5D1XB

Isdb neat2 bound by d4-30
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
217
structure length
212
Chain Sequence
QVQLVQSGSEVKKPGSSVTLSCKASGDTFNTHTYSWVRQAPGQRLEWIGGIMPIFAASKSAPHLQDRLTITANKATRTAYMELTSLTSDDSGVYYCARDGRGALQYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords D4-30 Light Chain
total genus 30
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1xB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1xB01
3HRZB 3RWFB 1F4YL 4LEXL 3L3OB 4LVNB 1NLDH 2L7JA 3GNMH 4XWGL 3BSZH 5D1QA 4S1SL 4D0DA 1LK2A 2OR9H 2XFXB 3O4OC 5KVMC 3AROA 1OGAE 4Y0GA 3RL1B 3PABA 4JN1H 5D2LE 3MLVL 2OZ4A 2XTJC 4Q9QH 4HLZG 4QXTA 1FZOA 2B1HL 4U1KA 4POZD 1ED3B 2F8VA 3G5YA 3C5SB 2YEZA 3F65A 4HHAA 3FRUA 3D3VA 5CLTA 2EDYA 2VDQH 5DRXB 3C2AH 4NRYB 5JW3H 5E9DB 1JWSB 3MREA 2DKSA 3BUYB 4XPHL 4OJFL 5B38B 2M26A 3HR5A 4P3WA 5GRWA 3EDKA 1UWEH 1OQXA 3JV4A 2BNRE 1U8LA 1BREA 3X11B 4XNUL 5IMKB 4K94C 4KJYB 3BSZL 4JFOA 4UZGA 4P5TA 3W0WA 3IJHA 5CD5C 3WO4C 4F37K 1AY1L 2X5PA 4LLWA 1YJDH 2DLEA 3BP7B 1DQJB 3LHPH 5ESQA 5BS0B 3PWPD 5IBLD 4X6EB 4YHYB 5MP6L 2FD6H 1LGVA 1EXUB 1FZKA 2VDLL 1CFVH 2JELH 2Y5TA 1T5WA 4NBZB 3GJFA 3ZTNL 3PGCB 3QCUH 4M93B 4PB0H 4WNQA 2GKIA 3O2VL 2VDNH 1XMWA 4LEOA 4HCRH 1ZHLB 3ARDB 4K3EH 1ZKAA 3A0OA 2O5YL 1NDMA 4ZUUB 3VGAC 4PV9A 2KUTA 2IH3B 3B6SB 3LEXB 3RX8A 1Z9OA 5H35B 5ADOL 4JDVA 3BHBA 2XRAH 2J2ZA 1U9KA 4HIJA 2GHWB 3BP7A 2VDRH 2OR8A 3Q5TA 4NHCL 5EIVA 2BVOA 4FQXC 3RQ3A 3D39D 2RCSH 1FZKB 2CJUH 3BH9A 3ULUF 1NUNB 2BXZA 2OP4L 2YA2A 4O9HL 3L95A 1G9NH 2A83A 3QZWB 5GGSY 1HN1A 1H3PL 3GBNH 2QKIB 1PVHA 5GGRY 5CJOL 4WJ5A 3QAZC 3O9WB 2JELL 4GO6B 4KH2A 1GVIA 4R3SB 3NPZB 4HIIA 3T0EB 4GBXC 1QLRA 2P24B 4MS8C 2VZOA 2APWA 3EFFB 3D18B 3MGAA 4U6TA 3LPGA 5KZCB 2H6PA 1HXYA 1ZS8B 3W2DH 4NO2A 1L0XA 4G43A 5EOQL 4ODXB 3DX6A 4W70A 3L3IB 4K9EL 1N5YL 4X6BB 1WZ1H 3HI6H 3CSBA 1KPUB 3O45A 3MJ7B 2IPUG 4JFEA 3NCYS 5E5MB 3C60C 2VDMH 3C60B 1N6QH 2H9GB 3HNSL 4S1QL 4AEHH 4ZFFB 3CH1B 1IFHL 1A9EB 4UUJA 2KZWA 1NFDF 5B39A 4WFGE 4NFCA 2J6EL 3RU8L 1RJCA 2BSRA 1F11B 3BD4A 4NO3A 1HZHL 4R26H 3DSNA 2X9XA 2YXFA 3HS0B 4KZEL 4PJHF 2BNUB 4UQ2B 1B4JL 4D0BB 5AYUL 1RMFL 2VXSL 5IJKC 4KI5F 2FGZA 3B5TA 2YK1H 1S8DB 4G9FD 4CL7A 1OAKH 1L7TL 2YSSA 4I1NB 4BYHA 1CE6A 2RHEA 3L3HB 3QCTH 4F9LA 3QDGD 3C8KB 5IESL 1NSNH 4B0MM 4EDXA 2FX7L 4WFEE 5D1ZA 3GGWA 5KVDL 1J7VR 3NGBB 3PWNA 1DSFH 2D2OA 1I1FB 2JK5B 4NO0A 3OR6B 3IVKB 1Q9KA 3P4OA 4Z7WF 4D0BA 2EDFA 5HYSA 1KGCE 4MA3B 5LQBL 3IB4A 3RU8H 4KJQD 4UTBL 2F58L 5FGCB 3WFCL 3S3PA 4C54A 3DETC 4JPVH 3ME0A 1AFVL 4V1DB 2PTVA 2HT3C 5DUBA 1A64A 2NLJA 3MBEC 5C0AE 3BAEH 1YYML 1WTGT 5EU7E 3L3GA 4DK6A 1NCUA 3WUWG 3KLHC 3TCLA 4U1JB 5C0IA 3OG4B 3PG2A 4KMTH 2A0LC 2WUBH 3RZCA 3TJEH 5JHLH 1I1AC 2V2WB 5CMAA 4PD4K 5E6ID 4YK4B 3DROB 4AG4H 5I74C 1AJ7H 5FK9A 1NSNL 2YA0A 1J1OL 4PJ5D 5F44A 3S7GA 5J6GA 3DX9A 1JF5A 4HUMB 4WUUB 5FO7A 2LU3A 5B22A 1A14L 4HKXA 5F7LB 3D25A 3Q3GA 1XR8A 5F1SA 3QWOA 2I60H 3UTOA 1HHHA 2CDEA 1RI8A 5DWUH 1QLEH 1GGBL 3VH8G 3CDCA 1BD2E 1AC6A 3I02B 1NGXA 3EOTL 1ZEAL 3GSUB 4NQSB 1HNGA 3DBXB 3OJDB 1YEFH 3MLRL 2LE9A 3DXAB 2NY3C 2QV2A 4LCYA 3FONA 1Q38A 1Y18B 1FAIH 3LRSA 4PJIF 4MD5A 4RAVA 3TC9A 2DTML 1AXSA 4Y16C 1LO3L 4XVSH 4EN3D 3GJFB 4GKZB 2FZ3B 1UH4A 4PRHB 3BP6A 5DHYB 1XF2A 1AD9B 3OB0H 1NEZB 3FMGL 1RZIB 2BOBA 2R0WH 4NC1C 5I18L 3HC4H 1LP9F 4J7RA 2FYYA 5CFHA 1D7FA 3FN3A 4QHLB 4JVPA 5BS0A 4E41E 4EDWH 2PO6D 4H25A 5SWZB 3DUSB 2WW8A 2I5YL 4XCEA 4CDGC 1D6EB 3HPLB 3O3EB 4WFHD 5CZVL 4K71B 4NSKB 1MRCL 1L7IH 1A21A 1VERA 1CXEA 4HQQL 3KWWB 2R9HD 1LWRA 3PWVA 2W9LA 4XXCC 1GOHA 1NAMA 4Z7NE 2APFA 1RPQA 4NM4H 4XP6H 4LCCC 1YYLL 5FA4B 5FDYA 4RFNC 1GIGL 1NBZB 2VL5A 4RFNB 3A6BH 4D9LH 4X4MA 3FFCA 3B8SA 4OZGF 2YMXH 4FQCL 1S7RA 5TE7H 1BGXL 3U7YH 3GEWB 4LVEA 5EIQA 1IRAY 4QTHA 3A6CL 4IM8A 4RWYL 2R1XB 4TSCL 4KKLC 3E1F1 4MQXD 4JRXA 1QSZA 2VLKB 1B4RA 3MA9L 1R3KA 4JQIL 1FNEB 4AT6A 2I5YH 2NY2D 4N9GA 5AEAA 4DZBA 3TM6A 3IU3B 5C86A 5IMLB 4U6HA 1JHTB 2EDDA 4DAGL 3QFDB 1MRCH 1TZIB 1UACH 1J0HA 1LK3H 4LGRB 3SJVD 2BSSA 1DLFL 1PKOA 4U6XB 4XMLH 5HJ3A 3KG5A 3HNVL 1XH3A 1CL7I 4NKOB 4DTGL 1FV1B 3K8KA 4GS7C 3LKRA 4HC1L 5ITFB 3SPVB 4M9OA 2OZ4L 3L3IA 3HC0A 1XGUA 4KKBC 5C0BA 5HHOE 5IW1B 3BXNA 3VDCA 2ADJA 1G7HA 4Z0XB 3S37H 1T1WB 5H94B 3VMOA 5DK2B 5DK2A 1D5ZB 2EE3A 3P0YL 3MBED 2DMCA 3BGMB 3T65A 4M1CC 3TN0A 1IM9A 2QBWA 4NDMB 3EFDL 3J8F7 2HA1A 2V6HA 4AM0B 5IJVA 3FO0H 3V5DB 4IEFB 1GL4B 4MDJB 2FX9L 2X4PA 3GJFK 2BNQE 3ES6A 3MLUH 3OHXB 1MHCA 5D9SA 2GK0B 2KDGA 2R1XA 1P6FA 5F8QC 4G8GE 1UACL 2VN7A 1TFHA 3E3QE 3WDHA 3RIAK 1FFNB 5HYSB 3HC0B 5MENA 5DC0A 2MQ3A 4HBCL 2EDXA 1DUZA 25C8L 1OTTC 4OI8A 3OGCB 1A3LL 1BQHG 3UBXI 2PETA 4JRXD 2KPNA 3HC3H 3E2HB 4PGCA 2NXYC 5JW3L 2AJ3B 3OXRA 1N3NA 2ARJQ 3SDXE 4WEMB 3F58H 4DZ8B 3D39B 2AJVH 2IPKA 3HCVA 1MIEH 4P2QB 4UOW1 1JUFA 2VDOL 3HLAA 4K7PH 1FGNL 2VLRE 1ZLSL 1RV6X 3E8UH 3VFUB 5BVJB 3Q1SL 1WFTA 3UO1L 4OZFG 3TJHD 1EHAA 4ZFGL 1SEQL 3HRPA 1QBBA 1KPUA 4PPTA 5CSBA 4M43L 3LHPL 3QIBA 3DYOA 2KZ1B 1MWAB 1DANT 2AK1L 2VB5A 4DUXA 3BYTA 3I02A 5I66A 4JQXC 1ND0A 4UUJB 3RVVD 3VFVB 1J0JA 3PQYD 4PJ9C 3IXAA 4LQFL 4XI5C 5TGBA 4C83A 2HLAA 5A3ID 5ACZB 3TV3H 4P4RB 4YHLH 5I1CH 4ZXBB 4WUUA 5FO7B 1NC2A 3P9LB 2IBZX 1VGKB 1UQSB 2XICA 5HGDA 4NQCB 4QRTB 1J8HD 5E00A 4WY7H 4PUBL 2DMKA 4M9PA 1CFSB 2YEZB 1T04B 3UCRA 2IMNA 2XN9D 3ZTJG 2X4NB 1RJLB 5D93C 3SGEH 3DRTA 3O3UN 5CEZD 3DBXA 3FT2A 3HMWL 1JYNA 3BDYH 4HFUH 2OTUB 2FZ3A 4ODBD 1EUTA 3RI5K 1UZ8B 3KPRE 4KRLB 8CGTA 5T3XH 4XPTL 2V7HA 1DANU 4FMFA 4X4ZA 4W6XB 4D9RD 2MCG1 4BQ8A 4KJYA 4CAGA 1NCNA 1HHGA 1WWAX 5D4QA 1A6VL 4LLYB 4AYFA 5L8KB 2CLVB 3QI9D 4EKXA 3T4YA 1KCSH 2P5EE 2MKWA 2DJ4A 3KPSB 4JEGB 3L7FB 3WKNA 43C9B 1RU9H 1QFWI 1MCCA 2WUCL 1A7RL 1AGBB 3BGFB 4QCIA 4ZODA 1NEZG 5FO8A 1OLLA 4W6WB 5EOTA 1CU4L 5DD0L 3HE6B 3Q2CA 4GQPH 5E6IC 2XG5A 1UADC 3BPNB 1MFDH 1ZGLB 4PRPD 4GW4A 4Y5VC 2R2CA 3TBSA 5ICZB 3QIWC 1SY6L 4IJ3C 3MSPA 1QFPA 1FL5B 4Y4FD 4H88L 4I3GA 5HY9B 4ZSOB 1WC7A 2ED9A 4KPHH 4J2XA 2F5AL 3N1FC 2AVGA 4B41A 3ARSA 4U7SA 3ILPB 5JO5B 4FQJH 5IIEB 1JZ5A 3SY0B 1DFBL 3BEVB 5TPWL 1YECH 3EOBB 4HULB 4NP4H 1DN2A 1QSFE 4KK5D 4JB9H 1KCSL 3EUUA 4Q2ZA 3OB8A 4YBQD 2CIKB 4GOSA 4KUCF 4YGVB 3DI3B 3P73A 5I74B 1VFUA 5E9DD 2BRRL 1X7QB 3KPOB 1IKNA 1L0YA 4GMSL 3SKUD 5JXED 5F6HI 4Z95L 4HEME 2BVQA 2BVQB 1WBYB 3ISWA 4AM0A 3PP4H 1FV1A 2VDPH 1OGAD 1NQBA 3VFSB 3ZDZE 4YFEA 1NEUA 1A6UL 4GXVH 4O2EB 4IRZL 4HWBL 4JHBA 4NJ9H 2F58H 1FH5H 2EC9T 5EPMB 5I9QB 3W39A 5JIPA 3BH9B 4MJ5A 4YE4H 5CAYB 5BW7A 3QEUA 5EU4A 1EUUA 3MJ7A 4WO4A 3BO8B 3BAEL 1A3RL 3T65B 5E2TH 3TBSB 3TN0B 1OB1A 5ICZA 3P0VH 1MIML 2Q7YA 3EJZD 4YBLB 3EKCA 3O3AA 2BMKA 5TQ2L 1JGDA 1KEMH 2CLZB 4W68A 2XTJB 2F15A 1TQBC 4HF5H 1ZSDB 3D18A 3HZYA 1Q1JL 5J89A 2X4TB 2OLDA 4X4XB 1A14H 2PTUA 4M5ZH 4GRWB 5LBSH 4GAFB 3I50L 4OFDA 5E8EB 2LVCA 3K1KC 3VD7A 5FYJU 5L7XH 1R24B 2IBBA 5DJ2A 4RMSA 5CBEB 4XP9L 4MHHI 1JV5A 3NTCH 4NQDD 5E2WL 4KVNL 1P4BL 3GRWA 5DT1L 1L9MA 1FH5L 2NY2C 4YDLB 4QOKA 4OFYA 4R3SA 2PW1B 4ESKA 3NAAL 4UIMB 1OPGL 4JHWL 4UILH 5DUPH 5E2TL 4PJHE 4OZIB 4GUPB 1I7ZB 4QHMA 1S7SB 5SX5H 4HMEA 2DYPD 3MUGB 3O11A 4KY1H 1KC5H 3ZKND 5IEHA 4NHUA 4BK5A 4HF5L 4Z77A 1JPGB 5BVJA 1A6AB 2HVJA 4IS6A 3BP5A 2BZDA 4M6NH 2UY7A 4NO0D 2QSTA 4NKMB 5FKPA 4M5ZL 3TBWB 5FEBA 4FQHA 2MJWA 4ELMB 3SKNB 4DGYL 4G8FA 5CKGA 2B8OT 2XQBL 3WUWB 1MFAH 1U8HB 1GHFL 3AFLA 3ARRA 1JYWA 5B39G 1ADQL 3D69A 4PRAB 2DB8A 2F19H 5DQJA 2AJUH 2ZOKA 4ALAL 5ACZA 4GKSA 4MJIE 4XPGH 3VFRB 4JFOB 1T7XA 4OM1H 1FZOB 1H8SA 2QLVB 4U1KB 5C8JB 5EIIA 2YMXL 5J1TC 2BVEA 5TDNA 1ORSB 4QNPE 4I0CC 4AMKH 5F1IB 4MZ2A 3A6CH 2MKLC 2V5MA 3FOLB 3NFNA 3OR7B 4CN4A 5IUSA 1FVDA 3MJ8B 5CZXC 5KSBB 5HHMB 1N64H 3CK0L 3FONB 5ITBH 4PRIE 5DJ8A 1DEEB 5CP7B 2FWOA 2P45B 2X42A 3N9GL 1U91A 4KQ4L 5DK0A 3RTQD 3SE3C 1E4JA 1A5FL 4P5TC 3UZEA 5C71A 4EUPB 5B3JE 3C5JB 4NUGH 2R8SL 2LV4A 2NXYB 4WHTB 2K7QA 1EEUA 3VW3H 3F7QA 1KB9J 3BT2L 2HN7A 3V5HA 2OYPA 4JZNA 3P4MA 1LDPH 3L3DA 4AIXA 3ZE0E 4XWGH 4XB7A 5D7IE 1IQDA 2ICCA 1FNHA 3OKDB 3WN5B 2VH5H 1KCVL 3MXVH 2E6JA 4K3HA 1G0DA 1LE9A 3DROA 3UJJH 2CH8A 2OJEB 1MJJA 4AIZB 3TZVB 3U7WH 1A3QA 4P99A 4NBXB 3S5LB 4CNIA 1RFDH 4FQLL 4N9GB 1ADQA 4P3DA 3MMEB 1ZLWH 4GQ9H 2E7LC 4KU1A 2HT3D 1KN2H 2Q20A 3PP3K 3AXLB 4OLZL 1CFQB 3RZCC 3O41A 1JF1A 2XZAL 3KLHD 3CD4A 1YEHH 4DGVH 4GH7B 4WWKB 2D7NA 2H26B 3HG1E 3IFLL 1DQLH 4HUWA 5BRZB 3PNWB 3GSNL 4NN7B 4GLRI 4P2OB 2PUQT 4P2OA 1UCBL 2UWEB 3B5HA 1NMCB 1VEMA 2X7LB 2IAMD 2LFGA 1F3DJ 1R3LA 3VXRE 2RFXB 3MV9B 5CWSA 4B7LA 5DK3A 3UJJL 2P47B 4Z7OE 4D9QD 3EYSH 4QRUA 2B4CH 5GGTA 4JANA 4GG6F 5B39B 3STBA 1MIEL 3T09A 4YX2H 1G9MC 4RNRA 4BQ9A 1TVDA 4BZ1L 2JF1A 3AAZB 4ZOBA 2DIBA 2CLRA 2FHCA 5T5NG 4P5TD 1SYVB 3W0WD 1FJ1A 2X9YA 2X6MA 2GJJA 1YEHL 1ZTXL 4G9FE 3W2DL 1JRHI 5C09A 2YD5A 2ZSVB 1T0MB 1WITA 4YHML 4DJMA 2NY2B 2Z4QA 3DV4A 3QUXD 1W72A 3CXHK 2HJKA 2H9GA 1IC5L 2DD8H 4QT5B 3NACH 4YAQB 1BP3B 3CUPB 3MCLL 4WDIB 1X4YA 5DC4B 1T21B 3MBXL 1HYRC 1NGQH 2I9LA 5GGVY 1CT8B 5JPMB 2P5WA 5HI3D 2VABA 1DJSA 3ZE2F 3FJTA 3DMMB 3JWOH 3LN9A 3WS3A 4BJLA 2Q3AA 1KJVB 3VFGL 4PR5B 4X5XA 3AREC 1DBML 3OXSA 4IOIA 4JJ5A 2ZUWA 1T83C 3DUHA 5DR5L 1YA5A 1B4JH 1YQVH 3D6GA 2FBOJ 1MCWM 1QLFB 3E0GA 3GSWB 5F96H 5BZWA 4FS0A 4YJZL 1LO4H 4PJEA 4XMPL 3O4LD 5TDOB 2FEEI 4YBQC 2EIZA 2YKLL 4HUVA 1AR1D 1PY9A 3OKEA 3PWPB 4YHIB 3O6FD 3ZTJH 1VGEL 4EXPX 4DFIA 2NZ9D 3RUGB 3CH8A 1SJXA 4O2FA 3DYPA 5IG7B 3X3FL 1WEJH 3BW9B 4ODTL 4XP4H 3HLAB 3JWDL 3FFDA 5I0ZA 3IDGA 1G7IA 1E4XH 4R0LA 1CD0A 3GSQB 4RGOL 4PJ7F 1HXMB 5CBEA 1XGYL 3GDBA 5GGRA 3MV01 2OSLA 4U49A 1J86A 1D5XA 2I9LB 1A7PL 1CDUA 4OZFA 2A6JA 3PV7A 4OAWB 4BELD 2FNBA 3UDWC 5AAWA 1Y18A 3WHXA 3QJHB 2UY6A 1IT9H 5F9OH 3QXAA 3GSXB 3IF1B 2ZUVA 2YK1L 4PB9L 5LXGL 2YPVL 3BQUC 1BAFH 4PRNA 4X6CB 3VGAB 1OF2A 4M6ML 4NZTH 1HKFA 5I1IL 4LCUA 4ZO9A 5I15H 1TQBB 5EZLA 4G8EB 4P2YA 1FG9C 2HFTA 1UH2A 2JB6A 3L3OA 2G9HA 2XPGA 1OTUC 4OIBA 4OF0A 3LS4L 1LP9A 3F12A 2X70B 2MTPA 2V7NB 4KI5D 5IMMA 1TZGL 5DS8B 3RL1A 4Z5RB 4WV1A 2P49B 3OKNB 4WHTA 3RRQA 4ENED 4NNYB 2CXKA 5LGJB 1TITA 5F7DB 1EERB 3EYUL 1RHFA 5D7JD 4PRHD 5T33H 2Y6SD 3LN4A 1IAIM 1S7RB 3Q0HA 3VFNB 4KTYA 4DCQB 2WINB 2WINA 1S9YB 3JXAA 1JPTL 3THMH 3WFEH 1B9ZA 4PJAB 4ZG1A 3GI9L 2Z93A 3WIFB 3NMEA 3U82B 1IGCH 4RMVA 3OAUH 1AP2A 4NHCH 4FZEL 4LSQH 1NAMB 2I60L 2OK0L 2NX5A 4UV4L 2H8PA 1A6WH 3C87A 4PRBB 5HVGB 4OI7A 3ALPA 2D4DA 3CDFA 4Q0XH 4ZXBD 1KB5L 4CU6A 2WLZA 2NY0D 1MEXH 3LMJL 3QQ9D 5C0CA 12E8H 3QH3B 4GW5B 1JWUA 2ITDB 1XH3B 2NTSP 3S9DB 2YR3A 2DTMH 4Z0BL 1FFOA 1HYSD 3SDYH 2IC2A 4LIQH 4ZAKD 4JY6A 4GG6B 3GSRA 3HE7C 4OLVL 3VXRD 4C56A 1LQSR 2J5LC 4IOFC 4TPRH 4JREC 1QPPA 5ERWB 3OF6A 1J8HB 5FYKE 3QNXA 2R23B 3DO3A 4YFDB 2X4UB 3QAZB 3VXMD 1OT1A 4HFWA 3RWEB 1YEEH 3BH8A 1Q72L 3GFUA 4ZOCA 1NC4D 2OS7A 1CXLA 4ODSH 1NFKA 5TF1H 2YRLA 4HXBL 2MFNA 4I5BA 3EAKA 4L8SC 4XCFH 3I3DA 4LPXA 2H6PB 4TULH 5LGKA 3W11C 1CDJA 1MEXL 3MNVB 3GJFH 4PV8B 2GUOB 1JRHH 2OR9L 5KN5A 4MB5A 4YHKL 4M48H 1NANH 2N4IA 3ULUC 1P1ZB 4EI5C 3ARGA 1WSST 1ZA3B 5L6YH 4LLMB 2IH3A 3LEXA 3LIZL 4OD1H 5D7JB 4QOKE 5MEOA 2AI0L 2NTFB 3O0RL 4XGZB 5SWZA 1P53A 4U1HA 4LVOB 3MJ6A 1YN6A 1RQ5A 4G8IA 1NAML 3MGOA 1MRFL 4HLZH 4D3CH 5C0AD 5D5MF 3N06B 3RWGA 5IKCB 3WIHA 4Y5VA 3D9AH 2GCYA 2A6KA 5H37H 3FTGB 3NIGE 5H2BA 1MJUL 4JPIA 4NN6B 3LN5B 2BFVL 1KG0A 1X5HA 3L95B 5TDOA 1T6VN 4X7TB 3MRQB 4X6DF 1QLFA 4DEPB 1I8KA 3DLQR 4Y5XB 4CKVX 3ZYIA 2HLFD 4JFFA 2D4FA 4WW2F 4LDLB 4OLYH 3VE0A 4DQOL 3B3IA 3NIFF 3WHE0 5HHQB 5JR1H 3QR2A 2VTFA 4M48L 4GMTH 1AKJB 3BHBB 3I6LD 4R96A 1HOCA 4LSPL 3L5XL 3MRKB 2Q1EA 3UTZB 4DKFH 4IOFD 3NIGF 1A7QH 1I1AD 1ZLUK 2VISB 3B9EA 3P9MA 1IKNC 2MOVA 3S37L 2GAZA 2R8SH 1PEWA 1SY6A 3D0LA 3IKKA 5M95B 3WO3B 3IAGC 3R06B 5JXEC 1YNKL 1GJIA 3TT1H 2CR6A 2X1WL 2Q7YB 2P8LA 4J6RH 4X7DC 1KUMA 2DF3A 4PJ9A 4DVBB 5D6DA 1ZHBA 3QEHA 5EZJB 1AGDB 4F7TA 3WEXA 4QRPE 1QR4A 2PYED 5C6PB 1GGBH 1F90L 5EH1A 3V79C 1XIWC 2DICA 2ICWI 1VADA 2X09A 5JDJA 4G80A 1DUYB 3OMZA 4WFFE 4OCSH 1QHOA 2Q8BL 3UTPE 4PJGE 3VWKA 4ONFH 3WIHL 4F15C 2GT9A 4O00A 3RVTD 5MENB 3MNWB 2H32B 4QY8B 4JKLA 1K4CB 4KZDL 3L3HA 3O4LA 2V5YA 2YZ8A 3MOBL 3R06A 2VXVH 4TOYH 3WYRA 3LV3B 3OKKA 4OGXL 2OTWA 4F37F 2OM5A 4I4WB 5J12C 3U4EB 4Y5YA 3IKCA 1U36A 2Y1VA 5EN2A 3S35X 2VUOA 4PJGA 1ZLWK 1VFBB 1FE8L 3MRGB 1G84A 3KYNA 3C2SA 2BVYA 1PX4A 1F4WL 5HHPA 4RZCB 4U1MB 1T20A 3CSYA 1T1XA 1I85A 3UPAA 1CXKA 2VXQL 5DMIL 5J56B 2QSCH 5FGSA 5AYQA 3PE9A 5ILTL 1T1YA 3RNKB 4OLXH 5KSAA 4YH6A 1IAIL 5I0DA 2IALB 3IFPA 3P4MB 3TO2A 4GRWF 4LFHD 4H8WL 3O6KL 5ADPH 3VXPB 4OFKA 1TCRB 3FO2A 4NQXA 3GO1L 1PX3A 5GGQL 5DZNA 5DK0B 1MCIA 5DFVC 1W72H 2R4SL 5KVEL 4Q9QL 1XF3B 4I3RL 5GRVK 3QUML 1JGVL 1BBJA 4RAHA 4RQQA 3KGRA 5DD0H 1CGVA 3GMPB 4JFFE 3CVHL 3DVNA 4HGKC 3DX8A 1R5IA 3V0WL 1J1PL 4NO5B 2XTLA 1U3YA 4YDLC 2VR4A 1QRNB 2FBJH 5CGYC 4F7EB 1K3IA 2CDFA 5DSCA 3S97C 4LVNC 1BFSA 4XMLL 3SKMB 3TVMD 3O81A 4TNWF 4WUUE 2NY4C 1O0VA 3QZWA 4KJPC 2CDGA 1UM4L 2E3VA 3LCYA 1MHHA 4U1NB 4NZJA 2DQIL 1U8LB 4LSSL 2Q87A 3QIUA 1BLNB 2HJLB 3IJSB 3QJFA 4XAKD 5DMKB 1IM3B 3U4BH 5MP6H 3F7VA 2AAVA 1WWBX 4JRYE 4KK6D 3C9NB 4LASH 1ZLUH 4MB3A 3V6OC 3VJ6A 3S96A 3EFDH 4N9OB 4Y4HA 4OD3H 5C0NC 3UPCA 2VDNL 1IM9D 1J1PH 3C60D 3T3PF 2YD6A 2VITB 4HGMA 2A6DA 3GSWA 5EBMB 5BZWB 1YNLH 1AJ7L 1DE4A 5GIRB 4QXGH 1UYWH 4LSVL 4CN6A 2ENSA 1RZ8A 3IJHB 2YBRA 4QT5A 3SDCB 4AEIH 3ZKXB 5C0BD 2NY1D 4Y8AA 1P4LA 2WWMD 2QR0A 2KH2B 4S1RL 2VABB 5C92A 4Y19E 3CNKA 1I8IB 3QG7H 3RWGB 5IKCA 3RHWF 5ICYA 1EFXB 3O6FB 2MQ0A 3H8NA 4Z7UF 5FDWB 3MGOB 3VXRA 2UWEF 1NBYA 2CRMA 3ARBB 1MQ8A 1UCTA 5HHMD 3TA3C 1SBBA 4LSRH 5DD5H 2WANA 3T0BA 2VDOH 3SGEI 1K8IA 2AV1B 5BMFH 2YN5A 3EOAB 4PJ7A 1WBZA 4ZYKA 3OGCA 1MFEL 4GXUM 3TH3T 4UT7H 1CT8A 5JPMA 1K6QH 2JB5L 5D6CB 3DSFL 3U9PH 1VFAA 1WZKA 4CU7A 1OAUL 1VACA 2CPCA 4QXGL 3JUZA 2ZG1A 3MRBB 1VPOH 2VMFA 5GGVH 4HGWB 5F21B 5F9WB 1JGEB 3I6GA 2OJZL 3DETD 1TTGA 2AV7B 2A77H 5A2FA 2VDML 3JTTA 1A3RH 2IAMC 1FFNA 5IROA 4BUHA 1ZGLM 2XKNA 1N6VA 2H3NA 3BE1H 3CFDA 5CIPB 3L3KA 1JP5A 3PWLB 4YWGH 1YYLH 3WFEL 3G6JB 4JPKL 3EYQD 3AMKA 4MQ7A 1JUFB 1OVZA 1X5LA 3JWNC 3QUYB 4FQCH 1G7PA 1FYTE 5CHNA 3V8OA 1V7MH 1MFEH 5F7NC 5ID1A 1IL1A 5HHOB 1LEKA 5ITFA 4ZPTB 1K6QL 2JB5H 4OB5L 4I3SH 1A6WL 4LLAA 3T8XB 3UZVB 3GMNB 3KPPB 2NY1C 2DL9A 4ZUWB 2AJUL 4M62H 4FXKA 5GJTL 3MUY1 1YEDB 1FN4B 1YN7A 1MCPL 3UJTL 4LSTL 4S11A 2H32A 3IDNA 3TZVD 2FIRT 4Z0BH 4OZHA 1A6TA 2BNQB 2BSRB 5CD5D 1MCHA 5HHQA 4N0CD 1NC4B 2B39A 1AQDB 1DEEA 5CP7A 1MUJB 4IRJD 2B0SH 2ID5A 5ALBH 2AKRB 3RWJB 4G6KL 3GHEH 3MJGX 3BEWB 1J8KA 4KVCH 5FV1L 2OZ4H 3EGSA 5D7IF 2MCPL 4MA1B 3ZKSD 1YEEL 2D7QA 2V2XB 1XF1A 2XWJB 3UJIL 4K7PX 2GITA 4KMTL 3QUXB 1IQDB 3WHE1 5JHLL 2RR3A 2ORBH 1RUKL 3G5ZA 3BISA 5I8KH 1UKQA 2H45A 2GEEA 3MLZL 5F9JB 1XGRB 1DVFB 2FEDD 3QEGH 2VLRB 2O5XL 1BZ9B 4LKCA 5F72S 5C07B 4XXCA 4U1IA 4FQXD 1I7TB 1RFDL 1CGWA 5EFIB 3RY4A 5CD3B 3CVHB 2GJ6A 5KVFL 1GC1H 2LQRA 4P2RA 1RZJH 3BX7C 3RJDA 2GY7B 1UWXH 4KJWD 4RRPG 5T3XD 4K7FB 4AENA 5EOQH 1EO7A 1E6OL 4P2RE 4OGYL 1K85A 2FHBA 3WE6A 1S78D 1QSFD 4OQTA 1S7VB 3BQUA 4P23D 3BYYA 4XVSL 5I1LB 5I1LA 4HS3A 3IFLH 3U46B 2B5IB 4Y89A 4K2UH 5DSCB 3W81A 1Z9SA 1JPTH 2Q6WB 5K9QG 5CINL 1FLRL 2P5WE 4G3YL 4G9FA 3QFJD 2VR5A 4KRMB 4TSAH 4Y1AE 5HGDB 2R15A 2EEAA 4LF3A 1B2WH 2LVEA 4JKPL 5JQHC 3HB3D 4PJBE 3WO4B 4RGNB 3KS0H 4G7YH 4GMTL 5AWNL 4KK9C 4IRJC 2WIIB 1KCVH 3QULB 4X6EA 4EQ3A 1KCRH 2HTLD 4Y5XC 2HFGL 5T5NF 4I5BB 5J9PB 5HDOA 3O2DH 2XZCH 4GQ9L 5EULV 5C6TH 2DWDB 1JZ2A 4FP8L 4NNPH 2DQJH 1ZGLP 4YDVB 1MHHB 3B9AA 3H3PL 1UFUA 4APQA 4CVXA 1S3KL 3TN0C 1Z6JT 3TO4C 4OJFH 4QWWC 5TFSL 3I50H 3QNXB 2EIDA 3C5ZC 3KPSE 3V5DA 2FJGA 5DVKA 4V1DA 5LKNA 4GW5A 3QH3A 4YXKL 5HXMA 1MCEA 4H5SA 3ZSSA 4MDIA 1LNUA 5E2WH 3S3JA 1PG7H 5IFHL 1XR9A 2XXCB 3KYMA 1CGSH 3FT3B 5K9OB 5GS1C 4P2OD 2X4RB 3GM0A 1G9ML 4XNZC 4NQED 2E6QA 1WUNT 3WFBL 2XWTB 4MYWB 1XF4A 4C58B 2YUVA 1YQVL 2NY4D 3TNMB 2YD7A 2AJZB 2GSIB 4LLQA 1WBZB 3T2NH 1NC2D 1YZZA 2CXGA 4Y4KB 2R69H 5D70L 4EUPH 3BRGC 3O8XC 3QP3A 2GQHA 3EFFA 3VH8B 4MDIB 2E7LA 1JZ8A 4ZUSA 3W39B 4ZTPL 1QFWM 1WEJL 2XQYK 1CDCA 3EYVB 1KTRL 2XKUA 2XKNB 3EJYC 2A83B 3QIBC 4IRSA 5JDSB 1CL7H 3WIIL 3R4DA 1FG2B 5I17A 1QBLH 4R90H 5SX4I 1QSEA 1RZJC 2VQ1B 1EPFA 2DQGL 1WBYA 3GO1H 4OM1L 3H9SE 3PWNB 3WEXB 3KPQA 3VDAA 4I18B 4AMKL 5L8LB 4PY8J 1TCMA 4EN3B 4MCYA 5CP3H 5CUSH 5HHOA 4BA8A 1AGCA 4ZS7H 1L6ZA 4PBVC 3WLWD 3C5ZD 4KHXH 3MA7A 1G7LB 2UYLA 1QFHA 2VZVA 3QXUA 3GRWH 3HZVB 2R56L 5AD0B 3O9WA 1T3FA 4AY0A 4DWHA 4K3GA 4Z7WB 4HIIB 1FCCA 4X98A 3KYKH 4Z7VA 3NFNB 4DN3H 1F4YH 4LEXH 4R96B 1AGFB 3QHFL 2BC4B 4OZIA 2IH1A 4OCXL 4H0GA 5C3TA 1AXTL 1IILE 1FCGA 2DMBA 2EEBA 1BFVL 3U79A 1PG7X 5DQJB 3L5HA 5ISZD 2DDQL 1FSKB 5EFIA 4JFEB 1UG9A 4PREB 5FYLH 1PD6A 3IDMB 2DN7A 4K3JL 4KROC 4XNQB 1PGRB 2VQUA 5IEKB 1SVCP 1F42A 4ZS7L 5BRZD 1JYXA 1EV2E 3VGDA 3BZFB 1CLCA 4OF3A 5AG9A 4OF7A 1T83A 4PJHB 1HDMB 5H8DA 1YMHA 4Z9KB 4OZIE 4ERSH 1M7IB 4ETQB 1Z9LA 1RZGB 4HIEA 4WCYH 2OBGA 4KRPC 2CK2A 3EYQC 3ROLB 1O7VA 3ZT6A 1OY3B 3N1MC 4OCRH 1GOFA 4LKCB 4U05A 3MRDB 3T0ED 3MRIB 1LHZA 5D96B 3I75B 3LQZB 3CSPA 3HNVH 4OLUH 3GSNH 3N1QC 3PABB 4NWTL 2DWEB 2IADB 4IRJB 4PREA 1QHPA 5TQ0L 4GLRH 3QO0B 4HC1H 5KSAB 2Y9RT 1U3HA 2YD2A 1I3RA 1NCCL 2VLMD 4N5UA 4PJ5E 5BZDB 3UTQB 2W0FB 4F7CB 1TZGH 4C83B 5LWYL 2UZXB 4PJHA 4QRQB 3ZKXC 1VDGA 5HHPB 2FCBA 1PZ5B 4MHHG 1FVCB 4S0SD 4N0CC 3EYUH 3Q6FA 3KLAA 2FRGP 3GIZL 3L9RA 5DVLA 1KOAA 5FKAB 5EU6E 4HCRL 3D25B 1OD7A 1I8MB 3PJSA 4ELKB 5IF0B 3HMXA 2AEWA 3NIDF 4UDUB 4G6MH 5EO9B 1VPOL 1EJ6A 3E3QC 4IMKA 1C16A 1INQB 1ITCA 2H26A 3NACL 1F5WA 4M7LH 2AS5M 1QR1A 5TQ0H 4O51A 1E6JL 4JZOB 4JZOA 1MVUA 3ARQA 3DGGB 4P9HL 5BQ7B 1R3IH 3NBNA 2UWEA 1NCAH 2F19L 1AO7D 2XY2A 2AEPL 5GISL 3SDAC 3ARGC 4MJ4A 4QRUB 1JNHB 2F5AH 5J1AB 3UTSB 2AJVL 2RFXA 4I2XB 3DARA 3HUJF 1R5IB 5D7IB 1WWWX 3FQUA 4WIQA 1P9MC 2O26U 5HI5C 4KC3B 3VXUB 4MDJA 1DN0B 1T66D 1EZVX 1NBQA 5DHVA 2CUMA 4NN5C 1EMTL 2GK0A 2VXTL 4LCIL 1NLBH 5E9DA 1J1XH 3RGVC 5E8DL 2P46B 3P9MB 3JTTB 3F8UB 4I0PD 2ESVA 5JXAH 4CNIB 2HT2C 2H32H 2NX5B 3UJTH 3VXQA 3T1WA 1GGTA 5J4MA 4DGIH 1K2DA 5IB2B 3STZA 4UV7H 3S35H 4NFDA 1HEZB 4WFHE 4LRNH 4BFBD 4CMHC 2PXYA 1Q9WA 3VWKD 5I8CA 2EE2A 4K55A 1T22A 1WFNA 5DMJB 1UJ3A 1OAZL 4ACPA 1X5JA 4ETYA 2XYCA 4P2RD 4HWBH 4Y16D 1Q9OB 3WNLA 4ISVB 5E6IA 2VR9A 3FT3A 1XGTA 2GTZA 1O7SA 4P4KB 2UWEE 4HK3N 3DRTB 4QHKI 3PP3H 4WTWA 5DHXB 2HVKA 1VHPA 2OI9C 5IM7A 4PJ9D 3NN8B 1VKXA 3IDIA 3WXVL 1RZ8B 4Q6IC 4Y1AA 3KJ4B 3LKSB 2X10A 3EBAA 4MCZA 4KDVA 4L8BB 4XPAL 4YHYC 5F1KC 5T3ZH 3QI9A 2HKHL 2YD4A 5KANG 5JXAL 1WJ3A 3CFKB 2BSSB 4GRMA 3EO9H 1KIPA 4QTHB 3MRKA 5J0BA 1LNUB 4KRPD 1P7KB 5CSGA 2ILLA 1F8TL 3BW9A 1G6VK 4PP2B 2ATPB 2NZIA 1AQKH 4PRDB 1HSAA 2UV3A 1Z3GH 3MBEB 1Z5LA 1AGEB 2GJ6E 4ENEC 5JOFA 3P30L 1A7RH 1U8KB 2XN9A 3L5WA 3RBSA 1CGXA 1LEGA 4O58L 1NFDE 1D5IL 2GFBA 3QDGB 1QD0A 3VG9B 2V9QA 3QWRA 5BXFA 1N5AA 4KAQH 4B7IA 4OUUB 2SEBB 3GMLA 5GS0D 1CFTB 2HFEB 1FLRH 3QDHA 1AO7A 1CE1L 3CFCH 1IC4L 4QXUL 4TSAL 1S7WB 1PLGL 2EDRA 3RWHA 3U0WL 4OT1L 3MLXL 4X0KB 1H3WM 5E4EC 3U36B 5DMIH 4A2LA 4JZJC 1KLGA 3V7AE 1WTLA 3DX7A 5E7BA 3AREB 3OBAA 4OIIH 5SWSE 5KSVA 3D3VB 4I48A 5E94B 3CGTA 3P4NB 5I17B 3QIBD 3MODH 4UAOC 3CPLA 4UINL 5TJWK 3IDYB 3IDYC 4WWKC 1DVFA 4OBRA 2EYTB 3RZWA 4RGNC 3SE9L 3OKLB 4PS4L 5CJBA 3BPCA 2X1XR 1HKLL 3B2UD 4U3HA 2C1OA 3SDYL 3SHSA 4BFIA 2LTQC 5DO2C 1KENH 2A6IB 5D72H 4K7PL 4GAYB 4DW2L 4UDTB 2AJ3A 4KDTA 4RRPA 3TO2B 3Q1SH 3TBYA 4MZ3A 4U1LA 4EDWL 2ITDA 5HDBE 1IAKA 1NMBH 3D39A 4MNHA 3OAZH 5EBLB 1FYTA 3T77A 4WEBH 3PGFH 3QDMD 4PJXF 5FM4A 3MJ9A 2R2BB 4HAFA 3PDGA 5F97E 3K4AA 4NUGL 4E42B 4OZGB 4HWEH 3F5WB 4NYLA 1KEML 1PKQE 5IWLA 1A4KB 3WUZA 3MNWA 4QF1B 5KJRH 1A9BB 2IWGA 3CVIH 5I1CL 2KBGA 1XGYH 2VLJB 5E1HB 4UTAL 4PGEB 4EUPG 5D8JH 3Q48A 4J3TA 5J57B 4L8DA 1OM3L 2YZ1A 5GJSH 5CGMA 5MEQA 2BERA 4O2EA 3WKML 5EU3A 5D72L 4I3RH 1FSKC 3HS0A 3GSRB 2JCCB 4HZLB 1ERNA 3MLYL 1YUHA 5D2NC 4Y4KC 1INEL 3LKPB 5E2UH 4M6OH 3KPLB 4P5MA 4ZS6C 1I8LC 2CQVA 1MOEA 5HGAB 5IVXB 1H5BB 2YHGA 3QDAA 3QUZC 1BQHA 4JRXE 4NYLB 5FGRA 4Q58C 4YIQB 3T0XA 1YNLL 3FO9A 2AJZA 1JTOA 1T6WA 4IIQC 1F3RB 3DMMD 2B5IC 2Y36L 1OAQL 1TVBB 5FO9B 2ZUUA 2VKWA 1T0NB 1GAFL 1VFAB 3H9YA 5C70A 1XIWB 1C16B 1ODAA 4KKCD 2P44B 3O9WD 3GNML 5KJRL 3JSSA 1CG9A 1NFIA 1IC1A 1IGFL 5TH2B 1R3HA 4I8DA 4ODHH 1INDL 1J9CT 1MVUB 5BQ7A 4GRLB 5E08H 2DRUA 1JN6A 1KCUL 2JKXA 2E7CA 3DWTA 3W5NA 1FVEA 1NEZA 4KJWC 3BKCH 4DN3L 1HIML 5EORH 3FQTA 3FT4B 3KPSA 4ZPVA 1RZFH 8FABA 1F6FB 3FO0L 2VDQL 1CXIA 1JNLH 1RY7B 3U9PL 4M7JL 1R3JB 3BKYL 4LCCB 4M4RA 1BQLH 3L5JA 3ARVA 2BVOB 3LKRB 3B9KA 5F70A 5IT2L 4GG6E 4D9QE 3RPIA 3H3KA 4FNLL 1R0AH 4Z7OF 2OJZH 1JYVA 1IGCL 4PG9A 4K7PY 2XA8L 1IAOB 4ODWB 1NGQL 1X5XA 1C1EL 3QWOB 3LKOB 5F3HB 3U7AA 4M7ZB 5I71C 1N64L 3CK0H 4ELMA 1FC2D 4FABL 4YAQA 1YNTA 3HC3L 3QUKA 3VA2C 4QRPD 4Q0XL 5F7WC 1YY9C 4KKAC 1N5AB 4HK0A 3CSGA 3C6SB 2F54B 3MR9B 3BKJH 5GS0H 2R0ZL 2Y25A 1FORL 1FNGA 1I8LA 3IRPX 1ORQB 1XGQB 2WP3T 5L2KD 3TO4A 4FFVC 5EORL 4F7MA 4G7VH 5B8CB 2YPLD 4IIQA 4KXZH 2VDPL 5HDBF 1JN6B 4HIXL 1AO7E 5DO2D 1OWWA 4PRDA 1S9WA 2Y72A 1H0DB 4PJEB 4JAMA 1BWWA 3N85L 3S36H 4QOKB 1CBVH 2ICWB 5IHZB 5J12B 4Y4HC 4LP5A 4XAWL 2YRPA 5HHNB 4GRMB 4OLXL 4JDZA 5DEFA 1KB5A 4YHPA 1CFTA 1Q0XL 1QBMH 4H20L 1FZMB 4OF6A 4JFHE 4ZTOL 1QFOA 3B4NA 3VXNA 3RGVB 5F88A 4N8VB 2YPKA 3MRLA 4H0HB 3N1GC 1TJIL 1JPGA 4Q7DA 4U7KA 3SOBL 2FH6A 3VFOA 4GRLD 3LH2L 1CDYA 4ZUTA 4X6FA 1UXWA 5JDSA 1CDHA 4OUOA 2BMKB 2ADFL 3I9GL 4YNYB 2JTDA 5D7LE 1UGNA 2X4SB 3CX2A 4HK0B 1PZUB 1R5VB 4P57A 3JV6B 3KPNA 2BVTA 1BAFL 5T3ZE 2Z9TA 3SJVE 5HVHB 1DQQA 4KUZH 3IFOB 2AJSH 1XGPB 4M6MH 4NZTL 5I1IH 4KTDL 4Q6IB 4L4VB 3P4OB 1A1OA 1V7NL 1N5YH 1T1XB 1U8IA 4Z7UB 1MRDL 5FHBL 2QEJA 1S7XA 1BFOA 4ZUWA 1EGJL 1A6VH 2G5BA 2OMNA 1QSFA 4LLUA 2E8YA 4P23A 4TUKL 4AEHL 5TE6L 4FQ1L 1UM4H 2A9NH 2LU4A 4UNTA 5E8PB 5D1ZB 3TBYB 3FN0L 3E6HA 3E6HB 2C1PA 4UBDC 5D2NB 4U0RB 2AJYL 3KYNB 2Y06H 1B0WA 5MEPA 5ID1B 1U95B 2FWOB 3ES6B 3RY6C 1MAJA 3V52L 2IANB 1YC8A 4L8SB 3MMEA 4L3EB 4PJCE 1RK1A 3G6AB 5C0BB 4M4PA 5MENE 3UEZA 2FR4A 4AQOA 4WV1B 5C0DA 4N68A 1EIBA 4Y2OA 2JLLA 3BDXA 5JOPE 1EHXA 3QHTC 2Y4SA 3FQUB 3L5IA 4R7NA 5HYFA 3UC0L 5EU6A 3U9UA 4WGWB 2FLBT 3WJLA 3E2HC 2X89A 4P57B 1NKOA 2PNDA 4MJID 5L88L 2YS4A 2W07A 3R8BB 3ZE1E 4TUKH 4GKOA 1LO2H 5IMMB 2YUZA 3VD9A 1JPSL 1UB5A 4LVHC 2K9UA 1WZMA 4X80H 5IV2B 4JZJB 4AIOA 3L1OH 3EHBC 1MCBA 2NNAB 1S5HB 2Q8BH 2QTEA 4BFEA 3PWUA 2Q7NA 4KROD 4ONFL 4JO4L 5AZ2L 2UZYB 2C4XA 5FUOL 5K33A 1JF1B 3PL6C 2AXFA 3MV7B 1IGYB 3RNQA 1V8HA 2G60H 2QADD 3VFMB 2P7TA 1EJOH 3ARZA 3MJ8A 4XMKH 3U2SB 3MACH 3D2UD 2ZSWB 4OCYH 4FFVD 4MLIA 1PZ5A 3LN5A 3LY6A 3HA0A 4QHUB 3X14B 3ZDYE 5J7CC 4HBQA 3BGFC 1OD9A 3VXOA 1CVRA 4XBEH 1J05B 2HP4A 1G9MH 3KDMB 1GSMA 4JFFB 4BZ2L 1Z2KA 4J8RA 4TUJA 1IGML 4X6CF 2NW2A 4QHNA 2DQHL 5E7FA 1MJ7L 2DM4A 3O2WL 4MWFA 1A7NH 1JGUL 2BXYA 3V4VH 3UTZA 4LLDA 1EEZB 4U0QB 3MR9A 3MLRH 3FQRB 3G5XA 3NCEB 5B8CC 2NX5D 2CUHA 2Z31B 3NCJL 3C6LC 1JWSA 3KYAA 5DJCB 4MAYD 5EU7C 2Y5TB 3D2UB 2X4QB 1MLCA 4ODWA 4OIIL 2XN9B 3KNBA 4ZUVA 1OSZA 2AI0H 2EDEA 1DQLL 1MCQA 2R0WL 4KI1A 4D0CA 2X1QA 3OKEB 1P1ZA 1UCBH 2JIXD 5ENWA 3W0WE 2PO6C 1NAMH 2VYRE 1FL6B 1PG7L 4JQVA 2QR0B 4PY7A 4Z7VB 3H9HA 4LSTH 3SDXA 3DMMC 3G6DH 4DKEH 2BK8A 4M1DL 2VZUA 3SDAA 5KVGL 2R9HC 4N90D 3DV6A 2VLLA 5CLWA 3S3SA 1QA9A 3OB0K 4JM2B 1ACYH 3D48R 1EGJA 1X4XA 5C09B 3DVIA 4U6VL 4HUKB 4G6KH 3BPNC 3D3VD 5IB3A 1HEZA 4QEGA 1ZHLA 4G8GA 4K9EC 1A02N 3ULVD 3QPQC 1CICA 4JHZA 4S0TD 4Y19B 2I9TB 3TH4T 4RWHA 4X6DA 8FABB 5D71L 5C3LD 1ZVHA 1IL1B 3DVFA 3KYKL 3TYFA 2B20A 1CLYH 3MCLH 5DJ6A 1AH1A 3GI8H 4NZUH 1FNFA 3SO3C 3BEVA 2DIAA 3F7YB 3JZ7A 1C5CL 7CGTA 3BZEB 1CFNB 3HUJB 1HSAB 5KS9A 4H1LB 4MA8L 1KN4H 5KVGH 3HZVA 5D8JL 2PW2A 4JM2D 1F00I 1FG2A 4HV8B 1BPVA 3DPBA 4AEIL 5GRZA 5EU6D 5JA9A 4LHUA 1MHCB 4XH2A 2C1PB 1HH9A 4X6DB 2JK5A 3QQ9C 3WDJA 3TIEB 3OKNA 3C2AL 3EHBD 4L8SA 3AVEA 2P8PA 1BFTA 4M61A 3GKWH 4N1CA 4LKXA 2JJUA 1NJ9A 3QRGH 1X9QA 5HDQH 4WTZA 5HI3C 1S7XB 1RK0B 1RIVL 3OZ9L 5GRUL 4DN4L 4LU5H 5CINH 3JWDC 4TTDC 3BN9D 4JO3L 5BZDA 3NPSB 3ARFA 3VGHA 4PJAA 1EH9A 1FYTB 5IBLC 4WENB 1ZHKB 3ZE2E 1DUYA 3KPSD 4MD0B 5DGQA 1YJDL 5C7XH 1IGIH 4L4VA 3JTSB 4JY5H 1U91B 4L1HA 1CR9H 1MJ8L 1CLZH 4E41D 4K3JH 4JJHA 4FQIL 1JE6A 1I9RH 3FB7B 1H8NA 2CIIA 2EDOA 4N8CH 5E00B 3HZMB 5T3ZD 3DXAD 4I0PB 1YEJH 1ZT7A 5CCKL 3GMQA 1RZKL 4PJIA 3CCHA 2FGWL 3WFHA 5KS9E 1AI1L 1HH9B 3G08A 4Y2DD 5GRUH 2Y7QB 2CIKA 4YXKH 4TRPL 1RZGA 1KTLB 2VWEE 1ZK9A 2ZZUT 4K8RH 1C1EH 1QNZL 1J05A 4LCUB 1ZA6A 1GGUA 1HHGB 4FXGB 4PLJC 1NCDH 5C7XL 1RUML 4D2NA 1AD0B 3ARYA 4NKMA 4U3XA 5FKPB 4X4YA 4GBXD 5HYQA 4LQFH 4FTVD 1FFPB 1I9RL 3KPRA 3TA3D 1U93B 4MNQE 5C07E 3E6FA 4QHUA 3GK8L 3B2UC 2PN5A 1F4XH 5F93C 3QQNA 4WI7A 3O11B 1AE6H 5F9WC 4APQB 3VA6A 3SE8H 1FLTX 1S5HA 5I73B 3BZ4A 4LLMA 1JFQH 4PJFB 4PJDA 3VRLE 3OAUL 1F90H 3D1MC 2XIDA 4UV7L 1HHHB 4F57H 1SQ2N 1HI6B 4GKNB 4KHTL 3FQWB 1JNNH 3KHOA 1FNLA 1OW0A 3WIHH 1EXUA 3PWJB 3HMWH 1NUDA 3TESA 4F7MB 2RGSA 5BV7C 1Y0LA 4LSVH 3BN3B 2AEPH 5GISH 1RUQL 3VD4A 2AGJH 4G6JH 2QADB 5JMOC 5JW4R 2DQTH 1P6AB 3BP6B 5DHYA 1XF2B 4Y1AB 2Q6WA 1T1ZB 1IEAA 4OCWH 4D0CB 3DTXB 3ORJA 4WU5B 4ZO6A 4PJBB 2W0LA 3QI9C 2X4UA 5KW9L 2PXYB 5DD1H 1KLFA 1LEIA 4YPJA 3VGBA 1I1AB 3T4AA 1KIPB 1A1NA 3GKZA 1MI5B 2R2EB 4PTTB 3WLBA 3VWJC 3EW3B 4TPRL 3RTQB 2P4AB 1HSBA 5FB8A 3GRWL 3W82A 3FQRA 2VLRD 3L3JB 5EWIH 3TIDA 1YEIH 1A22B 3WSQL 2PCPB 3NFSL 4OIAA 1B0GB 2C26A 3HG1A 2VZ3A 3FOMB 1Q72H 3OAYH 4FXKB 4PV8A 1MY5A 4Z78B 5BJTB 4P46A 4PYHA 2XV6B 2VE6A 1AQKL 3VXQB 1TNMA 3O4LB 1BFVH 4C56E 5SWZD 1F13A 2PKDA 1QSEE 4LCWA 3O41B 4G7YL 5AWNH 5GXBB 2A77L 5DHVB 2N56A 5F1OB 4Y16B 1ZHNA 4L8CB 5GQBA 1YECL 3QEQA 3QEQB 2V9TA 2WBJB 3F7YA 1NGYB 3AUVA 4ORGB 5FF6A 5LXGH 5IMOA 2GT9B 2UYLB 1KNOB 2NYYC 1DLHA 4U0RC 3X3GL 4ZUTB 5HGGS 1S8DA 1PQZA 3SCMB 3NFSH 2BY0A 1J1OH 7FABL 2HFFB 5AUMB 5HTSA 1K5NA 4HCRA 1J11A 1P4IH 1EBAA 1I3GH 4LMQE 3U4EA 4N1HB 3M8OL 3EYFA 4RMQA 4LPWA 1FL5A 2NXZB 1KB5B 4YHPB 5JOEA 5EOCJ 4NO3B 4WGVB 3TBVB 3JV0A 3DVGA 5KOVC 3TYFB 2DQDH 2EC8A 1MCNA 4R8WH 3ULUD 4M62L 4OZGA 3SKJL 3R0MA 4TTGA 1DBKH 1GOGA 2VLLB 1NGYA 4NM8L 5BOZG 3BPOB 3T8XA 3JWOC 1QZ1A 1NAKH 3RWIB 5BO1L 5FUOH 4PLJD 1FGVH 3CDYA 3D87B 1FYTD 3QCVH 5ANMA 3QO0A 3LQAC 2AK4E 2BHZA 5EZIH 4HKZB 3RHWK 3KYOB 4OKVB 1BF2A 4FTVB 1I9JL 1YNKH 1JHLH 3THML 3ULVC 5GGUB 1T7WA 4MD4A 5F71A 4DVRH 1A4JA 2EXYD 2ITCB 5DJYA 3U0WH 2ZCKL 5DD6A 2GAZB 4YHNB 4N8VA 5F3BA 4QF1A 5EUOA 5C0ND 5B21A 5I9QC 5IQ9B 3GSQA 1RJYA 3MLWL 5C9JA 1I1YB 5DT1H 2WIIA 4MVBD 5J11B 3V4VL 3IT8D 4GS7B 4LNRB 1S7QB 4I48B 1HILA 2W65A 2W65B 3QEGL 2X4NA 5SX5K 2VLKD 3C8DA 4QXWA 3V2AR 3T77B 4OUUA 1EEYA 1AXIB 2DQGH 3V4PL 1OARL 1GPOL 3EDEA 5K59F 4PJXE 4TOYL 1HKLH 4MNGE 1E4WL 3RGVD 5C0EB 1W0WB 1D5BA 2BY2A 3QXDB 1TETL 5KVFH 3HZKA 2G5RA 2BCKB 2L7UA 4GKZA 3U0PA 1FE8H 3FB7A 5HHXH 2VWEC 1FO0H 2YBRB 3SDCA 5CD3A 3MA9H 3PF2A 4JFDA 1MHEA 4X99B 2EIZB 1NMBL 5KSVB 5EC2B 4DGYH 3VWJD 4Q97A 3KYOA 3RAJL 4X7CC 2EDWA 2FJHB 1SM3L 2IPUK 2Z8WC 4QYOA 1I9EA 4N8PA 4Y4HB 5HYSG 5T1LA 2XKSA 1FFOB 4WUKL 3B9KB 4M7KL 2A9MH 1KXQE 4WI5A 4JZJA 1PY4A 3REWB 4JR9L 5GIRA 3GMRA 3IDGB 2ARJA 2XWBA 5I1GH 4P9ML 1BQHB 2F54D 5A2KH 3JV5A 1J0YA 3RIAF 4QHLA 3HAEB 3VXMB 1TVBA 2HFGH 3A6OA 5FO9A 4UQ3A 1FNSL 4PJ5B 2HRPL 3BH8B 4Y8DC 1MPAL 1ZLVK 4Z7QE 3U2SA 4BH8B 2DQUL 4GAGL 5DJZB 1T80A 4ISVA 2P7TB 4ODUA 5T3ZL 5ITBL 3CVHH 1FRGH 3LSOB 3X14A 3QDJA 2IFFL 4HZLA 1KTLA 5IMKA 3MROA 4D94A 1F58L 1LO0L 3QUMA 5IFJA 3WJLC 2NY0B 1YC7A 5T1KA 4TYUA 1FC1A 5F7DA 3S88L 3X12B 5C07D 4JR9H 2CDEB 4JPWH 1J0IA 1T22B 4L3CA 4WRLA 5D7SL 5F7KC 5FYJE 4R4BA 3UPRB 2DLGA 4JDTH 1YY8A 3P30H 1G7PB 5BRZA 5E08L 2HMID 5IM7B 1LILA 3O6ML 1NBVL 4P5MB 5IB5A 2MWCA 1D6VH 4JRYD 5IW1A 3BKCL 4ODVH 4WO4B 3IDIB 2PW2B 1TVHA 1TVHB 1NLDL 2ZUYA 5DC9B 3E8UL 3TT1L 3VXSE 5FYLD 1Q9WB 5T1KB 3QEQD 1S5IL 2O5XH 5HDLA 1MFBH 4HKJB 4KK9D 5INCA 3N85H 1U3ZA 5INCB 3S36L 4UB0L 3CXDH 4LPUA 4Y4KA 3SDAB 4RBPH 3QNYA 4LAQL 1MJ8H 3LSOA 4YFLF 2XA8H 1RZJL 2B1HH 1OL0A 2QQLL 3MO1B 3MRMB 5D7SH 2XWTA 4P2CG 2R0LL 4HIHB 5I1KL 1DBJH 4OZIF 4X0KA 3U36A 1E6OH 5MHSD 3SE9H 5C08E 1OSZB 1MAKA 3QUMB 2Z8VC 3TP4A 3O6MH 1LMKA 2FB4H 4MAYB 3SCMA 2ZUQB 2JB6B 3CC5A 2FATL 1HHIA 1X6LA 3CX5J 1LEIB 1IGTA 3PIQB 2P24A 3LRGA 1TZHB 9CGTA 4YX2L 3M1BA 5BV7B 1RMFH 5JO5A 3T0EC 5IG7A 2GK2A 1Z0MA 3GIVA 2RAMA 1S7WA 1A1OB 2EE9A 5DUML 3PWVB 4TNWK 1Z5LB 4X6FB 1RUMH 4HFUL 2HWZH 4EVNB 1J5OL 3DO7A 4H1LA 1QVOA 3MOQA 3H7BB 1KLGB 5E99L 1QEWB 2QQLH 3MJ9H 4F2MA 3MBXH 3LAFA 1CICB 5FIEA 2I9TA 3U83A 3O6KH 5I1KH 4NQCD 5H35A 4XGZA 4HS8H 1XT5A 1GC1C 2H2PC 3FCTB 1G0XA 4HIJB 3ULUH 1FVCA 4K3EL 3SDXF 5C0EA 4PRPB 3HI5H 3LH2H 1G7IB 3VI3E 5C9KA 4Y4KD 1JGVH 2GJ6B 5CJXC 1S9WB 4KWUA 4XNMB 3PWUB 4NQEA 1V7ML 3FB6B 5JPNB 1NFDB 3QDGE 4X7TA 1U8KA 1JNNL 3V0WH 4FQQA 3ARBD 4MJ6B 4WJ5B 1JGDB 3GHBH 3TN0D 1HCVA 5JHDB 4FTVA 3U4AA 4TVPL 1JL8A 4MD0A 1RUQH 1MREL 1RULL 4H88H 5E1AB 1V7NH 4L4JA 5L88H 4WI8A 5HVFB 5JW4M 3VG9C 1E4XL 3SCMC 1KACB 2ZOKB 2QHLA 3B2VH 4RGOH 2NY3B 4IMLA 4KTEL 2BDNL 5SWSB 3S36X 3D3VE 4OFPA 1TNNA 5IEKA 3RGHA 5IFAH 3PHOA 1NFDA 3DUUB 2PYFA 1J0ZA 4MWFB 4NZRH 4RGMB 3TEUA 3ARFB 4LOUC 1C5BH 2EDNA 3G5ZB 4JFXB 5TDPB 3L3GB 3SE4C 3O2DA 4XC1L 2EYRA 1NFIB 2G60L 1BX2A 3MCKA 3FQNB 3PP4L 1N7ML 1K8DB 2VKXA 2CSPA 2APXA 2HH0H 5I18H 1QBLL 4P4KC 3KR3L 4YHNA 2CDGB 4CN1A 4OGZA 3MFGB 2BNRA 4J8RB 5ICXB 2JJTC 2PXYD 4YIQA 3V5KA 1YMME 1T89A 5E0QA 1KIUA 1UXSB 4P9HC 1K4CA 3FT4A 4GFTB 3IFPB 5HY9A 4FRWA 5C0CE 4R7DB 2KQNA 4KHXL 3ARXA 3CDGA 3LKQA 5EU3B 4IRSD 5MEPB 3HRZA 3RWFA 3TA3B 4TNVF 3KAAA 4PYGA 4DUVA 1WFOA 4OKDA 5FOBA 2R56H 1L6XA 3HE6A 1LP9E 4NM4L 4XP6L 5BJTA 1UB5B 2IEPA 1QTYT 2R0ZH 2DYPA 4N0UA 1SJVA 1HNFA 3PHQB 3ULVF 3GBLA 3VCLA 3OAZK 2PO6A 1VSCA 5B3NA 3SDCD 4XX1E 5LGHH 3VMPA 3GMOA 4LGSB 1OGAB 2VXTH 4LCIH 4XNXH 1U3JA 2HH0L 3OKKB 1TENA 3KHQA 4G3YH 5D2LB 3MYZA 3BJ91 3NH7H 3DI2B 5GGVL 4TN9A 2J12B 2CKBB 2JCCE 5INDA 1JBJA 3FB8A 4XXDA 3QDJB 2PYEE 5FDWA 3NZ8A 1IEAB 2VLKA 3CLFH 5E9DE 4LRNL 1H3GA 1WBXB 1G1CA 4WHYH 3IRZA 3MRIA 3TJEL 4X9BA 1KC5L 4LBEA 1T2QL 2XZCL 2COQA 1H9VA 1M7DB 2E9WA 3QUYC 4X9IA 4NNPL 2Y5EA 3MFFA 3X17A 1MCDA 1M7XA 4YQXH 5FM5M 2EDHA 1G9EA 2DKUA 2D0HA 3ARUA 4N5EC 1EAPA 3CZFB 4YPGA 1WV7T 4XCCL 4FA8A 3TCXA 4C59B 5L2JB 1B0GA 1G6RA 3CFBB 2ADFH 4PP1C 2VRAA 5GJSL 3RWCB 1YEGH 5FOBB 4QCIB 4TSBL 4XNXL 5BS0E 3MRNB 4Z78A 2DS4A 4LDOB 5KN5B 4FG6C 2CO7B 2GIYA 2OMBA 1INEH 5E2UL 4U6HB 3V6BR 4WU5A 5D7LD 3MV8D 4ALAH 1ZA3A 1OGTA 1KN4L 4NUJA 3LEVH 4O5LL 5FHAH 3V4PH 1ROWA 1IBGH 4LVHB 3GIZH 1S9XA 4FQ1H 1IC7L 1ORQA 1EHNA 1S7TB 1G7MA 2HRLA 3HPLA 2GCYB 3AS3A 2CDFB 3MRLB 3SDDD 1P69B 1T5WB 5D6DC 4BKLA 2O61A 2E6PA 3ALXA 3SQOH 2D0FA 5EB9A 3OAYK 5I30L 4XWOC 3HE7A 5HYJB 5IW3A 4JFDE 3F58L 1YEGL 1WT5C 4MAYA 1V5JA 5CZVH 2I07A 3EIFA 4GSDL 4YLQT 5H37G 2ED8A 4I9WD 1OWRM 5D71H 2YUWA 3VWKC 1RUKH 4E5XB 2F54E 4OZFB 5FCUH 3CCHB 4FN0A 1M71B 4NGHL 4U6YA 4UNUA 5CSZA 3UC0H 1ZT1A 1DL7L 4PRPA 4R26L 2I27N 4ZFGH 3QUZB 2O5ZH 1S7TA 3BKYH 3KXFE 2NY6B 5IEHB 1G6RL 4Y5YC 4X5XB 1AO7B 4MA8H 3S8WA 3TPUA 5F7MC 4HS6A 2ZSVA 3F7RA 4FNLH 2IGFH 5IQ9A 1LO2L 3QISA 3O8XD 4A2MA 2HRPH 4MJ6A 2OQJA 1YJDC 1L9NA 1NCBH 5C0GA 4KUCD 2IMMA 5ESVA 4JFED 1UJ3C 2NTFA 3B9DA 2XZAH 3BGAA 4PJAF 3VWJB 5D2NA 4DGIL 5T1MB 1W0WA 4NRZB 3HCVB 1SBSL 1NL0H 2VLRA 4XPFL 5F7FA 1H8OA 3BKML 1AC0A 1NC2B 2A38A 2NXZD 1LO0H 4OD2A 4L1DA 2AK4A 3S88H 1I7TA 4G6AD 2UVFA 1DL7H 4U33A 1A2YB 1K4DA 2OTWB 5D7LB 3WL9B 2BNQD 1QVOB 3VFTA 1U2HA 2CLZA 4XBEL 3GMQB 3MRJB 1MWAA 1I1RA 4ZQKB 3M45A 1AGFA 3MOAL 4XAWH 4M6AA 4ONOA 4NO0B 3NABL 5T3XL 5J06A 5FUCC 1XCTB 3FZUC 3ARDC 2LAGB 2FO4B 1VESA 1A0QL 2APTA 5IBTL 2J8OA 5ICXA 4QLRA 4NFBA 4HJJH 2MHAA 5CEYB 1N6UA 4WCYL 5ELIA 1RK0A 1MFBL 2YSSB 1A9BA 5C0JB 3BKMH 1FL3A 3RDTB 4HC1A 4YO0B 2VDRL 4OV5A 1CU4H 1Q9LB 1Y6MR 3QIWB 3QIWA 1E28B 3GGWB 4XI5D 1A6TB 2BNQA 2R2BA 3CZJA 4YUEH 2IANE 3QHZH 3HFML 3ARED 3FOMA 3TA3A 5C0BE 4J4PA 1YDPB 3ZE1F 5MI0B 3WFBH 1A4KA 4YDJA 3UYOD 3MCG1 2DYPB 1GAFH 3RVUC 3WJJC 4LLYA 4NWUL 4LIQE 5A16B 1FO0B 1I8MA 2EC9U 1HWGB 4JZNB 5I75B 3PHOB 4YZFE 2XTJD 43C9A 4OLWH 5FGBA 5CZKA 3U6RA 1H3UA 1IC4H 4QXUH 2M8XA 4R7DA 2EDLA 1INQA 2XNAA 4CJ1A 1T7YA 4UIKL 2EZ0C 3FT2B 3MRRB 3WFZA 2YWYA 4ZAKC 4P46C 4P46B 4WHCA 3Q6GL 5EOTB 3HI6L 3IGAA 2D03H 3FHQA 3VFPA 3I2CH 3MGTA 1IAII 2BRQA 4O02H 1M4KA 4DKDC 2DKMA 1AHWB 1IFHH 5IVNA 1S9KC 4UDUA 4PJDB 4M8QB 5HJ3B 3QFJA 2Z92B 1BQLL 1WIOA 1G7QA 1KJ3L 2WQRA 4XPBH 4EN3C 2QQKH 3P77A 3HB3C 3VJ6B 5DRWA 1CDGA 4YE4L 1LD9B 5KSBA 1SEBA 4NPYA 4M03A 2ZPKH 3O3EA 3EDJA 4L4TA 3W11D 1MVFA 4HMCA 1KG0B 3QRFM 4R4NC 2DQIH 5D7KD 4OZ4A 1EBPA 4PB9H 3UZQA 5ISZB 4LHQB 4F80A 3MYJA 3MYJB 1TLKA 3P4NA 2EDBA 4JO4H 5B4MC 3S34H 3VI4F 3WSQH 4LASL 4WFED 1RIVH 1I8IA 1S7UA 3WXWL 1KB9K 4U6YB 1XZ0A 3TNNB 1CK0L 5JNYA 3G5XB 4P2QD 1Y0LB 2W91A 1SYVA 4IOIB 3RVUD 2EYSA 4XP9H 4XXDB 2FIKA 4HSQA 3RWDB 2XN9E 1CZ8L 3CIQA 5KSUB 3ECBB 1C8PA 4WNQB 4P5TB 3W0WB 1I1YA 2IQAB 1H0DA 1K5NB 3H7BA 3WKMH 2WMPA 2APVA 3PIQA 1C5BL 4LNVA 3U0TA 4E5XA 4WDIA 3CC5B 2YN3A 1NDGB 4WWKA 1Z9MA 1KELH 1A7NL 3GMLB 3C9NA 3TIEA 1XGQA 4R2GD 1G6RB 1KJ2L 3CFBA 3KR3H 2HKHH 2C7UA 4ZPTA 2F5BL 1FJ1B 3S34L 4YDIL 5C09E 1KEGH 1IGJB 7FABH 2NW3B 5DD5L 3OG6B 1CICD 5GS1A 3NCCB 3PL6B 2QQQA 5JOFB 3ULVL 5TPWH 1NUGA 2AQ1A 5I16B 3OPZH 5C0AA 3VFTB 4RMUA 3AU1B 1KJMB 4WW1B 3AM8A 1UWXK 4KKBD 1GZQA 2R4RH 4NC1E 3UTTB 4CADA 1KT2A 1DBKL 2X4TA 3K1DA 5E2JA 2GJZB 5FECB 3VH8A 3B83A 4RSVA 1A4JB 3IJYB 4BSVA 4MCYB 3DURA 5K9OA 1JZ3A 2D0GA 1ZLSH 3L7EB 1A2YA 2UZIL 4OZHE 4LLVA 2HFFA 3PL6A 5AUMA 1CE6B 3D85D 4GXVL 4K94H 5DEZA 3CAFA 5ANMB 3TCLB 5IT2H 2QHRL 4LHUG 2ZNWA 4YDKL 1NC4A 2XRAL 4F7CA 5DVOA 4AL8H 4F57L 2MSPA 5DJ8B 3QJHA 5D2LF 3VGEA 4APQC 3QUZA 1BJ8A 3WN5C 4FABH 2RCSL 2J5LB 2P8MB 1RK1B 1OCWL 3G6AA 2P8PB 4PGBA 1MCLA 4D8PA 5I1GL 5EU5A 2AGJL 5KANI 4X7SH 1V3KA 4GAYA 4S1DD 2ADGB 2I25N 4PJDF 3NA4A 5MERA 5C0JA 3QDMB 1HK6A 3OSKA 1U2CA 3U7YL 1VFBA 2C4FT 5ESVB 3C6LA 5DQ9A 1U8JA 5DEGB 5DD1L 5L9DH 1KT2B 3P3YA 5EN2B 1B6UA 1BEYH 2FEEL 5A2IH 3O0RH 2XY1A 4PRAA 4CDHA 3JBG7 2O93L 4GBXB 3I6KB 4NRZA 3MXWL 4RCAA 5EO1A 3KLAB 4M5YH 3ARWA 4WEBL 4X9HA 4LPYA 4DGVL 3P4LA 3U0PB 3GKWL 3GSNB 2FJFA 3TBTA 5JW5A 5IVZB 1FL6A 3IETA 5TDNB 1SM3H 4RAUB 2G2RA 4HPOL 3OZ9H 1UXSA 5DJAB 1JCKA 1RJLA 1RSFA 1WAAE 4NQCE 4YNYA 1T04A 4JE4B 4YXHL 1GZPB 1RU9L 3ROOA 4Y4HD 2OTUA 2J3SA 5D96C 5GZOD 4UTAH 4J12A 3KWWA 4AH2A 3UAJC 1MCOH 3LVEA 3RTQC 3HR5B 1IGMH 1N59A 1ULVA 1WVZA 4FFYH 4JN1L 3SO3B 1KCKA 3ULVE 2VC2L 3MLYH 5HYIA 4U3CA 1T2JA 4OF5A 2IAND 1VEPA 4M6OL 1U6AH 3X3GH 4M5YL 4NCDA 5F7UA 1OP9A 1MRDH 2JCCF 4DK3A 3ZL4H 3RVXD 1LO5A 2B7DT 3NZ8B 4P59H 5T1DH 4X5WB 3GSVA 4KXZI 3INUH 2DM7A 4NJAL 3T2OA 4PJFE 1T3FB 4PJCF 5ERWA 2F74A 3WV0A 5DF0A 5AG8A 5AZEH 4MJ2A 5I71B 4XZUB 1UKTA 2AJYH 2NY6C 3K3QA 2B2XL 3NA9L 4DKEL 1MLBB 1QUNA 1RURL 4M8QA 5IVOA 3W5MA 4TQEL 5L2JA 3MOBH 4G8IB 2H2SC 5J8OA 1NL0L 4RGMC 3ROOB 1R3JA 5HI5D 2XT1B 2R39A 3MRNA 1LO4L 4XMPH 3OX8A 1FDLL 3K74B 4NJ9L 2P1YA 5ALCL 5F7YC 3H3PH 1PQZB 3OJVC 1DLHB 3T0EE 1RJZB 3D85B 2DBJA 2ZCKH 4HW6A 4OI9A 1QSFB 3F6LA 4LLUB 2WP3O 4P23B 1TDQA 2PR4L 1YPZF 4KDWA 3O3AB 1UEMA 3AC0A 1CLYL 4JCLA 4NUJB 3SDDB 5I1AB 4XVTH 5EBWB 3CMGA 4Y16A 1BVZA 3MV7A 5EUKB 5EZJA 4JGMA 2DI8A 1UA6L 1KSRA 1MFCH 5KAQF 3TV3L 4S2SA 1GH7A 1IGJA 2OP4H 3BMWA 2E8ZA 4L3AA 2YUXA 2DQFB 1UM5L 5GS0L 1E4WH 3OL2A 2DQTL 1T4KA 4IHOB 3K2UH 4I0PA 1KFAH 3MNZA 4DW2H 3BGMA 2GSGB 4JKMA 2PYFB 4Y2DC 1QSEB 2VQ1A 3STLB 1FO0L 2E5EA 4RFOL 3QO1B 3K0WA 5D1XA 3OQ3B 2C3HA 4JHWH 4UILL 1GZQB 2NR6C 3MV7D 4KK8C 3PGDA 5EUKA 4BSVB 1BM3L 2FSEA 3QA3B 3MRBA 5HDQL 3EYSL 1G1YA 2HWZL 3WS6C 1Y6NR 1CD1B 4X6BA 2J88H 1BFOB 2X4RA 1OF2B 1G9NC 1I7RA 3HNSH 4S1QH 5HD8D 3STZB 3K8MA 4H26B 4NQVB 4MMXC 3K4ZA 5L0QB 3PWLA 4R90L 1A9EA 4URTB 3O6FC 2GSIA 1MCFA 3K2MC 2Q86B 5HYJD 4PIRF 1YN6B 3GJEB 2N7AA 4PY7B 2R1WB 3K2UL 1GGIL 5FGCE 1N0LA 3I9GH 2V17H 2EXWC 4V1DE 4LMQI 3G04B 4G43B 3TPUB 4YGAB 4RFOH 2VL4A 3PDOB 3P11L 5LCVL 3C8HA 3IDMA 1SY6H 4JFHD 2NW2B 4FQHB 4QHNB 1OAQH 1IQWL 4TVPH 4FTVE 1BVLA 2ICEA 3MV8B 4XBGA 1IAKB 2EEDA 5GRVL 3VE0B 5DJAA 1ND0B 1P4IL 1I3GL 1EEZA 1JGLH 5DI8B 5I8EA 5E5RB 4BM7A 1FHGA 3S4SB 3QEHB 4U6VH 4W4OA 4ZMAT 5EO0A 5I1EL 1REIA 4JFDD 3IXTB 1UWGL 4UV4H 3I85A 4I18C 2YKLH 5GGSB 3IGAB 5FAAA 5D93B 1NCDL 4RGND 4H8WC 1BD2B 1BD2A 2P5EA 4PRNB 1BVKA 1CDBA 1AFVH 2Y06L 3RJQB 3IETB 3T04D 3LD8B 2ATKB 5FM8A 5JW5B 1I9IL 3DXAE 3GMMA 4FQQB 4POZC 5IBUB 4ODTH 2OSLB 1BJ1H 3BMVA 4MJIB 4LIQL 1LDPL 3DUUA 1L0QA 5TF0A 1CQYA 3WUWA 2CKBL 3VGFA 4PLKC 1F4HA 4LSDA 5F6IC 3UP1A 5C0FB 3QPQD 1K3ZA 4PRHE 4LFHG 3GZKA 4L4TD 4HUNB 4DKAA 4LL9A 1IQWH 3DV6B 4OFIA 5B38G 3K80A 4GAJL 4UB0H 3REWA 5E6ZA 4OCRL 2ZNXA 2E9BA 4I13B 2V5SA 2X44D 4MQSB 2V7HB 2H8PB 4PRBA 1I85C 5HHME 2OXGA 5ESAA 4X9FA 5ISZA 3V4UL 3GSNA 4E41B 5SWZE 3ZDZF 4CW1B 5EA0H 4R7NB 5TQ2H 3F7VB 4OLZH 4AENB 1UENA 2ZCLL 4MA7L 4NC0B 2V2TA 1KELL 4YO0A 1RD6A 1ZEAH 1NCCH 2FX8H 1JK8B 1RHHA 4HT1H 3QYCA 3V8CA 1BIIA 1WQVT 4HHAB 2CLRB 3VFNA 4DCQA 3QRGL 4DOHB 1IZJA 1LD9A 3DJ9A 5I15L 5CJOH 3UXFA 5EO0B 5IW6B 4OCWL 1T03H 5JQ6H 4G7VL 3W9EB 3NCBB 5IHLB 1ZV5A 1TIUA 4LU5L 3ZO0A 4HIXH 3OJ2C 1V05A 3ZYOA 4HEPG 1TETH 2J8UB 1R3LB 1SVZA 3NTCL 3VXME 4QWWD 4OGAD 5DUMH 4L29A 5I73C 5F3HA 5IB1A 3QUZD 4YHZL 2F8XC 3G5YB 5GJTH 2R4RL 3NAAH 3Q5OA 1TQCB 4UI2A 3DVNB 2VAJA 4JFPA 5DUPL 3D9AL 4Y4FB 2HAZA 3LEVL 5E4IA 3ZKMD 3C08H 4CRPA 2R1YB 5DA4A 1XR9B 5E6IB 1D9KA 1N6QL 2W9EL 3MO1A 3MRMA 4RFEA 5I1DA 4HJ0C 2BJML 5M7QA 4H1LH 2NW3A 1R3IL 5JMRA 2D9QB 4YHLL 1TJIH 2DJUA 3SOBH 3PL6D 1JPST 4IDJL 1YPZB 4KQ3L 5K9KB 5BRZE 4YC2B 5I30H 1UWEL 1HQ4B 1FPTL 3QFDA 4LLQB 1FZJA 1HHIB 2QSQA 1BIIB 4ONGH 3UJIH 1WISA 5HGBB 4XP5H 2P42B 1E4KA 1OAKL 1QFUL 5FCUL 3LDBC 3I6GB 1KTDB 2DQUH 3QCTL 2EXWD 3QA3A 2ZOLA 2R1YA 4OQTL 4HLJA 5EC1B 2DQFA 4NZDA 3V95A 3MLZH 4DUWA 2MNUA 3G6DL 1HXMA 2W1NA 1S9VA 2MPAL 3MNZB 1N0XH 1KIQA 3ZDYF 3WL9A 5CIPH 4IHOA 3QCUL 2AJXH 5DDHA 2A9NL 4G8GB 1HQRA 2CRIA 4OLVH 4UTBH 1BEYL 4LHUB 2WAHA 1ZHNB 2VQTA 5IJVB 1FIEA 2BY1A 4JPWL 3KXFA 3EO1B 5CHNB 4WI4A 1OTTD 3QUXC 4NZRL 3SQOL 4WTZG 4KZDH 4JFQA 3B9KC 2C7UB 2YC1B 5C08B 1SBSH 3BXNB 2VLME 3K81A 3D0LB 4ODSL 4K2UL 3WNNA 1CYGA 4NQEB 5ABDE 4NZUL 2X40A 3ZKMC 3T3PE 3DX7B 4P2QE 2E9JA 1D9KC 4YXHH 4EBQH 1B6DA 2N7BA 3HAEH 3MLUL 1XFPA 4U6XA 1AKJA 3AY4A 2J8UF 2DQCH 2QSCL 3FCTA 5D5MA 1N0XL 3HI1A 4C57C 3ZKNC 3BVNA 1DBBL 3OXSB 3EO0B 2ITCA 4FQ2H 2BOCB 5EOCH 4OD2B 5CEZE 1JZ6A 3B5GA 1YEFL 1A0QH 4M3JA 4PBWD 3BP5B 4IS6B 4U7MA 2BX5A 4WW2A 5EWIL 2I07B 2A6IA 4GRLC 3LKSA 3ILQD 3SEPA 3TYGL 1QKZL 2ZUSA 2FATH 2YA1A 2Q86A 4YEEA 2JJSA 1OP3H 2FL5A 5D1QC 5DTFA 2A0LD 4XMKL 3FO2B 4IDLA 4RX4A 3ZDXF 1D5MA 5E24E 1D5BB 1N59B 2ZUTA 4OLYL 5GGSA 3LOWA 3H42H 3X11A 4CJ0A 2BSTA 3RVWD 3UYRH 4OGAC 1DBBH 4DKFL 5DZLA 1J5OH 5JHDE 3QUXA 2AQ3A 2EO1A 1U8JB 5DEGA 2PF6A 1FFPA 3KPRB 4N5ED 4OLWL 1U8HA 3RPIB 5E8OA 3D5OF 2HJFB 2R1WA 4WI9A 3IXTA 1A8JH 2A73B 4XRCB 1U8NB 4RQQB 2ZUQC 2PR4H 1MHPL 2P5EB 1FQ9C 2YPLE 3F7PC 3SO5A 1KF9B 3MRPB 5KBNC 2EH7H 4RWYH 3R0NA 4I2XA 1T1YB 2D9CA 2G75A 3DRQB 5D1ZC 4MVBC 1F3DH 3LN4B 2ERJC 4OSUL 3H42L 3BPLC 5I6XB 4PGDA 1CL7L 2CKBA 4EQ2A 3WN5A 3OKDA 1ZT4B 3GBML 5HHVL 4F7EA 3QIWD 1XCTA 4I9WE 3T0VA 1FGVL 3FB8B 5L2KA 5I1DB 5CBAA 4Z5RA 3SKOA 2J8UA 4ZSOE 4DTGH 4H0IA 4LBEB 4HUXA 1DEDA 4WUUD 5JTWA 4M6NL 5ACLA 3UTSD 1CFQA 1P7QD 5C0CB 4XBPB 4L29B 4LHUD 2VIRB 3T0EA 1EK3A 2VXUL 1MFAL 4S2SB 1BJMA 5INDB 1QLEL 3N50A 1ZVSA 3WXWH 5IMOB 5IP4A 4M8VA 4KKLD 1U95A 5FYLE 3SBWC 1BIHA 3B9KD 5BMFL 4MQXC 4KHTH 1F6AB 5K9KA 4L9DA 3S5LA 4O02L 2HT2D 4IOSD 4U4BA 5ADPL 2XI9A 4FFZH 3MUZ1 2K1MA 5DFWH 3TNMA 1QRKA 1J10A 3DTXA 3LPFA 1V3MA 2ENYA 1B3JA 1KV3A 1A7PH 4UNVA 1GGIH 2BNRD 4Y4FA 1CF8L 1UVQB 2ZPKL 4FQJL 3RL2B 4LARH 3RTQA 2WIMA 3PWJA 3SE3A 5IHBA 3S96B 1MWAL 2PYEB 4QYOB 3SQBA 3DX6B 1M6OB 4FZ8L 1IE5A 5DJCA 2PTTB 3FRPG 2A6DB 3ARBC 1R3KB 5KSUA 4NRXA 4Q9CA 3HUJA 2HKFH 4AZ8A 1B0RB 4XPFH 5C2UB 2DAVA 3T3ME 4OTXH 3VMNA 4M1CD 1PG7W 4JO3H 4TUJB 4NC2B 3SGKC 5A2LH 1F3JB 1DQJA 3C5ZA 5ESQB 3RIFK 3QPXH 5E1AA 5DGRA 5HHOD 3Q5YA 1GIGH 4WTXA 4J3OC 3MV9D 2ZKHL 1CZ8H 4HS6B 3MUGA 3EZ8A 4JJ5B 4XX1G 1BQUA 3UTTD 3IFNL 5DJ2B 4FQLH 1QSED 2RBLA 3MJ9L 4TSCH 4MNQA 1CLOH 1FYHB 4GXUN 4NRXB 1FP5A 1BVLB 2D7PA 2R29H 2XXMB 1D5XB 4PV9B 1WIUA 4JFXA 1YEJL 4DFHA 4F9PC 4JDZB 2VUYA 5DTFB 2X1OA 3RUGA 4P4KD 5E95B 2VO5A 43CAA 1KXTB 1U3HC 3OKLA 2BCKA 4Z7VF 3FFDB 4AL8L 2AXJA 3FTGA 1DQDH 1WF5A 1CVSC 4W4NA 2WWKO 5E6YA 3ULVH 3BEWA 2AXGA 4JFDB 3Q3GB 2DQDL 5SV3A 4OFYD 4QOKD 4J1UA 3PXJA 5IVZA 1BZ7A 4NQDA 3BDYL 2FX8L 4YHOL 4IRSB 4IRSC 4ZNEE 2G2RB 3BWUC 4HUVB 1F3JA 3C5ZB 2XG4A 4F58H 4HKZA 3ABZA 3UMTA 4LAJH 5EUOF 4DZ8A 3KXFB 3CMOH 2LU7A 3VU2A 1O5DT 1MUJA 3QXVA 4RA3A 5DJYB 4QRRD 4HKXB 5EBGA 4L9LC 4QRPB 3WNOA 4JKKA 1BBDL 3QG6A 2GTWB 4RIRA 5CZXD 3GMOB 4H26A 3EYOB 4LRIA 4BQ6A 1WICA 4WO4D 4LAQH 4PRIB 3IKCB 3U6RB 4TNVK 4U1JA 5C0IB 3S35L 4PBXA 4I4WA 5TGBB 4Z7WA 2B4CC 1Q94B 3DNKA 1ZT4A 1ADQH 1A3LH 1AQDA 5CJXA 4MXVF 3MRRA 3RUGF 5IQ7L 1G9NL 3LKPA 4IDJH 3MROB 2VN4A 1ZLVH 4YDJB 1FFRA 5IGXH 4FHBD 2NNAA