 4ZPTA 1QR4A 4FFZL 3O4LD 3LKOA 2ZG1A 3ULUF 4ZS7H 3RA7L 1CFTA 2F5AL 2WW8A 2DQUH 3SPVA 3UTQB 3ULVD 1KB5H 3WFEL 3G5YA 1AHWC 4JCLA 4P3DB 5DMYA 5EG6C 2V2XA 1EH9A 4MNHA 1HNGA 2ITDA 2EC8A 4N90D 3SDXF 2JB6A 4HZLB 1V7NL 1DEDA 3ULUD 1CYGA 2HLAA 2I9LA 3HAEG 4J1UB 3UAJD 4OM1L 4KH2A 3O81A 4FFYH 1I85C 4G3YL 2HFGH 2WZPD 4M93C 2FO4B 1IC5L 3QZWG 2YUVA 3RY4A 4BZYA 3GHBH 4UTBH 3PWLB 5MENA 3FAXA 5IHZA 1T6VN 4UTAL 1CFBA 3WE6A 1QSEA 4I3RH 3FCTA 2W60A 4JFDA 3C5SB 1I1FB 1QVOA 5HHOE 4GKNB 4JKLA 5JHDB 4NKDA 3RL1B 1IEBA 32C2A 5CWSA 3WV0A 5F9OL 5CKAA 3MLYL 2Z8WC 2VLKB 4J4PA 2R9HC 1VERA 4PGEB 1FPTL 5JOFA 1BVKB 2OP4H 5KVMC 5TDNA 1ZHNB 1KTKE 4ZD3H 2R0LL 3NGBB 4N0CD 4PY7B 4KTDL 5MEQA 4ENEC 3IDJB 1AP2A 1FE8L 1TMCB 5F9WC 2I27N 3VG9C 3HTLX 3DWTA 1Y6NR 5D7JC 4NZTL 4IOFD 4X9IA 4L9LC 1MRFH 3BPCA 3CDGA 3DSNA 4K3EL 1CE1H 4XGZB 3HPLA 5J6HA 3STLB 1KPUA 3PWPE 3GM0A 4P3CL 1JHLH 1OAZH 4WI8A 3U7YH 4KRLB 4L4TE 4R97C 4F7TB 5ADOH 2BMKA 4UIKL 3UJTH 4LQFL 5KTEL 5HI3D 3QUYA 4M62H 2QSQA 1OARH 4IMLA 4EQ3A 1C5DB 4JRWA 3VXMD 1QBLL 4KV5F 1IKFH 1MJUL 3P0YL 1HQRA 4UAOB 4GRLB 5D7LD 1D5ZB 3TM6A 5IB4B 1SJHA 2OXHA 4LQ1A 5EOTB 1A02N 4JANB 3UJIH 5DGQA 5J3HD 2IG2L 2ZOKB 4S2SB 3ILQC 5DLMH 2C4FU 4P2RD 3FT2A 4H1LG 3RHWF 5AYUL 4JZNB 2VDRH 4KRNA 2F74B 3EYUH 4K8RC 5IEHB 1X9QA 1U8NA 2H32B 3GI8H 4YDIH 3TBWA 1NBZB 5A3ID 4E5XB 1MCFA 4Y16B 4MAYD 4RMVA 1U92B 4OLYL 4HHAB 5I1GL 4FMKA 3HI1B 1RK0A 3HUJA 3PWUB 1FBIL 2D7NA 5IFJB 1IBGL 4N0FA 4J2XA 2X44D 4UQ2A 2UZIH 1S9WA 3I3DA 3QDGA 4Z7UE 3X3GL 2EC9T 2Q86A 4GBXC 1HXYA 4YC2B 3MNWB 3RDTA 1EFQA 3Q5OA 5DHVH 1C12B 4EDXA 3NIFE 1CT8B 4LGRB 5JLZB 1RIHL 3IB4A 4AENA 3QCTH 4DN4H 4QXUL 4S1QL 4U1LB 5F89B 1UENA 4P57A 1T83C 1RJYB 3IF1B 3DMMD 3L3KA 4KJQC 3QUZB 1YYLH 5I66A 1DQML 3OKKB 5D1XC 4Z5RB 1KEML 1RUAH 2CIIB 5GS1A 5D8JL 1E6OH 3O6FD 1T0MB 5IQ7H 7CGTA 1IVLA 1TZIB 3RX7A 3OJDA 4AMKH 2MTPA 1ITBB 1TNMA 3MRCB 2ICES 5DUMH 2Z4QA 2P45B 1F4AA 2NY1D 3DVNB 5JMRA 4HPYH 2VIRA 1DN0A 1H5BB 3GUTA 5T33L 5T1LD 1RUML 1FNHA 2FNBA 4J12A 3RRQA 2D7MA 1A9BB 1IEAA 3NFNA 3GMNA 1HINH 5HHQB 5HDLA 3TA3A 1OGAB 2G2RB 5DRNB 1JWSA 1HHIA 4TNWF 2DAVA 1AGDA 1U8PB 5D2LB 4RISH 2Y6SD 5E2VH 4ZNEA 1TZGL 3G6JA 4G6KH 1CLYL 3B9KA 4E0RB 3DO3A 2KH2B 4MNQE 3UTSB 2HWZL 3KS0J 1ZHLB 4XP4L 3HC3L 1M7DB 2QSCL 4PGZA 1OTSD 1QTYT 3O41B 1T4KA 2IQ9L 1V3LA 2VDNL 4FXGB 5F3HA 3SDCD 5C09B 2A9MH 3OV6A 2JJVA 3OAUL 1UKQA 5FCUH 2DQDH 3SE8H 2FSEA 4KUZL 4Z7NF 1JHKH 5FYKL 3HNTL 5B22A 5I18L 4NC2B 5DK3A 3IKKA 4JB9L 2BNRE 3LCYA 3LB6D 4UV4H 3GNML 2LU7A 3BT2H 1CGXA 2ADJA 5DQDH 3RUGF 4PGCB 3UX9B 2AJUL 3IDNA 1WAAA 3RVUC 5GRWA 1AKJB 2R1WA 2Q8BH 4CMMB 4KROB 4OF6A 4YNYA 4XNXH 3K74B 4XPFL 1S7SB 1CFNA 3AVEA 3MCKB 3SJVD 3WNMA 1KIQA 4X6DB 5DFWH 1GSMA 1I3RB 3HCVB 4KQ3H 1S7VB 2EZ0C 1XFPA 4UDTB 3MC0A 4PRHD 3MLWL 4OJFH 1PBYA 5IB2B 2P43B 5DUBB 1SJEA 4Z78A 4LEXH 2ARJA 3U4BL 2K7QA 5TF1L 3MRMA 1A9EB 1D5BB 1U3HA 4K9EH 1DBKL 4MZ2A 4RMSA 3LOWA 3ARFA 5E7FA 4I0PD 5D70L 5E4EC 3RKDD 1ZK9A 2XNAB 5FB8A 2YC1A 1NC4D 3FQRB 3V0VA 3D0VB 3SGJC 5EZOH 4H1LH 4PJCE 2IADB 2DMCA 3W2DL 4I0CC 3G5VA 3PUCA 4G6AD 5GGRY 1UM6H 3P73B 1AH1A 3LEXB 5IMLA 5HYEA 4HPOH 2G60L 2NXZB 1TQCB 3EYVA 1IAKA 3KPOA 2HJLB 5CP7B 1R3IL 4YEEA 1FZKB 2EYRB 4AT6B 2V2TB 4BH7B 1WFOA 4QLRA 1YC7A 4LSPL 1F4XH 4IOIA 4DAGL 2XICA 3ISWA 1JV5A 5JPMB 3T0XA 5D72H 3D0LB 4OCWL 5C0CB 3TO2B 3V79C 4B0MM 5F88B 4FTVA 4K2UH 3O11A 3KXFB 5HJ3A 5D96C 1I3GH 5FGCB 4O51A 1DVFA 3T0EB 4GXUM 1J05A 4KKAC 5DUPL 2VNCA 3BEWB 4Q0XH 3V6ZB 4R90L 3BD3A 3CK0L 4KMLB 1I9JL 3C08L 1WQVT 3OAYK 1SYSA 4Z7VF 1T2JA 3BE1H 4NZRH 4XCNB 5IHBA 2R8SH 5D4QA 4J4PC 4HH9B 4PD4J 2V9RA 2BOBA 4CGTA 3UBXG 4PR5A 1UH3A 3QDJA 2W59A 3QULA 5ERWB 4XCCH 3JV0A 3U2SB 3TPUB 1U95B 15C8L 2ID5A 4GRWH 3ORJA 2CGRL 4TTDD 2AK4E 3PL6B 4LAJH 5DD5H 4J6RH 4HC1H 1RFDH 2VLKD 3ESVF 4I18A 5FYJD 1LP9E 3QJFB 5C7XL 1LDPH 1MFDH 1HKFA 1MLCA 1L6ZA 4RNRA 4U6TA 3MNZA 4YE4H 1CZ8L 1UC6A 1CN4A 1R5VA 5IFAH 2CKBL 2DB8A 2F54D 4NQDB 1ED3A 4RFEB 3UPCA 1TVBB 4N8CL 3TBSB 5ILTH 4WTXA 4LLYB 4O2EA 2GW5A 3AAZA 2I60L 2ORBL 2ZG2A 3LN9A 3QUYC 2A9NL 3HS0A 5HHXH 2DM3A 4JKKA 4RZCA 3NTCL 3GSQA 2AEPH 1LWRA 1NCBL 3CMOH 5JW5A 1EGJL 1AD9B 5C0ND 5GGVL 5BJTA 2A77H 4HS6B 4PUBL 5FGBA 1SYVB 4WUUD 1B90A 3QQ9C 1NAMB 4U1NA 4ELMA 1YDPB 3CFCH 2MCPH 3V9FA 1EUUA 5D7IE 3MCLL 4Z8FH 3VXOA 4GRMB 3QQ4A 4I9WD 2C7UA 1YQVH 4R96B 5EU4A 3LKNB 4RQQB 4XMLH 1T03L 3QJHB 2WQRA 4UIMA 5L88L 4LLDA 4ODSH 3WFHB 4MD5A 4WY7L 5TF0A 1KFAL 2BHUA 5H35A 2E27L 5GGUA 4UQ3A 1LO5A 2BNQE 4OKDA 4OIAA 4XPGL 3D18A 4ZO8A 4YGVA 5JPNB 4HEME 1E4WL 3LEYL 4HUWA 4R0LB 2NY3B 4KJPC 3JTSA 4K8RL 1T0NB 3I02B 1UVQA 2Z91A 4PTUA 1X4ZA 4Y16D 5EU6E 1TLKA 3QFDB 3RDTC 1ZSDB 4ZXBB 5IT2H 1A0QH 5BOZG 3ZTNH 3EAKA 1CLZH 2RIKA 3SE4C 3O6KH 5E99L 1UKTA 4HXAH 4NRYA 2LAGB 5FYLD 3DXAE 4M1CC 4PJGF 4DFHA 5I1KL 2AABL 2ZSVB 4OQTA 4QF1A 2J6EL 3GKWH 3KLHD 1W72B 4NOFA 1F13A 3U46A 3TWCL 5IF0A 1VCAA 1BHGA 1MIEL 3QI9C 5BV7B 4OF7A 3B5GA 3WO3B 5GS1C 5C0AE 5BVPL 4X9HA 1KLFA 1OT1A 2VSCA 1II4E 2VAJA 1A6ZB 5D2NA 5HHPA 1T2QH 3N1QC 1JWMB 3GMLB 2VISB 3GSUA 3MOBH 4ZQKA 5KZCB 3QUZD 5DVLA 5IOPA 4ODHH 3F8UB 4XCEA 3DV6B 2BFVL 3QIUD 2NTSP 1GZPB 4JPVL 1QKZL 2FBJL 4R4BB 1F4WL 4HUNB 1XGPB 3TA3C 2IANA 4HKBB 1NDMA 4NQVA 4QRRD 4LSRL 5L9DH 1KCRH 1ZTXH 2MQCA 1N3NB 3DX7A 2W0LA 4KU1A 3WLBA 4ZSOE 4GG6A 3GDBA 4UT9L 3D39A 4B7IA 1HHJB 5D2LF 4LMQI 2XPGB 4XMPH 1HXMB 3GB7B 1FYHB 3VE0A 2VXQH 3ARDB 4JLRB 1OGAD 2V7HB 4HF5H 4NRXB 1MVFA 4X6CA 4F7MB 1S7RB 2HRPH 4WHTA 4DK6A 1TPXC 2XXCB 4XVSL 5DRZA 3B2VH 3C8KA 3MJ9L 4EUPG 2OSLB 1X4XA 5C0RH 4IRJA 3A6CL 4LCCB 2YKLH 1NFDB 2AP2A 3K8KA 3BKYL 1JF1B 4BKLB 1YNTA 4L4JA 4JN2A 1G9MH 3VFGH 4G9FA 5ITBH 3FFCE 2B1AH 5D1ZD 5C0DA 1FNLA 2LU3A 3WDIA 5FHAH 5FV2A 4XXCA 4KK6C 1VKXA 3FO0L 1CVSC 4F2MB 3QPXH 5T1DH 3S3JA 5LJYH 5JXAH 5J11C 4KZEH 5DMIH 4X5WB 3PGDA 2QHRL 4M5YH 1KN2H 1JGDA 3QFJA 2QR0B 1CI5A 3WIHH 2OQJB 4TSAL 4LKXB 1UCBL 4QYOA 1UKSA 4U3HA 3QNYB 5FO7A 2E9BA 2P5EE 5KAQG 2NYYD 2BY2A 2DLFL 2DS4A 5IP4A 4FQ2L 4D2NA 4DGVH 4WV1B 2Z92A 5GXBB 3VWJB 4GUPA 1AKJD 1WWCA 2VXVH 2ZNXA 3M17B 4D9RD 4KVNL 3FMGH 4KROD 4V1DB 4NC0B 1Q0XH 4JO1L 2Q20A 5IBLD 5KANI 4IS6B 5IB3A 1WT5A 4OTXL 2YSSB 1S9XB 5FUOL 4LCYA 3PDDA 4JRYE 1A6PA 2B1HL 4NN5B 4PJDF 5GJTH 3CVHB 1GGBL 1A7QL 1U3HC 4PG2A 1FYTE 4C56D 4OZGB 4P4KB 4X80H 3ARFC 1W8OA 1VEOA 4QTHB 1A7OL 4MA7L 5IQ9B 1PW3A 1AGCA 1OTTC 4G80A 1C7TA 4MA1C 1KBGL 1KB5A 4P4RA 1UACH 3H9SB 1MFEL 4X0KB 1DLHB 5BZWB 1I8IA 4MXQD 2WK2A 4PRAA 1LEGB 2VLLB 4JFQA 43C9A 3CZFA 2EE6A 5I1LA 3QUXA 4K3JH 2VSDA 5GGTL 5DJ2A 3VFNA 5CD5C 1CDGA 1CBVL 3IYLW 5FM4A 4ZOEA 2GY5A 1CLCA 4M48L 3MLPA 4QWWC 4LARL 1JZ5A 4LLMA 2XG4A 3KVQA 3BIKA 2DQHH 1IC7H 3K4ZA 4WO4A 3PV6A 3GMOA 3HN3A 4M5ZH 2QKIB 3M1BA 2XRAL 2NLJB 4G7YL 4JFED 1MRCL 4XXDA 4NKMB 5BZDB 2MHAB 1T7VA 4XVJH 4R26H 5HY9B 5GGSY 1S7XB 1KCSL 3VU2A 1DVFC 2DM2A 4HJ0D 4D0DB 3S8WA 4ODXA 3SKNB 5CIPB 5DD0L 3OF6D 1OTUC 2ADIA 1HZHL 1RZFH 4QY8A 4U4BA 1IC1A 1NAKL 5I17A 1DSFL 4GJTB 2DIAA 5C0CD 4LU5L 4JGUA 5HHOB 3KXFD 2Z31B 4NQSA 4KZDH 5GZND 2X9XA 1S5IL 5GZOC 4L5FH 1D5IL 1BOYA 4LFHD 1IAMA 3QIBD 4M4RA 3LKSB 4NN6B 1LEKA 5AWNL 2PW2A 2Z93A 1NDGA 5FYJU 2OK0L 4LPYA 4ORGA 4ZUSA 3KDMB 2FRGP 4A2MA 4N8VG 1QOKA 2AV7A 4WCYH 4XI5C 1CE6B 4F3FB 2PCPB 4GW1A 2YD8A 4I18C 1LNUA 5F21B 5EIIB 5E2TL 1B0GA 5I8OH 4XTRD 1RK1A 2HN7A 4GG8B 1ZLUK 4OCRH 4TVPL 4ZFOB 5EUOF 3L1OH 1JTTA 1YEGH 4PJ7F 4QRSB 5BMFL 3MRLA 4Y4KB 3C5ZB 4XNQB 2AK1H 2BJMH 5ENWB 3BP7A 3WFBL 2A74B 4L4TB 4XBGB 3JV5A 4TUJB 4P49A 3PWVA 4ERSH 1MJ7L 4M02A 4NOBA 2BY1A 2OJZH 3FRUB 1T04B 1N8ZA 1AO7E 2VH5L 2WSKA 4F7EB 1FL6A 2QADC 5B39B 3OR6B 2PR4H 4CVUA 1VESA 3QXDA 3VGBA 3FO2B 3PQYE 4EUPH 4PYHA 1V3KA 4D94A 4H20H 3WXVL 1TQBB 1K4DA 1C8PA 5C0EB 2F53D 2BX5A 3ZDXE 5DRXB 2BC4A 4JO4H 3UTTA 1OY3B 2RR3A 2AQ3A 4UT6L 2JJTA 1WTGT 2JELH 4YXLL 1CLOL 4BQBA 1F90L 2CDGA 5IK3B 1FFPB 3BUYA 5E8EA 5K93A 3CFDA 1DUZA 4XX1G 1PG7H 4PJIE 2NY4C 4PB0L 1HIML 3DV4A 1AXIB 4ORZC 3PJSB 1GRWA 5I8CB 4C54A 1WTLA 4UINL 3JWOC 5DO2D 5DEZA 1L7TH 3SQOL 3BQUC 3VFSA 3OR7A 4FQJL 4FG6C 4I48B 4OV5B 1SEQH 2FGWL 4Z7UB 5T3XE 5EO0B 1H15A 4XMKL 1PQZA 2ICWJ 1WZKA 2NY3D 5H2BB 2F5BH 2VDKL 2GHWB 3P9WB 2BSSA 3LVEA 3FFDA 3RZCA 1HNFA 3C2AH 3P9MA 4K3DL 4YK4B 2FX7L 2I26N 4OQ1A 4GT7A 1NJ9A 3O9WB 1OP3K 4GW5B 3BRDA 4GLRI 1GC1C 4ZXBD 1J5OH 4M61A 1VPOL 2YPVH 1I7UA 3VWKB 2CLZB 3S37H 4PJFA 1QP1A 3EJZD 5DDHA 5FA4B 1QR1A 3PHOA 5D2NC 1JPTH 3MV8D 3H6JA 4YX2L 2VDPL 4Z0BL 1EMTH 3T1FA 2O93L 3WL9A 5IIEB 4O58H 4X98B 4LLVB 4U6HA 3V4VH 1CICB 2G5BB 1CFQA 5TDOA 2DDQL 1QSFE 1MAML 2WBJD 4I5BA 1MCCA 5J1AB 3QPQC 1BX2B 3PP3H 5K9KA 4HWBA 5KZCD 5CGTA 4Z0XB 1PZ5B 1MNUL 2ZCLH 1DBBH 2C1OA 1H8OA 3JV6A 2FJGB 4OZHA 1CCZA 5HYQA 4QRUB 1AIFA 1VHPA 2XA8H 4ZUUB 1ZLVK 3RWDB 3KWWB 1MRDH 3SGDH 5M94B 5EZIL 1U8JB 2P48B 2CIKB 4OLVL 1JPST 4MNQB 2UY7A 2VL5A 1XEDA 4J3VA 3DVGA 1OQXA 5TE7L 2YEZA 3KGRA 2AJVH 5HGDA 1KELL 3TIEA 1JFQH 1G0DA 4UU9B 1N2RB 4L1DA 4IRJC 2XWBA 5C0JA 3UTPE 2DTML 4NQXB 5CEXB 1IL1B 5F1IB 2DKSA 2EDTA 4NKQB 3IKCB 2NNAB 1BIHA 1XAUA 3KYOA 4YDJA 4JN1L 4LSVH 2OCFD 3KLDA 1I9IH 3TFKD 4TNVK 5I1IL 5I0ZA 1J1PH 3X11B 3V52H 2IAMA 2ZP0T 2V5YA 1G7IB 5L8JB 4WNQA 3O0RL 4QXTA 5EH1A 3SDDA 3GRWH 5CZXC 2VC2L 2FX9H 3V0WL 1VSCA 1JPGB 4PJ9D 2R23A 4LSUL 2D4DA 2CLVA 3D3VA 3ULVH 4N1CA 1FL3A 4K71C 1AD0A 2UVFA 4LEOB 4O5LL 4HGMA 3D2UB 3FQWA 3MRDB 3TN0A 2V5SA 4LPWA 3G08B 3ULUH 1WT5C 5ACZA 4YXKL 2DJ4A 2AI0L 3OXSA 4YHKH 1RZIA 4F57H 4F58H 4ODBD 3STZB 5JW4R 3M07A 3K2MC 1NEZB 3ZKXB 4LHUA 3K80A 5LGJB 3VH8A 5GHWH 4PG2C 5FUZH 1C1EH 4V1DD 4LL9A 1FRGH 1Z5LB 3DX6B 4WEBL 3MV7D 3ULSA 3MACL 4WU7A 5DJCA 1AR1D 2EYSB 3VFOB 4JQVA 3EHBC 1EAJA 2ERJB 4WIQA 5IW1A 5E94B 4BYHA 4PG9A 1ZAGA 2ADFL 1JF6A 3NCBB 1KCLA 1FG2B 1MLBA 1UQSB 4PJCB 3UO1L 4PJHE 1J1XH 4GS7C 6FABH 2IBGA 2P5WA 4LP4A 4P4KD 3QUXC 1RIVH 4CBPA 4HLZG 1A7PL 2YXFA 4C83A 3GSRB 1DQDL 2BZDA 1T7WA 1E27A 4M6NL 5LBSL 4MA8L 4WI5A 3DX8A 2HG5A 2FWOB 4NSKA 5KOMC 5EZJA 4O02H 4KAQL 4HAFA 4G8EB 5CEZD 4LLQA 1HSBB 3EJJX 4JJHA 2VXSH 4JFPB 4MA3A 1YPZA 3WIIL 5IBTL 2VZ3A 1YEEH 1Z0MA 2GJ6A 4POZD 4I3SL 5FKPA 2HVJB 5INDA 1QFUL 2YD7A 5DHXB 3ZHDA 4O4YL 4Q9RL 2BHYA 4K7PH 5DEGB 1TETL 4HT1L 1CFSA 3BYTA 3WMSA 4QT5B 2QEJA 1X6NA 3QG7L 3BD5A 3BI9X 2X6MA 4NQED 5DR5H 4BQCA 1F97A 5SV3A 2VLRE 3PHQA 2GFBA 3IS1X 3GBNL 1KSRA 4JM4L 1YECL 4HC1A 4XP9L 2X4QB 1QEWB 1EEZB 1MCKA 3G9VA 3H3KA 2Q6WB 4XHJD 4PS4H 2PXYA 3LEVL 4JAMB 5BO1H 4NN7B 5J12C 4LCIH 4AM0B 2DJUA 3VD4A 3W9EB 2OLDA 5C0FB 4YFDB 3BXNB 5JQ6L 2AK4B 3K4DA 4YAQA 3ZTJG 3QO0B 4Y5YA 1LP9B 5I8KL 3OKOB 4UB0L 3WLWD 2GT9A 4C59B 5IW6B 2DKMA 5I71C 4X9FA 1FGVL 3QIWB 3UPRB 3DTXA 3O4OC 4ZDHA 4KKLD 5KVEH 4JFHE 2DJSA 1MFBH 1NGPL 4XVTL 1MPAL 3U48A 1FCGA 2CKNA 4RFOH 2ZPKL 3S98A 4NFCA 2XKNA 1KEGL 4GKSA 2GSIB 2XTJC 4HSQA 1QNZH 4J8RA 5BS0A 4WI6A 1UA6H 3VFVB 2HFFA 5MENE 1KENL 3C5ZD 1HQ4A 1QSEE 3E2HB 4PJBF 4XH2B 4JFDE 5ID0A 1F3JA 1IGIH 5I74B 1WWAX 1QBAA 43CAA 4S1SL 4TVPD 5CBEA 3DGCR 1T1ZB 3HC0B 1EEYA 4KKCC 2YK1H 4P2OD 3MLTA 3NOIA 1HCVA 1NC2B 3IFNL 5DI8B 5D7IB 3C2SA 2JJTC 4WGVB 3I2CL 3BWAA 2DD8H 5K9OA 1BGXL 1MWAH 2A83B 3VCLB 1JN6A 3D69B 5D1QA 3JVGC 4GW4A 4X6FB 3ROLA 4XNUL 3J7HA 3INUH 1Q1JH 5I1EH 3SGEI 4L8SB 4NPYB 2NY7L 1PSKH 2E6QA 1TJGH 1A6TB 2DMBA 4H26A 2XQBL 1JP5A 4TYUA 3QUMA 1VACB 5EU6B 5E08L 3FN3A 3BO8A 3MBEA 3UTZB 3HZKB 5I75C 2OR9H 3EO9H 4NUGH 4OZIE 3RTQD 2MQ3A 2YWYA 1SM3L 4RAUB 1FLRL 4TVSa 4Y5VB 3RZCC 3RKPA 4LVOC 2GAZB 2VQ1A 3ARED 1E6JH 3EYFA 2DMKA 3DXAB 3K3QA 4LBEA 1I1YA 4JY5L 4LNRB 3MRQA 1S7WA 3MLVH 2R2CA 2CDFB 3ZSTA 2J88L 3QWQB 2EE3A 2OS7A 5KG9A 3SCMB 3MLSL 5C0AB 3OKNA 5L2KD 3V5KA 3GMMB 4U33A 4PFEA 1H3UA 4KK8D 4X8JA 2VR9A 3OB8A 4HXBH 4OKVB 3SKOB 2NW2B 5IWLA 2RFXB 5JUEH 4TUKH 3U7WH 1GC1L 4PRNB 1T2XA 5DJXB 1F4YH 3VWKD 3G6AB 4M9OA 3TT3L 2AW2A 3QDHA 3HE6B 3BJLA 3IETB 5B8CB 4QTIH 1S9YB 1RUQH 2ZJSH 2YD2A 3TYFA 3HUJE 3FB7A 2ZUYA 3LN5A 3MODL 3U83A 3C6LA 2AJZA 3N1PC 3I75B 5ESVB 1N6VA 3GMPB 1ES0A 3S36H 3GSOB 2X5PA 4ZSOB 1T1WB 4FHBD 3QDGE 1ZA3B 3BKCH 4WTZG 1I9RL 3DX9A 5DJZB 1JYXA 2JJUA 1PD6A 4X7SL 4EXKA 1UWGL 4PV9A 5GS0L 2Y7QB 3LHPH 1A6AA 5E2UL 2EDQA 3U6RB 1XGRB 1GGYA 2N4IA 3W0WD 1HDMB 2NY0B 4WUKH 3VXNB 4L3EB 2D31A 3WD5H 4MNQD 4AIZA 3VD9A 3AB0B 3QEGH 5B38B 2ZKHH 4ZFFA 2VITA 3FFCB 3EO1A 3ZHKA 2IAMC 2MSPA 3SDYH 3SDDC 4M1DL 5DVOA 5TGBA 5CP3A 1XIWA 3BW9B 4WW2C 3ZTJH 5EO1A 3G5XB 3ARUA 3IDXH 1D9KB 3TCLB 5GGRB 3CFEA 4EJ1C 5BRZE 3RNKA 2FEEI 1CU4L 1EHXA 2P5EB 3DLQR 3OQ3B 5HYJA 5BQ7B 2J8HA 3GJEB 4NNYA 4RIRB 1G7JA 2WUCL 4IIQB 5ICXB 2BVQB 4K9EC 3TN0C 2Q76B 2XZZA 4MD4B 4ZNEE 3G6JE 2IC2A 3RI5F 5HYSA 1DQLH 1YN6A 3QUKB 3BZ4B 1IMHC 1JL8A 5EUKB 4B7LA 3VGDA 1BD2A 1RZJH 3E6HB 3EO0B 4KGJA 3QNXB 3D25A 4JRYB 4POUB 1WIUA 3MRBA 3D2UD 2IBBA 4LF3B 4XCYB 4JR9L 4Y19A 4PJEA 3BZEB 2WP3O 4NO2A 5A1AA 5ISZA 3VFRB 4JQVC 4ODWA 1AI1H 3QXAB 4OLUL 1MI5A 3JTTB 4AL8L 1IAOA 4ETQA 1GAFL 5TQ0L 2ATKB 4TRPL 5A2LH 1CK0H 1WICA