5D1XB

Isdb neat2 bound by d4-30
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
217
structure length
212
Chain Sequence
QVQLVQSGSEVKKPGSSVTLSCKASGDTFNTHTYSWVRQAPGQRLEWIGGIMPIFAASKSAPHLQDRLTITANKATRTAYMELTSLTSDDSGVYYCARDGRGALQYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D4-30 Light Chain
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 30
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1xB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1xB01
4FQLL 4GUPB 3H9HA 4QCIA 1C7TA 4I4WB 5KSBE 1T5WB 3EOTL 4MA1C 3EOYG 3SKMA 1NGPH 1A3RL 3PHOA 2DB8A 2BXYA 2HT3C 3H3PL 4U1HB 4R26L 3KLHD 4Z8FL 1UH2A 1SHMA 3VFSB 3MPCA 2WBJA 5F8RC 4OT1H 3WNPA 1A7RH 1AQDB 3VXOB 4XPHL 2EXYC 1MQ8A 4LK4A 4YDIL 5EU6E 3VXTA 1HHGA 4U4BA 5JW3H 1P5VA 3OJDA 1IGFH 5JW5A 2DBJA 2UZXB 2J6EA 1LO0H 1S7WA 5FF6B 4NZRH 1RIHH 1A7QL 1CE6B 1OAUH 3BD5A 4ZPTA 3FN0H 3AM8A 1I9EA 2QHRH 3MCKB 3ZDXE 2QQKL 3CDGA 2R56H 4WFHD 5CP7A 4ELMA 3MV9D 4RA0C 3G6JB 5EORH 3SPVB 1JYXA 3HAEH 4FFVC 3JWOL 2AJ3B 4ODHL 5DSCB 3V0VA 3RWFA 3L3OB 4JAMB 5D6DC 5IT2L 2LE9A 2LU4A 3JZ7A 1P69B 5D7IA 1PSKL 3R4DA 1NL0L 3ES6B 5T1KA 4GT7A 3D3VD 3MO1B 3HZKA 1QEWB 1DN0A 4JN2A 1KFAH 3WIHH 1LEGA 4KZDL 3HLAB 3LIZL 3VXPB 3GBNH 5LXGL 1AGFA 5KN5A 1JV5B 2VC2L 2D4DA 5C0IB 3ZKQD 2WBKA 2W38A 3MROA 4R6UA 2H1PL 5F7KC 4F9PC 2F54E 2BFVL 5ENWA 2VXTH 2Q1EA 4NZTL 5HHNA 3WLBA 3MFFA 4X99B 4WUUE 3FB8B 1TVBB 5D2LB 3U46A 4EOWL 2I60H 1P4LB 1EEZA 3QWQB 4S2SB 2NW2B 3WN5C 5MERB 2PYEA 1RUAL 4B53A 1BOGA 2Q86B 1TIUA 3KWWA 5BS0D 1S7SB 1CFQB 4ALAH 3EJJX 3GMLA 1JE6A 3B9KA 4OD2B 3ULVF 4URTB 3QCTH 3PWNA 4U2ZA 3TBSA 1LEKA 3T8XB 4JKKA 2RFXA 4ZUVA 1MCPL 1GGIH 1U95A 5SWZD 1OW0C 3V5DA 1YYML 2FEDD 4X5LA 4WW2F 3IJHA 3NTCL 3F12B 4Z7WA 5GRVK 1UM6L 4O9HH 3HRZA 1CLZL 4LEXH 4WEBL 5IJVA 1R5IB 2IBZX 4NNPH 2VTFA 2E9IA 5IBTL 2X4UB 2LABA 3GJFB 1ZLWH 1RUML 5I18L 2HVKB 3I2CL 5J0BA 1OSPH 4CVUA 3QNYA 1S9WB 1MH5A 2E27H 1NFIA 4DQOH 3LY6A 3SCMC 5J06A 1A7NL 5F88B 1PYWB 2AJYH 4QXGH 3SGDI 2NY1C 5EOQH 4I3GA 5AYUL 4NRZB 3MLPA 3QUML 5HI3C 1HWHB 4RMWA 3MACL 4I3SL 1ZT1B 4Z77B 5HD8C 4YHZH 3MBEA 1YEHH 1HQ4B 1K6QL 1NBQA 1CD0A 4XNZC 2X9WA 1BLNA 2F5AL 3O6LL 3CFJB 4GKSA 3IKKA 3ELAT 3S5LA 3CFKB 3D9AH 1M6OB 1SJVA 3BO8B 4N68A 1MPAL 2PETA 5F3HB 4LASL 5ESAB 4HIIA 2FDBP 4LIQE 1Q1JL 4M62H 4JR9L 4KJQD 2VL5A 4U1JB 4OTXH 3MODH 4BZ1H 2VABA 4QHMB 1NAMB 1S7RA 3RGHA 3ZE0F 3NFPB 3DGGB 4NHUB 4ONFH 2A38A 5FYJE 1UVQA 3FB5A 2MTPA 1PZUB 3D69B 4RFNC 1X5IA 3MRFA 1PW3A 3H3BC 3KPNB 2NY7H 5KW9H 2DQUL 4Z7VB 4MCZA 3KYOB 1WFTA 4X6CE 4QRRA 3ZYIA 2ZUYA 3D0LA 2GTWB 4U2YA 2QTEA 5FGSA 2A73B 2F5BL 2JJSC 1AQKL 2DQHH 5T5NF 2F58H 3SDYH 4WO4C 5F7HA 2IAMD 4UQ2A 3G5YB 5F21B 1NSNH 3QZWG 5GZNC 5EDXA 1A6ZB 3SDXE 3QDGA 2R1WB 3TBWB 2YBRB 1BM3L 1MI5A 5CCKH 4NNYB 2JIXD 1IM9B 1DVFB 4R4BB 2MHAB 3KXFA 1CG9B 4MZ2A 3QJHB 4CKVX 5LGJB 5L8LB 5D9SA 1MIEH 4HF5L 4OZFG 2PXYD 3K74B 1KCVH 1XF5A 3BE1H 2JJWA 1OP3H 4F7MA 1XCTB 4M61B 1XIWB 1F4XH 3RDTC 1GH7A 3CFBA 4JREC 1JNLL 3ZT6A 5KVEH 2HH0H 2VSDA 5EU5A 1K2DB 1AO7E 5C0BA 1AR1D 1IT9H 1NBZA 5HI5D 1R0AH 5DURB 5E5UB 2L4OA 3BP4B 4HJ0D 3BRFA 1UJ3C 3VG9C 1IGIH 4WHCA 3HPJB 3H9SB 4NN6B 3UTSE 4P4KD 1I85A 5LQBL 4MQ7B 1EGJA 5DQJB 3GSXB 1ZK9A 3DV4B 4HFUL 1GGCL 3W5NA 2YXMA 3I85A 1T0MB 4XMLH 3S35L 1HZHH 2Q3ZA 2HMID 5F71A 2DL9A 2H8PB 3TT3H 4F57H 2VLRB 4Z7NE 2C1OB 1CXFA 5CJBA 4M5YL 4M7JH 3RVVD 3HE7C 3EFFB 1RULH 5HPOA 3U36A 4CBPA 1ACZA 2VE6B 1JPSL 1RIVH 1TNNA 5ALBH 5F7DB 4YXKH 5T3ZD 4PY8I 1A1MA 3IDYB 5EPMA 3QUZA 1IC7L 1BJ1H 4AIZB 1U8NB 1ZS8A 4PJHE 1DBKH 5C0EA 1EPFA 1RJYB 1XGPB 3FN3A 3BKJL 1YA5A 3MRGB 3S4SG 2ZKHH 1EIBA 4OI8A 3ILPB 4N9GB 1JGDA 2BC4A 4Z7QE 4M1GL 4JO4H 3TT1H 4DKEH 5GISL 4PRHB 5FYJH 3N1FC 4NHCH 1I1RA 4R2GB 1CS6A 2Z0BA 2CKBB 4D0DA 1NDGA 2X4RB 1XR9A 3VXSE 1EHLH 3VFMA 4HKZA 1LP9A 6CGTA 3VG0L 3KPPA 3EDJA 3QWOB 4JKWA 1U92A 1T7ZA 3RWCB 1G84A 5AZ2H 4U33A 4UV7H 5DD3H 3RL2A 12E8H 3WE6B 4GBXD 2G60L 4AL8L 4GG8A 1KJVB 3QNZA 3TC9A 5DHVB 4MMZC 4PJ9C 3DSFL 4XHQA 1VACB 4K3JL 3TZVD 4KH2A 1HOCB 1R5WA 1ZSDA 5HYFA 1OSZA 4JJ5A 5GS1A 4LVHC 3D0VA 4QF1A 3CFCH 4CADA 2BNRD 2FZ3B 4Y4FD 5CJXA 2A6IB 4M7LH 4AYFA 4KTDH 1CLOH 2NY3C 3BD4A 1NBYA 4XPFL 3ET9F 3RUGE 2MOVA 4JY6B 4E0RA 4DFHA 3A67L 2ICEB 1FORL 4XAWH 1YMMA 1OY3B 2YUVA 2XI9A 2YA1A 4OIAA 2ERJC 4ZSOA 1WAAF 1EAPB 2DWEA 3ZL4H 2JJVA 4L4TE 4ELKA 1M71B 3REWB 5E56A 3MRPB 3VGFA 4PP1C 3BSZL 2CO6B 1LE5B 1AGDB 2X44D 4UDUA 4HWZA 4I1NB 5F70A 3FFDA 3FOMA 3FFCB 2GYSA 2J12B 1KC5H 5H37H 4JLRA 1DEEA 3CC5A 1YEKH 4GLRH 5D1XD 3JTSA 3WD5L 2BSRB 1ND0B 1X5YA 2F53A 4ELME 1UCTA 3I02A 5DVMA 4GAYA 4WI5A 3E6HB 1S7TA 4NN7B 4XB8A 3G5ZA 5FGBC 4AEIL 5I8CA 4K9EH 1XH3A 4FTVA 5FA4B 3BXNA 4K55A 4OFDA 1KGCD 4EQ3A 5D7IE 2VXQL 1KCLA 3IS0X 4XMPL 1OQOA 4J3TA 1K85A 3LHPL 3I84A 4L9LC 1Z9LA 1BQLL 3IGAB 1LK3L 5IHLB 5ICZB 4NCC2 3A6OA 4MYWB 1URLA 1V05A 4U0RC 5IVXE 1R3KB 4KI5E 5CEYA 2ICWJ 2HJKB 4OGAC 5I1GH 2HFEB 3VJ6A 5DD5L 3ARFC 4CMHB 2XYCA 4U6VL 1U8QB 4QOKD 5D1QC 2BY3A 4KI5C 1U91B 2R1YA 1BF8A 1FVDB 4PRIB 4XVJH 5C0FB 5DGQA 2PF6A 4KAQH 1S7XA 1SEQH 1U8KB 3MTRA 5IB3A 1C8PA 1IEAA 3P0VH 3R06B 3KPLA 5EIIB 3MC0A 4JG1H 5TDOA 5E2TH 3PGCB 3FQNA 3TBTB 4I0CC 2UZIL 5EUKA 5DJYA 5ADOH 4WW1B 5D96C 4LGPB 3UJIL 5I9QC 4IRSB 4LKCA 1G6RH 2E7MA 5DLMH 1IGYA 4G7VH 5F7WC 3G5XB 1DBAL 2F19H 4KK6D 4LVEA 1J8HD 1OAYL 5C86A 1OTUD 2OI9C 5ACZB 1MCWW 1P6AB 2CLZB 1AGCA 2MCPL 1NANH 1QO3A 3KDMB 1A22B 4O00A 2DBLL 5HHOA 2XKNA 4M1CC 4YHNB 2FGWL 3X14B 3BYYA 1CDJA 3QUXB 4P48A 1U42A 4XP4H 5T33L 4Q9QH 3EO0A 5LWYH 4Z7WE 4KK8D 2R29H 5CEZE 1I7RA 3P4MA 2R2EA 4LPTA 1IL1A 4NC1E 2D3VA 5E00B 4QGYA 3V4PL 4DKDC 4PLKD 5ICYA 5ID0B 1UWGH 4TOYH 4NC1C 5D72L 3VGBA 4N5UA 3T4YA 3ZT5A 5JMRA 1RAMA 3EO9H 5K9JL 4U1GC 3LB6D 5JR1H 2AVGA 4P59H 4PJGA 2J6EH 1DUZA 1YNKL 3Q2CA 5INCA 4HZLA 3TWCL 3SE3C 5CHNA 1IAKB 4JY5L 1M7DA 4K3DH 3V6ZA 3VRJB 1MFAL 4PGCA 2VIRA 5BZWB 5E1AB 4CDHA 5IV2B 4IDLA 4POUB 1JZ2A 5FCSH 5E6IA 4PREA 3NPSC 2YC1B 2CDFB 3MRIA 3WEXA 4G43B 3S7GA 3OPZL 2ARJQ 3FJTA 1NAKL 2GUOB 2VXUH 5DO2D 1NCAL 4EVNB 3WFCL 4KU1A 1ADQA 3FO2A 4AENB 4PLJC 2JCCF 5DJAB 5TFSH 5DS8B 1N0LA 4UILL 3MJ9L 3NIDF 3ARRA 2R39A 5GRYA 1ZEAL 4N8VB 5E9DE 5I71C 1LK2B 4OM1L 5FYLD 1G9ML 1R3HA 2Z8WC 4HUUA 4OAWA 5IOPB 1X5XA 1HH6A 1A6AA 3T2OA 4R90L 3RZCD 5F8QC 4DFIA 5DGRA 4U1NB 1B0GA 2VH5H 4WWKD 3DVNA 3ARDD 1YMHA 2FX8H 3VXUD 3WFBH 4QRRE 3FO0H 3HAEB 4XVTL 5C0CA 1GIGL 4FQXD 4NFBA 4P99A 4FG6C 3QULB 1KLGA 1A6TA 2XFXB 1V7NH 2Y9RT 3K3QA 1U3HD 2NY5C 2P24B 4Q6IA 4K07A 1CFBA 3X11A 2HKHH 2D9QB 2H9GB 2HVJA 1EBAA 4L8CA 1AJ7L 4W81A 1DP0A 4KK5D 2UWEF 5C09D 4UIKL 2IPUK 4LCUA 4P5TA 4PGEA 3IXTB 4MQSB 2EH8L 3ZHDA 1CN4A 1S7UB 1MIMH 3RWDA 5BV7C 1MI5E 4HV8B 4OBRA 3ZO0A 5I76B 3KXFE 2VN7A 4MNHB 4CVXA 5CEZH 1JHKH 1W2KT 3ZKXB 4CAGA 4GSDL 4JRYA 1F90L 3NZHL 4P4RA 4PGDB 3DX9B 2DLIA 5SV4A 1QRKA 4YQXH 1T20A 4M03A 5CBEB 5H94B 1IGCH 3NABL 3RA7H 3JV4A 4I18B 1D6EB 4MVBC 1QFWM 5C0AD 3T0EA 3IYLW 1TJHH 2D03L 1H15A 2FJGB 3VXRA 1EVTC 3QIWA 1FBIH 1JPTH 3LQZA 2A83B 3C6LA 2R0ZH 4PRBA 5GZOD 1N64H 3TYFB 1HIML 5J6GB 3C5ZB 1EO8H 2D7OA 3LS5L 3B3IA 5E8NB 1WEJL 5K93A 4GKNB 1XGYH 3MMEA 2XKSA 4JPIB 2YMXH 2XZCH 1ZLSH 4H0GA 3OZ9H 3MXVH 4JFFB 3MOAL 4JFZH 2EIDA 5IFHL 3PG2A 1PEWA 3LV3B 4TNVF 5JW4R 1HXMA 5KSBB 1B6DA 3GSRA 3O9WA 2HT3D 3DURB 3FCTB 3IXAA 1JGLL 3IB4A 2GAZA 3KJ6L 1NMBH 4NM8L 4P9HH 3VD4A 2VDKL 5ANMA 5IK3A 1FFOB 4DGIH 4HWEH 3C60C 3U7AA 4LLWA 1RY7B 1YJDL 4M4PA 4JG0L 2EXYD 3L1OL 3QIBA 1TJGH 2VJXA 1NUGA 2B5IB 2JCCB 5E2WH 4RRPG 4G6AC 1YEJH 1BX2A 3MRRA 5EU6D 4HWBL 4M6AA 3P30H 1HHKA 5IHUL 1HE7A 4OLUL 4XCNB 3O3BB 1DBJL 3HI5H 5EUOF 1PX3A 3OV6A 3BP5B 4Y5XA 1Q9OB 4TUJB 5DWUH 3UYPA 2GFBB 1E28A 4FFVD 1BZ9A 2VLLB 2I9LB 3MNWA 4O02H 1NGYA 1J0JA 1H8NA 3VFVA 4YDJB 3DTXB 3U6RA 4JM2F 4BQ9A 3EJZC 4PJIA 2N56A 4JDVA 3FTGB 5CGMA 2AJSL 5LCVL 3STLA 2KDGA 5KSUA 4G80A 4KQ4L 1G7MB 3TCLB 1BZQK 5TH2A 1CICC 3H42L 2AK1L 4FXKB 3SY0B 2Y5TB 4LLYA 5GHWH 5B8CB 4M43H 5I1KL 4JZJA 4HMCA 1CQYA 4NNXB 1FE8H 3CLFH 4H5SA 4MA8H 2QKIA 3DOSA 2GHWB 2YSSA 4PGJA 4H25B 2F54B 2DYPB 3PQYA 1Q0XL 3H0TA 1JWMB 1MCRA 3QUYC 5FEBA 3P0YL 2DYPD 2ARWA 4G9DA 5BMFL 2LAAA 3FQTB 5D7LE 2DMKA 4WUUD 3S3JA 5A2IH 1A64A 4BSWA 3O3DA 1LHZA 2F53E 4X6FB 5BZDA 4D9LL 1WICA 5KANG 4Q9CA 1I1CA 3LN5A 4XPAL 5BW7A 1EGJH 1P84K 1HCVA 2LVEA 4M93C 4E5XA 1XCQA 3Q5TA 4FTVE 4J4PA 4JFOB 3EBAA 1XR8A 2EYRA 5D7JA 4DCQA 3ROOB 1GHFH 2X4PA 4OKDA 4OCRH 2RBLA 1J12A 4Q2ZB 5FV2A 3RVWC 5DUPH 1KEGL 5F97E 5F1KC 3QEUA 3MLZH 3MLYL 1X5AA 5GRUH 3SDAA 3V0AC 1K4CA 5CKAA 1F3JB 2M2DA 1CGSL 1ACYH 5DUML 3UJJL 3DYMA 3QG7L 5CD5C 2R8SL 2QBWA 3NAAL 4G6KH 3DX6B 4C56D 4X7SH 1J0YA 2B20A 2VZOA 5MEPA 3SCMB 1E6JL 2NX5A 4GAFB 3UTPE 4G6FB 2PYFA 1HILB 1UKTA 1TDQA 4X7TA 1NCTA 1G7JA 5F9JB 3SCMD 2P42B 2FBJL 2Z31B 5HGHB 3QJFA 5IESH 2NY1D 2IH3A 3FKUS 4HQQL 1EK3A 2HFFB 5HI3D 1FAIH 1L4IA 4XHJC 1R24B 5HD8D 1REIA 4K94H 2P8LA 2O26U 2Y72A 4KVNL 5DK2B 4DN3L 4NPYB 3NGBC 3KYKH 1HHHA 1UZ6E 3DUSB 5FM4A 4RMSA 3SQOL 3NOIA 3W39A 2Q8BH 3RZWA 3U79A 5FM8A 4EIGB 4M6NL 1DQLH 3UJTH 5HXMA 3VFGH 5MI0C 1SY6L 5HHOE 3TA3B 2E9JA 4JO2H 1NQBA 2ZCLL 2NTFA 4UTBH 5I15L 4S10A 5IB4A 1JTOA 4Y4KB 1ED3B 2H2PC 2ZSWA 4KK9C 4RQQB 1U8HB 3FQUB 4U1SA 2JE8A 1C5BL 1HCFX 1J0IA 2PTTA 4IHOB 4AG4H 5GS0L 3L5XL 3AUVA 2DKMA 3VI4F 4WI7A 2AK4A 1RFDL 1ZKAA 2OR7A 3WS6C 5C9JB 3AREC 3FRUB 1ROWA 5BVJA 1GAFH 3CH1A 4PY8J 3VWJC 2QHLA 4X6CB 3HUJE 1YY8A 3BJLA 2CR6A 2YXFA 1QACA 2IADB 3WFDH 4WO4B 2B7DT 1T4KB 5CJ8A 2AQ1A 1CLCA 4KUZL 4YDVA 4L4VE 1F11A 1A0QH 4WO4D 1RMFH 4JN1H 2LTQC 3HC3L 1RZFH 5GZND 5TQ0H 3FN9A 3UBXA 3BQUB 1L6XA 1VGEH 2PTUA 3PABB 4PUBL 1GPOH 3O0RL 1QQDB 5I1JL 3M17A 3OAUL 3HHRB 3IU3B 4RIRA 3EO1B 1MUJA 5F96L 1FCCA 5I8EB 1YNLL 4Y1AD 5EU3B 1AIFB 4J3UA 5EB9A 4LHUA 2Q20A 2RQ8A 1Q9LA 1F4WH 1KJMB 3LEYL 4NUJB 1L0XA 3GHEH 3BH9B 3IJYB 2AEPH 3GI9H 4JKLA 3RDTD 1ZHKA 2ZCKL 1OP5K 1CFNA 1I9IL 1L0QA 1H8OA 4F7PB 3BIAX 3VWKC 2VB5A 4QHLB 5IG7A 1AO7B 2L7UA 2VZUA 2YWZA 3DMMC 4K8RC 3UO1L 1BP3B 4HLZH 1FVCA 4HFWA 1DSFH 3GBMH 5T1LB 2XPGB 1U8IA 4UAOC 1YPZA 3GI8H 3CJJA 4NZJA 5H8DA 5K59E 4G8IA 5C0CE 1I3RB 1NMCB 2BVUA 2PR4L 4QHUA 4DWHA 4JFQA 3UTSD 3QI9C 4XNUL 5I1IH 1YZZA 4PLNC 3HE7B 4HZAA 2CKNA 4KROC 3UZVB 4JZOB 5ICXB 1H0DA 5BRZA 3HE7D 2QQNL 1A1NA 3CUPA 1YNTA 2Q76A 2CJUL 1FZKB 3T77A 1PY4A 5I16A 1R3LA 2AS5M 4HJJL 1BPVA 4JANA 1WCQA 1QFWH 1UZ8B 5FKPA 4X4ZA 4ZXBB 4K2UL 2AEQH 4KY1L 4PJHB 3TJEL 4BKLB 1A7OL 5BOPA 1KN2L 3SGJC 5JLZB 5DI8B 3O3EA 1G7HA 2V2TA 1JPGA 3VXME 1AFVL 3J7HA 4OCYL 4JKPH 1PAMA 5L88L 2GQHA 2C5DC 3ARGA 3MXWL 2CDEA 1MCDA 4KVCH 4MDIB 5DR5L 2I9TA 4BK5A 3LQAL 1ZHNA 3GM0A 4NJ9H 5D1ZB 1NFDF 4N5EC 1NMAH 1INEL 4YO0A 2J8HA 4Y4HC 1B0RA 4ONGH 4F7EB 3BPNB 1P2CA 3VXSB 2BDNH 3KS0H 3V2AR 1NCDL 4P23A 2FJHA 4FQJH 2WUBL 43C9B 4NN5C 1G6RB 3VXSD 1J18A 3GSVA 3INUL 3JWOC 1GZQA 2CO7B 4P2QA 5KVGH 3DIFB 4HXAH 3MRKB 4ETQB 3QO0B 2OX5A 4D0CB 4PS4H 4PJ9D 3UX9B 3H9HB 2CPCA 4QCIB 5FGRA 1X6LA 2UY6A 5E7FA 5C7XH 3GKZA 1WZ1H 1I9JL 3SKMB 3PHOB 2NY3D 4ZO8A 1ADQH 4X7DC 4RISL 5JIHA 2WBJB 3RUGB 4UU9A 3M8OL 1MCEA 5CKGA 3THMH 2W0LA 5D2NC 4PJ5D 5B3JF 1OVZA 1S3KH 5LG1A 1MFDL 3QR2A 3RAJL 3VXTB 2AXJA 4U1IA 1JL8A 3OJDB 2P45B 1CK0H 1UXWA 5JW5B 4PP1D 1AY1L 4M7LT 5C70A 5CSGA 4L4TD 2C7UA 5JW4Q 1OAZH 1WZKA 4YDKH 3F8UB 1S7WB 4LPVA 5KS9E 3GBLA 1C5CL 5AWNL 1WSST 4ZPTB 3CU7A 4RNRB 4UT9L 2VUOA 4X5XA 1F5WA 5CP7B 2XTJE 2XNAA 4ELMB 3IKCA 1MHEA 4C58B 1GOFA 1QBLH 3K81A 3NN8A 3RWFB 2K7PA 3V0VB 4ZODA 3OKMA 4XP1L 4NSKB 4MX7A 4YHML 2XTJC 4GLRI 4YXHL 1FL6A 4OM0L 4MSWA 4NDMA 2DDQL 5MHSE 4B5EA 5D7IB 3WS3A 2CGRH 4NQXA 5T1KB 2VLJA 4PJIE 5DMYA 4FXGA 4XI5C 5KSAC 4ODSL 2GI7A 4ORGA 1DN0B 1N3NA 2E7HA 4JN2B 4OGAD 3VXNA 1LEGB 3ARFD 1AGFB 4XRCA 3MSPA 5KN5B 3W5MA 5D1QD 4KI5D 3IDXH 1WTLA 5E8DL 1Z0MA 2EIEA 4FQ2H 4K7PH 4KZEL 4GW5B 3MROB 5HDBE 3EYFA 3O6KH 2Q6WA 2BHYA 5AAMA 5ENWB 1HDMA 2Y7QA 3P4NA 4QNPF 3WLBB 3MFFB 5SWSA 4LEOB 1J0KA 3ILQC 3LEVL 4D3CH 3U46B 2AABL 1G1YA 1Z5LA 3KLDA 1EEZB 2X4NA 3MA9H 4JZNA 3T1FA 2DQFA 3L3HA 4M7ZB 2MPAH 2PYEB 1BOGB 4RWYL 4F9LA 3KWWB 4FMKA 3GMLB 1J9CT 4I0PA 4BZYA 4FQIL 3SDDA 5DYOA 3PWNB 4YZFF 3TBSB 5C6TH 1LEKB 5KJRH 4M1CD 2LAGB 3C9NB 2W92A 2OTUA 4ZUVB 1EXUA 3BH8A 3LN9A 2H26B 1CT8A 1U95B 5DHXB 4MJIA 2GJ6A 3BKCH 3IJHB 2D7MA 5FO9B 1NANI 4Z7WB 2VQTA 5LGHH 1EJ6A 2R0WL 2ZJSL 4JDTL 5IJVB 1I3UA 3HC4L 3L5JA 5TE4H 4OLZH 5L2JB 3SN6N 5DJ2A 1P4IL 4OJFL 1QFUL 2M26A 5B39A 2NX5E 1RZGA 3K4ZA 1NAML 4K3EL 3QFJA 4WI6A 2VLKA 3DRQA 3RHWK 2Y25A 3QNYB 2NCMA 1MH5B 4BFEA 3DPBA 3KPMA 1NCWL 5B4MC 2IQ9L 3MRMA 4RFEB 3IJSA 4JPVL 5CLWA 3LS4H 4F7TA 2DIBA 3MNZA 4O4YL 4JQXC 4PG9A 3MCLL 2V9QA 2NY4B 1YYLH 3CXDL 4ENEC 1KF9B 3MBEB 3WO3B 1IE5A 1MAML 5A1AA 4YC2C 25C8L 3A6BL 1BLNB 2VITB 3ALWA 4OIBA 2W1NA 3GNML 3PGDA 3B5GA 3U4BH 3K8LA 4G9FA 4GKSB 3S5LB 2OP4L 5CJOH 3EZ8A 1K8IA 1CGWA 4PLJD 1JP5A 1ULVA 3QQ9C 1KELH 4M9OA 3U9PH 4HIIB 2DD8L 3ULVL 4DUVA 1HHJB 5IWLA 2NTSP 4QTHA 5DD1L 3WFZA 2QSCH 3PNWA 3Q5YA 5DFWH 2FB4L 3TLRA 1CFVL 2VABB 4XNXL 2A9NH 1S7RB 5E9DD 1LP9F 3VFTA 1UVQB 3FB5B 3NBNA 2AK4E 3IU4L 1ITBB 1JUFB 1IGMH 5EBGA 2VYRE 3MRFB 3PWPD 1IAOA 1EJOH 4HLJA 1Q8MA 4XX1E 3V5HA 4JFYA 1MCJA 2WLZA 3IAGC 2VN4A 4MCZB 4ETYA 4IIQA 4QRPA 3U7WH 2WP3O 3S36H 4QRRB 2R0KH 4FG6D 3D0LB 3NCJH 3RU8L 4AEFA 1ITCA 3VXQA 3FOLA 3BOVA 1FPTL 3DXAA 1S7QA 2Q7NA 4G5ZL 4U05A 3Q48A 2YS4A 4UQ2B 4LVNC 3UTTD 2XRAH 1HSBA 3ZHLA 4KWUA 4U6TA 4I9WE 3QDGB 1L9MA 2EDFA 5FM5O 1EHNA 2ICWA 5F6IC 1TQCB 4DZBA 5KVDH 2X05A 1U3ZA 1MI5B 5TQ2H 3QEQD 5FCUL 1NGZA 3S37H 1UA6H 1F3RB 5EA0L 3KXFB 4PRPA 5KVFL 1G9NL 3ULUH 5D9SB 4YHPB 2IAND 1XF5B 4LKXA 5A40E 3HG1A 1OT1A 2G2RA 2G9HA 3CFBB 4MVBD 1NC2D 3BYTA 4K23L 2XZAL 4GAJH 5T3XL 5EU5B 4OCWL 5C0BB 1NBZB 2CKBL 2EYSA 3CK0L 1GYAA 2H41A 2FL5A 1UJTA 5ESQA 1YPZE 4HPYL 1QYGL 5JHLH 3IFNL 5DFVC 2Q8AL 1WC7A 4Z7UA 3FB6A 3O2WL 1WIPA 5EWIH 3EDDA 4QHNA 3C08H 1Y6NR 5GSVB 3IDJA 3IFPA 5BRZE 1N2RA 3V7AG 4FABL 3C5SB 3U36B 3C60B 4WY7H 4YWGH 1UB5B 1A1MB 2O5ZH 5DEFA 3LDBC 5EPMB 5TGBA 1E6OL 2VDNH 4ZUWA 2ATKA 3QUZB 3C60D 5J12B 1J05A 2DAVA 3WKNA 1Z3GH 1ZS8B 4NO2A 1CDYA 2XA3A 5C0EB 5E8OA 2ILLA 2VDRL 4ZD3L 2IMMA 5J56B 5EOCJ 3JV5A 4I13B 4RGMB 1J8KA 3QAZC 1VFUA 4KJPC 4S1RH 4G6AD 4XWOC 2BC4B 4UNUA 2EEDA 3TPUA 3CDCA 4Y19E 5IHZA 2NXYC 3PP3H 2BSTA 4UMGA 5L9DH 2DQDL 1P1ZA 4D0DB 1NDGB 1XR9B 5IW3A 3VFMB 1T1XB 1ZT4A 4HKZB 1QSEE 5D7SL 1QRNE 1T1WA 1U92B 2OR8A 3EGSB 4U49A 1TETH 3RL2B 4RAVA 4NQCA 3DX8A 3TH2T 1UH3A 5EO9A 5FOJA 1SMOA 2DM3A 4Z0BL 4NCDA 4WHYH 3BEWA 3QNZB 2CLVA 4KHTH 2V5SA 3EJZD 1R5WB 1OSZB 4MMXC 5GS1B 3AS0A 2V9RA 3D0VB 4QF1B 8FABB 4Y2DC 1KIPA 1RVFH 3GIVA 5HDQL 3F58H 3AC0A 1CICD 4G7YL 4BZ2H 4LFHD 3TN0C 4E0RB 2Y36H 3Q3GA 3ARUA 4QYOA 3OB8A 1J0HA 4YFLF 2HT2C 4DVRH 1CYGA 4ZUTA 1YMMB 4M00A 4PJGF 3DI2B 5I8KH 5IMLA 2B1AL 2IBZY 3BIKA 2VZTA 1G7IA 1JFQH 4ELKB 4PV8A 3QUYD 3DSNA 2J5LC 1A7PL 4XNQA 4FS0A 4UDUB 4HWZB 3QPXL 1J87A 5I1HH 3FFDB 2ZPKH 3BPOC 3FOMB 1QBAA 5D7LB 3TV3L 4JLRB 1JVKA 3V5KA 3JTSB 2F53B 5D7LD 3CMOL 5EU4A 4PYHA 4MA7H 4GAYB 3IDNA 1JHLH 1S7TB 3G5ZB 4PB0H 1JZ8A 5I8CB 1XH3B 4FTVB 3PP4L 3BXNB 5DRNA 3G6AA 3SKNB 5CD3A 4OLWH 2VLJE 1JWSA 1FSKC 3MLXH 3OKLA 5DA0B 4HIHA 1IC4H 4ERSL 3SE8L 1KCSL 3VJ6B 3JVGA 5J57B 2AEIT 4NFDA 4H20L 4OLXH 5CD5D 5IM7B 4YHOH 1IRAY 4CJ1A 2R1YB 2XA8H 5ITFB 4AM0A 3E8UL 1CDUA 3U30B 2PO6A 1S7XB 1RZIA 5IB3B 4KMLB 1IEAB 2JJTC 2R9HC 3KPLB 4YIQA 5TDOB 1CF8H 1NCBL 5SWSE 3FQNB 5CLTA 5HY9A 5ADPH 5EUKB 4JQIH 5DJYB 4XHJD 4LSTH 1AXTH 1ORSA 1PKQA 2HN7A 2ZCHL 4A6YA 2FHCA 4M48L 1PG7H 4LKCB 3HR6A 1IGYB 2IH1A 1YN7A 5BOZG 2X4OA 4O58H 5F9DC 3I9GL 4NJAH 4NP4L 5BVPL 3NH7H 1I7ZA 1LD9A 4QRUA 5GGTA 1AGCB 4XXCC 4WDIA 2FATH 3TVMC 5CAYB 4WI8A 4S1DC 5HHOB 2XKNB 1N0XL 1NGPL 5BCAA 1JWUA 2VWEC 2FNBA 2MKWA 4F15B 2B8OT 4MJIE 2GJ6E 3EO0B 4F33A 4DOHB 4PJBA 3S97C 4NWUH 2H2PD 2WINA 4R0LC 4M7KH 4KK9D 1I7RB 2W9EH 3P4MB 4P2OC 4OT1L 2R2EB 5A2KH 1IL1B 1YC7A 3RRQA 1A7RL 3H2WA 3AREA 3RTQC 1G9MC 1MVUA 5IQ9A 5ICYB 3TH4T 2X7LA 5JW3L 1IGFL 2C3VA 4LHQB 3QFJE 3DBXA 3T4YB 3KG5A 3OTTA 1QOKA 2C1PA 1LO0L 3IRPX 1XGUB 3CPLB 3LEXA 3O8XA 1WISA 4NZRL 1RIHL 1CVRA 2EE9A 4PJDF 5GGRY 1OAUL 3FQXA 1DUZB 3FN0L 4CW1A 4W4OC 5INCB 1A6VH 2QHRL 3FMGH 4WENB 3VWJD 4HZLB 5EBMA 5KVMC 1BHGA 5CHNB 2R56L 5I6XB 1M7DB 3V6ZB 5EORL 4Y16A 1OT2A 4PGCB 2VIRB 3KJ4B 4JFDA 4E9LA 3O6FA 5E6IB 5C2BH 4PREB 4L4VB 4UNVA 1A4JA 5CEXA 3MRIB 2AKRA 3WEXB 4L4VD 4UUJB 1KEMH 3BEVB 4C4KO 4N0UA 2XQYK 2O5XH 1NGWA 1RZJC 2J1KA 4G6JH 4RSVA 1KFAL 3WIHL 1F4AA 2R0LH 3NZ8A 3MV8A 2E5EA 2BRQA 1ZGLP 3GBNL 2FR4A 1A3LH 1CWVA 1QNZH 2B0SH 5E4IA 5C0JA 3SDCC 1R3HB 4HUUB 4OAWB 4X9BA 3QDJE 3S8WA 1HH6B 1A6AB 1WFNA 1RJCA 5IVNA 2VXTL 5IW1A 3VWKD 1MCSA 4NO0A 4YHYB 4EDXA 1ZGLA 1B0GB 3DMMD 4K8RD 3ZE1E 3DVNB 3OAZK 2VNCA 2I60L 3PXHA 4E41E 4TN9A 5J8OA 1YMHB 3U0TA 1PEZA 4KROB 2RGSA 3KLSA 5C0CB 4ALAL 1DLFH 1JNNH 4AY0A 1A6WH 1VGKA 3QI9D 5FUZH 1UKQA 1KLGB 4KROD 3QCTL 4Q6IB 4UOJA 1T7XA 5ACMA 3X11B 3EZJB 2HVJB 4MD4A 4GG6F 4L8CB 1B0WA 1OCWH 2EIBA 4ZTOH 4LCUB 1GGIL 4P5TB 2GITA 3U0WH 3NIGE 4KV5E 1H8SA 3RWDB 1NDMB 4OF5A 1YJDC 4O9HL 1Z2KA 4LEXL 4CVXB 4NNPL 5K9QG 5IHBA 1KT2A 3HCVB 3VXMD 3HG1E 1T20B 4N5ED 5FHAH 2DQIH 3QP3A 3L6FA 1OSPL 3JV4B 4Y4HD 2E27L 4DQOL 4I2XE 4OCLC 2PCPA 2AJYL 4QXGL 2B4CH 5EOQL 1H15B 5IJKC 3VXRB 3QIWB 4LAQH 3LQZB 5MENA 3C6LB 4HIJA 4PRBB 4PJ8A 1IMHC 4W4NA 3GIZH 2VKWA 4YHZL 3B3IB 2LQRA 4PJCF 4W70A 1YEHL 1I1AC 5HBBA 1JZ6A 3MMEB 1CFTA 1CDCA 4ODUA 1OP9A 2BNQE 2EDWA 2ZSVA 4D8PA 1HXMB 32C2A 3GSRB 3O9WB 3ULUF 3N9GH 3WHXA 3RQ3A 2GAZB 3QZWA 1JTPA 4OD1H 5HYJE 3RWIB 4U31A 3LZFH 4ODVH 4RGOH 5ANMB 3TO4C 2BVYA 1IARB 4M62L 1QFHA 4LLWB 4IS6A 4OTXL 4ZAKA 2DLTA 3MODL 4BZ1L 4LBEA 2V17H 5CIPA 1N7MH 3AAZA 5AZEH 2APFA 5IP4A 4ONFL 1C7SA 1GZPA 2PTVA 4C57C 3A0OA 3BUYA 1MWAA 4XNMA 1BX2B 1JCKA 4OZFA 3HPLA 2HA1A 4JRXD 4UZGA 1HHKB 2NY7L 3VI3F 5KS9B 1RU9H 5KW9L 3G08A 3VCLA 3L3GA 3OF6A 3EFDH 5HVWA 2EDXA 3DVIA 1E28B 1BZ9B 2H2SC 3UXFA 3MNWB 2R2BA 3GHBH 35C8H 2XTJD 2VO5A 1Y0LA 2DQHL 2F58L 3SDYL 3VFVB 4ODTH 1NSNL 1KCRH 2ZUQC 2UUDK 1BBJA 3X3FH 3DUUA 3U6RB 4XI5D 4MXVF 5KSAD 1N5AA 5I30H 1ZGLM 4PJIB 4G3YH 4JDVB 4M6MH 3MV01 5MHSD 4ESKA 3V6FA 4NQVA 3RWGA 3DWTA 4TULH 2EO9A 3STLB 5DD6A 4NO3A 4G80B 5KSUB 5CCKL 4Q7DA 4XCCH 2NZIA 5AEAA 3QXAA 4LLYB 5LAXA 5FYKE 1MLCB 1MIEL 4JZJB 4GW1A 1KCVL 3BE1L 2QKIB 2ADJA 2YSSB 3U82B 1F4XL 5E7BA 2GTZA 3S4SA 5KVEL 4X8JB 3H0TB 2HH0L 4ZFOA 4MAYC 1IVLA 3ILQD 2EDJA 1T1YA 3KPSA 4G9DB 1IT9L 1R0AL 1A8JH 2DM2A 2NXZC 1IGIL 4BSWB 3O3DB 4JFHE 5BZDB 2AV7B 1E4XH 3D39E 3V79C 3LMJH 4QTIH 1Q0YH 4XMLL 1HZHL 1FV1A 4OFYD 3X17A 3VH8G 3MR9A 4WWID 2ADGA 4E5XB 1XCQB 2BMKA 3PL6C 4HSQA 1XR8B 2EYRB 3TT3L 4F57L 1P9MC 5D7JB 3GSQA 4M7JL 5ISZA 1EFQA 1RULL 2X4PB 4L5FH 1RIVL 4YXKL 5ALBL 5CMAA 2XXMB 4QHKJ 2BVTA 4P3WA 2XKUA 3QEUB 1MFCH 1DBKL 2HLFC 3SDAB 3HE6C 4WW2A 5ISZD 1K4CB 3BDXA 2ARJA 4LNVA 2ZKHL 4DGVH 4XT1C 2ZUWA 2OQJA 5GS0C 2B2XH 5MEPB 2NX5B 4S11A 4JO4L 3TT1L 4DKEL 3ETBF 4X7TB 5FYJL 4NHCL 1G7JB 4KDVA 4JFEA 1FL3A 2YHGA 4FFWC 1OTSC 3MREA 1MREH 5B38G 1FZMA 3QJFB 4ZFFA 5B4MD 2IH3B 1EHLL 2DQEH 3DECA 1OGAA 4XNYH 2GJZA 4QXTA 5E94A 3VGAB 4ZOCA 2EDLA 5EZOH 3B9VA 5AZ2L 3KLAA 4UV7L 5DD3L 12E8L 1J86A 4UTAH 2P8LB 3QQ4A 1FYTD 1AD0A 1HHHB 5L6YH 3W39B 3IFOA 2HKFH 2YPLA 5SX5K 2N1KA 1CD9B 2NW3A 3CFCL 4YE4H 3RNKB 3QQ9D 4M1DH 4M7LL 3WL9A 3ZYJA 2NTFB 4KTDL 1CLOL 4GS7C 4PJBE 1AKJD 4OUUA 5IB4B 4ZFZB 3L5IA 3RI5K 2ZSWB 4C83B 4XAWL 4KTYA 3I6KA 4BFGA 4U1SB 4EN3C 3MLUH 3LRHA 2PTTB 2V5YA 3ZL4L 5FYKH 1J0ZA 5EC2A 2YPVH 1UXSA 3F5WA 3NPZB 4NO5A 4PTUA 1OF2A 2X4TA 2AK4B 5F1NA 5DHYA 5I1DA 5BVJB 5L0QC 1KC5L 1YEKL 1Z6JT 1QKZH 2G75B 2ESVE 4JFDE 4ZUUA 3ZKNC 1EO7A 1F3DJ 2Z4QA 1NKOA 3ZT7A 5BVPH 1F11B 5F7YC 4K9EL 1IQWH 3RGVA 3WIIH 3UBXB 4KHXH 5ERWA 5C08E 1JRHI 5D5MA 4N0UE 3H8NA 1EV2E 3VRLE 1BWMA 1DBMH 4Z95H 3MV8E 3TF7C 4RIRB 5I1GL 1ZMYA 4I9WD 2EH7H 1MUJB 4K71C 4YEEA 1KNOA 2DLEA 3WJLC 4LHUB 3BPCA 4O51A 1ODAA 5GGSY 4XVJL 1SEBB 1Q9LB 2YWYA 4KAQL 5D7KE 1SEQL 3LQAC 4FP8H 3P0VL 3MYZA 4LNRA 1ZHKB 2BHZA 4WFGD 1BFOA 1S5IH 4JG1L 1C12A 4LRIA 5E2TL 4AH2A 1D6VH 4FMFA 5JXAH 5IB5B 3F7YA 3PDOB 1RK1A 5DRWA 1G7PA 3DROA 3G6JE 2FGZA 3U7YH 1FVCB 5ADOL 4RWHA 4M9PA 5DFVD 5IR1A 1YPZB 2GSIA 4G8IB 2ZWLT 1EAJA 1G6RL 5DLML 4G7VL 4G8GA 2F19L 5IUSA 1E27A 4A6YH 4JFQB 2P5WE 2Y06H 4XBGA 2FCBA 1UGNA 3ARBA 1KTDB 1CTOA 1T0NA 4DZ8A 1D5ZB 1MJJA 1H0DB 5BRZB 4HGKC 1WWBX 1A1NB 5GGTH 1YNTB 2Q76B 3VFWA 4XP4L 3LPWA 3T77B 4PJEF 4Q9QL 5I16B 1R3LB 2P5ED 4UT7H 5BQ7A 1JGEA 5FKPB 5LWYL 1RUKH 2R29L 3ABZA 4HS8H 5F93C 3O4LD 5JW4N 3O3EB 1G7HB 2V2TB 1JPGB 1UWGL 4TOYL 3U0PA 4KJPD 2NXYB 4XWOD 1T2JA 1TVDA 5GGRA 2CDEB 4V1DE 3GFUA 1BWWA 2I9TB 5D2LE 3EO9L 2NXYD 3M45A 5F7LB 2A2QT 1IGJA 3ARZA 5JR1L 4P59L 3B2VH 2J6EL 1B0RB 4Y19D 1I9RH 1P2CB 3QUKA 4HIEB 5MENE 1ZT7A 1OL0A 2FJHB 4NQED 5EZIH 5DJ8A 2EDOA 4K3DL 3GSVB 1QSED 3HNSH 1GZQB 1QRND 3GZKA 5EOTA 4ZUSA 3VGHA 3JV6A 3A6CH 4ODXA 4LLQA 1MCHA 4Y2DB 2D9CA 1IAMA 2VXUL 3CFEA 5DJ6A 1EFXB 4Y0GA 3MV7D 4Q0XH 3CU1A 2XIDA 4Y2DD 4N0YH 2D0GA 1EFXD 2FECL 5TFSL 2NYYC 4AQ1B 4HUNB 3TNMA 4XXDB 3TN0D 3V4VH 1L7TH 4HC1A 4EDWH 2HT2D 4FA8A 3UBXI 4YK4B 2NY6B 1JPST 5I0DA 1LMKA 1A3QA 1YY9C 2QR0B 4U1IB 4HJGA 3ZLQC 2V5TA 1UXWB 3EW3B 1WAAA 2IPKA 2YD3A 5F7NC 5KZCB 2R69H 2C7UB 3BHBA 2VH5L 3MRDA 3UZQA 1P53A 5KAQF 4BYHA 2FX8L 4KTEH 3EHBC 2AAVA 4L3CA 2XICA 2IALA 3WFBL 4F8TA 3FO0L 4X5XB 5E4EC 3RIFF 2NY0B 2CRZA 2XNAB 3TBVA 3IKCB 4BSVA 4GRLA 3RNQA 1MHEB 1V7NL 4NBZB 3NN8B 5DRZA 2HKHL 3OKMB 4HKJA 4MX7B 4C4KT 4F2MA 1BQUA 3HFMH 1FL6B 2PNDA 4MSWB 4NDMB 4JGJA 4YNYA 3WS3B 4DTGH 4JPWH 2VLJB 4FXGB 1O5DT 1HQRA 5FO8A 5H35A 4HGMA 2ED7A 1D5BA 4ORGB 4APQA 5DJXB 3BZDA 1N3NB 1MIML 1QSFA 3VXNB 2C4XA 1N6VA 1VFAA 3KR3H 4XRCB 5E99H 5JXEC 3I6GA 3V9FA 5CEZL 1JHKL 1RURH 1U8LA 1JK8A 1J88A 2C9AA 4NGHH 4OF6A 2P8MA 3H7BA 1UWXH 2OR9H 4YQXL 2W9LA 2NNAA 1IGCL 2R9HD 3GJFK 1TZIA 2Q6WB 3RA7L 4S1SH 2CUHA 5D8JH 3VW3H 1HDMB 2Y7QB 3P4NB 5J1AA 2ED8A 4OQ1A 4WHTA 5SWSB 4RRPA 1TJHL 3LCYA 4LCWA 5E95B 2C4FU 5HHMB 3KPRA 1FBIL 1JPTL 5IBUB 1LDPH 1UB6B 2R0ZL 4KRNA 1Z5LB 3T1FB 4M5ZH 1VB9A 2DQFB 1EHAA 1N64L 1U2CA 3L3HB 4PJFF 1EO8L 4KDTA 3D85D 4PY7A 5J1SC 1XGYL 2BY2A 2IPTH 1FNGA 4OI9A 2YMXL 3NCCB 5FDWA 2XZCL 1ZLSL 1FC2D 4I0PB 4M02A 4XBPA 3O45A 2YK1H 3OZ9L 1SJHA 2VLME 5DVOA 5DYOB 3SDDB 3MLVH 3MXVL 3TVMD 4JFZL 4S1DD 3ULVE 1ZHLA 3HZMA 3WSQH 2OTUB 1EXUB 5DC0A 3BH8B 4P2OB 4BK4A 4X98A 4D9QD 5I8OH 1CT8B 1NMBL 1OM3H 3ULVC 4P9HL 4PJ7F 1N4XH 4MJIB 4DGIL 2GJ6B 3GSUA 4HWEL 4P2OD 1P5UA 5DT1H 3T0VA 3RTQD 1DVFC 5J7CC 4H8WH 4NKMA 1TJGL 1UM5H 2DJUA 1QPPA 1RJLA 4WV1A 2OZ4A 3QDMD 1RZKH 2VMFA 1INQA 5DJ2B 5DQDH 5E2WL 5C9KA 2IC2A 3D2UA 5B39B 5CIPH 1YEJL 3HNTH 1XIWC 1CFSA 3QFJB 4NQDA 3RKPA 1QSVA 3DRQB 2HG5B 1RSFA 3OKKA 3P30L 1MWAH 5HVFB 3H9SE 4Z7UF 4OZFH 4DK3A 4JFPA 1DDHA 3KPMB 2KL6A 3BI9X 4LL9A 2ENSA 4XCFH 3IJSB 5IEHA 5C0RH 3HI5L 4F7TB 5DWUL 1P7QD 4J6RH 3MNZB 2BJMH 4NN6C 2DI9A 4PG9B 2D2OA 1Z0NA 4TQEH 4OF0A 4WEMB 4O02L 3OB0K 1ONQA 1S9XA 2BNUB 5EBWA 4IOSD 3PGDB 3TCXA 1AGBA 2YPLE 4ZO6A 1KTLA 3WFEH 3FT3A 4UB0H 1TNMA 1K8IB 4BQ8A 2IGFH 1EEYA 1VADA 3IDYC 2N7AA 4ZOEA 3V4UH 4NIKB 2SEBA 3SDCB 4QTHB 5FO7B 4BFBD 4X6DF 3PNWB 1G9NC 2EE3A 3P4OA 5GHWL 1MCOH 1HYRC 3SDCD 3MBXH 3DI3B 4M43L 4PRHE 2APBA 1FE8L 3CLFL 4X6BA 4MA8L 4ZDHA 4IRJA 3MRJA 5C07D 3VFTB 3ZE0E 3FT2B 5GRZA 3QDJD 3W9DA 3VFRA 4R2GC 1QR4A 5JORA 1IAOB 1YDPA 4UQ3A 1FYHB 3V5HB 4JFYB 1ZVSA 4E41B 1DE4A 2WWKO 2GIYA 4OQTA 3TPKA 3AB0B 4IIQB 3EOAA 4QRPB 4E41D 5DJCA 1E4KA 4YGVA 4LLDA 1NC4D 4W68A 3U9UB 1EGJL 3P0GB 3U2SA 3VXQB 1LDSA 3FOLB 1QLRA 1S7QB 5JOPE 4BM7A 4YFDB 1GHFL 1HSBB 2XN9E 3QDHA 4OCRL 4RDQF 1U0QA 1AXSB 2UWEA 1JNHA 4IOIA 5J3HC 5EG6C 5DUPL 2DQJH 2ICWB 4DZBB 4LF3A 4MNQA 3MLZL 3QRGH 3T4AA 1WGOA 3D5OF 2BY1A 3HNVH 5GRUL 1T83C 4IMKC 1NGZB 1ACYL 4HUWA 5FUCE 4MJ6A 1OWWA 3GMPA 4G6KL 4X7SL 1CTNA 1PJ9A 1X4XA 1CE1H 5FUCC 3SBWC 3QPQC 4M3JA 4LKXB 3HG1B 3RJDA 2IPUG 1Z9OA 2G2RB 2G9HB 4BA8A 5INDA 4YHKH 1Y18A 4LVOB 1L7IH 4EBQH 2VXSH 2EYSB 3LRGA 2EIZA 15C8H 2FL5B 5FHBH 2P44B 1FAIL 3UP1A 5ESQB 1J1XH 1JTTA 3F6LA 4ZTPH 4K94L 2E6PA 1U8MB 1KPVA 1I1AD 4DKAA 1WC7B 3QBTB 2LFGA 4EXPX 3KYKL 3FB6B 5IMKA 4NN7C 2Q8BL 3S3SA 4QHNB 1GGUA 5FK9A 5FXCH 4Y7MA 1YEEH 4KPHH 1DQLL 3UJTL 3VFGL 5I74B 1X3DA 3IFPB 1N2RB 4QGTA 2BNQD 4OGZA 3F6IA 3MA7A 1RUQH 2VDQH 5JHDD 4JO2L 1DQDH 4TNWK 4UTBL 4ZO7A 3PHSA 5HYJB 5DEFB 5TGBB 4U6HB 4ZUWB 3TO4D 1ZHBA 2ATKB 4U0QB 4PRIE 1J05B 3SGKA 3WCYA 5E8PA 1TENA 5L2KA 5E8OB 4CMHC 1RIUH 3CZFA 1JMXA 4NQSA 2AV1A 3GO1H 4UT6H 4PJXA 4AG4L 3LSOA 5HHXH 4L3EE 5IHZB 1FG2A 3OHXA 1F00I 4KC3B 2COQA 3WHE1 2X9YA 4XWGH 4R97B 1GAFL 3IDIA 5HYSG 1P1ZB 1VEOA 1ZT4B 3OKEA 4YJZL 4P2RA 5F9OH 1T1WB 4RA3A 5CGYC 3BIBX 3WFDL 4IRSC 5EUOA 2H2SD 4RAVB 2E7LA 1RJZA 4NQCB 3DX8B 4Z76B 4P3CH 5EO9B 1A0QL 1RMFL 2OTWA 4JN1L 1RZFL 5TQ0L 1G7QA 2CLVB 4ODBD 1T2QH 1VGEL 4U7SA 1GPOL 2ZUTA 3G6DH 5D93C 4YPGB 5DUBA 3QUXC 2H6PA 4JM2A 5GGSA 1MVFA 1KIPB 4J3OC 2OBGA 5GJTH 4P46A 3GIVB 4EUPG 1JZ7A 3FAWA 1QHPA 4MD5A 3Q3GB 3O81A 4BQ6A 4ZUTB 1F4WL 3W0WD 1DL7H 3GHEL 4B41A 1XMWA 2AEPL 3BIKB 1BD2A 3GI9L 1GL4B 1LE9B 1X4YA 1G7IB 3GJEA 2ICWI 4PV8B 1NLBH 1WAAE 4MAYD 4Y5VC 3DYPA 4I5BA 2KH2B 1W0WA 3RJQB 2NXZD 1DSFL 1Q72H 2L7JA 3GBML 5F7EH 4P9MH 3GI8L 3V5KB 2DTMH 2OXHA 5JOFA 2W59A 2X6MA 5EU4B 2FX7H 2WUCH 2DLGA 5I1IL 4JFHD 3IDNB 1S9KC 3PL6D 1TCMA 5J11B 1CXLA 3D39D 3QFDA 4JGMA 4X7EC 3KPOA 3BFOA 4RMRA 5DRNB 3G6AB 4WUKH 4EI5A 1E4XI 1JWSB 4HX1A 3OKLB 1QFWL 1QSFE 3VD9A 1CZ8H 4K7PX 2AEQL 2HLFD 3AFLA 4D9RD 3HE6D 2GCYA 2ZZUT 3QIUA 3TYGH 3MRCA 4JHWH 4DW2H 4JKPL 3C8HA 4AM0B 5GS0D 3MRLA 4KVCL 2PO6B 1RZIB 4WFED 4NOFA 3C5JA 4ZNEA 4NJ9L 1AHWA 1NMAL 4FFWD 1OTSD 2XWJA 5DXWA 4ONGL 4AMKH 3QQ3A 4LPXA 2BDNL 5L7XH 3KPRE 1S5HA 5HY9B 1BF2A 1DBBH 2HAZA 1XGTA 2NR6C 2JLLA 2Z93A 4FQJL 1ORSB 4IRZH 1PKQB 4KMTH 2HN7B 4LFHG 3ZDYF 2YEZA 4U1MA 4A6YB 5KVGL 1HN1A 4HBCH 4HXAL 2IH1B 5DD0H 1I8LC 2X4OB 1NLDH 4PS4L 2N7BA 3MJ8A 1I7ZB 1LD9B 1T7YA 3LKRB 4QRUB 3E3QC 3REVA 3RVUC 1MHPH 4WDIB 3QHZH 5C7XL 4UINH 3CSPA 4RDQG 3PE9A 1WZ1L 3KHOA 4RX4A 4GJTB 1JWUB 3V7MA 5DZNA 2NQCA 1IKFH 1ADQL 4F33B 5TPWH 4PJBB 2WINB 3THML 4YBQC 3ZTNH 4PG2A 2O93L 4WI3A 1OOAA 1MVUB 2OCFD 3ZKXC 1S3KL 1NBVH 1CGVA 4KGLA 4HC1H 5EZLA 4LRNH 4EN3D 5IQ9B 1CQKA 2A77H 4WGVB 4XGZA 4LCCA 2X41A 2WIIA 2X7LB 2Y23A 5KSVB 1CK0L 2C3VB 3OKYA 3PUCA 4NQDE 3VFOA 4HUXA 3NIFF 4Q9RH 1OAZL 2C1PB 4I18C 1G7LA 4YDKL 1A5FH 4MB3A 3O8XB 3LEXB 5HHVH 5IROA 4O2EA 4OZHF 4CW1B 1ZLVH 1QLEH 3LPGA 1JGUH 2NLJA 3K0WA 5EBMB 4HKBA 3T65B 4CL7A 1MCWM 4YH6A 3C5ZC 3EIFA 2HRPH 4Y16B 2ESVB 4JFDB 3ZKND 2FEEL 1QBLL 4JFFE 2Z91B 4X80H 1X5HA 3O6FB 2ESVD 3BGMA 1A4JB 5CEXB 2AKRB 5CJQH 2CLRA 1X5JA 2CGRL 2YRZA 3DETC 1LO3H 4PLOB 2ATPA 5C08B 3GMMA 4N0UB 2J8UF 1NGWB 1EUTA 3AY4C 4K71B 4NRXA 5C08D 1MFNA 3MV8B 3NZ8B 5EZJA 5GGUA 4TSAH 3JWDH 1D5XA 4NC0B 2OJZH 4X7CC 2JCCE 3IDXL 5ABDE 4XVUC 4HK0A 1TPXB 2EDKA 4FQ2L 3NIDE 1EVUA 5C0JB 1CE6A 4UNTA 3CAFA 4K7PL 5HHQA 3ROLA 2B5IC 3MV9A 2CRMA 3O6KL 3T3MF 1HKLH 3QCVH 2IG2H 5EU7E 5CILH 4BH7A 4UI2A 5IW1B 4J3WA 3C87A 3FQWA 3PXJA 4NO0B 3GRWA 3S6CA 4EDXB 1ZGLB 1UH4A 2VDPH 3ZTJG 3L3OA 4LDEB 4D3CL 4JAMA 2FSEA 3MA9L 3D3VA 2ZG3A 4YXLH 3U0TB 2MPAL 3ES6A 5GPRA 2DOCA 5SX4H 1EHXA 3H9YA 4CDGC 1H3UA 2ZUUA 3BX7C 1VGKB 3U4EA 1QEWA 3NCEB 2P5WB 1MY5A 3T0DA 1BIIB 4MD4B 5C6TL 5KJRL 2P5WD 1KBGH 3LKOA 2APVA 2UWEE 4L4JA 2GITB 4S0TD 3BKCL 2FRGP 4MNQE 5F9AC 3QWRD 5LGHL 4O2FA 4HKXA 2KPNA 1JF6A 5TE4L 3KYNA 4OLZL 5DVLA 3GB7A 3CGTA 5GRJH 5B8CC 1BFVH 5EOCH 1ZLWK 3R1GH 4MJ2A 2OZ4H 5BS0A 4V1DB 1BECA 5JPMA 4PRNA 4OFPA 1S8DA 4V1DD 5JQ6H 2PCPB 4FRWA 3UYOD 1NFDA 4OD2A 3LS4L 1J1OH 2VXVH 5MENB 4HIJB 4WGWB 4PJ8B 5SWZA 3HI6H 1HINH 1YYLL 3V8CA 2EXWC 4CU7A 2DQTH 1MNUH 2AJVH 3MUGA 1CGXA 1RZJH 3LPFA 4ODUB 4R4FH 5E6YA 3U4BL 2ZSVB 4XPGH 1V5JA 3H7LA 4XBEH 1IEBB 2CH8A 32C2B 3MGAA 5CJOL 3MLWH 3B6SB 3I3BA 2E3VA 1KN4H 2FD6H 2X4UA 2NYYD 3QZWB 4HAGA 4HWNA 1KELL 4LSSH 1WWAX 3U9PL 1Q9WB 4TTGA 3FO1A 2W0PA 3GMQA 3BT2H 5F6HJ 2QSCL 1KSRA 3FRPG 5L2KE 4IS6B 5EULV 4ZAKB 2Z92A 4ZFGH 4LBEB 2BOBA 1YY9D 5CIPB 5HGGS 3AAZB 2A9NL 2D0FA 1GZPB 3R8BB 3BUYB 1MWAB 1IKNA 1RD6A 1IGML 5HVHB 4OZFB 3HPLB 2Z31C 3S35X 2VQ1A 4B7LA 1EJOL 2DF3A 5E4EB 2AW2A 3EHBD 3G08B 1LEIA 2MSPA 1T89A 5HDLA 3VCLB 3L3GB 3U7WL 3S36L 1PY9A 3LAFA 2R0KL 4Z5RB 1H5BA 3NCJL 4OQTH 5EUOE 3UDWC 3PWLB 3BO8A 5CSZA 4GXUN 5I1CH 5ESAA 1LO5A 1Y0LB 4TYUA 3RY6C 2XRAL 1W0VA 5K9KB 1BBJB 4WTWA 3DUUB 1N5AB 4YHLH 3TA3C 2P46B 4OLEA 3V6FB 5KVDL 4NQVB 3RWGB 4NHUA 5DD6B 4NO3B 5TQ2L 4Y4KC 5JXED 3S37L 1UA6L 1I7UA 1BJ8A 4TNVK 3QXAB 3VDCA 5LAXB 3ULUL 4MQXC 3KPNA 4NBYB 4JQVC 2ZUXA 2X5PA 1BD2E 1INDH 1OP3K 4UOW1 5F9WC 2R1XB 2ADJB 3KYOA 1ETZA 2GTZB 1UYWH 4QY8A 1JF1A 3S4SB 3VMNA 3D87B 4GAJL 4ZFOB 3V6OA 2IAMA 2VAAA 2WWKT 3KPSB 5MP6H 1D9KB 4XAKE 5AG8A 3K4AA 5JHLL 4OGXH 1BAFH 4UV4H 1D9KD 1KLUA 2OJEA 5D5MF 3NFSH 4X4ME 5C1MB 4P49A 3FO9B 1HK6A 2R1WA 5EWIL 2JIXA 4HXBH 1FV1B 2BOCA 3C08L 1ES0A 3MR9B 2F8VA 1MJ8H 2BMKB 1A2YA 3BQUC 3GSQB 3FT4A 3X12A 2PXYA 1NEZB 1JBJA 5LGJA 2F74B 4WY7L 3UEZA 4YWGL 3ULVD 5CMAB 5E24E 2O5ZL 2VDNL 2EZ0C 3GDBA 1Z3GL 2CSPA 3F7RA 5B22A 1IM9D 4DJMA 1DVFD 5GGVY 4WW2B 4CUCA 2ARJB 1XF4A 3FZUC 1CXIA 4YEFA 3C8DA 4P4KA 3RVTC 4S1RL 2OQJB 3MLTA 1FCGA 1XIWD 4RBPK 4ZNEE 3I6LE 2X1XR 3Q5OA 1RHFA 3GSXA 4JFEB 5L9DL 4CJ0A 1PG7X 1FZMB 4ZFFB 2OL3H 3WKMH 1GGTA 1T0MA 3LVEA 5DURD 1OGAB 2D7PA 4QXTB 3P9WB 3GMNA 3H9SD 5E94B 1YQVH 2AXGA 1TETL 1R3JA 3KLAB 4OZIF 1NMCC 3QQ4B 3GUTB 2XZZA 4K9EC 2DMCA 1AD0B 5EO1A 4AIZA 4KHTL 3IFLH 1B4JH 2VLRD 3IFOB 4LMQI 4KKBC 2YPLB 4AT6A 2P43B 2NW3B 5IEKA 1J7VR 1RVFL 4N9GA 3SJVE 3WL9B 3BKMH 3QO1A 2QQQA 3F58L 4ZXBC 2AJXH 4TSCH 1IFHH 4BZ2L 3IETA 1FN4A 3UAJC 2Y36L 1VFOA 3O41A 4DVRL 3TIDA 4RBPH 5IW6A 2W0FA 3HB3C 5I8KL 4AEEA 4ONHA 5E8EA 1T04A 4FQ1H 4AEHH 2BCKA 3UC0H 1RZ8B 2CIIA 2IQAB 1JFQL 5EC2B 3IF1A 4GBXA 1UXSB 3F5WB 4NO5B 3SE4A 4D94A 4PTUB 1OF2B 1KENH 4PRHD 2P47B 3QXDA 5D1ZC 5T3XD 1IQDA 1AE6H 2X4TB 1BVKA 4R2GD 4LGRB 1F58H 3ARXA 5DHYB 1GOHA 5I1DB 2ED9A 5I1HL 3VI4E 4H88H 2MWCA 1YECH 2ZPKL 3FL7A 3HZVB 3BPNC 3TZVA 5GSRA 1ZLUH 2BNRA 4Y4FA 3L9RB 1BVLA 1I3GH 4NYLA 4ZUUB 1I8KB 1XEDA 4MA7L 2DS4A 5TDPA 1JHLL 2A6DB 5BXFA 4PB0L 3MGOA 4OF7A 1MFBH 2Z8VC 1IBGH 1B9ZA 1V3KA 3RGVB 1ZA3A 1HNFA 1TJIH 1TXKA 4OLWL 4WFFD 1ZWIA 4QRTA 5ERWB 3AMKA 1AXIB 2XN9B 2EC8A 3MLXL 2J4WH 4XVSH 3T2NH 5J3HD 3AXLA 3LOWA 1IC4L 3SO5A 1IZJA 2XN9D 1L6ZA 5SWQA 4R7NA 4M6OH 4F3FA 5IQ7H 2WBJC 4OLXL 1KNOB 4YHOL 4TUOA 5D1XA 2XA8L 2X1PA 2QSVA 3UCRA 4WFHE 3K2UH 1M7IA 4HW6A 3QPQD 4C55A 3MV9E 1MY7A 1IZKA 2BSRA 3GSNA 4HDIA 1KTKE 1BFOB 4OUOA 1C12B 1CF8L 4Y5YA 3WFHA 4YGAB 3F7YB 4ZS6C 1RK1B 5DRWB 3FFCD 4J3VA 2DKSA 3DROB 5ADPL 3VFPA 4JQIL 3D3VE 5TDNA 4LSTL 1IM3A 3AM8C 1AXTL 4HUVA 1PG7L 1UT9A 1WJ3A 5IKCA 1CCZA 4G8GB 4FFZH 4O58L 4NJAL 3R0MA 3NH7L 4XBGB 3EOBB 2AP2A 4QOKA 1T0NB 4DZ8B 4NM4H 2FATL 1MJJB 4X9HA 1F6AA 1FH5H 4TVPH 4MS8C 1FZOA 1BQHG 4Q6YA 3VFWB 4WCYH 4GXVH 2HFGH 5BQ7B 4L8SA 2V7HA 1JGEB 1FFNA 4NWUL 5DMJB 3GSOA 4M7KL 4BUGA 2W9EL 1S78D 4NOBA 4XX1G 2YUWA 4PRID 2VERN 2EDQA 3PGFH 3RWEA 3U0PB 3K8KA 4LDLB 1CVSC 4GKZA 5GGRB 5BS0E 4ODWA 5EBLA 5JA8B 4L3EB 1A1OB 1J8HA 1IGJB 4L3ED 1NFDE 2ZG2A 1HHIA 2H3NA 2PYEE 3ARTA 3TNNA 3VD7A 1A6VL 3FMGL 3QUKB 1UKSA 5ACZA 4CU6A 5CGYD 1ZT7B 2MCG1 3EJYC 4IRSD 4M7ZC 2CDGA 5SWZE 1AH1A 2KUTA 1CL7H 5C2BL 3B43A 3B9KC 4ZUSB 3JV6B 1GJIA 5D93B 4HD9A 3RWJB 4ODXB 4LLQB 1S9YA 4P5MA 4TPRH 2NZ9C 1KEML 3CFEB 5DJ6B 2O5XL 1F6LL 2CR3A 4GRWH 3QUXD 1JJUA 2XZQH 2HT4C 4G6JL 5ID0A 1EO5A 2HJLB 2R0LL 3V0WH 5I17A 3MLRH 1TZHB 3VA2C 5IFAH 4ZOBA 3UZEA 1KJ3H 5DMKB 4NWTH 3K8MA 1A3LL 1QNZL 2B0SL 4RZCA 3ZMRA 43CAA 5KTEH 4X4XA 2HP4A 2YKLH 3P73A 4L1HA 1HNGA 5B3JE 1VFBA 4HIXH 4Y5VB 3RX7A 1MHCA 1P84J 4HJGB 3WJJA 1YEIH 3PWJB 5E1AA 4LLUA 5IV2A 1I8IA 6FABH 3BHBB 3MRDB 3BAEH 1CXKA 1DQTA 2EECA 3GRWH 2CK2A 1ZVHA 4LLMA 1BGXH 4H26A 2IALB 4LPCA 2W0KA 4XCYA 2GUOA 3CXHK 1DLFL 1JNNL 2NY4C 1A6WL 3TBVB 4BSVB 4GRLB 5FUZL 3RNQB 3OR6A 3MBEC 1JYVA 5LBSH 4DKFH 3JBG7 3TP4A 4HKJB 3K2MC 4V2BA 4F2MB 1MQKH 1OCWL 2DRUA 4TSBH 4ZTOL 3ZYZA 1QP1A 3T2PA 1HQRB 3U0WL 5FO8B 5H35B 4P9HC 1MFDH 3RZCA 4GFTB 1D5BB 4APQB 5AG9A 3V7AE 1QSFB 1VFAB 4WWKA 1CGYA 3ARDA 3O2VH 4NQUA 5AYQA 2K7QA 3I6GB 1U8LB 4M4RA 3VXUA 1JK8B 3EAKA 1ZA6A 2P8MB 4FQXA 2VKXA 1VESA 2NNAB 2V2WA 5FHAL 5JA9A 1TZIB 2DQIL 1E4WH 1U3HA 2DTSA 1FQ9C 2KBGA 4GH7B 2DL2A 5J1AB 1I8LA 4WHTB 2B4CL 4RMQA 4LCWB 2P24A 4GOSA 4QNPE 4WVRA 1CDGA 3KPRB 4LAQL 2NR6D 5C09A 2Y07H 4U1LA 4X5WA 4RMUA 1K4DA 2ZUSA 2CQVA 1OPGH 1UADC 2X4QA 3GMRA 1LO4H 2FX9H 3E0GA 1QA9A 1WF5A 4F37F 1HH9A 4P2CG 1FNGB 4XBPB 3O45B 3RVUD 1SJHB 4I8DA 4WI2A 3QDGE 4D2NA 4OCSH 1ZHLB 3HZMB 4PJAF 4G42A 4YZFE 3DX7A 3N9GL 3FONA 3WMSA 4OD1L 4PGDA 4X98B 5ITBH 2C3XA 1AGEA 3LZFL 1TQCC 4ODVL 4OZGF 4RGOL 2J2ZA 3GSUB 5GRXG 3F62A 5C0AA 4YBQD 2WV3A 4I3RH 1OAQH 1W8NA 4KRPB 2V17L 1MF2H 4NKMB 2FJGA 4JJHA 1N7ML 1RJLB 4WV1B 1OAKH 5AZEL 1INQB 2X2YA 3D2UB 2G5RA 3GMOB 2VZ1A 5C0BE 5K9OA 1CFSB 4NQDB 3TM6A 1WT5A 3OKKB 1RU9L 4C59B 1DDHB 5A3IC 1X5ZA 5IEHB 5E08H 4WTXA 3P11L 4PJDA 5KOVC 4YDLB 1VKXA 1EZVX 1SBSH 3C5ZD 3EFDL 3LV3A 4EI6A 1BEYH 2HJFB 4JDZA 1I85C 1MCCA 3GHBL 1FNEA 35C8L 3SO3B 3ARYA 3SKUD 1F3DH 4GXUM 1ONQB 1S9XB 4JFFD 4ODTL 1MLBA 3DETD 1KCRL 5EC1A 5EBWB 3X3FL 4QRSA 4HAFA 1AGBB 2Y6SC 1A02N 5I30L 1KTLB 2YD2A 4A2LA 4G3YL 3VH8A 4M6ML 3FT3B 3RIAK 3BISA 5EU6A 4TULL 1EEYB 1VADB 3S88H 2SEBB 3QUZC 4PJXF 5J12C 3PV6A 1NGQH 1BVZA 2ADIA 3N1MC 4PFEA 4XCCL 4XVUD 3U1SH 3HI1A 5TJWK 1KG0B 3P4OB 5EFIA 1D3CA 1OQXA 1SJEA 4RGMC 4X6BB 4ZDHB 3BP5A 2XQYG 5D6DA 1LP9E 2X4SA 1WWWX 5JOEA 3W9DB 3VFRB 2B39A 1FAKT 4OKVA 4QRQA 5JORB 1YDPB 4UQ3B 3U83A 3SE9H 5A2LH 1ZVSB 1DE4B 4U3HA 5B38A 1FJ1A 4K94C 3SGEH 4J23A 3EOAB 5DC4B 3QQNA 2CK0H 5DJCB 5IGXH 4YGVB 1E4XL 2ITDA 4LLDB 2V5RA 3LMJL 4QTIL 3WXWH 1Q0YL 3CZJA 1P6FA 1A14H 3U2SB 1SM3H 3WUWA 5FGCE 1BIHA 3CH8A 1M1SA 1QLRB 4JVWA 1FDLH 1XF3A 5SX4I 4OZ4A 4L5FL 3EYSH 1H3VA 4F9PA 4GG6A 4YR6A 5GS1C 3NA9H 5DVKA 2UWEB 1JNHB 5CJXC 1OLLA 4PP2B 5JIKA 4LF3B 4MNQB 1MFCL 1YMME 2DYPA 4ZSOE 4HUWB 2UVEA 4LSQH 1MCKA 4MJ6B 3ZSSA 4DAGH 4WUUA 2AJZA 3L3IA 3QEHA 3WN5A 3GMPB 4UDTA 4DGVL 5E5RB 2B2XL 1PZ5A 2F54D 2BVQA 1KB5A 1GC1H 1EERB 5INDB 2JF1A 1MREL 5JIPA 1D5MA 4NFCA 1MRCH 1KGCE 1U8PA 2DQEL 4XNYL 1J11A 3VMPA 4KUCD 5EZOL 4Q74A 1OW0A 3MNVB 3VGDA 2D7QA 2EXWD 4UTAL 5T3ZH 3T1WA 4R8WH 5L6YL 4PJCA 4QOKE 5FM5M 5FK9B 1V7MH 2HKFL 4KQ3H 4C56A 5FA3A 1A47A 5I1EH 3GKWH 3MA7B 4YE4L 1FGNH 4M1DL 5GJSH 3SCMA 4M3KB 1ZHBB 3FB7B 3RL1A 3OG4B 1X9QA 5E8PB 5KANI 1N59A 3IDGA 4PR5A 3WYRA 5L2KB 5IMMA 5FV1L 3CZFB 3WNMA 4NQSB 1IJ9A 2BVOA 1JNJA 3MLUL 2OM5A 4LPWA 2AV1B 3U30C 1WCBA 3HS0A 5FYKL 1IC1A 2YPVL 4G6FD 4W6WB 3LSOB 1WVZA 5HGBA 1J8HE 1FG2B 1T1ZA 2Z31D 1U58A 1BJMA 2PW1B 3L3DA 1MAKA 3HZYB 3IDIB 3QISA 1PLGH 3OKEB 5E03A 1QKZL 1W8OA 1AC0A 3AMLA 5EUOB 2WM0A 5GQBA 4FABH 3JXAA 2OTWB 1IQWL 3KYMB 3WDHA 3WIIL 1ED3A 4KHXL 1X7QA 4EXKA 4MHHG 1IC5H 1KYOK 1NCCH 3TA3D 4DOHE 5C71A 4RQQA 1U8HA 3HMXA 5DUBB 1DBML 2H6PB 2PW2A 4JM2B 5GGSB 4MB4A 2J88H 4Z95L 5GIRA 4F15C 4P46B 2EH7L 4Y4KD 4TTDC 5CZVH 2X89D 2WNGA 5F9WB 1B3JA 2ITCA 4MD5B 4MQXD 5TF1H 1TQBC 4FN0A 4GAGH 1U8OA 2HYMA 1MJUH 1BD2B 1CGUA 1OAXH 4FP8L 1QVOB 5FYJD 4PJGE 1B6UA 1S5IL 1CXHA 2DJ4A 3GJEB 2JJSA 3MUY1 1MRDH 1D6VL 2R4SH 3LH2H 4HG4K 3GSNH 4WO4A 5JXAL 4I5BB 2RAMA 3BJ91 3QXUA 1L0YA 3SHSA 3U7YL 1W0WB 4LCIH 3C2SA 2AQ3A 1MCNA 4JPKH 4GRWF 5I6XC 4ZS7H 3PABA 4AIXA 5JOFB 1U93B 3TH3T 3T3PF 3KJ4C 3OR7A 4XAKD 3SDXA 4A6YL 4YHIB 1XGRA 4XP9H 2Y06L 4Y1AA 4DUXA 4OCNC 5E6IC 2YD7A 2AJUH 3EO1A 3BQUD 1K8DA 3KPOB 3G9AB 5GGTL 1WBZA 4EI5B 1X5FA 3UTOA 4HX1B 4F58H 3RDTA 4GW4A 2EZ0D 4UT7L 3NACH 1M4KA 5IF0A 2DLFH 1RUKL 4AQOA 4HS8L 1F13A 2GCYB 3F7QA 3LN4A 2QLVB 3T0WA 2C3HA 3QIUB 4OB5H 2FYYA 3MRCB 3VRIA 4F7PA 1UJ3A 3FZUD 3PWUA 5DEGB 3VXUE 4QXUH 1FNLA 3BZFA 3OGOE 3RVTD 2DMBA 3MRLB 5B3NA 1H3PH 3J8F7 5T1DH 1IAIH 3MRNB 5EN2A 3UTSA 4U3XA 1AHWB 4IM8A 3NFNA 4YHYC 4ZYKA 3B2VL 3LRSA 4JVPA 2XWJB 2I24N 4M8VA 1AO7D 4M8QB 1I9RL 3QQ3B 3HE7A 5C09E 1S5HB 2BHUA 3D6GA 5T1LD 2P8PB 1PQZA 1Q9KB 3BVNA 1XGTB 3BWAB 2Z93B 5EZIL 5ICXA 3V52H 5C8JA 3AGVA 2HLAA 2AEWA 3HNSL 2YEZB 4U1MB 5C0GB 4HT1H 3A6CL 2NY2C 4Q6IC 3MJ8B 4UIMB 4KKBD 5TE7H 2XV6B 4PJHA 3REVB 4Q0XL 3ZKMC 5DI8A 4P5TC 4N0YL 2APWA 2B1HH 1TTUA 3SJVB 1Q94B 4ZXBD 1G9EA 4JRYE 5C0AE 3V4VL 3UAJD 1L7TL 3SJVD 4EDWL 3HB3D 3RVXC 3S96A 3LD8B 2DI8A 2GKIA 5EZLB 1U2HA 5DMIH 3VXSA 4MA3A 2F8XC 5DQ9A 4LCCB 2WIIB 1V8HA 3T0EE 5D1ZD 2FWOA 3VXRE 3VFOB 2XQBH 2R69L 3CNKA 1G7LB 4PJ9A 3B9AA 3CDFA 3BD3A 5CSBA 3T0EC 3N85H 3VE0A 4BFIA 4KTEL 2OMNA 3FAXA 3QIWC 3C6LC 4PJDE 2NLJB 2D7TH 4HKBB 1UQSA 1KIQA 1N0XH 1SJXA 4N0FA 2BRRH 4NUGH 3BGMB 3HFML 5E2UH 4GMTH 4PJ5A 3RUGA 2CLRB 4LSPH 4GRWB 1KPRA 4DTGL 3JTTA 4JPWL 2ATPB 3GMMB 5FYLH 5ANME 3O9WC 4TRPH 4H1LG 1DJSA 4NRXB 1EDQA 4L4TA 5EZJB 3BESR 1W72A 2WBJD 3KR3L 5GGUB 1D5XB 3UPCA 4UBDC 5E99L 4PB9H 1RURL 5DFTA 4HK0B 3IDMA 1HHGB 3QIBC 1DQMH 4NGHL 3OAYH 4FQCH 5HHQB 3ROLB 2OR9L 3MV9B 4RNRA 4PYGA 5DTFA 4RFOH 4S1SL 1NJ9A 5D8JL 3BP6A 3VU2A 4BH7B 1T0PB 3VW3L 5FGBA 5DF0A 1BBDH 4JB9H 3FQWB 4MCYA 4ZS6D 2UVFA 4G6MH 4CVWA 3SKJH 3CDGB 3BW9A 4NSKA 1LDPL 4L9LA 2FSEB 3D3VB 4M5ZL 3VGGA 5DK0A 5JPNA 1CLYH 4Y5XC 1MJ7H 2GY7B 4I77H 5C6PB 2WIMA 2IPTL 2XTLA 4QXWA 3ARFA 3U4EB 2YK1L 5D1QA 5IVXA 1UWEH 3MLVL 4HULB 3HZKB 5T1KD 3LKOB 4MS8D 3WSQL 4OCMC 5I19H 3NMEA 4GG6E 1RHHA 2H32A 5I8OL 1OM3L 1N4XL 4GW5A 3I50H 4Z7VF 4PJEA 5DT1L 4O2FB 4HKXB 5FYJU 4LEOA 3KYNB 4H8WL 3GB7B 1UM5L 2G5BA 4QKXB 4DUWA 5J6HA 1RZKL 3PQYE 5DQDL 4LSVH 4JZJC 3CLEH 5HHNB 1OWRM 2CIKA 3OX8A 3HNTL 5BS0B 1KB9K 4S1QH 3EDEA 5JPMB 4PRNB 4YPJA 1S8DB 1MWAL 4ACPA 4LGSB 2LVCA 1DTUA 1MCFA 2BSSA 1NFDB 3WIFA 4XCFL 5C0RL 3DO7A 3SKOA 3EJYD 4J6RL 2WAHA 2BJML 3P40A 2PYED 1I8MA 3B9KB 3C9NA 5SWZB 4TQEL 1A4KA 5A2JH 2H26A 3B9KD 2VDOH 4ZG1A 5BW7C 3MUGB 4PJCE 2RFXB 2NZ9D 5FO9A 2DQCH 4J4PC 3C09B 5D7JC 4C56E 3V5DB 3WFEL 2BVPA 2WBWB 4UB0L 2HT4D 3QA3A 1CL7I 5L2JA 2ZP0T 2IGFL 3OKNA 4HCRA 3HRZB 1MEXH 3V4UL 3ULUE 3OGCA 1C5DA 3ZSTA 5CEZD 2XG4A 4WU7A 3FO1B 3GMQB 4IOFC 5HYIA 1CR9H 3SDAC 4K7PY 3ULUC 1MCOL 3SE3A 1TCRA 3MBXL 1OGTA 1UEYA 2Z92B 4LP5A 4FQHA 2BOBB 1WFUA 4LSUH 4RFEA 5I1AA 4XMKH 4RCAA 1NFIB 1UENA 3KPQA 4YLQT 2A74A 4Q9BA 2VAJA 2VQ1B 4R7DA 4HUMB 4ZFOL 3AS2A 1A6UH 1NPUA 4OIIH 2VITA 1LEIB 3WLWC 2LV4A 3VI3E 3VGAC 4AIOA 3QHFH 1B2WH 2NY4D 3B8YA 1H9VA 4OLVH 1H5BB 3MBED 4IEFB 3UTZA 3B5TA 3JV0A 5CSZB 5DA4A 5JIIA 1LO5B 4LLVA 1FG9C 4MGXA 1HHJA 1W0VB 2FHFA 3MJ6A 5E9DA 2EKJA 1AI1H 5GGVH 4MXVE 2V7NA 2DQJL 2VL5B 3QRGL 1OARH 2YD8A 4R4NC 3HNVL 1KCKA 3PWPA 2MMXA 4ORZC 1I7UB 1JUFA 3ZE2F 5T1MA 3GGWA 4WI9A 5TF0A 3MQIA 5CBAA 1CE1L 2PUQT 4QHKI 1T66C 1TZGH 3OXRA 1AP2A 4GO6B 1ETZB 1GCFA 4QY8B 1JF1B 1N5YH 1FP5A 1KB5H 4YHKL 2OSLA 4TNWF 4RMTA 1L7IL 2IAMB 2VAAB 4EBQL 2VXSL 3UTTA 1JRHH 3BP7A 1KIRA 5KG9A 15C8L 5FHBL 4OFKA 1J1XL 4ZTPL 4QRRD 5HYSA 2ENYA 1XT5A 2R4RH 4XP6H 1KLUB 2OJEB 1KXTB 2YA0A 1PX4A 4PJFA 2AI0H 4Y1AE 3PJSA 3QEQA 1MFEH 1LILA 2JIXB 4OCXH 2BOCB 2W91A 1ES0B 1YEEL 2YD6A 4KPHL 1A2YB 1TITA 4PPTA 3FT4B 4CN4A 4LCYA 3X12B 2BK8A 2IANA 2PXYB 3PWVA 1RUQL 1SMAA 2VDQL 3L5HA 3QDGD 1GXEA 1DQDL 4YHPA 1X5LA 4LOUC 2VISA 1AC6A 1MI5D 4L29A 1NC2A 4JO3H 1GGYA 5D70H 3KXFD 4PJ7A 1RIUL 1I7TA 4F7MB 2R2HA 3SQBA 1XF4B 4EUPA 5GS3A 3E2HB 4P4KB 3GO1L 4UT6L 3MLTB 5HHXL 2E9WA 1MCBA 3CSGA 1DFBH 3PP3K 5I0ZA 2MQ0A 4XWGL 1FFPA 5A3ID 5C0BD 3CFDA 5F9OL 3GMNB 5GSVA 4JY4A 4GMSH 5FIEA 1A9BA 2AXGB 1ZAGA 1R3JB 2XY1A 1ZOXA 3C5SA 3C60A 2YUXA 4P3CL 1KXQE 1KJ2A 1UB5A 4KRLB 3KVQA 3AU1A 3VD3A 1CDHA 4CU8A 3MLSH 5EO1B 2AXHA 1T2QL 1DUYA 2Y6SD 3BDYH 2C3WA 3W2DH 3ARSA 2M8XA 4ZNCD 3G6DL 4LIQH 4AT6B 1B88A 5IEKB 5C2UB 1DEDA 4KKLC 2IFGA 4R96A 5GJTL 3HMXH 3QUZD 3C8KA 3QO1B 4QWWC 5HYQA 3NVQA 1FZJA 3IETB 3QH3A 1FN4B 1E4JA 1QHOA 1JGDB 3O41B 5EO0A 4DK6A 1WUNT 3TIDB 5IW6B 2W0FB 5JO5A 1DL7L 4ONHB 4X6DA 5E8EB 1T1XA 4X4YA 1T04B 2BCKB 5J9PA 3ARGC 2CIIB 1FO0A 3IF1B 4GBXB 1NLBL 3I3EA 3VGEA 3QXDB 1IQDB 1WBXA 3EGSA 1LP9B 1BVKB 3OKOA 3KPPB 2E9BA 5F72S 1Q72L 2DQGH 3TZVB 4F8QA 1NEZG 2D7NA 5F7EL 4P9ML 4P2QE 4J2XA 4P23C 5GSRB 2DTML 3LKSA 2BNRB 4Y4FB 4GG8B 1BVLB 4NYLB 3G5VA 2FX7L 2HTLC 2WUCL 1MAJA 8FABA 2EKSA 1CICA 2KZ1B 5TDPB 3MJ7A 5BXFB 4JRWA 5FGCB 1ZSDB 3MGOB 2BP3A 4JJ5B 4PJ5E 5F7FA 1WTGT 4CADB 3SGEI 1ZA3B 4TUKH 4WUKL 1ZWIB 4QRTB 4HBQA 2XACC 1NBYB 1J1PH 3WUZA 3L7EA 4O5LH 3AXLB 1IEHA 3OXSA 3SOBH 3QUYA 3L3KA 4LQ1A 1CZ8L 2OLDA 5SWQB 4R7NB 1QBMH 2WK2A 4F3FB 3TYGL 4ZSOB 4JHWL 4DW2L 2DWEB 3MRBA 1YMMD 2NY6C 4TUOB 4YK4C 1P4BH 5D1XB 5BO1H 1M7IB 5D7LA 1T5XA 4Z7OF 2RCSH 4MXQC 3GSNB 4HDIB 1CDBA 3P77A 1A6PA 1F97A 4Y5YB 1DEEB 3CC5B 3LKPA 3WFHB 8CGTA 1T03H 3CVHA 4AMKL 4N8CH 2LU7A 5L7XL 2KQNA 2ADFH 3O2DA 1DBBL 3VFPB 1LO2H 1H3WM 3LQMA 5TDNB 1IM3B 3I02B 1U9KA 2F53D 4IRZL 3SKNA 4KMTL 4HUVB 2NY0C 3ECBA 1YC8A 4HBCL 5IKCB 4PGBA 5DD0L 1NLDL 1R6VA 3KHQA 4FTVD 2EC9T 4QOKB 1UCBH 1MHPL 5ILTH 3QHZL 4UINL 1F6AB 4CN6A 5IM7A 4LPYA 5CEYB 1MHHA 1MCIA 1FZOB 1VPOH 5ITFA 1FNHA 4JO1H 5F3BA 1IKFL 3QEGH 4L8SB 2V7HB 5TPWL 1FFNB 3GSOB 4PJEE 3ZTNL 2R2CA 1II4E 1KPUA 1NBVL