5D1ZI

Isdb neat1 bound by clone d4-10
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
149
structure length
149
Chain Sequence
b'NNTYPILNQELREAIKNPAIKDKDHSAPNSRPIDFEMKKKDGTQQFYHYASSVKPARVIFTDSKPEIELGLQSGQFWRKFEVYEGDKKLPIKLVSYDTVKDYAYIRFSVSNGTKAVKIVSSTHFNNKEEKYDYTLMEFAQPIYNSADKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Y10 Light Chain
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 149
sequence length 149
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5d1zI00
2O6PA 4YMPA 2ITEA 3SZ6A 5D1QE 3S48A 3QZMA 5D1ZI 5D1XE 4H8PA 3RURA 3QZPA 3QZOA 2Q7AA 4NLAA 3SZKC 2ITFA 2K78A 2MOQA 2E7DA 2O1AA 3QUGA 3SIKA 4FC3E 4WJG3 3RTLA 2Z6FA 2H3KA 3QZLA 3QUHA 4MYPA 3OVUB 4H8QA 3VUAA 3QZNA 3VTMA
chains in the Genus database with same CATH superfamily
2HTLC 3VGHA 3HMWH 3I9GL 2EDTA 4OZIF 2JIXD 1HEHC 4YEFA 5I76A 2OMYB 3UTOA 3I75B 1HI6A 3GMPB 3IDGA 5TJWK 3ZK0A 3QDHA 4BE5A 1V27A 3MXVH 4PREB 3V4VH 2NNXA 3LVEA 4K0OA 3NYKA 1MFDL 1SM3H 3ARGB 3RJOA 3EYOA 1RQ5A 3HMXH 4CMMA 2ZUXA 2YPLD 3WJJC 5INDB 5EIQA 2IGFH 5J11C 5L9DL 4WY7H 4JFVA 3ZPDA 4AQAB 3QZPA 1ORQA 1BHGA 5EHFA 2ZAHA 4PJ9A 1AGFB 2FIKB 1A4AA 2JCWA 3N41F 1FLRL 3L95B 3PGFH 1WZLA 1JIBA 1M7DA 1T5KA 1A8ZA 1OK0A 2PABA 1FUNA 3LCYA 4MNHA 3D85B 5I71C 1V55B 4YL4A 3UX9B 3E1F1 4JFXB 4ZO6A 3D07A 4XI5C 1ZANH 4QJ4B 4XCEA 3RVVD 2ZCLH 4OF3A 4HUXA 3Q01A 2YAEA 3VYNA 1OGTA 4BK4A 2OK0H 1QUNB 1B2WH 1WAAF 3HI1B 3NDYE 1RMFL 3K8KA 1AE6L 4NRXB 1V05A 5DJYA 3QISA 1TZIB 5K1VA 1MCJA 1CURA 1KBWA 5I9QB 2FX9H 2DJSA 3DXAD 3OL2A 2Y1AA 4JVUA 1OTTC 1VFBA 2YAPA 3F12A 3HG0A 4NQTA 4GBXA 4P9HH 3L08A 4PJEA 4XNMA 3O0RL 4F7MA 1BEYL 2DM4A 4XPBL 1NA8A 4K3DH 4M6OL 2DQDL 4PGCB 4I2XB 5I6NA 2KC0A 2Z91A 1NCHA 1OGAA 4P2RE 4MMXC 1KXQE 3DHPA 4HV8B 4EQ3A 3OB8A 2W94A 3HIZA 4DGYH 1PIFA 1Z3GH 1XO8A 3ARXA 2EVHA 2CDFA 2ZUUA 2R7EA 1TJGH 1IAII 4HCFA 5HJ3A 3P9MB 3QSKB 5AB9A 1FL6B 5L2JB 2FJGB 5B4MD 2FWOA 2UX6A 3B9KA 5C09B 1UD6A 5AB1A 4G8EA 1GOGA 3AAZA 1JYXA 3IDNB 2F58L 4M43H 4MMYB 2D0GA 3EHBD 4KVCH 3LEVH 1IC1A 3TBWB 1F86A 4IIQA 3CIQA 4S10A 5E95B 1FG2B 4PVBA 4JFOB 4WDIB 1N5AA 3BW9A 4B3VA 3IDIB 4QXTB 4TQEH 2V3EA 4L0YA 4F7EA 4UQ2B 4JFQA 4MQTB 3DGGB 5D1XD 4R3SA 2R15A 3ZXAC 2XACC 1CLVA 4JM2B 1BJ1J 3M17B 4DW2H 1MUJB 2O61B 2WJ5A 4LKCB 5TQ2H 4J2XA 4TL5A 5DS1A 1ZLUK 4LOUD 2WXMA 2VDRL 1HCVA 2ZOOA 3L45A 2IH1B 1QFWL 3O8XB 5JDJA 1KFAH 3LH9A 1QTYT 3X1FA 4S1RL 4W9CC 1X5HA 3KMDA 3BUQA 2VM3A 4N24A 1DDTA 4X2UA 1PZ2A 3EJYC 1ZPLA 1J5OH 5B1AB 3TN0A 1KCVL 1UA6L 4YDKL 4X7TA 4W4OC 3QWRD 1RZIB 2VABA 2CBOA 1UM6H 4Z7QE 2YZ8A 1EIBA 2Q7AA 3KXFA 1AHWC 2UYLB 4DWHA 32C2B 3FQNA 5I16A 4BM7A 5KS9E 3C6SB 4O02L 4U2YA 4P3WA 5BQ7B 1Y07A 5HYFA 3BGFC 2A0LC 1RZ7H 2EIMB 2P80A 2BH0A 3GJFH 5ADPH 1TU2A 1HXMB 1RUQH 3VWKA 3ZMEA 5IOKA 5SWZD 4HPYL 4C56B 3UBXI 3CVDA 2VDLL 1JMZA 1SDDA 5IROD 1RHHB 4Q9QH 5DSCB 1ADQL 1PZDA 1A64A 3W0WD 2BOBB 3L9RA 3LKNB 4PJIB 1FSKC 1AKJB 2VLKA 4PWGA 4NN7B 1SJHB 1XF3A 3HG1D 1E9OA 1KELL 3BUTA 1S5HA 3PHAA 2B1OA 1MCCA 5ALCL 1FRGL 3GTTA 3LS5H 1KGJA 3HG4A 4X7SL 3ARBD 4E41D 5KWYC 2HMID 2XQ0A 1PS3A 2ROYA 1EZVX 4MD5A 1HS6A 1WK0A 2BCKA 4DUVA 5ICZA 2W65A 3EGXB 3EYSL 5IQMA 4ZMLA 3VB8A 1V3LA 4RFEA 2A83A 3OXSA 3PCYA 3RUGE 3QXAA 3RVTC 1G7MB 1BAWA 4D8PA 3TJHC 1SRDA 5C0IB 5IMOB 4FQLH 3S96B 1WG3A 3TBVA 4DCQA 2YMTA 1NANH 5KSBB 2EVFA 1E28A 1MN4A 3DXAE 3BISA 1QKZL 2OL3B 1T0NA 3O9WB 3NZSA 2GTQA 3FB8A 4AQ1A 3VW3H 3GIZH 3IEAA 1IMHC 4QTHA 2IGTA 3L1OH 3NCJL 4UQDA 4KQ3H 2F53B 3DK0A 3JWDL 4OJDH 5IWLC 1TZAA 2VT0A 5DJXB 2PLTA 2BY2A 1J0YA 4HHGA 3X14A 3BZ4A 2OW6A 1P7KA 2I85A 2QQNL 1BZEA 4OZFH 4EO5A 1YEHL 1MJ7L 4LPUA 3EYUL 4DAGL 1C5DB 5J12C 3HS0B 1NCTA 4JE4B 1NIBA 4PJAF 1PNDA 3MLZH 2H3XC 1ETZA 1ZRUA 2DY2A 4FTVD 1QBLL 4PGEA 1MY5A 1C16A 1DEDA 2F19L 2RTTA 2AQRA 3HVNA 3MV9B 4UOZA 1YUKB 4BSWB 1JV2A 2OKMA 1H3XA 3SE3C 4BK5A 5D1XE 5B38G 5I17A 1A1NB 1HCFX 2NUPB 2IDTA 3EJZC 4KXBA 1PGRB 4PI2A 5F7FA 1QR1B 1I7TA 2OULB 5CEZL 1MG3C 3WS6C 4ELDA 4KWUA 2FH8A 4PWKA 1CFSA 4HZLB 3T3PB 5DR5L 2EIBA 4RBPH 4TQ8A 3VFNA 3WHE1 4GXUN 4IMLA 1VHPA 2PP7A 3ESPA 4RMWA 4GSDL 2VSMB 2YIHA 4K94L 1ZHLB 5I0DA 4AYMC 5KVFH 2DWYA 3QULB 2NZ9D 4HXAL 5EF0A 5EZOH 1MFCL 3LXAA 4G1EB 2Q86A 1MVUB 4WI7A 4W9JC 4ESKA 1RUAH 2CHDA 4DGWC 3FUKA 1KEGL 4XRCA 4LCCB 2ATAA 1MNUH 2PYFA 4IBTA 5EA0L 5EORL 5FM4A 1OGSA 4MWFB 4HCRL 2O93L 1LLAA 4PMFA 2VXVL 4C4UA 5TDNB 5LGHL 2OMXA 2HUEA 4JY6B 4LHJB 4I85A 3RBGA 4ZAKA 2QTVA 4KHTL 4R7LA 2WUCH 5AYTA 3RU8L 3QUHA 5SWZE 3OZLA 3LKOA 4HKBA 2XTLA 3HI5H 5I6MA 3OHXA 2ZIDA 3NSFA 4FQXB 4JPIB 3WTYA 2CKNA 3LZLA 1BZOA 4L3AA 4RAVB 2KYIA 4ZMYA 3SDCD 5K1JA 4N3UA 1G1CA 3HG1E 3MV8D 3VXUE 2NCMA 3WTTA 1N5YL 2SEBB 3C2AH 5GGTA 3UP1A 1HOCB 4U1IB 1F1GA 5KZCD 4QRPD 1T1WB 3BAYA 1IM9B 4HK0B 1H19A 5E56A 1JZ3A 5FYKD 2XNAB 3I74A 4QWWC 5HDBB 3SYOA 4E41E 3ULVL 3VMNA 2X42A 1MG2C 2DQTH 3NFPB 4WW1B 3SPVA 5LHDA 7TAAA 1BM3L 1J18A 1NCAL 1JK9B 1XIWA 2HJLA 1JI1A 2EXWC 2H26B 3LKSB 1X5XA 4DZ8B 5E6ZA 5IB3B 3F7KA 4FGMA 3IN0A 1HNFA 3NUKA 4R26L 4RCAA 5FGSA 2VKWA 5H4ZA 3SDYL 1EAJA 4BFOA 2FBRA 3QQ4B 4B0MM 1V3MA 1T21A 4Y2DD 3OV6A 4QXUL 4XMKH 4TNVF 2OZ4L 5CJ5A 1F2QA 3SKJH 2JJSA 2N4IA 3D4GA 5H35A 1PZ5B 3GTNA 1NZRA 3SQOH 2Z6FA 4UQBA 4HWEH 4ODWB 3EJCA 5EZIH 2RQ8A 5GHWH 2GSGA 4H8UA 4O9HH 1BYOA 1KJ2L 1QAWA 2BK8A 2LFEA 2EH7L 4NUJA 2ZICA 2UY7B 4A7QA 1EERB 5I6KA 4LK4A 4H4NA 1DSFH 4M6MH 1MVFA 4JZOA 3X3GH 1TTCA 1MFVA 3HN3A 1K3ZA 2E8YA 1DL7H 1E27A 4ZMZA 2AXWA 4AW7A 1KN4L 3H42L 3HS8A 1B0IA 4GQQA 4FTVE 4M62L 2XTSA 4KQ0A 4R0LA 3DJTA 1GVIA 1A6AB 4R6UA 4HWZB 3PHQA 4LVOB 1MFNA 3E80A 1N0LA 3IRCA 3EYOB 3OPUA 5HYQB 2EVGA 2WYTA 1XD1A 2VUYA 4JQXA 5F0MB 3S34L 5EIIA 5IW6A 3OMNB 3IJSA 3D34A 2W9DL 2K9FB 1PL3A 3F7PC 3T6VA 2RFXA 3VD3A 1G7PA 3MRGB 2NX5A 5HJDA 1MIML 3CD4A 2OCCB 3DIFA 3FMGH 4IJ3B 1H8OA 2YFNA 1M42A 2KPNA 3TL5A 1J9SA 1UM5H 3CC5A 3VXRA 1M7DB 4BFIB 3ZU8A 2IJ0C 2VRAA 1EK3A 4U1SB 1FAIL 4OQ1A 5CILL 4RFOH 4KH9A 3R0NA 1IQDB 3BP5A 3WN5C 2XBDA 4XCEB 3FHEA 1CICD 2BY0A 1ZLVK 1F4AA 3ESUF 4R5TA 3RTQA 2Z92A 1OOWA 3AREC 3LEYL 4HUXB 3US9A 3HJEA 4KJPC 4ISVA 3QRLA 4PTTA 3ARDC 4F58L 1NGPH 2NY7L 2YPKB 4OF5A 3WLWC 2PMZA 2VW7A 1CDUA 2PXYB 4PJBE 4H0LC 4LHUA 1XR9B 4I0PD 4RGMC 4PJEB 1WFJA 3C5XA 3F12B 4GBXB 3CVIL 4IOIA 3WN6A 4F7MB 5IMLA 5LKNA 4OTXH 2QLYA 1AGBA 4NX0A 4BFGA 1I3GL 2JKJA 4FQPA 2BS8A 1JXJA 5GGVY 2IOMA 2Z91B 3OKNA 2I7OA 4NB7A 3MV8E 5C9KA 3AMKA 1I9JH 1NOLA 2EIKB 2CM5A 4PJCF 2R0KL 5FOBA 1SJEB 4QRPE 1BQHB 1MHPH 3QNZA 4U6HA 2CDFB 5E9DD 3LZPA 4N9GA 5FYKE 3ZDZB 1R17A 4WI3A 3WJLA 3CFJB 2GIXA 2WANA 2YQ2A 4FQCL 5HJ3B 4AM0Q 3A6BH 1FJ1B 1AYOA 5BS0D 4C47A 2FWOB 4GW4A 4PJXF 3TVMD 4XWOD 2WSPA 1F18A 5JW4M 4X5QA 3RB5A 3UYOD 5JORA 1WAEA 5I26A 1H5BA 3AAZB 4PJ8B 4ZS6D 2OL3L 3OQRA 4TQIA 2NY3C 4TSCH 5C6PB 2P5WE 4HBCH 3FK3A 3ULUF 1BQUA 1OALA 5DD1L 3QEQB 3FU6A 1XR8B 2F08A 1IC0A 3MNVA 2P52A 2Y3NA 4G42A 2WXPA 1DUYA 1WE5A 2GBVA 1N68A 1TZOA 4UT6H 2P46B 4JFQB 3VX1A 4R3SB 3FU7A 4LEEA 4WWPA 3V4VA 1C5BL 1R3LA 4KTYA 1N8ZA 5DK2B 5L8KB 4HUUB 5B7MA 4JPKL 1DQDH 1NCBL 3F6LA 4KDTC 4XPTL 4YJZL 1KIUA 2MEJB 2WTRA 3HMXA 1H6UA 4PVMA 3MMEA 2YPVH 4G8GB 5IREA 2J72A 5HJBA 4XN5A 4OZGB 1FFOB 3FO1B 3TJEL 4LDEB 4M7LH 3KLAA 3P3RA 5DGQA 5T3XD 5T1KA 4X7TB 3O2DH 1J9RA 4YHPA 2UZYB 1JGDB 2EEFA 1HL5A 3KXFB 4RAHA 4YAQA 5E8PA 4PVNA 4OFIA 3FB6A 3V4LA 1UT2A 2ALAA 3FQNB 4XO9A 1C9SA 4XC3H 1F97A 1MHCA 3LRHA 2V5TA 3OKYA 4EI6B 1GPOL 3F84A 3UBFA 4NO2B 3DRTA 4M7ZC 3PJSA 1U8PA 5DXWA 1CXKA 1XBRA 1PZBA 1FO0H 4KX9A 1ZT4B 2FVNA 4OFVA 3QCVL 4GRWH 5JQHC 5A2IH 1NC2A 3L9RB 2ZYHA 2QQLL 3MV7A 3B5GA 2JTYA 4C4BA 1ZLWK 1XF3B 1OWWA 5C0ND 3MRMB 4X99A 3THML 4ICXA 1QUPA 3IMSA 3LB6D 3EDFA 3WEOA 3S0PA 4MD5B 5ICZB 3U9PH 2W65B 2UX7A 1XGYH 1ANUA 1XH1A 2X4UB 4ODXA 4OGYL 3KW7A 4PRPB 4XVTL 3VDBA 2VMCA 4BWTA 4XAKD 2ENSA 4RFEB 3FQWB 2A83B 3EJRA 3OXSB 5DYFA 4B97A 2Q3ZA 3DX8A 1HH9B 3B9EA 1ZEAL 4NFBA 4D8PB 2IOIA 4NENA 1GHFH 4TNWF 1KIRA 3BHBB 4Z7OB 2AC0A 4MASA 5TFSL 1AGEA 4JFPA 5C0EB 3OBAA 5KVEH 1LEKA 1SN5A 3BXNA 3IFOB 2CK0H 4Q58C 2WLNA 4QTHB 5AW6B 5IHHA 3Q06A 1I1AC 3NEXA 3ISWA 3Q5OA 4S1QH 3FN0H 5LB1A 3VGDA 1MJUL 3IBEA 1O7SA 4F15C 1OE1A 1XH0A 2FTAA 5E9DE 2OMTA 1G7QA 3PWPA 2I9TB 1BD2A 5D7LA 5HVWA 4WUUB 5BS0E 2VO8A 3EOBA 3BH8B 5E2VL 4ZXBD 2D7TH 2OQJA 2LV4A 4JN2B 2PCPA 4M4PA 3UACA 5D6CA 3GLAA 1ETZB 4XNAA 4ZQKA 4PJHF 2EABA 4GI8A 4X42A 1O6VA 2Y2YA 4GEJA 4F9LC 3EKCA 5E2TL 35C8H 3HUJB 1ZVNA 4S1DD 1EXUA 2L7QA 5CGYD 4D0CB 1WD8A 1IM3D 3BFWA 5CINL 1R5VA 3MLPA 3TA3C 1A7NL 3LEXA 1I7TB 2K7PA 3NRQA 1FP5A 4NQQA 1R24A 3ZIMA 1JXFA 2BRRL 5TK4A 3R7QA 2XQYA 3GJFA 1CFSB 1FNSH 1NCNA 4YXLL 3CSBA 1IGFH 5DVNA 1DBMH 4IMLB 4HSCX 3BKJL 3CFBA 4NAJA 2B4CH 4X9BA 5F89B 4RSVA 2P4AB 3KDMA 1ES0A 4ZW7A 3N9GH 3BFQG 1IGTA 3SGEI 3FAXA 4BH8B 3BSZH 3HR5A 1YPZF 2A4CA 3HB3C 4K5OA 1WP6A 3TBCA 5FO8A 1KN2H 1OHZA 3NN8B 1K85A 3JV0A 2UWEA 4DEWA 4GKZA 1BMZA 4W68A 5IBUB 1LWJA 4PJGF 1Q9OB 1IC5H 5DFVC 1OCWH 3KLHD 4RRPM 3HFMH 4UBDD 4OD3L 4NT6A 1G1OA 4ZAKB 4TULL 3VI3A 4JFED 4KI5F 5CWSA 2A6KA 3MYJA 1NAKH 3WKYA 4HKBB 1FIGH 2OMZA 3MJGX 1Z7JA 1RZFH 2ZUWA 4I4WA 2FQGA 3WXVL 2EDXA 3G6JA 3ZTJH 1KJVA 1HVXA 4AZUA 5ERWB 2AJSH 3B43A 2X2YA 3CZFA 3ZE2F 2YD0A 4JFSA 1XSIA 3F05A 4YPJA 1SXAA 2F7OA 2J25A 4KK6C 3RDTC 5I75B 5KSAB 1RJYA 5I28A 3GK8H 5JIDA 3RAJL 4RGOH 2BHUA 3QZLA 3SPVB 1ZHKB 3RDJA 2DYRB 3ZX1A 3KS0J 2BXYA 4K5LA 1XIWB 5JW3L 5KBMA 2X28A 4ZOCA 1H3VA 1AIZA 2V7NB 4KUCF 4KY1H 1NGWB 3DETD 2XN9A 3TA4D 4LCYA 2V9TA 5MERB 4OZFA 2VLMD 4TLUA 5GPRA 2CR6A 1O7DE 5KANG 3QZWB 1MKFA 1QRNE 3LNIA 4IHOB 2E6QA 3IXTB 1ZLUH 3RIKA 3B3IA 4KKCC 4AIZA 3KH4A 3RKDD 4Y2OB 5BZWA 5HHOA 4HIXH 4G83A 4EN3D 2OYLA 1FORH 2GSGB 2AEOA 2ADFH 4NUJB 2MPAH 3J27A 3NZHH 3HNTL 1JPEA 4ODHH 4CKQA 1S9XA 4JB9H 4IDJH 1T89A 3OLGA 3ECBB 2W9EL 3G5YA 3ASNB 4JZOB 2VLJA 3VJ6B 4LLYA 5T5NG 3N1FC 3NSXA 1ASPA 1XF1A 2GC4C 4IW4C 3UEZA 1C1EL 3V4UL 1MLCB 4H0HB 3G5VA 1H3PH 1E27B 4X80H 3SE4C 1K3IA 1CJYA 3O6ML 2RBLA 1VZIA 3FQ2A 2YAHA 5CSGA 4BFJA 1OCZB 4FMVA 3WMSA 2XPYA 4ORGA 1AO7D 2DLTA 3BQVA 43C9A 1YVLA 4WEEA 1CL7L 2XV2A 5I2IA 5FFOA 3HPJA 1QATA 5GZNC 5CP3H 1BOGB 1SZNA 3OQ3B 4KTEL 3GSRA 4D9LH 4OJYA 3GMRA 3P2BA 3STBA 4PGBB 3ZDXF 4AYFA 3UROR 1U8OA 1SLWA 5IW6B 3NTCL 2AJVH 3LD8B 4W9KC 1QSFA 3P11L 2J21A 2WQ8A 5HVGB 2DDQL 3GKWL 1G7PB 5JW4N 3RJQB 4NO0A 1DVFB 2J6WA 5IHZA 1HK6A 2EIDA 1P4LA 3X13B 4JDVA 5L6YH 5I66B 1FNEB 3D0VA 2NY0B 2Z0BA 3DIFB 2AQTA 1P2CA 3CN3A 2VZ3A 3SQRA 1IIKA 3K4ZA 1TMCB 4BZ1A 3CK0L 5H2BA 1TSRA 2WLLB 1QR4A 1KSRA 3C6LB 4DGIL 1MY7A 5JPNC 4YHLL 2DAVA 2ICEA 4G43B 1UCBL 3I9AA 4P3CH 4E9WA 2AKRB 2MWCA 4JM4H 1GSMA 4HPOH 3ZR5A 1AZRA 3BP5B 5K9OB 4PQXA 5BO0D 2W0PA 3VXPB 4TTDC 3RTQB 2Z92B 4HH9B 1Q38A 3M1BB 2VDKH 3TO4B 1MWAB 4OLZL 4ISVB 1PCSA 4PTTB 4N1EA 3VSTA 5IMMA 3UO1H 1PKQE 4JFEE 5DJCB 4H26A 3VD4A 5I8CA 3H3PH 5T5NF 3TT1L 5MEQB 1RD6A 3NJIA 4X7FC 2VC2B 1WICA 4E9RA 3BO8A 3OKNB 3KPNA 2C1OA 3TIDA 4OCXL 3IGLA 3BSHA 4CDHA 4KQ4L 4HJ1A 1GTFA 3MBEC 4Q89A 2C5DC 4N87A 4N9GB 2WXKA 5CO1A 2GTZB 2EIZA 5ANMA 1XXDC 2DWXA 5CJQL 3S8FB 4GW4B 5HI5C 1G9MH 2N3JA 3IDJA 5JORB 3JV5A 1CU4L 1U8IA 4BZ2H 4PRHE 1H5BB 4Z7UE 2DQCH 3LZRA 2XQBL 4Y4FB 5AVQB 1B4JH 2XX0A 3K74B 2J8OA 4UQ9A 4YL9A 1X4XA 1QFWI 4GQZA 4TNEA 5BZDA 3PL6B 4HH8A 3U46A 1DUYB 1JNHB 4OGAC 3UJJH 1P4IL 2XTJB 3Q1SH 2GK0A 4YSDA 3V4VB 3Q2VA 1R3LB 5IKCB 3MRHB 5BVJA 2G4GA 4C54A 2ZCHL 1E50A 5DQ9A 1WFNA 4WNQA 3BDBA 4HISA 2EDYA 2WTRB 2JK5B 5D1ZD 5JOFA 5CJOL 5AYQA 3TYGL 3QCTH 1S7VA 4UAOB 4Y5VC 4XPGL 3KJ6H 1G0YR 2B0SL 2TAAA 1TETH 1ZHBA 1E4KC 3AT0A 3KLKA 4PRAA 1JE6A 5A16B 4Z0BL 2OW7A 3CZSA 1QLEH 3SCMD 3ES6B 2HFFA 4WFHD 4V1DA 3GUFA 4CBZA 4EQ2A 3MNWA 3FB6B 4U1KA 1FFNB 3GLZA 5E51A 2AK1L 2WYIA 3KWUA 1AO7E 2Z7UA 3A4EA 1WZ1H 4PFEA 2BIMA 5I8KH 2V9QA 3MCKA 2OMWB 1Z32X 4JFDD 5ECGA 3S36L 5J89A 4JG1L 2A77H 3DRTB 2BFVH 2OJ1A 4Z0XB 4YMPA 1UJ3B 2VQ4A 5D2LF 5FXCH 3ULVF 2YUXA 5I8OH 2YBGA 4N2NA 2XVBA 1F4XH 1JNNH 3NP3A 4L1TA 4OKVB 3QIBC 1PF3A 2W80C 3TF4A 1DN2A 3IFPB 4PG9A 4UDUA 3QEUB 1MCWW 2BOLA 1XB6A 3PUUA 4PRID 1EDQA 4XXWA 3V5KA 5AUMA 1BAFH 4ZFOB 1I9RL 2AV1A 2QKSA 2BSBA 3P73A 4A6YB 1AY1H 2A3TA 3O6FD 2NY2D 5KANI 2GJ6D 4F7TB 1DBKL 1CFQA 4GKNA 3JUZA 5PCYA 1YNTF 5DD5H 1R3IH 2PPFA 2HFEB 3BKMH 1CFTA 1JN6A 2UY6B 5EZJB 3QORD 3QJXA 3VXNB 2QV4A 3O41B 3VX0A 2ZAIA 3EH4B 3QQDA 5TE6L 4AK2A 3LPOA 3O4LD 1CMOA 1BLNA 4QRSA 4YSCA 1XCQB 1EGJH 1KIRB 3EUDA 3H0TA 1SVBA 2XG4A 3QHFH 4GUOA 1LHZA 4JFPB 1NIAA 4MDJA 1H0DB 3PF2A 4P9MH 3B2DC 1E4XL 2QLVB 2HP4A 2J1KA 3D18B 5GGTL 3KAAA 2OMNA 2YAOA 4J6RH 3STZA 3Q8CA 2F7RA 5B8CB 2PYEA 1QNZL 3JZ7A 1GA2A 2OMTB 4FA6A 4X6DA 2PWEA 3PWPB 1P7BA 4OAWA 4YX2H 3B4NA 5AYUH 5GRZA 3R1GL 1NL0L 4IKKA 3K6OA 4QNPE 1OL0A 4YLQT 4CDGC 2EDBA 4DEPB 1Q0XH 3UZEA 5MEOA 4GINA 1T7VA 1GKOA 2V7HA 4JAMB 1AQKH 4LSRH 4PWHA 3ZIYA 3MLUH 2X6VA 5D6CB 1ACYH 4XNXL 5DCCA 4PLNC 4MYWB 3NIFF 4P46B 2ZJSH 2R69A 4XPAH 2CLZB 4LT7A 4MQ7A 4A7GA 3O2DA 2G9HA 4P2OB 1C7TA 5FYJU 3V8CA 1J1PH 4J12A 1RU9H 3HNSL 2WNKA 3IU3A 3GBNH 3LV3B 1OSPH 3U30C 5DWUL 1KMGA 1R5VB 2PWDA 4QXGH 3FFOA 1FNHA 6FABH 4HJTA 2PPEA 3WI9A 1ETJA 3Q05A 2VERN 2DQGH 2Y24A 3LEXB 2IH3A 5GIRA 2QPEB 3IXAA 4ELKB 4L8DA 4LGSB 4BXSV 1JDDA 3QJHA 2E7HA 3QZBA 3UGUA 3FTGB 3IDMB 3NEOA 4XT1C 3WXWH 5HYSA 2ZUQB 4L5FH 1FO0A 4N8VG 2VE6A 4JJOA 4ZSOE 3OKEA 3U1SL 3FRPB 2GY5A 4JN1L 4X4YA 2NZIA 4JL1A 3ZE0E 4DUWA 5JPMC 3QYMA 3DMMD 1PSKH 3MACL 5TDOA 1OHQA 1I8MB 3D9AH 4JKPL 3I9PA 4WFHE 2HT3C 1ZLVH 4UNVA 3MOBH 4GQ9L 4QRBA 2O5YH 2NXYC 3V6ZA 5FO8B 5BV7C 4DP9X 1Z5LB 1XDTT 5GRVL 4J3SA 3KPRD 2XSKA 3KPQA 5C0CB 4JFDE 3S7GA 3ENEA 2AJXH 2D4DA 1K2DA 2D31A 2VTFA 3QHTC 3QA3A 4L4TB 1ED3A 4QAWA 4FG2A 4HLZH 3PQYA 2X3CA 4L8SA 3U82B 5I15L 1M56B 1ZLDA 1KBGL 4ENED 4P59H 5AENA 1E8ZA 1THCA 9PCYA 1SOSA 5ES4B 2VR3A 4I4WB 3ZZLA 3L5HA 3P4MA 2H32B 3A4AA 4R2GB 1KJVB 5B1JA 5F9JA 2OSLA 1XD0A 4XP9H 3U6XA 5FYLH 3UYPA 3W2DH 1J8HB 1R3HA 2DM3A 4G8AC 2R0LH 1D9KA 4PRIE 3AY4A 3L7EA 2XG5A 2PW1A 4WCYL 1ICTA 4KRNA 1JCKA 4LF3B 5EZLA 5BZXA 5KBNC 1RJYB 2H3KA 4XP6L 5K59E 4Z7NE 4PS4H 4OF7A 3KPSA 3ULUD 5IVOA 3TBSA 3PY9A 3C5JB 1RZJH 2GJ6E 5D8JH 5E4OA 4YDVA 3CNKA 5FYKH 4HFWB 3EAKA 3IPEA 4RMRA 2ZXEB 1CBVH 3WLBA 3KNBA 4OB5L 3VFOA 5GS1B 4HHAA 3D09A 2DLIA 2JMRA 4OZFB 4X5XB 5C8JB 1LE5B 4LSDA 2F9BT 4JRLA 1WUZA 4OFDA 5B7EA 4TNVK 3C09C 3S4SA 3EF4A 2QPSA 5BW7A 4FXKA 3MLTA 12E8H 5I1HH 1J0HA 3B3IB 2ATKB 4YDIH 4LCUA 4R7NA 2JKSA 5ENWB 3MRNA 1IILE 1S9WB 4EUPH 1DBJH 4N3TA 2WLJA 4XXCC 4ABWA 2DEWX 4B50A 4MA3B 1CLZH 4LSSL 1WHPA 1G6RH 5DRWB 2LLGA 5L0QC 3QFGA 4G59C 2GY7B 3IDYB 4AIOA 5CD3A 3W9EA 1YEGL 2VLJB 4PP1C 4XCCH 2IBGA 5HP5A 3AY2A 1F56A 1FC2D 1U8KA 4Q9CA 4HAKA 1LNUB 1DUZA 3K80A 4AQEB 5BXFA 3H3BC 4YQXH 4KV5E 3DYMA 3SQBA 3V4VL 43C9B 4ZMQA 5E24E 5JOPE 1TOXA 3A47A 1P6AB 2QSQA 3BSZA 3HPJB 4LRNL 5DRZA 3OKMA 4WTXA 1I1FB 3GSRB 2YHGA 1U3HA 2ZX9A 5F7HA 4KY2A 5DC2A 3HMXL 3AADB 2XY2A 1E67A 2IGFL 1BQLL 2BP0A 4TV3A 3WO4C 2BP5M 4MJ5B 4KX7A 4LLAA 3ZYOA 4ANXA 4TNFA 3RE0A 4NO0B 2V2TB 3LNHA 1P4LB 1RZKH 1X4YA 3D0VB 3W39A 4J3UA 1JF6A 3WIIL 1P2CB 3P4NA 4OH2A 5CBAA 4UNIA 5GZOA 3BMVA 3PGFL 2RCSH 5K9JH 2BWDA 2VMFA 4JGMA 5HJGA 3A21A 5CSZA 1HL8A 5K9QG 3QUYA 1KIQA 2NTFA 3D25B 4OJEH 4BA0A 1M9WA 4FDWA 1P7HL 4PJ7E 4P2RA 3TIEB 1KXQA 1ZANL 3KPRE 4W70A 1FAKT 5IBTL 2BSSB 4AEFA 2ZCLL 5CAYB 1P5UC 1OP3K 3VQ1C 5E7FA 1QQDB 4MA1B 1S7RB 3R4RA 2XWEA 1W0VA 2EP6A 3IMVA 2DYPD 5EU6B 3ZOAA 4QRUA 4CMHB 2BNUA 2IG2H 3MODH 3AWGA 1JWMA 4JO2H 3UAJD 4PJCE 2BWIA 1DO5A 2CGYA 3GRBA 1CDCA 2YAFA 3GSWA 4H26B 3EYVA 4RLDA 1NDMB 1PKOA 3VD5A 2KDGA 2UZXA 5CEYA 4WJKB 2W95A 1OANA 3Q5TA 2GTWA 2HUHA 1KB5B 4K3DL 6TAAA 1JV5A 2EIJB 1IBZA 4XI5D 1JGLH 3C60A 2H41A 2CPCA 2G0KA 4QJ3B 5DHYA 3AUWB 3TBTA 2OP4H 3D39A 4P07A 1CG9A 2V2WA 4OM0H 5C6TH 3K0YA 5DHDA 2VLLB 3CDCA 5IBLD 1TJGL 3ULUE 5GRUL 1N26A 5FGCB 2CSPA 4Q6IA 5ANMB 2WWKO 3WU1A 2LAAA 3LZOA 1Q0YH 3RGVC 1BBDH 3IDJB 3LH2L 4F7KA 3KGUA 1AR2A 2NMSA 3K71B 5IB5B 4OFQA 4G6AC 4M43L 4LSPH 5EUOE 4KVCL 3DKHA 5BRZD 1J12A 2EYTA 3FOLA 1M05B 2JIXA 2W0FB 4K8RC 3U46B 1KXVA 2IWFA 3CUPA 3LSOA 4Y4HC 2GK0B 5FUZH 4NHCL 4FNLL 4M93B 1PQZB 2X4NA 4DW2L 1JTTA 5TQ2L 5IQOA 5KS9A 1OLLA 5CP3A 4XGZA 4LFHG 5E2JA 6PAZA 2X89D 3G7TA 4YSTA 1RL1A 4NQCB 3FTXA 2CO7A 1KFAL 3FUJA 5FDYA 3NG5A 4YO0A 1YYLH 5DK3A 4MAUH 4DPCX 2YPLA 2BO0A 1CO1A 1Y6NR 4IBZA 4EDXA 1EEYA 1U42A 5AW8B 4CN1A 1J5OL 1NGYA 2QADC 4OLXL 4X8XA 3PWLB 3T4AB 4AGOA 2GABA 4I9WD 2YGQA 3RX9A 2ZSWB 5T3XH 1N7ML 4JZJA 4KI5D 1B0GA 1SEQH 1CZ8L 4X83A 4Q14A 3KGRA 2F8VA 4DESA 4KO9A 4TKWA 3MCKB 1CVRA 1A25A 1DEEB 1XWVA 3PUCA 2YUVA 3FZUD 1A47A 2QR0B 5ADPL 1RUQL 4JR9L 3EJYD 4JMNA 4Z6AT 5DUML 2GITB 3RVUC 5F6IC 3RUGA 1IAIH 1Z9NA 4JJHA 2H2PC 2HJFB 4EXKA 4POYA 5EBWB 4F92B 1R1CA 5IJDC 5DI8B 1MLBA 3A22A 3CZLA 1QWHA 1HL4A 3L3JA 3V7MA 4FQJH 2EC9T 4AM0A 3EH1A 5HTSA 4KFZC 3V5KB 5AUMB 1YY9D 3WO3B 3DXAA 3L2MA 5BUPA 1OT1A 1OB1B 3O4OC 5I5IA 3LS5L 2A9NL 1A5FH 2H3NB 3BDYH 3BIKB 3P73B 1I7ZA 5HPOA 2H6PA 1VAHA 4GMTH 1CFQB 4JQVC 3RY5A 5B1KA 3QYCA 1MCNA 4IU2A 1ZT1A 3DVGA 4ONOA 2J4WL 3VGBA 1A9BA 1E5ZA 4OJAA 3IPFA 1WD9A 4Q4EA 3C08H 2BVUA 4GAYA 4TNWK 4DVBB 4HUVA 4AITA 4NKIH 4NWTL 4OUUB 1J5HA 3H0TB 2VR4A 2XG4B 4AENA 5GGSY 2IQ9L 3HBZA 3L3GA 5IF0A 4BZ2A 1MCEA 4AJVA 3T1FA 1U8QB 4ATTA 4Z3TA 4NDMB 1K5NB 1M6UA 5DO8A 3H4HA 3GIZL 3QNYA 1GZQA 1VCBC 3QAQA 5KYWB 2WXOA 3KYNA 1P1ZA 4FP8H 1XL4A 4KQ3L 4RA3A 3HKZA 2VDML 3EH3B 1EAPB 5FO9B 2PYEB 4YDJA 4ABVA 4PJHE 3VA6A 4X6DB 4ZPVB 2LU4A 3RL1A 1T66C 5D1XA 4KOBA 1D7DA 2C3XA 3DPDA 1KWGA 4GG6B 4XE5B 4F5CE 1ZA6A 2JB6B 2FEEL 4GRMB 4P4KD 5F0PB 3ZE1B 5JXEA 1BPVA 3ECQA 4UDTA 2QVFB 4WSKA 4M3KB 4K7PH 5TE7L 2EKSA 2DLHA 2JF1A 2GIMA 3MLZL 4Q7DA 4NRYA 2OFQA 2ZXQA 5BRZE 5JYLA 1FZJA 2HKFL 1OSEA 1WFIA 3T0AA 5D2NC 5DMIH 2WQRA 5FV1L 1KPVB 4XAWH 4IGBC 4DNLA 3T0DA 3IU3B 3QWRA 4HK3J 1MFBL 3MRPA 2EJ1A 4HP5A 5EC2B 3RRQA 5E6ID 3NPSC 2YJLA 5IQ7H 3IXAB 3Q8AA 4JRFA 4E5XA 1SOQA 3QJHB 1MCOH 5K9QI 3FAWA 2LVEA 2PF6A 4L1BA 2YXMA 4H2AA 3HG5A 4XN1A 4W1TA 5HYSB 2B15A 1SNRA 3SY6A 3PV7A 4GRWB 1BBJA 2ZUTA 2XPGB 3F6JA 5F44A 4NZRL 1M7IA 4PJGE 5SWZA 4EI5D 4X4YB 1I3VA 5IROA 3MTXA 3IT8D 5KVFL 1NCJA 1I1YB 4NOFA 2FYVA 4J4PC 5C9JA 2XZCL 3ZDYE 3CDFA 4G5ZH 1ZDQA 2PP9A 3NIGF 5I1EH 2A73A 1KB3A 3EJZD 5LJYH 1TJIH 3QDMD 5BO1H 3DV4A 4DF9A 3HG1A 3IE4A 3U1PA 4FZEH 5EFIA 3KPQB 4MFHA 2B9BA 2EECA 3CSFA 1K2DB 2D31B 1D2OA 4Y5XB 3ZE2E 3PQYB 4E41A 3PFQA 1KLUB 4NQDE 3FQRB 3D0LB 2OYKA 4UOJA 3HI5L 5F9JB 4UIKH 4BZ1L 1R3HB 3NIDF 4MHHG 1D9KB 1TZHB 3L7EB 3QG7H 4L0PB 4LASL 4UM9D 3C2AL 5DHEA 1UFUA 1KGXA 1UQSB 2E76C 5I1LB 4AL8C 4EBQL 2YN5A 5I5JA 3BVWA 1JBJA 4WO0A 4AV0A 4LNVA 3AVEA 4OF6A 3TBSB 2V17H 1GMEA 1HEJC 2DQTL 4JHZA 4YDVB 1ZVSA 1CYXA 3FCBA 3RWEA 3E0GA 2VMDA 3UG4A 4NO5B 5JQIB 3LNGA 1U4FA 4ZPTA 4APQC 5MI0C 3PYCA 2I69A 2WZ5A 3DVIA 2J8UE 3LQAH 4HHAB 5CMAA 5EN3A 1UXWA 1ID2A 2DQJL 1E65A 3R06A 1LWRA 1BFTA 1Z5HA 4CNIA 1L9QA 1M57B 4TLTA 1BZQK 2XA3A 4XMKL 3MLTB 2E56A 3HZVB 2XPZA 4E9TA 4LCUB 3TH3T 3HA0A 2YEZA 4FTVA 1JCVA 3MRNB 4HWEL 2VXSH 4DPBX 3F65A 4WTQA 3I6GB 5D72L 3X3FH 1RPQA 2J8HA 4O9HL 2D03H 3QPQC 5LNEA 1FGVH 3QR0A 1PZUB 3MJ7A 2XXFA 4NGHH 3IWVA 4PMEA 3W9EB 2Y6SC 1CL7I 4M6ML 3CVHA 5FO7B 4IRJB 4A67A 4NJ9L 5EOCH 1WWBX 5AAMC 5BUAA 3X3GL 4YLCA 3DX2A 3B2PA 1VEOA 1MAKA 5CLTA 1DL7L 2I60L 3ZDXE 3QE5A 1NEPA 4MDRA 1DUZB 2DL9A 5BXFB 5J6HA 1AZUA 3APFA 2A9AA 3WMQA 2YD4A 4A37A 2Y25A 5B3JE 1GAFL 3H9SD 3SQBB 5HI3C 4G80B 2NY4B 4F8OA 3EGSB 4M5YH 1U3HB 5IMKB 2WLMA 3ASOB 4JREB 4WJ5A 1EHAA 2FECL 1KYOK 5HYIA 3ARGC 3G9AB 3IPBA 1RPUA 2YGNA 1GZPA 1EJOH 1U2CA 4N68A 1HJCA 2J7LA 2YA0A 4HULB 2DJMA 3TO2B 3VQ2C 3B8YA 4Z3FA 2G3XA 3VM5A 2J56A 2WVSA 3VG0H 1OTUD 4YGVB 4M1DH 1EA9C 3FMGL 4MJJA 4CC4A 4PJBA 2BHYA 1UM5L 3JV6A 4GAJL 4FQ2H 5D70H 2NLJB 5CSZB 4ZI8A 2VOTA 3T2NL 5GS3A 3QUYB 1FE8H 2FLRT 5IFJB 3QDME 3SDCA 4F1ZA 3MV8A 1HJBC 2BP8A 2ATPB 5DUPH 1NEZG 1UWXK 4QRPA 3WIFA 1HFUA 2QQKH 1E9QA 4QRUB 5FDWA 1ITCA 3GO1L 1A7QH 2DL2A 2CU9A 2QQQA 3GSWB 4MCYB 1JD7A 5JNYB 3KYMB 3L2NA 4AX3A 5I9QC 1K8IA 1IJNA 3IMUA 3QH3B 1JZIA 4AQ8C 6CGTA 3RURA 4OTXL 1JV5B 2XZQH 1N64H 2BZCA 1ND0B 4LEXH 3CBKB 5DHYB 5CLWA 4YXKL 1BVKB 4RZCA 3D39B 4Y2DA 5MENB 2ZKYA 4MMZB 4ZG1A 2ZOKA 2ZSVA 3ARDD 1MHPL 1W16A 2V2WB 4KKAC 5E03A 4JL2A 3HHSB 1KENH 4EUPA 3VXTA 2CJTA 3TH4T 3U9WA 3QRBA 4HKZA 3PNRB 3DHMA 3D50A 1YEJL 2YMXL 5A6LA 4LHUG 3VXSD 4BH7A 5LN4A 1AR1B 4TSCL 1NCWH 2GVYA 4HBCL 3V0WL 4G6KL 3CPLA 3OR7A 1KXTA 1XF5A 3BZ5A 4WO4B 4FFVC 4XZUA 2AV7A 3QHZH 3VYPA 5ESQA 3ZUCA 1BGXH 4XVJH 4BINA 1NFDE 4Q6YA 4Z7WB 2L4OA 2X0WA 2X4NB 4EIBA 4Z7VE 1DQDL 4XGZB 15C8H 4KH2A 2CDEB 5JIMA 4HUWA 2ZX6A 1I8LA 2ZYIA 1G9HA 1EFXD 1CXHA 1PD1A 4LGPB 2W0LA 3PWNA 2NY3D 2HFGH 3E6FA 4FQ1H 3TONA 3X2QB 4YO0B 4JO5A 2YPLB 2X09A 3CCHB 4KUZL 5GRJL 1H8NA 3FFDA 1KGIA 3GDCA 2R69L 3LKPA 4M7LL 1RK1A 4C57C 2MCPL 1TDQA 4PJFB 3O2DL 3X17A 2PO6B 3NK4A 5A2CA 4ZOBA 2HG5B 4UTBH 1OT4A 4JFFB 4WLCA 3TEUA 3S3DB 3BLBA 4XC3L 3H9SE 3V6OE 2NY5H 5FEBA 2R56H 3NA4A 1R75A 4NIKB 3MZGB 2NW3A 3LZNA 1TJXA 4MHHI 4NQVB 4X4ME 4NQEB 5CLXA 3D7PA 5BCAA 2XWTA 1ID5I 3BRFA 3FQTB 5CUSH 3HLAB 1XSKA 1INQA 4G8IA 5HI4C 1FO0L 1RERA 3SBQA 4AUYA 5GISL 1CICA 2B77A 1X7QB 5JOEA 2WP3T 1J05A 2XIIA 3SPCA 3MBXL 3ZJAA 1J1OH 4J1UA 5I74C 2R23A 4HD9A 3EO9H 1A14H 4WK4B 2B1HH 3INUL 3QJOA 4MZ3A 4OCNC 3NCMA 3S35X 4NN7C 5DHMC 4I0PA 1IEAA 5DK0A 3AB0B 3L16A 3BMWA 3CWGA 3JTTA 2AJUL 4NWUH 4KNQA 5EULV 1UWEH 4MDIB 2CKBH 5GS0L 1E4XI 3VFWB 1B3JA 5HD8D 3O3DA 4PGJA 1IAOA 4WF7A 3VRLF 2A38A 1G84A 4QO1A 3V52H 3WJMA 5E9DA 1XEDA 3LN4B 3PWVA 3D1MC 3EJQA 1GHFL 4QPEA 4P2QD 1BAGA 5E7BA 5BS0A 4G70B 5IF0B 1DBBL 1ZVHA 1LP9F 4P2AA 1MCLA 1RPKA 5AKRA 2JCCF 3IF1B 2DQUL 3O9WC 4UAHA 1PJ9A 3EHBB 4ODSH 3W38A 3KYNB 1P1ZB 2RR3A 3NZ8B 2XV0A 3CZGA 3GSOA 3MFFB 4KDVA 5ADOH 1RUKH 3FN0L 5DQDH 4AGNA 4YDJB 2LLLA 1FVCA 1N6QL 5I1KH 5G2NA 1IEBA 4M1CD 3DX7A 4FJYA 4F2FA 3ESNA 1L5GB 1SEBA 3GJEB 3LPFA 4GW5A 1RZQA 3LY6A 3UJTH 1WAPA 2HN7A 4K9EC 4L1LA 4YDMA 4EOWH 5AG8A 3PHSA 5DJZB 5JA9A 1OAQH 3VXSE 1RZGA 2A9BA 4TVPD 4NRYB 5J1SC 2F1EA 3MRIA 1QLEB 1NC4B 1ECYA 1NCUA 4FJ6A 4MCZA 2BVOA 3QNXA 3RLSA 3V5DB 1T4WA 2HT2D 2OR9L 2KBGA 35C8L 2PR4H 5H4YA 2X1WL 1ZTMA 3OC8A 3ZRSA 1ZK9A 1OM3H 3WFBH 5JW5B 2Y5EA 4H1LB 2W91A 1A3RL 2ZYSA 3NMEA 4H13C 4LLWA 2X6AA 1KTBA 4IEFB 2QPFA 5F71A 4E5XB 1SN2A 2P7TB 2TSBA 2XKNB 5JUEH 3E9TA 3GI8H 4KI1A 4K4KA 1DBML 2DIAA 4PLOB 3NJFA 5TPWL 3ZTEA 4LIQE 1BBJB 2VW6A 1M7IB 1ML0A 2B4CL 4QD2E 1CFMA 2VJ8A 3IJEB 3KM1A 4N0UE 4URTB 1YEDA 5EU3B 4X9FA 1OPOA 3BUDA 2IPKA 3P30L 3N9GL 3W0WB 3EFOA 1HILA 4FG0A 5E99H 4BRVA 2Z1PA 5C9JB 2E9GA 4AVIA 2C7UB 2JH2A 3BSZL 1C8QA 3ZUNC 4AYEC 3LHPH 1OP3H 4F8TA 3OJ2C 2PN5A 5DZLA 3BAKA 4B53A 2IC2A 3HG1B 3NESA 4BWUA 5EFIB 1NFIB 2K6ZA 4LCCC 1EHNA 3FO0L 3Q1EA 4WIQA 1D6EA 1OCWL 1JF1A 2XIBA 2Y7MA 4JJ5B 3B7SA 3ARBB 1DP0A 4J3WA 5GRWA 2WLYA 2E4TA 1E8YA 1UJTA 1NAKL 3KM2A 3GINA 3ARUA 4TQHA 1JSYA 4IOFC 4LLMA 4HIHA 3MRFA 4FQXC 3UTQA 3KHQA 1VADA 2APFA 4B3EA 2WCSA 4U1MA 3LRSA 3H2WA 3ARWA 4JCWA 3KPPA 3F00A 4PV9B 3GK8L 4X5WA 4MXVE 4RGOL 4NM8L 3VGAB 1IBGH 2CHXA 2X41A 3ULUH 3T0BA 4IK6A 3GNMH 1AZVA 1U8NA 4KY1L 3TNMA 1M7UA 2J88H 5CHNA 5CMAB 1B6DA 2GCYB 3R06B 3FO9A 3C87A 3KR3H 4P2QE 1PFCA 4CNIB 5KG9A 2VDOL 3BUYA 4G6JH 2WZAA 4FQIL 3RPIB 3ATAA 2WOBA 4X6BB 1JHTA 3UBXA 4ZXBA 2WOYA 3S8GB 2EH8H 2XZAH 3UTSB 4YXHH 1VGKB 3BAIA 2YEZB 4DKEL 4NBYB 4F27A 5E4EB 1KCBA 4HIXL 3SGEH 4KK5D 1XEUA 3GLDA 1FORL 4DKAA 2MQCA 4HBQA 3NZHL 4NCC2 4NBXB 1IM3A 4ODHL 5TF1H 4JB9L 1OAJA 4I1RA 3N0AA 2ADJA 2P8LA 4KU1A 3WUWG 1K9TA 1TJHH 4ZYKA 2HX7A 4ZUTB 3SKOA 4JQIH 5J7CC 1REIA 3V9CA 1DO6A 4B7IA 4TVPE 5J6HB 3MUHL 3K4DA 4K5NA 2QSCH 4TLSA 3CSYA 2BNQD 4YPGA 1THAA 1E9PA 2UWEF 2E75C 2HRPL 1UM4H 4YHOH 4PY8I 2Z31D 4LVOC 1BV8A 4MB3A 5FB8A 2WKOA 5IB4B 3V9FA 1GZPB 3QJRB 3L4CA 1CDHA 1QSED 2NCEA 4J28A 4ANVA 4I3SL 4M8UA 2R2BA 3VI3F 4AGMA 4NC2B 5MEPA 3QQNA 5IQ9A 4ANKA 1D7BA 3ZL1A 3DHJA 1PKQA 4JFEA 4R97B 3ZT6A 3ZW3A 1G7HA 3G6JF 1T7ZA 4LFHD 5GZND 4JVWA 4ZFZB 4IJ3C 1U6AL 2WWMC 2VO5A 2XU9A 3ATBA 3APMA 1VEMA 3B9KD 4IRSB 1V3JA 1NJ9B 4EE2A 4QXVA 3DPBA 3SDCB 4CAGA 4HPOL 3MV8B 2QHRH 3CSPA 3I9GH 4Z1PA 5J6GA 5KZCB 4LLQB 1DBAH 5INCA 2GFBA 3K3QA 1Z9SB 2VDKL 3U0PB 3WIFB 1UD3A 2FX7L 4W9FC 3WEBA 3Q0HA 3UO1L 3VGEA 2IOOA 2IXQB 2X40A 4P2CG 1GC1C 1A9EB 2G75A 1J86A 3KPMA 2Y1ZA 5A6MA 2IPTL 5TTRA 3H3PL 2PXYC 1G87A 1K8IB 1ROCA 3B2UD 2GJZA 4PRHA 2NYYC 4Z7UA 3B5TA 3COOA 4GBXC 4P04A 3QCUL 3L3IA 1KEML 5F8QC 1T1ZB 1GIGL 2CDGA 3D6GA 3MTRA 2R1XA 5B1BB 4RMTA 5J6SA 3Q44A 4TTDD 4BSVA 1RFDL 3GXTA 5HHQA 4GI6A 4R7XA 4Y2DB 1A4KA 2ZOKB 1WBZA 5IR1A 5L9DH 3EXLA 1UVQA 4X0KB 4EUPB 2DH3A 2P5PA 2E27L 4HFUL 5IV2A 4QLRA 4C55A 5JHLA 1QFOA 3OZ9H 4Q6KA 4EN3A 1G6RB 2RHEA 4Y19D 1MDTA 3G5ZA 1M1XA 5HHPB 2WAHA 7PCYA 4BZ2L 1DZBA 3K2UL 1TQUA 3QUZB 3QXUA 5F7EH 3CZUB 4PJ8C 1B4JL 3OJDA 2CWRA 3K1KC 4AT6A 5I6OA 3IMRA 4NCC1 2FO8A 2AV7B 3MBED 5ESQB 2VM9A 1A6ZA 5FKAB 3UJJL 5I76B 4YFEA 1KG0A 4JRYE 2Q6WB 1BOYA 3LZFL 1AP2B 4ES8A 5HI5D 1L3NA 1AO7A 1RMFH 5AFAA 5L4JA 4OW6A 2YZ1A 3NVQA 3PWNB 2AW2A 2R29A 1WH0A 5HVFB 1QFUH 5CCHE 5LN8A 2VL5A 1BEYH 3H53A 1OOAA 4JDTH 3H8NA 4PR5B 4X6EA 3MLVH 2QBWA 3DWTA 4M6OH 1KGYE 3I6SA 1TETL 2PCFB 1UH2A 4QRRE 3ZZQA 1XVSA 2AFNA 4OGAD 3SPJA 2D3VA 1QLEL 1ACCA 4MB4A 1SXCA 1LVEA 1N0XL 4OR1A 4C4KT 5BMFH 2Y06L 3EBHA 4IU3B 1ETA1 1O6SA 4DPAX 3ECUA 3ARYA 4WFGD 2D2CC 1KDJA 1JZJA 4DT2A 4QF1A 2NW3B 4N6QA 2HLAB 3I02B 4N2FA 4WO4D 2R2HA 2BNQE 2HKAA 3D69A 2X5PA 5AZ2L 4MXWH 2X4OA 3QFJB 1XTLA 1Q94A 2OTPA 3ZHDA 2CO1A 1INQB 1ONQB 3L13A 1CICB 4HIEA 4N2DA 7FABL 1ADWA 3HS9A 4UYQA 1FZKA 3V5HA 3K6NA 1WDAA 1N2RB 3QIWD 5I5RA 4WHTB 4RNRA 5ITFA 1EMTH 2ZWZA 2AQQA 3KPOB 3EW3B 4F1SA 1AANA 1AY1L 1B0RA 2QTEA 5G5DA 1QFWH 4OV6F 2WNXA 3JT2A 3GXDA 3FUEA 2B7DT 3NJJA 4S1RH 5DD5L 1R3IL 3QFDA 1OTSC 3QIBD 4ANWA 4RISH 3ML8A 3FH7A 2CO6A 5L8LB 2E0PA 4FABH 1KCVH 5HGBA 4FFWC 1N10A 3SSGA 4OM1H 5FLUA 5AOIA 4RRPG 3CHQA 5BS0B 2F7QA 2ISDA 2N7AA 4G9FD 3IS1X 3TVMB 1R3JB 5T1JA 1GCFA 3PAVA 3ZKMC 1F4WL 4HJ0C 4HKJA 1DYZA 5T1DL 1I7UA 3FTUA 4M7ZB 3CLWA 3IJHB 3QUKB 2QL1A 5K9KB 3GSOB 4HYTB 1OWRM 3UBHA 4AXWA 1FVCB 3NEEA 3TEWA 1NBCA 2TRYA 3T6WA 5IEKB 2JB5H 4X5LA 1IEBB 1S7XA 1ADQH 1YN6B 5AYUL 4WI0A 3FT2A 2YRZA 5L2KD 4GW5B 3NFSH 1KT2B 2HN7B 1DE4A 2K45A 2K6WA 3MRLA 4L8BA 4P06A 3U2IA 4JG5A 4Y19E 1ZA3B 4TVSa 4AWJC 2M26A 1AQKL 4YNYB 2W60B 1KELH 5D1ZA 3MLUL 3H7BA 1RZGB 4QHMB 3SDXE 5ALCH 5LG1A 2Z4QB 5D5ME 2DN7A 4LDCA 2I7SA 2ZJSL 4XPAL 5GGVL 4ZSOA 1BIIB 2Y22A 1FVDA 2NNCA 3HI6H 2WIIB 1JFHA 1YMHB 3BWUF 2EEAA 4M3HA 2HPTA 3VI4B 3H9ZA 1J1PL 1W72H 1RU9L 3EYSH 2EE2A 3SCMA 1ET8A 3GBNL 1U4EA 1OSPL 2MKWA 4EN2A 3WDHA 4QXGL 3WE6B 5I82A 1UB5B 3H7LA 2MQ0A 1WJ3A 1Y1DA 2DQGL 4Y4KB 3U1QA 3NCYP 1C8PA 4YUEH 3CVHL 2FWLB 2OCJA 4JFDA 1XAKA 4AK1A 1BF2A 3WXWL 1QKZH 2NPLX 3M1CA 3GIVB 4E9LA 1HZHH 4I87A 3RG1C 3PXHA 4M00A 3HRZA 2BWQA 1KYDA 1UH4A 2MKLC 1PSKL 2DEYX 3FUFA 3AG3B 4R4ND 4MA7L 5B3SB 3JVGA 2F54D 1LEGA 4KROB 1UWXH 3MOBL 5E8OA 3X1GA 3DRQA 4ZX3A 1GXEA 2ITCB 4MX7A 2O5YL 2ICES 4H44C 5K1NA 2VDPH 1MI5D 1S7TB 3FT4B 4Z3IA 4PRIA 3ALWA 4WFGE 5J13B 4X8CA 1D6EB 1I3RA 1TPXB 4Y1TA 4W81A 1DDHB 2AJXL 4TN9A 1YEHH 3SPHA 3A23A 3EYUH 2P1YA 3AZUA 3GHPA 3K0WA 1DJIA 3O6FA 3T0EB 1CGYA 1P4BH 2GJ6A 3FQYA 1F3RB 3P3TA 4RMQA 3UG3A 4ZAKC 4FA8A 2JFCA 2YUWA 4HK3N 1IL1B 5FUCC 4JM2F 2O30A 1VA9A 3PS6A 4AUJA 2IBZX 2HT3D 2M83A 3A67L 3ASWA 3HN5A 2DBLH 1U8MB 2F19H 2LOEA 2NXYD 4XP9L 3F7YA 3MRFB 1FL5A 1JZEA 5IVXF 3UTQB 4JANA 3N3EA 4N28A 2E6PA 2R0LL 4U1MB 5IK3A 4UYPA 2XWBA 3LRSB 2YD9A 1FNGA 3APNA 1T0OA 5CEZH 1VERA 4X5WB 2WN3A 4I0CC 1DLFL 4UUJA 5I1DA 5I75C 5KSAC 4OZIB 1RHFA 4JPVL 1RZJL 1W8NA 3NJHA 5D71L 5DR5H 3PGCA 3KPLA 1HESA 5FYKL 2H2SC 1CWVA 3HLKA 4GSDH 5K39A 5D1QB 1U8NB 4K94H 3T3MF 1XIWC 2X70A 5CHNB 3ROOB 4J8RA 4WWKB 4HXAH 3HBPA 2Z8RA 4QRFA 5KG9B 2EYSB 1PY9A 4G9FE 1KEGH 4JCLA 5IESH 3UBXB 3GWJA 3T5WA 5EORH 1U95B 12E8L 1AMXA 2EZ0C 4ZO9A 4A7GF 1V54B 4YDIL 3DGDA 5LGHH 2VAAB 4I89A 2FJFA 1CE6A 1ZIBA 1UACH 2ALWA 2WSKA 4U33A 2ODHA 4KKRA 4MNGB 3AS3A 4KHTH 4XP1L 5D55A 1KCLA 3RU8H 3UIYA 4PJ5E 1AZCA 5J56B 3FXIC 3L3OA 3N41B 1R5WB 2FJSA 3CFTA 4ZMVA 2YK1L 2ZWSA 4XMZA 4XCCL 4NUMA 4WHDA 2YRBA 2K3TA 5IHBA 3SKOB 1Z9MA 5HGAA 1N5YH 4QRQA 5I0VA 3U7YL 4GFXA 3S3JA 4HOWA 4XVOA 4H25A 1CI3M 3ULVH 1Z3RA 3DMMA 1KGWA 3L3KB 1G9EA 3CSYB 3U7WH 1BM3H 1M3IA 1NCAH 4JKNA 4YPGB 5C70A 4LHUD 4U1NA 3V4PA 3IMBA 5F7NC 5KJ7E 1MCQA 2F18A 5FB8B 1A6WH 4L3ED 3H55A 1HSBA 4PJ7A 2YA2A 5IJVA 4R26H 2R83A 5CGBA 3P0VH 1U93A 3KPRA 3T4YA 2HVKA 5DRXB 3VWJD 3F7VA 2R2BB 3LD8C 4JUSA 1KPRB 2Y7NA 1Y18B 1IB5A 4MAYB 2WUBH 1DVFC 4JFEB 4KITB 4PJCA 5JHDD 1KJMB 4R83A 3UAEA 2M8XA 2NY0C 5AVUB 1JG9A 4TTGA 2G5BA 1YMMB 1COBA 1IGYA 2RCSL 5AWNL 5K9JL 3KL0A 2F54E 4K73A 1JHLL 5DVKA 3C6LC 3QJFA 2DKMA 4AUUA 2GSIA 1MI5E 4GW1B 4KKBC 1W91A 2W1NA 1MCRA 1A02N 2D4FA 3RFZA 1IZKA 3V0DA 3H85A 3RTQC 4ZUWA 4M61B 2PP8A 5C08B 3UZQA 1RVFH 1KZQA 3TO4C 1FYTD 4UOW0 2IG2L 2WNWA 1KN4H 1N9PA 3H42H 2G75B 2Y5TA 4M62H 4P5SA 1BF5A 5IVZA 1AKPA 3RVXC 1UCTA 2CUHA 1KPUA 3OPZL 3PHOB 3EZ8A 4UNUA 5IP4A 3R8BB 2GIYA 5EUOA 2R1XB 4FE9A 1L9TA 5CCJA 1HU8A 5HHQB 1SYSA 1S7UA 2A7BA 4ZMWA 4AIEA 4MD0A 2XVLA 1S9VA 4KZCA 1BSIA 2W9DH 4X0NA 4AYDC 2NYKA 3QQ9C 4OM0L 5C6TL 3MBWA 4OI8A 3S5LA 2OMVA 1JK8A 1YEWA 3WJLC 5G4MA 1Q0YL 5EBLA 3AG1B 1BQ5A 1BBDL 3EO0B 5AVWB 4W6XB 3SYPA 1FL3A 4P23B 3TZVB 5I8EA 4CGTA 1KTLB 3ETBF 5K69A 3K5RA 3ILPB 1H5BC 3K4AA 4LSPL 3OJDB 1FAIH 4Y4FC 5AVYB 3KDPB 4JQIA 1MAMH 1V10A 5CILH 3TP4A 5CJXC 2YD1A 4BXVA 5C7XL 4NNXA 2AJ3A 3PL6C 3LEYH 5L88L 1EJFA 5HBBA 1QSZA 2XTJC 1RCYA 4MTMA 1AO7B 4F58H 1HHKB 1A3QA 2JQAA 2NY7H 4POZC 3KYOA 4X6CB 1VEPA 3V2AR 4QY8A 4Q9BA 1MCKA 3T6XA 3N1GC 3CVIH 4B9YA 5E1AA 1YYLL 2XT1B 4MAUL 4YIQB 2D0FA 3PWJB 4AGLA 4UAOC 1IX2A 3FU5A 4FKHA 4K8RD 5EO0B 3LVTA 3IJ8A 3LPWA 1VFAA 2QMJA 4Y4HD 5F97E 1HXYA 5T3XL 3H9HA 1SEQL 5D96B 3BQUD 1YJDL 4MA8L 4I5BA 1O6SB 1UXSA 1JPST 4FQCH 2OJZH 4QF1B 2FL5A 1JZDC 4JHAL 5KYUA 2MCMA 4ZD3H 2UXTA 1INDH 3TCLB 5F3FA 4U3SA 3GBDA 4EXPX 1VACB 3LS4L 5GJSH 2AXFB 3N5AA 3P0GB 5J9PA 1L0XA 1X9LA 4L3EE 1I3UA 4MXQC 3SDDB 1UJ3C 2QADD 4QOKD 1DTUA 4KOCA 3QDJE 2I5YL 4GY4A 1RKRA 1Q8MA 1IAIL 2IFFH 2YOAA 3HAEG 1QPPA 2NNAB 1WGOA 2QPUA 2YMOA 3UAJA 1HSAA 5JHDE 3IGFA 4FQJL 4LO9A 1C5BH 1GH7A 4P9HC 4JPKH 1EVTC 3QB7C 4FKEA 4XPTH 1T2QL 3RWDA 3BDYL 4F2ME 1BQKA 3GSUB 5G5DB 3WEAA 3O45A 1NLDL 1LP9E 5EOCJ 3RVUD 3IJ7A 3SY0A 4D9QD 1D5MA 5IIEA 1PAZA 4PJAB 2JCCE 5T33H 3O3BA 3RWGB 3TJEH 4OCMC 2CO6B 3PNWA 2A6DA 4E9XA 1TO4A 4PJHA 1BQHG 4JCMA 5CR1A 5LCVL 1FYTE 4NKIL 2D7MA 4F5CA 4N20A 1VF5C 5EB9A 1UD8A 5E1GA 1KGUA 1Z0NA 1U58A 3QWNA 2XKSA 4JKWA 4HKJB 1ZLSH 5GGQH 2FT7A 4M9PA 4MMXA 5BRZA 2B16A 2V9UA 4Z7QF 3N2JA 5DC9B 5C07D 5DMGC 1OD7A 1ZV9A 5B8CC 1F0LA 5KS9F 3GUTA 1KUMA 2LQRA 2A5UA 3BIBX 2QQLH 5I73B 2IAMB 4XOBA 1DE4B 2NT0A 5DZPA 4DH2A 2Y72A 5KVGE 4F9PC 2PW2B 2X89A 4IS6A 1E5BA 5SX5K 4DEPC 3H7BB 4KZDH 4XH2B 4K3EL 3VTAA 4EMZA 4QYAA 5HHME 1VCAA 2JKTM 2XN1A 2NT1A 1FVDB 4GKSA 2Z35A 4PJGA 4P46C 3RY6C 4TVPH 3VYOA 3VDAA 3GXNA 3L6FA 5DMIL 3QARA 4P2OC 2CR3A 4PRDA 4XCYA 1AQ8A 4NI6A 3WEXA 4APXB 1T0MB 1M6OA 1N6VA 2PWFA 1FV1B 3BKCH 3BWZA 2GAZA 5DFAA 1M53A 1PFOA 5C71A 1KTRL 1UT9A 1SLXA 4A1RA 5IQ7L 5KVDE 2N01B 2FHBA 5DO2D 5F1NB 5TFSH 1D5XA 2JKWA 1BXVA 3WTUA 2FAUA 3GKZA 1U41A 3IKCA 2DIJA 1GYAA 1DN0B 4WSGA 1XGUA 2R4RL 2ZUQC 3MRRA 3RUGF 5ID0A 4NQDA 5CEXA 4IGBD 4W4OA 2ZOLA 1F6AA 1J9CT 2DWSA 5CD5C 3X1BA 1MJUH 1LEGB 5ID1A 1E7VA 4G5ZL 5C0AE 1A4JA 1AHWA 2XN9D 3HFFA 5B38B 1KXHA 1TJIL 4X8GA 5BO1L 5KUMA 4BFNA 2YAQA 1UH3A 4PYGA 2ITDB 2YXFA 2CKBB 1UB6A 1MZYA 2C26A 3MNMA 3O6FB 2NY2B 4PJDE 4HA1A 4ABQA 1Q9KA 3QI9B 1WVZA 4M4RA 3MJ9A 1LL1A 3VE0A 4CL7A 4QOKE 1FHNA 3KCPA 3QORB 2X2JA 4A7UA 5IB2A 5JO5A 3ILDA 4J4PD 2DKSA 4U3XA 4WW2F 4XBGB 2J8UA 1JXKA 4LVEA 1Y1UA 3F7YB 3O4LB 4NAQA 1PLGH 5E2TH 3GSNA 1FFTB 4JANB 3QO1A 4R2GC 1G4MA 2BSRB 2X4QB 4H8WL 5JA8B 4U6YA 4OZGF 4N2GA 3DX9B 1FVEA 1UOKA 2BRRH 1TTAA 2FLBT 2IQAB 3SOTA 2HT4C 4YXLH 4GIOA 2YBRA 2I9LB 4M7JL 3D3VB 5K39B 4D9QE 4R7DA 2ZF9A 4O4YL 2VSCA 4PM1A 5H37G 3US0A 2DWTA 1KTJA 5GS1C 1DQLH 2BSTA 2IF7A 5AZEL 1C12B 1T4KA 4P4KA 1L7IH 2B59B 2XN0A 2EEDA 2EVIA 3L3HA 2CIKA 3Q6FA 3WY4A 4GG8A 1QSFD 3J2PA 3VXOA 4JFYA 3MROA 2MSPA 3VD9A 2BNRB 4OD3H 1NBVH 1A1MB 3WNKA 1W72A 5EO9A 5IWLA 2EEBA 3QDGD 3X3FL 1MJJB 4TULH 4XC1L 4APQD 1XTMA 2EUXA 5C07E 5JHLL 2D03L 1FGVL 4PSRA 1BPLB 2UZIH 1R3KA 3S37H 3L3OB 3WXVH 1CVSC 4NGHL 2Y36H 5E6IA 2OV0A 4HDIA 4WKZA 1T89C 3IDYC 1BZ8A 5EOCL 5AOKA 1UZ8B 1UYWH 4KXDA 4WFED 5C0JA 4I88A 1CTNA 1T3FA 2VSDA 4HUCA 1U8JA 1C5CH 1CTOA 3ME0B 4H25B 4L4VB 3RAJH 3D2UB 4XNQB 4N8PA 1WFOA 3DMMB 3QPQD 5MHSD 4MJID 1X5MA 4OIFA 3SE3A 1XGTB 2KMWA 4M5YL 2BCMA 4UU9A 1OE3A 1YEFH 4HJEA 4Q56A 2XFXA 4RDBA 2ZPKH 1JDAA 2R29L 1HSBB 4L48A 1AS7A 3QDMA 5IJVB 1HYSC 1JPGA 1AJ7H 1JVKA 1EJOL 4KVPA 1U93B 4TYUA 2HVKB 2E5EA 3IWUA 3DO3A 4TSBH 1IV8A 3L9EA 2CIIA 3MX0B 3LPPA 3LRKA 1ODAA 3S88L 2LGNA 4PJCB 4NI3A 4M1DL 1H6FA 1U2YA 2KLTA 4L9LB 4TUOB 5JHAA 2XI9A 3FPXA 5A2BA 1WFTA 2PCYA 2VJXA 3ZHKA 1IZJA 2JJTC 4N0FA 3MSPA 4DKFH 3O3AA 3ARGD 3N55A 3NCXA 3QJFB 2GSIB 1DVTA 3HNTH 4PJXB 3GZKA 4S0TD 2YQ3A 3ATDA 3TTYA 2W9EH 3HC0A 2AK4E 3L5JA 4UV7L 4UM9A 3RWHA 5C1MB 5LWYH 4OIBA 4HJJL 5DD0L 4Q74A 2EIEA 3UIZA 4Y8AA 1C1EH 3V4UH 3VH8B 1AVAA 2QQKL 4MA1C 3WS3B 3O6MH 4IBLT 3H56A 2Y5TB 3EDJA 2RA1A 2ARJB 3FU3A 4CMHC 4YFDB 5GGRA 2QT6A 2ESVB 4W9EC 1CL7H 1KPUB 1CDBA 3BVXA 5HYJE 3D85D 3B2XA 4KTEH 2AZUA 5D7IE 5BVPL 2XZQL 1YG9A 1OZTG 3BT2H 3MRBA 1SYSB 1S7UB 2FQDA 3QZWG 2F1AA 1N6UA 1S9VB 4GEIA 4B9CA 1SF5A 1G1YA 1U8HA 3P11H 4DQOL 3MFGB 1TFHA 1NFDA 1LK2A 1OF2A 2DDQH 2OMVB 4V1DD 5CBEB 1A1OA 2CXGA 5TF0A 3SPGA 4Z7VA 3GMMB 2R8SH 5KBPA 1UFGA 3SZKC 2QPDB 1BXUA 3RA7L 2IADB 1FL3B 4YFLF 3GGWA 3CU1A 3TEXA 1NAML 3VCLA 5HGDB 4LBEB 1JAEA 5E2UH 1LXMA 4DGIH 1NCWL 4YHLH 1OAKH 4YVUA 2EUZA 3BAJA 3EH2A 1BFOA 3RWJA 1BGXL 3HCVB 3BGAA 3K2MC 5E9AA 4JE0A 4FTDA 3MNDA 4XP4H 4KZ0A 3GS4A 2H9GB 5EDXA 3H9SA 3QDGE 3MUGA 3V6OA 4LCIL 1AI1L 5C09D 3KYOB 3EXJA 4X4MA 4RQQA 5A43C 4A66A 3QQ3B 2AVGA 3N6YA 2IALA 1S7WB 1RIVH 5DS2A 3N0PB 3RX7A 3VFSA 3JWOH 5SV4A 3TV3L 3DX1A 3QDAA 4WFEE 4WU5A 4GP8B 3HG2A 4PV1C 3WFCH 3T4AC 3EH5B 4BQCA 4G5AA 4PJBF 3ULSB 1QLRA 4KQ4H 2N1TE 4FFTA 4ZDHA 4E9SA 1DQJA 5C0GB 2BDNL 1UXSB 4JM2D 2C9QA 2D3LA 2Y7LA 2EKJA 1AH1A 1NWOA 2FL5B 2NY5L 4DK6A 5F8RC 4Z8FH 2J1WA 1MOEA 5FA3A 4MJIE 4BRJA 3UTZB 4NN5B 5F7DB 3NRPA 4U3SB 4LNRA 2AJZA 3O8XD 1PY4A 2B3RA 2FEDD 1BWWA 5IW3A 4G82A 2QEJA 3LMJH 4MGXA 5CUSL 4LKXA 4WFFD 4DP7X 5HDWA 2XQBH 3LKQA 4N1CA 2DS4A 5DHVB 5FM5O 4QUOA 2BM3A 3SYCA 2ZG3A 5M94B 2DYPB 3TFBA 1J1OL 2R0ZH 1XF4B 3MREB 4AGQA 2IAND 3EO9L 5FECA 4AJWA 4X4KA 3K8LA 4XNDA 5TH2A 3Q43A 2ZCHH 2BP3A 6PCYA 2LFGA 3WIAA 3IAPA 3QP3A 4NWUL 1MNNA 1UWEL 3O45B 3OGCA 3QR1A 5CJOH 5HI4D 1YA5A 3SY0B 1RJLA 1ZSDA 1MW3A 3RZWA 4Y5YB 5IIEB 4CBPA 1QW9A 2C1PA 1JDCA 3AREA 3K5SA 3KLDA 4ZFFB 4HJIA 4LLDA 1QA9B 4H8QA 3QXVA 4PJHB 1CD1A 2G9KA 1INEH 3ARDA 3L1EA 4Z0BH 3U25A 2BINA 4ONGH 4QMEA 2HKHH 2MHAA 1GS6X 1R4XA 2AK1H 2QVTA 1EANA 5E0QA 4UQIM 4MRCA 1VKXA 2FO1A 3VXSA 3Q8BA 2ILLA 3S36H 2QGCA 3MRCA 4ODSL 1NIFA 4PH8A 4F7PA 4KK8C 1QBML 5F88A 5ADOL 1MH5A 1RUKL 5DQDL 2FGWL 3OVUB 1A0QH 1F5WA 3C5SB 3UADA 4BCZA 3GUTB 3APCA 3RIFK 3LPGA 3E6HB 3RZCB 4N5ED 2WZ6A 1U2HA 3UJTL 1I9IL 1PU0A 4TL4A 4EOWL 2GBTA 5D93B 3W11C 1YPZB 3O9WD 1EFXA 1I9RH 1VJSA 2MJWA 3GBML 1QPXA 4D0BB 4PV8A 2DTML 2Z35B 4I2XE 4PJGB 3RIAK 5GS0D 5IJBC 4N0UA 2F53D 1DBKH 2C4XA 2HFTA 4LVHB 3GB7B 2ZXWB 4XCYB 4HS6A 3QO0A 4JPWH 2PR4L 3RGHA 5DD6A 2GAZB 3WFBL 2P42B 4RGNB 1ZV5A 3LRLA 4PGDB 4KDTA 1YC7A 3CN4A 3PJLA 4NZ8A 5C09E 5FYJD 5JUEL 1D5XB 1UC6A 1TENA 3O3UN 4GRLB 1XXFC 5C86A 3ZE2B 3BAWA 3WFZA 4Y89A 3IKCB 4C59B 1ZTXE 3G3LA 3MRRB 2DD8H 2HLFC 5ID0B 1M71B 3BJ91 5E8EA 4L8CA 3POCA 1F6AB 5E99L 3CMOL 2K8MA 2R9HC 3LHPL 3NA9H 3V4PL 3Q2WA 2KH2B 5CZVH 3BVNB 4ACTA 2CGZA 5JTWA 3CN2A 3FQXA 1NL0H 4K71B 4PU2A 4BDVA 3B6SA 4FMFA 5F9DC 2H47C 1CGSL 1F1AA 1UB6B 5IVXE 3GSQA 3NSYA 1A66A 4N8VA 3BEVA 4NPJA 4Y5XC 1EEUA 4UV4L 4XNXH 4WFFE 1N3NB 1RZ8A 1S4IA 1A8JH 3B9DA 4GO8A 3ZQWA 4UILL 3DUHA 2YXWA 3BP4B 3HNSH 3N40F 1CDIA 3FUHA 1FPTH 4LE8A 5DWUH 4P2QA 3FTVA 4U6YB 2K4WA 4P05A 2YS4A 1D9KC 2VUKA 4O02B 3WKNA 4BKLA 4G7SB 2A9DA 3LQZA 1ORSB 4HLEA 3PWUA 1GGUA 3DARA 2BVQB 1MQ8A 1FI8C 4F2EA 3ULUL 3UPAA 1A6PA 3VFTB 1EXGA 3GNML 4R7DB 5SWSB 2OMUA 4LPXA 3U1SH 5DZJA 4JN1H 1MHEA 1A3LL 4YHNA 4DZBA 4IOFD 4WHYG 4UMSA 4KJQD 4ZFGH 2MQGA 2BSTB 2MH4A 1JGEA 1T4KB 4JKPH 3GMLA 3KR3L 3FN3A 2FLMA 4NFDA 1W0YT 4P4KB 2P49B 3S5ZA 1JPFB 5CFAA 3I2CH 5C0BD 2EUVA 4A2MA 1FZOB 1IM9D 4GG8B 3ZDXB 2E6JA 2EH8L 2XZAL 4WU7A 2DICA 3JV4A 3MROB 4Y1AB 5CP7A 4YXHL 5KBDA 1MAJA 4EZLA 4QRTB 2JE8A 1W72B 3L48A 1VFOA 3RTLA 1AXTL 2QHLA 5E94A 3BLKA 4LPVA 1KBGH 4ZTEA 4ACPA 1KCKA 4MLSA 4XMPL 2X3AA 5TF1L 2VQTA 5E6IB 2KKQA 4OLVL 3S9DB 3ARRA 2CCWA 1M9SA 1M7XA 4JDEA 2X9ZA 2A6JA 5I1GH 4IRJC 1TJHL 4ZK8A 5F7BA 3H1ZA 1T3FB 4JQIL 5EU7C 1CLOH 2CUIA 1XCWA 3FBKA 4XBPB 1MRCH 4E42B 3UERA 4XP6H 4EI5B 4JO1L 4F9LA 2F53E 3FRPG 5H94A 4I3GA 3OX8A 5ICXB 2IWKA 2KPWA 3F5WA 3KYKL 4HSQA 4L3FA 1J8KA 4UU9B 2VDPB 4OB5H 1UM4L 3AG4B 1XX9C 2NY4C 2XFXB 1ECZA 4NZTL 3TA3A 1U3HC 5FA4B 3VMOA 4Q4IA 3QDMB 3WMPA 2J3SA 4JREC 1Y0LB 1CGXA 4N86A 2V6HA 3QUMH 3GI9H 4MS6A 3RPBA 3SZ6A 2V37A 5ISZB 2DIEA 2Y7QA 5FYJE 3BP6B 1LEIA 5K93A 2FR4B 2IDUA 1CTMA 3NSCA 2CIIB 4MJHA 4M02A 4M8VA 1NKGA 1U8LA 3U2JA 2ZCZA 2D3JA 2A74B 1G7LA 1X5ZA 5DLLA 5IFHH 4AZ8B 4KVNH 5E00B 2VITB 3LNDA 2GB2A 4OCWL 3KZ8A 4HOMA 5GSVA 4TUUA 3QIUB 3O3EA 3QUYC 4KK9C 2QHRL 4F7CB 3FT3A 2OTUA 3RWHB 1YEGH 1KACB 2VQUA 3NCWA 1DBAL 1BVZA 3U4EA 1HHJB 3UC2A 3RGBA 3T3PE 5KSUB 4GLRH 1H3UA 3EJPA 1IUZA 2X10A 4YC2B 3VSUA 1C08B 1DANU 3HBGA 5GGRB 3IBOA 1E4WL 2WWMD 5FUOH 2WBJD 5EPMA 1TCMA 1UKSA 1IO4C 1KY7A 2JKNA 3CH1A 1AD9A 2EYRB 4LRNH 4EIZC 2H4EA 3K91A 3IRPX 1FCGA 1HHHA 1MIEL 5DRNA 1Y7VA 1BQLH 2WO4A 3WE1A 1U8HB 2VXTH 4HMDA 2Q8BH 3WAKA 3QJQB 4MMZC 5SX5H 5ACZA 2D7OA 1UURA 4B9GA 1HTYA 3L4TA 1WZMA 4RDQG 1A1OB 3QWOB 3FCGA 4KO5A 2ZXDA 3OZ9L 5SX4I 2PXYD 3WIIH 3BWSA 4HALA 5ICUA 4RMVA 2XBTA 3JWNC 5F96H 1SUJA 4GSXA 4CSZA 5J5EA 5F7EL 2AEPL 4FYRA 1B3IA 5J1TC 1AFVH 3A24A 1AR1C 3G6AA 3CSTA 2XA8H 3US1A 1LO4L 2CO4A 3RWJB 3TX4A 4QRRA 1QO3A 3CXDH 3BX7C 5C0BE 4WO4C 1WTGT 1DJYA 1M1SA 3ETTA 3PP3K 3FRUA 5IBTH 5D2LB 5HDBE 4XWGH 4EVNB 3RWIA 3KCWA 3REVB 1XGZA 4RWHA 3V6BR 4F37K 1XGPA 2FK9A 2KI6A 1QLFA 4A2LA 3Q3GA 2WKOF 3FOMA 2BNQA 3J07A 2Y3AA 5KVDH 3DURB 3O11B 1A21A 5CZXC 1QFUL 2IALB 2Z31A 2XWJA 4U1JA 4Y7OC 3IB4A 3VXQB 3WUZA 1UASA 4JDTL 4ZZKA 4U7SA 3MLVL 1NPJA 3ISYA 3QEQD 2ZWLT 1FDLH 1T1YA 1QSEA 1YO4A 4ETQB 3L3DB 1E4JA 4FHBD 3E8VA 3SN6N 5I1JH 2OXHA 2WW8A 3AXLB 2C3GA 2JV6A 1UOWA 1BREA 2PO6C 5DDHB 1YNTB 4ZX6A 5BMFL 3OR6A 5GRUH 1EHXA 1JGUL 5GZNA 4C83B 1KJ2B 3GPEA 4ZOEA 1NWPA 5DVPA 3CX5K 3ZMRA 3LH8A 2EDEA 3DYOA 3LH2H 2AJZB 3WY3A 2N7BA 2DWDB 1DJSA 4MXWL 1RUPH 4G8GD 1HDMB 3WHXB 1NGZA 4RX4A 4RDQF 3BGMA 2EDOA 4M8RA 3ZN6A 3BRGC 1BZ9B 3ARPA 3L9YA 4KPHH 3RVVC 5KN5A 2EDJA 3OLEA 1EWHA 1KB9K 3MRQB 4Y16B 3QYNA 3DO7A 1EZLA 4H8PA 1E2VA 1H9VA 1SHXA 2W07A 4OLYH 3GSXA 1U0QA 4FNLH 4NHCH 4B60A 1EMTL 4Z7UF 4X5RA 3RNKB 5C2BL 2WM0A 4RMUA 5EEXA 1X5IA 4OVUA 5JXED 1S2EA 3AB0C 3ALPA 2PNDA 3OGCB 1T5WA 2V33A 1D6VL 3DVNA 3L2LA 5DMKA 4A2FA 5M7QA 1DJWA 3TURA 3CDZB 3SJVD 4PJ6A 5D7JD 1JJUA 4RISL 4LLDB 3ARFD 3MJ9L 1CD1B 2WLIA 3NIFB 5ESVA 3REWA 4FABL 4OLXH 1LE9A 4OM1L 2FHFA 3GXPA 1N7MH 3N42F 4UNTA 1CZ8H 1IKNA 3GSNL 4CVWA 1G9MC 4Y19A 4QHKI 5D7SL 3LXBA 4XR8C 5GSRA 4FG6C 3LRMA 5B4MC 1VKXB 3SDXA 4IM8A 5D5MA 1PDKB 4B41A 2LTQB 3ABZA 4RA0C 4PRPD 1OTSD 3EHBC 4JR9H 2Z93A 1D3CA 2DKUA 4PS7A 3ZO0A 2VJ0A 1SVZA 1WBXA 2P8PB 3MBEA 4XXDB 4FFWD 5DUMH 5F7AA 2JB5L 2D8KA 4I1NB 4POUB 1WGVA 2P47B 4N1HB 2ED9A 5I74B 4KAQL 3SGJA 5EC1A 1CD8A 2XJKA 3NFSL 4HOZA 1DHKA 5FCUL 2VR7A 4KJYA 3VXUD 4PJEE 1KTCA 4LOUC 3T2QA 4D8OA 3SGKC 4U6XB 2A9NH 1YEIL 2K3HA 3S2AA 1PYWB 3HI6L 4JHWL 4OT1L 3FUDA 1F1DA 4MSWA 3U2SA 1W72L 3QO0B 1T7WA 2J4WH 3HE7B 2CNYA 5DD6B 3MRJB 4D9RD 1SHSA 4OD1L 4F33B 3JTSB 3MQIA 1T04A 5FC9A 4BUHA 4G8FA 2OJEA 3HPLB 5I6XB 4ZS7L 2FZ3A 4NWTH 1RIHL 4YE4L 4YUEL 4TXVB 1P53A 1Y6KR 4FNPA 2IQ9H 1E6JL 4JKKA 1YDPA 3DBSA 4Y5VA 4EZKA 1MZZA 2VXQA 4HGWA 2NTSP 3BRDA 1HZHL 4HG4J 3U6RB 1A9VA 1QYGL 1E4KA 3IDXH 4M8QA 3QEQE 4NKMA 2QVKA 3DVFA 4L8CB 1I8IA 1NIEA 3P02A 5IROC 1EBPA 3H54A 2VDMH 1CGUA 4GT7A 1ZCRA 3PAUA 3STLA 2E86A 4HOXA 1GGCL 3QIWA 2WC7A 1AOZA 2VDPL 4Z5RB 4PB0L 3NQKA 1WITA 4KJWC 2PR9A 4OF8A 5BJTA 3B6SB 2QDWA 1JHKL 4Y0GA 1S7QA 1HH6A 4XN2A 5KW9L 1JNLL 4DIXA 4X9IA 3II2A 1M2VA 5TE7H 1P4BL 4J27A 4G8GE 4ILDA 4MNQB 3NGBB 3ARBC 1UD4A 3EFDL 4N90D 4OZGE 3W5NA 2M2DA 5C3TA 1PZ3A 3DSFH 1KCRH 3QIBA 2HKFH 4MYPA 1KNOA 3DIVA 5KEZA 3FCTA 3FQ1A 2DBLL 4PAZA 4QNPF 2OSWA 2COQA 1NMCB 3CV5A 5I1AB 3N50A 4OVVA 5J57B 1MFBH 3K6DA 2NQDA 3EJJX 4NRZA 2B9AA 2P8MB 5DEFB 1OKEA 5HHNB 4YSRA 1AS6A 4G9FA 3VG9B 5I23A 4QGYA 4LMQI 1AZNA 3RWFB 3LQZB 2YGOA 1A7BA 4AMKH 4MVBC 3T8VA 2NR6C 2KZWA 4WEBL 3VGAC 1XZ0A 5E8NA 3C2SA 4DKEH 4YHYB 1T20A 2A99A 2OMUB 9CGTA 3SJVE 4NZRH 1MHEB 3MRKA 2P24A 4MZRA 4JG9A 4DZBB 4MLIA 3TF7C 4LL4A 4CKVX 4PCKA 2VLRB 2NXZB 1JGEB