5D1ZI

Isdb neat1 bound by clone d4-10
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
149
structure length
149
Chain Sequence
NNTYPILNQELREAIKNPAIKDKDHSAPNSRPIDFEMKKKDGTQQFYHYASSVKPARVIFTDSKPEIELGLQSGQFWRKFEVYEGDKKLPIKLVSYDTVKDYAYIRFSVSNGTKAVKIVSSTHFNNKEEKYDYTLMEFAQPIYNSADKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Y10 Light Chain
total genus 33
structure length 149
sequence length 149
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5d1zI00
2MOQA 2Z6FA 2K78A 3QUHA 2O1AA 5D1ZI 3OVUB 3QZLA 3SZ6A 4H8PA 3QUGA 5D1XE 2ITFA 2Q7AA 4WJG3 4MYPA 2E7DA 3VUAA 2ITEA 4H8QA 3S48A 5D1QE 2O6PA 3VTMA 3RURA 4NLAA 3RTLA 3SIKA 3QZNA 3QZOA 3SZKC 2H3KA 4YMPA 3QZPA 4FC3E 3QZMA
chains in the Genus database with same CATH superfamily
3D1MC 3DTDA 4M1GH 3ZRSA 5L6YL 1VZGA 4JEGB 2RH0A 2KHAA 3RJDA 5J3HC 4A7GA 2G2NA 2OP4H 2V7NA 2YPLB 5IMLA 3TS8A 5CCHE 2RHEA 4RMBA 2FJFB 3QXAB 3MLTA 5HYJE 5IEKB 3ZKSD 1MWOA 4AGNA 2QGDA 2VSDA 3FZUC 4G3YH 3CX5K 3US9A 3EF4A 1TZAA 4LVEA 4ERSL 5CCKL 1J0ZA 4HWNA 4U33A 1I7ZA 1R9FA 3T2QA 3VXRA 4QJ5B 4ZFFA 3CSYB 1YEFH 1GIGH 4RESB 4FF9A 1J0YA 1IM3D 4Z7OB 3KPSE 4EIZC 2X7LA 1ZTXL 3WEOA 1WZKA 2OMWA 1KTBA 4UTBH 3LIZA 3EFDH 4QRUA 4PP2A 3VD3A 2DWDB 4DPAX 1R0AL 3AMLA 3U4EB 5JHLA 4XBEH 1NAKL 2WO4A 4HPOL 5IMOB 3SE8H 2H45A 3G5XB 3MDJA 4LLYA 2DM3A 4OLVL 5CFAA 2VCOA 2DI7A 1XSJA 4PJCE 1QFWH 2DDQL 4KQ4L 3C5XA 1FYTE 3JWOC 1OALA 2QHLA 4LVHB 5IBUG 3JT0A 5L0QB 4QRTA 1IGJA 4YFLI 4APQB 5D9SB 5KBDA 2OZ4L 2W9LA 1BXUA 4G5AA 2CG9X 5A3IC 5LGKA 5F72S 4M8QB 3A23A 1MFDL 3ARBD 2X6AA 3LNEA 3CFJB 2K9UA 3MLRH 3BEVB 5IB5B 5T1MA 5EMYA 4DSYA 2DOCA 1QR1B 1EWHA 1YN6B 2J1ZA 1UATA 4CN4A 5KS9E 1C1EH 25C8L 1RIHH 4TF4A 4O9HH 1YN7A 5HGGS 1KYFA 4UBDC 4XOBA 3IDMB 4TSAH 4QHLA 5DVNA 2Q5BA 1T5WB 1UWEL 1HL4A 3NOIA 5G5DB 3X3GL 5IB2A 4DQAA 5GZNA 4Z3GA 2ZKMX 3AUWB 3AT8A 1A02N 4PP2B 3DGCR 3QR2A 3BH4A 5EZPA 4XP1L 2CLRA 4BQ8A 3CX2A 1HWWA 2P80D 2P26A 5GGTH 1J8SA 4AMKL 4PS8A 4D0CB 1XIWC 4X80L 2E7LC 4G5ZL 1JXFA 3T0EB 3SE9H 5ISZB 1P6WA 1BQ5A 5KANG 4P07A 5DZAA 5LGHL 1T22B 3NQKA 5CCGE 2BZ7A 1U8IA 4KK5D 1ZIBA 4NXSA 2MIZA 4Z95L 5IMMB 1ZEAL 2OXGA 1LO2H 5FM4A 3T2LA 1OW0A 2VJ0A 2R4RL 3AREA 4UINL 2VDPB 2YBGA 4Q0XL 3Q5YA 2WXOA 3HFML 5AALA 4AVJA 1ES0B 4JQIH 4A2DA 1F58L 1E6OH 2F54D 2H1PH 4AEHL 3LEXA 4H8UA 5FGBA 3V5DB 2OMUB 3V6ZA 2WINA 4PH8A 2NSXA 1HOCA 3E6FB 4OR1A 5DR5H 3RKDD 3EJRA 2ICEA 4TPRH 4BH7B 4DJMA 5JPMB 1EMTH 3FN0L 1NIDA 4XMLL 3U0PB 3HLAA 2DQGH 2ZWKA 2R0WH 4CA4A 3CCHA 5I24A 4NM4L 1DQML 4QRBA 3KPPB 4EDWH 3PL6C 4HU8A 5J6SA 4MSWB 3L4VA 2IAMA 5IQMA 4YPGA 3JVGC 1MCWW 3LV3A 4PCSA 2ZUYA 3NEEA 5AKTA 5KS9A 4EI5A 4C58B 2FHCA 5AKRA 1M42A 2JKNA 1D7FA 3E2HB 3TBSA 3OD3A 1UH2A 4LSSL 4I1PA 4EIUA 3TJEH 2DLFH 2AZUA 1E90A 3QJFB 1OAXH 2P1YA 4U3SA 1GXEA 4WV1C 4NNXB 2Y3NA 4JANB 4FFZH 1BSIA 4AL8L 2DJUA 3EJZD 1CF8L 2XV6B 1MCLA 3D06A 4TLTA 4KX8A 4OI7A 5EB9A 2O6DA 3DX0A 3DURB 1IKFH 1JYXA 3V7AG 2VDOH 1AR1D 2OXHB 3KWWA 5DFTA 3UPCA 2ATKB 3IF1B 1E5BA 5DFVC 3VFTA 3VXMB 1UCBL 3BSZA 1ZOXA 4P49A 3AAZB 1MRDL 3DLQR 3THML 4FLQA 5C08D 1NCCL 4YHKH 1P1ZB 4TLUA 1T03H 1BFSA 4P4RA 1W6LA 5JZ7C 4FNQA 4JVPA 4KGJA 3MMEB 4HLZG 3LS4H 4JDVB 3IDXH 3KHOA 5D4JA 4P2OA 1MHHB 3R4RA 4NQUA 5GSRB 4E41A 1J1PH 1NPNA 4Q89A 3HA0A 4YHYC 5IROC 1N3NB 1FWXA 1GR7A 1OB1A 3ZX1A 3ZKXC 4HK3J 5TFSL 1R3IH 3D7PA 4HIEA 1EANA 2VMDA 5FO8A 5DMKB 1INEL 5DF0A 5E6IA 2IBGA 4LPYA 3QQNA 5GZOD 1ILUA 5KBPA 3ERXA 2YO3A 1R5VA 4JFUA 1IAKB 1KGUA 2WO2B 4M8VA 3VQ1C 1S3RA 2XBZA 3QB7C 3HC4H 4IDLA 1SOSA 2CKNA 2WUCL 4M43H 2YMXL 2P8LB 4H7VA 3SCMC 2PUQT 4HGKC 4NQED 3D25A 3MO1B 4E5XB 5I18H 1ICTA 4MA7H 4M48H 5EIIB 1SDAB 3LRKA 5JOFB 2P80A 1U93B 3Q8EA 4P4RB 1G6RA 3WTTA 4EIGB 1HZHL 4UZGA 2XN9E 5F0PB 3KWXA 4F7CB 1TQBB 1R47A 5A6MA 2F7QA 3CLEH 1R33A 3VUAA 4GSQA 2DQEL 5D2LF 5HI4D 1J5IA 4GMTH 1P69B 2GBTA 1A7QL 1MRCH 2Z8WC 4G1EA 3S37H 1IGFL 4DPBX 1BFOA 5JW3L 4GG6F 4GKZB 5DZ9A 5BRZA 5T8IA 2VR7A 3VXUE 4WSJA 4A37A 1NDGA 3GIVB 3WS6C 2E27H 1YJDH 5EORH 3QGVA 2CO6A 1M1SA 4ZTOL 2R4RH 3L1FA 2XWTA 1YECL 3E8UL 4D7PA 5E95B 3REVB 1HIMH 2P45B 1HEZA 4ODXA 5ABDE 2HWZH 2FAUA 3IVKB 2VUOA 1WFIA 3M1OA 1SDDB 1YEHL 5I1HL 1CYXA 4KPHL 4J2XA 5EA0H 4NUGH 1IC5H 1DEEA 4LGPB 4R97B 3RVVC 4HOXA 2AS5M 1RPQA 4LHQB 4MDJA 4XP1H 4DO6A 2CDEA 5LCVH 3WS6A 1UM5L 3NYKA 2E9JA 1TDQA 1CLOH 5I16A 3E3QC 2VIRB 3MXVH 4K9JA 3RDTB 3WIAA 1T2QH 4PRPD 1G9NH 3F7VA 4CDGC 2D03H 3CVHH 3GWJA 4CVWA 4K94C 3T0EA 3F3HA 3FCUB 3IE4A 2JV6A 4L0ZA 1INDH 3RVUD 4OCYL 4TL4A 1F5WA 4Y4HC 4GBXD 4I3SL 4E36A 1M7IA 2Y5TA 1OAZH 5D7LE 3U7YL 2BP8B 2LLGA 1F11B 4GO6B 3PP4L 3PGFH 2QQNH 4W9CC 3APNA 4Y5YB 1MRFH 4ZUTA 1SDDA 3IGFA 1LEKA 4F37F 4RMQA 2UUDK 2X53A 1IBHA 4MKMA 1XXDC 5BVJA 5KVMC 1YN6A 5BS0E 1ZHBB 1ZDSA 2BIIA 4JB9L 1S7WB 2NZIA 2G0KA 5FDYA 3VXUA 2YRPA 1I3GL 3MV8E 4QTIL 5GRUH 3RWIA 1CLYH 1WAAF 2BIPA 1UOLA 2OW7A 2CIIA 2CKBB 3CNKA 3DJSA 3DMMD 4M5SA 1DJIA 1X7SA 3GBNL 5DR5L 3SBWC 1OTUC 3K6SA 1GOFA 1LEIB 5E6SB 4ENZA 4LASH 1XTMA 2OV0A 2E6PA 3ARQA 1LQSR 3Q3GA 2Q8BL 4XE5B 4LOFA 1EEQA 1QRNB 3DSNB 5FWQA 1EUUA 1DQLL 1I7UB 2FBJL 2GHWB 3FQUB 1PD0A 1LILA 1MJUL 2E74C 1JPFA 3CN4A 1UD8A 1D7DA 2EKJA 3KXFD 3SE4A 3H9HB 3LSOA 2HYMA 3L45A 3ABKB 2CRYA 2DEWX 4JPQA 2XWXA 1NCWL 4U3SB 1S7UA 4ZPTB 5JLZA 4Q9QL 5EEUA 1V27A 5DVMA 3M1BA 3GMNB 3IDJB 1EXHA 3QQ9C 3ZUCA 5DJ6B 2YD4A 3L9RA 3T0EE 1U42A 4W81A 5FW7A 3T6XA 3TBCA 2HRPH 2OX5A 2FWUA 2EDHA 2EJ1A 2NY4D 3SDXE 5DRZA 2VOTA 1A6UL 5E4OA 3N41F 3GHEL 4LLAA 1XO8A 4XPBH 3R0MA 3DETC 4H5SA 5T5FL 1JHKH 2J55A 1DUZB 3GZPA 3O9WD 3QQ3B 4L5FE 1FFNB 4FQ1L 3CFEA 4YC2B 3ZE0F 2HT2C 4YHNA 3KYKH 3CN0A 4MQSB 3VSUA 3VXPA 4IIQC 1NDMB 1HX0A 2BWDA 2XUWA 2D0HA 4HS6A 4DK6A 3C60B 5JQ6H 1M05B 1IL1B 3U6XA 1MNUH 1MHHA 4K8RL 4WNQB 1A3QA 3TA3C 4AG4L 2PO6D 2A4CA 4FFWC 1AY1L 1BG9A 4KTDH 2G4EA 4FNTA 4HF5L 1MRFL 2VDPL 3HG3A 5SWQA 4AV0A 1BG1A 3EG9B 2VLMD 4FQPA 3ZYIA 5IM7B 4CU8A 1JF1A 2P5WB 2F54E 5IVXF 3O6FD 5C0EB 5DK2B 1NEZB 2NR6C 3D3VB 4KX9A 3MUZ1 3TYFA 1NH6A 3ESMA 2JLPA 1U3JA 4TVPE 2I32A 5D93B 1TVHB 1BBJA 3G08A 4B5ZA 3D50A 1G7IB 5BRPA 5BCAA 1ZWIA 1XSKA 1JNNL 3HPLB 1EDYA 2JJWA 1RURH 3OKMB 5AFAA 4PJ9A 5EBWA 6PAZA 1MCRA 2VWEE 4FMKA 2R2HB 5CMAA 4LB8A 1RURL 3DBSA 2HMIC 3ULUD 4UANA 5JR1L 3UZQA 1QKZL 3F6IA 4EI5B 5MERB 4X4ME 5D5ME 5A7BA 2MCG1 1SFDA 2GSGB 3KPLB 4AK1A 5F9WB 3SDCC 4K8RD 2CRZA 5L88L 2AXGB 5FO7A 4FULA 5B3SB 4MMYB 3S8GB 1YA5A 2X28A 2CLVA 4IOIB 3VB8A 3D8MA 1AE6H 1BZ9B 5BV7B 5J56B 5B1JA 2D3VA 2W65B 1Y1UA 4EZMA 1AP2B 1F90H 1NSNH 1ZJBA 2Y7SA 3MTXA 4EVNA 4XVUC 4K3JL 3FCBA 1U8PA 2XWBA 4FQCH 2Q3ZA 3BCDA 3MRBA 4JGUA 3RY4A 4XN7A 3PPEA 1SEQH 1HSBA 2WBJB 1FFTB 2ADFL 3CWGA 1P84K 4R8WL 4PHZA 2UYLB 4I0PD 2CJUL 4XWOC 4ZFOA 1LK3L 2J6EA 3ZTCC 1T83C 1HS6A 2VZTA 4L1TA 3AUVA 3HS0A 1ILSA 2BSTB 3L3HA 2VT0A 3EJYC 1Z3RA 2GPZA 1A1NA 3QWRD 1DR9A 3MLYL 4FG0A 1CD8A 3LZLA 4HJGA 1DFXA 2P24A 5B1JC 2GCYB 1BYOA 1IIKA 4FMFA 5C0IB 2PP9A 4PRHE 3EXLA 4L29B 2B1HH 4S2SA 4Y5VC 4JFFD 5A2BA 4G6KL 2HX9A 2M8XA 3P77B 1XSIA 3DIDA 3J2PA 5T1LB 4RH4A 1U2YA 1YUKB 4A6YL 4TNWK 5TPWL 1IKFL 3IDJA 1PX4A 4XVSH 3D0LA 1RUPL 3BGMB 3F6JA 1EJOL 1TYEB 4X5WA 3NCJH 5FYKH 4LAQH 4FFZL 2YJQA 3B6SB 3RTQC 1CC3A 5ES4B 3CK0H 3V4PA 3FHQA 2ZYHA 4XPGL 5D5MA 4PP1D 2WOYA 2AGJL 3VFNB 3BP6B 4JFTA 1EK3A 2K70A 4QOKA 5JXED 4R4FL 1QVOB 2IMMA 5DEFA 2ZF9A 1LP9F 3WO4B 4JY5L 4RMVA 1EZVY 4Y5XA 4DGWC 1XF5B 4A2HA 4I88A 4OM0L 3ZTNH 1F4XH 1HEHC 4Z3HA 2EO1A 4L4TB 4ACPA 1WBYA 2BZCA 1J9CT 1VZHA 2O5NA 1B0GA 2WZAA 1J86A 1I8KA 2KQMA 4PJIB 5ITFB 5GS1B 3HZMB 2OI9B 3BUPA 3BXNB 3CVDA 3LIZH 1MQKL 4Y2DC 2BW5A 3G6DH 2HKFL 4GKNB 4X8CA 3FO2B 4M7JL 4ZT1A 2B5IB 2CO4A 2NRDA 3ARVA 3HMWL 2X4TA 1U8CB 4IRJC 4QD2E 5ACMA 4BQ9A 1AO7B 1Q1PA 3CX5J 1O7SA 3MTRA 5DJCA 1NBZA 3FB6A 3GMPA 1KIRB 5CO1A 4GSDH 4NQTA 1TCRB 2CBPA 3MR9B 5I1LA 3DX8A 1A8JH 2WZPA 3A6BH 5BPPA 4MCZA 4YZWA 3TFBA 2B16A 4I3SH 1NAMH 1E4XH 3MJWA 4OUUA 1AFVH 3MLTB 1M6OA 3V0DA 1F4AA 1I85C 1T89C 2WXQA 1VHPA 2NYYD 4ZW7A 4PV9B 4PJ9D 3DVFA 4F15C 2XTJE 2W5PA 4AY0A 2DL9A 1KBPA 2P3YA 1O6VA 2MNWA 3ARBB 4U1IA 1BYPA 2OMNA 5LDSA 4PJDB 3NJVA 1MCIA 2AQ2A 2Z0BA 3AU1A 4ZG1A 4XCFH 1TG8A 3SOTA 5IW6A 4X50A 4Z23A 2DRUA 5FIEA 4ZJ9A 3NABH 3KR3H 4NQDB 1DVXA 4R0LC 1C7SA 1I85A 1RULL 2AQPA 2NT0A 4J3TA 5ETUA 1AHWA 3S34L 2H4EA 5EO0A 2C7FA 1CU4H 3VFSB 4UM8B 3L5WA 2ENPA 3QUZC 4FXGB 2EXTA 3RX7A 3K6DA 5FUZL 4LZKA 3EO1B 4RRPG 3WS3B 3QUYD 4M5ZL 5INCB 2AXHA 4PJHA 4ZNEE 2JKJA 2Q8BH 1GZQB 2BDNH 3NFNA 3FF7A 5JDSB 5EUOF 1HHKB 3TVMB 4MHHG 4UWQB 3QCVH 3BQVA 2QBWA 2TSAA 2Z1KA 4HS3A 4GPVA 4OUOA 3PAVA 1BHGA 1LWHA 1X7TA 3L3GA 3WIIL 5T1DL 4B53A 3B9EA 3ME0B 3RFZA 1VPOH 1QZNA 4WNJA 3RTQD 2V2XA 2VM3A 5GGTL 4AMKH 5TDPB 1ZTXH 4MAZA 2QFPA 3H55A 1WD8A 1V54B 4F7MB 4K07A 2XNAA 3NZ8B 3IXAA 4BSVA 3CXHK 5KAQF 3P9MB 3VXTB 1JGUL 3DX6A 1TJHL 4UQIM 5CINH 4XN8A 4F7EB 4TTGA 4WUKH 4G42B 2KYIA 2ZOLB 3FUKA 3HE7D 3WFHB 1RCYA 2OXGB 1INDL 4XI5D 3DYMA 5F3HB 1EIBA 1OGAA 3IDYB 2C4XA 2XZQL 1EZVX 2B1AL 3HE7C 2I27N 4H44C 1NAML 4I4WA 1V3LA 4RGNE 5FHAH 1B90A 2UY6B 3L3KA 4MCNA 5DRXB 3TIDA 4NZRL 4OB5H 1X5MA 4CSPA 4X4KA 1OK8A 3L4WA 2VXSH 3TASA 5GS0C 4I77L 2IALA 4BKSC 3CN2A 1CQKA 5IOPA 4X99B 4XCNA 2VR6A 3O8XA 1PZCA 5LBGA 4BXVA 1XGTB 4PGDB 4A7TA 4YNYB 1YPZB 5CU9A 3L4ZA 1R4XA 4PJ9B 2NX5B 1B4TA 4OAWA 2EIKB 3NG5A 3SBPA 1A4JA 3VW3L 1KEGH 2ITCA 1D6VH 5ISZA 1KGXA 2CBQA 1A7PH 4LCUB 5D6DC 5FA3A 1HQRB 1KB9J 1NC2D 1CMOA 4XP6H 2VSMB 5HYQA 3EJZC 4XRCB 1EXUB 1CZ8H 1QPKA 2UY7A 3X11B 1A5FL 2Q6WB 3S4SG 2R1YB 2XN2A 4QRTB 4G3YL 3EOTH 4JUTA 1IFGA 3BYTA 3BIAX 2UZXA 4HCIA 1ITCA 5F1KC 4LOUD 2V3FA 2BNRD 2EDWA 1H5BA 3FRUB 1XB3A 3LXUX 4XNBA 5C0RH 4V1DE 4N87A 2XWRA 5D8JL 5CN3A 3SO3B 3Q0HA 2YD2A 1JHTB 3PQYE 5JHLH 4N2IA 4FYRA 4K5MA 3N1FC 1L5GB 4IMLA 1HOCB 3TEXA 3TBSB 3PWJA 3I02A 2NNFA 4JFEA 3L48A 4MNHB 3DX4A 3UGEA 3B3BA 2ZX8A 4KUCD 3GMLA 3NFPB 4AVKA 3UO1L 1C12A 1M2VA 2ZXGA 3F58H 4X6FA 2FNBA 4N68A 1AJ7L 3TJHD 4XVJH 4YBQC 3SGEH 2N7AA 4J23A 3QJSB 4IKNA 2D7TH 3QPQD 4I48A 1T04A 1TQVA 2CDGB 5I73C 2F19L 3CFTA 1LHZA 1SYVB 3BVUA 5EZOL 3MRLB 1TF4A 2I24N 2DBJA 2QVMA 2YD3A 4ZS7H 3UFIA 4CKVX 1SLXA 2XZAL 3AVEA 5AKSA 2VDMH 4CL7A 1WTLA 2QKIA 3LYRA 5E5UB 3UBXB 2AK4E 4Q6IC 4AI7A 3QWNA 4J3OG 4P5RA 4RX4D 2CRMA 3GXMA 4IRZA 1KDIA 3O9WA 5C0BB 5LQBH 4HCRH 4WI0A 3P3TA 4PRHB 3RKDC 3BQUD 3EW3B 1FLRH 4EXPX 4MJ6B 4PRIA 1J8HE 1IVLA 3GIZL 3OV6A 1GOHA 2YUZA 4P0DA 1A7OH 3OMAB 3GZKA 2WQXA 3G5YA 3MBWA 4V1DA 4XP5L 3EYUH 5JXEA 3SY6A 1L7IL 1FNLA 1XGRB 1DDTA 5K39B 2QHRH 2WPGA 2CU9A 2VR5A 7PCYA 3O6ML 4LDCA 4WFFD 2XTJC 3F7QA 4OJAA 5H2BB 3SGJA 5GZNC 1DBKL 3HB3D 2XKNA 5I1AB 3BVDB 3L8QA 4JR9L 3FTXA 3JZYA 3M45A 2FWLB 4MD5A 2EXWC 1U4EA 2A73B 4A6YA 4LVOC 4B27A 5F89A 3O3DA 4LHJB 1D5IH 1P5VA 4WUUA 3O4OC 4WEMB 5DSCA 3KAAA 2WLLA 5IVXA 3A5VA 4OAWB 3ZSTA 5C09E 3QPQC 1BD2E 3QORA 5EV7A 3O4LB 3EUDA 4MCYA 4HLZH 3H8NA 4JM2B 2HJFB 5TQ0H 3HE6D 2NTSP 4FJZA 1GA2A 4I89A 3BKYH 3U2SA 3B2PA 4ZSOE 2AK4A 5JQ6L 2ZWLT 4B50A 3OSVA 2R69L 5HPOA 3CZGA 3QJTB 4A63A 1WBZB 2X4QA 1JYVA 4KUZL 1A7RL 5IW3A 1J8HA 1WHPA 1JZHA 4MS6A 1FNEA 3QWOB 3FQ4A 5C08A 1U8CA 2GSIA 4LSRL 3QFJE 2OYPA 4IEFA 2EDNA 4U0QB 5HTSA 4HK0A 3U9UA 4NX0A 5J0BA 4F8TA 3WNKA 5LBSL 4ODXB 2J8UA 5D72L 1BGXL 3MRMB 2VO8A 2WKOA 4IYKA 4JFEB 5B39B 1HC1A 3GIZH 5GGQL 1PTZA 2ZUTA 1TQCC 2GVYA 5I6LA 2IWFA 1J9SA 2NDGA 3EGSA 3FO1A 1YY9D 2E6QA 3MRRB 5CF3A 1LE9B 1KCRH 1QEWB 1S9YB 4YC2C 2FO4B 5C0JA 4RISL 3V6OA 2FJSA 2VXUH 4FFYH 5I1EH 3F12B 4Q2ZB 4HKZA 3MLXL 3HHMA 4G80A 2DWEA 4MQTB 3QS2A 3ZGIA 2CHDA 4F7KA 3MCKB 4U6XA 1UXSB 5DUBA 1J18A 3DHUA 4HKXB 2RIKA 4KPHH 4GB9A 4WJG3 4UM8A 1PYWA 2WNXA 2CCLA 4P2OC 3SQOH 2YXFA 2IXQB 3N42F 3R06A 2XWJB 4M61B 2HLAB 4FA7B 4Q6YA 5EZIH 4BQBA 1HILB 3TCLA 1RZQA 2IOOA 3D05A 3QAZB 3PUUA 1DE4A 1HINL 3K80A 2XN1A 3B9KC 4FXKC 1KZQA 3KBEA 3QH3B 5D4IA 5E6IC 5I6OA 2YD7A 4FZEH 4N86A 4Y2LA 4ZO8A 4XNDA 2H8PA 3DC0A 1A2YB 8PAZA 5C0BE 1Y1DA 5F88A 1Q38A 3A4AA 5DJYB 3FJTA 4ZQKB 1JPGB 4HETA 2WM0A 3SCMA 1MF2H 3STBA 4YHIA 2DI9A 3AS3A 5F1NA 3U30C 4EO5A 3BN3B 5AQ0A 4Z18A 3IFLL 3CLWA 5LHDA 1EA9C 5E5LA 1GYWA 2LV4A 1TZIB 4XMVA 5JYLA 1XF2A 5CZKA 5F7YC 5IJKA 4YDKH 2IPTL 5KSVB 3TESA 1CZ8L 1QLFA 2GBAA 4XN5A 3MYZA 2ADYA 1XMWA 4PJIE 4NT6B 2PPDA 1QP1A 3V6OE 5F0JB 1YJDC 4PREB 2D0GA 5LCVA 5GSVB 1IAIM 5EUOA 4NIYE 5J13C 3QZWB 2Z34A 2IPUG 3LKSA 4JQVA 4WSGA 4WWOA 1AR2A 3OXRA 5LQBL 3O4LA 1NJ9B 3MV8D 3BH8A 5IFHH 5KOMC 3NA9L 4QXUH 4YSCA 3BP7B 4LCWB 4BHUA 4DNLA 4L1DA 2H8PB 4FHBD 2YAOA 2AAVA 4EUPG 5C3LD 3HG1D 2PP7A 1KGWA 3LZOA 4DF9A 3JV5A 1F4YH 4KHTL 1T1WA 4NO3A 3NQIA 5F93C 4APQA 1KG0A 1IILE 4ZUUB 5T1LA 3SO5A 2XA3A 1H0DB 3VFRB 1WTGT 5KVEE 3NJMA 1WGVA 1G9MC 1JRHI 4JFED 4NWTH 5T5NG 1NCBL 2Z9TA 3NCBB 1ETB1 3RUGA 4LK4A 3E6HB 4ZFGH 5GRVK 1D6EB 1TKWB 1H6TA 3O9WB 5C0BA 1NANI 3PV6A 5K9OB 1M9SA 3PPSA 1JZJA 2XFGB 3STLB 1IUZA 4R4NC 2ORBH 1KYDA 1UWFA 2RB8A 3MRIB 3O6KL 5HYJA 2HXAA 2W1NA 4IW4C 3T0ED 1NLBL 2CZNA 1N10A 2G2RB 4NS0A 3UAJC 4KNTA 4CC4C 3T0EC 2GY5A 5J1TC 4AQOA 2EH7H 1OCCB 3BHBB 4FTDA 3HNVL 2NY5C 2HPTA 5IZ7A 1Y07A 5T3XH 5J6GB 4ZPVB 2FJGB 3FO0H 2ZNXA 5HHNA 1HNFA 2RAMA 4DT2A 1OP9A 2WBJA 3HS8A 3SDYH 3C60C 4K7PL 2H0PA 4KXCA 4D8PB 3K72A 5ENWA 5DMKA 3KPOA 1KB5L 4NKDB 5A1AA 1ODAA 2WIMA 3NGBC 3VFWA 1ZD6A 5H35B 2GJPA 3L17A 5I2IB 1G9HA 4LCCA 3QS3A 1SVBA 2IPKB 4WUUD 4PI0A 1FYTA 4YOKA 1EDHA 4GRWF 3UTQA 5E2UL 5DQ9A 5PCYA 5I17A 1J8HB 2AJVH 2JCCE 4IGBA 2IWKA 3HRZA 2XN9D 4UOW0 5E8DL 4HC1L 4JKKA 3DJZA 5JW4R 1Q1JL 2R59A 1QBLH 2VRQA 1ZGLB 2DWYA 2OXHA 4NOFA 2G30A 5F3BB 4L8DA 1BCIA 3KXFB 4AYFB 4EEEA 1P7KA 3ZRCC 3VQLA 3QWQB 3N85L 3EJJX 3LEVH 1AGFB 3L4CA 4J6RH 4LHUD 4FYSA 1FO0H 2NPLX 2AKRA 2D31B 1TJHH 4E0RB 4HH9A 4M62H 1H6FA 4W9KC 5FK9B 2GQHA 1T3FB 1AR1B 5A3ID 2VW7A 3CDZB 3KEHA 4XXDB 4TTDD 3X3FH 1V5JA 2KZWA 2BSBA 2J8UF 3FH8A 3FO9A 2EVFA 2WUCH 1RUAL 3CVIH 1DDHB 2XG4A 4OD1L 3HBZA 4K7FA 4XMLH 3F01A 5E03A 1S9XB 3SDAA 5DC2A 5F0LB 4GXUN 3J07A 4GQPH 2Y1AA 4Y7OC 1W0YT 3MNZB 2PTVA 3GTNA 3MRQB 1F58H 4B3VA 1EFQA 2IV9A 1EVTC 3RI5K 4JDEA 1FZJA 4APXB 1HJBC 5I66B 5F3BA 4TQ8A 2F5BH 5GQBA 1FVDA 2Z93B 3ML8A 5ANMB 3MV7B 4JM4L 4AT6A 5CILL 4AM0A 3DV6B 1IVTA 3IJ8A 2FWOA 4IOSD 1OKEA 4B9YA 4OCSL 3CCHB 1EAPB 1BVNP 3K7UA 1Z5LB 4G8GE 2ZICA 1A1OA 2R56H 3D07A 3CPLA 2XV2A 5HHXH 1KZYA 2W9EH 5KSAC 1G9EA 4LAQL 1RJZA 1SJHB 4Z7OE 1RULH 3ES6A 1PY0A 4ODTH 1VIWA 1RK0A 2EDJA 3QZWG 1WBZA 4H25A 3ISRA 4R9HA 4B97A 4OI8A 3WEMA 4QGTA 3CIQA 4FXLA 4NKDA 1FNGA 5GISH 4HFUH 1XGPA 1K4DB 4YVNA 2R4SL 4NC1E 4YR6A 4OKDA 3QRGH 5D7LD 3UJIL 3WKML 4BK5C 1N5AA 4ISVB 4O9HL 5D7EA 3JWNG 1KTCA 2YMOA 2GJJA 1E4HA 1KLFA 3QUGA 4UZUA 4XGZA 3R18A 4J6RL 1NC2A 4OVVA 2XG5B 4NZTL 3OAUH 3ZO9A 1S7TB 2J2ZB 3I75A 3K81A 4YBHA 3RPIB 2PO6C 3D69A 3ARZA 2G2PA 3HZVA 4DKFH 1M57B 3A6BL 5E2VL 2BSEA 4UTAH 2ZXDA 8CGTA 1QO3A 1UQSA 3TONA 5CBAA 4L9LB 1XZ0B 1F4YL 4C59B 3ZL4H 3CXHJ 2VC2H 4FTVD 3TEUA 2H3KA 4N25A 4BK5A 2Y1ZA 3DI2B 2ZAIA 4CADA 3KGUA 4HUCA 1PJWA 4CSZA 3T4AB 3X1NA 1E2WA 3F7VB 2UZXB 4TUOA 4KO6A 5E6IB 2XOTA 3KMDA 1KWGA 3EJQA 2VZ3A 3VAEA 4IBSA 3B5TA 1N64H 4I18A 5CLZA 3LH2H 5AZ2L 3HS0C 3G6JB 3DX7A 4KJPD 1HJCA 2XPGA 4B9KC 2B2XL 3SJVB 5I23A 2VH5L 5LBSA 3DX8B 4FQJH 4GNKB 1WICA 1SEBA 4JHAH 7PAZA 3ARGD 2DTSA 2NXZB 3IFPA 4WI7A 3SN6N 3WLBB 4RZCA 1BVNT 4WDIB 3KPQA 3FOLA 4N0CD 1AGEB 5CLXA 4YDMA 4M1GL 4R96B 4I18C 1FBIL 3TZVD 4M03A 1CIUA 4Y19B 5TDNB 5DVPA 4ZPVA 1U8LB 3QR0A 2VR3A 2JELL 4HIXH 4ELDA 5CGMA 3ZDXF 2AI0H 4I0PA 4XXWA 1FC1A 3KE0A 4G1EB 1DUYB 1YNTB 3FAWA 1BW8A 12E8L 3DMMA 3GK8L 4MYWB 3EIFA 4PJXB 5CKGA 4NWTL 2ARJQ 3L9BA 5C8JB 2ICES 4A7QA 4M93C 4PJDE 4YZFE 1RL1A 2R1WA 5DEGB 3V0HA 4ZD3L 2IGFH 1I75A 2D73A 4X42A 2YPLE 2R29L 2P47B 2ADFH 4L8SA 4MVBD 1AGBA 3NPSC 5E2VH 3BQUC 3IU3A 2FSDA 4HJSA 5HYJB 3QVAA 4FEMA 4PJDF 1U92A 4K3JH 2P5PA 3DXAB 4ZMXA 5FKAA 1ACXA 1A4KB 2Y36H 4FQ1H 4NP9A 3JWNH 4O58H 4P3DB 4Y16B 1IX2A 5EU6E 1SJVA 5DD0H 1NPUA 1AIFA 4XBEL 2WAQA 1YEGL 4ZOBA 4XGZB 5GRXG 1L9TA 5EBLA 4ZAKD 5BQDA 3PWVB 4FFYA 2J44A 3O45B 1JGEA 1VFAA 1S7TA 2Z8SA 5HJGA 4XMPL 1PCXA 4F2EA 1DFBL 2WHVA 1D9KB 1SF5A 3T6WA 1A9EA 5D4QA 1XH1A 3TWCL 2HVBA 3VFPB 1OTSD 1RUKL 4LLVB 4MNGA 4O2CA 4GXFA 2B1OA 1AOZA 4G11A 3S96B 3IGLA 3VH8B 5H4ZA 3QEGH 1XR9A 4DZBA 4LGRB 1J12A 4I48B 4QEGA 4XC3L 4PJ7E 3NZUA 3SOBH 5T3XE 1KPVA 5EC1A 5IFJA 1MCKA 3BUQA 4TSAL 4CNIA 2PYED 1TTCA 5D7LA 5KYUB 4G6JL 4OCWL 4P46B 3CBJB 5J3HD 4J8RA 5DVLA 1NIBA 2P8PB 4QRPE 3K2UH 1KYUA 4JZOA 4ZK8A 1SVZA 2EKSA 3U36B 2LW3A 3DIFB 3L6FA 5BS0A 5MEQB 4HPYH 1KT2A 2H32B 2EACA 3MV8A 3EOBA 3GSXA 4NQEB 2Z64C 3RVWD 1FZJB 5K1NA 5A43C 4M6OH 1TZGL 1ONQB 3DARA 3P9LB 3ZDZB 1I9IL 4PLJC 2WWMD 4U1NB 4K7PY 3FW6A 2FQGA 3PNWA 4RZCB 5KG9B 1KELL 2Z35A 5AEAA 4BFFA 5FYKU 3GUTB 4UYPA 4K7FB 3TC9A 4XPTH 1KB5B 3PP3H 2OSWA 3AROA 4P46D 5ESQA 3E1F1 4W9GC 3T3MB 1WGOA 3V4VL 2KDGA 4XXDA 1VB9A 1PG7L 5CUSL 1YPZE 1E9PB 1BM7A 4UNTA 2FK9A 1FG2A 2Y07H 3PHOA 4MQXD 5EPMA 3KPNA 1U2CA 3PWPE 2DN7A 5LLIC 1G9MH 5FAAA 2OMYB 1EFXB 4NM8L 4UCFA 1KTDB 1PZ5B 2HRPL 4XTRC 3BSZL 3NSYA 2MQGA 2FH6A 1F42A 2QT6A 4L4TA 1ZGLA 2X7LB 2ZUQB 3CGTA 4AWJC 1KLUA 3EAKA 3MU3A 2E9BA 1GGYA 3D69B 3U0PA 4P9HH 2WYIA 1CR9H 3L95B 3FPXA 1G0YR 1U8MA 1LYQA 1KB5A 5EEYA 4O5LL 3TO2A 4HIJB 2O30A 4JO1L 3LPGA 2O5ZL 2BK8A 3UPAA 4QXVA 4P05A 4AJVA 3D18B 2WXLA 4ZTOH 1V3JA 4MGXA 2Z4TA 1EV2E 2EP6A 1XBRA 1K6QL 4FNRA 1JDAA 3BQUB 2OJEB 5EORL 4PJ6A 4LCVA 2YAEA 2G75A 2WKGA 3C8KA 1ZTXE 4KVNH 4ZFOL 2GK0B 4DERA 5CEXB 5ABAA 3F05A 3C5JA 1U8JB 1RERA 1TEGA 3MRHB 4JJ5B 4DUXA 5IR1A 3DTUB 1AQ8A 1CF1A 1CTNA 2NQ3A 2VLJE 3QUYA 5SWZE 1YN7B 1P7QD 1ZXQA 3CVCA 3OJMB 4Z7WF 4NENB 5IROD 1SEBB 5J7CC 1KLUB 1A3ZA 1MG2C 2ITFA 1G0XA 1GS6X 3LKQB 3MV7A 4PJEF 1SLVA 1YUHB 1SN5A 1BM3L 2R0KH 5GHWH 3U1SL 1NGYB 2COQA 2HG0A 2RFXA 3WHXB 5HYIA 1AMXA 4FQ2L 4LLVA 3FTWA 3WFCL 4LKCA 3TV3L 3X13A 2WCPA 1E43A 3FQXB 3G6AB 1FO0L 1LWJA 3ULUF 4GJTB 3VSVA 5I15H 4Z9KB 1RZPA 1U91B 4ORZC 3TT3L 2G3XA 4X4MA 4MX7A 4HJ1A 4GI8A 4XMWA 2ZUQC 2KC0A 4ZXBC 4Y16D 2HKAA 2IBZY 4K5LA 5MENA 3ZK0A 2JB6B 4TQIA 5DWUH 4BZ1H 1RHHB 5ITBH 2DD8H 5GIRA 4DKEL 5IUCA 3OAWA 1LK2A 3GBLA 4LPUA 1TETH 3GSWB 2QEJA 4HC1H 3LN9A 5HDLA 1BIHA 1ZHLA 4KK6D 2F53E 5AOIA 1CG9B 1HXMB 4TNVK 4D9LL 2FSEB 4N2GA 3W37A 4HXBH 4WI9A 1MI5A 4JE0A 4NDMA 4PGZA 3UG4A 4FA6A 1HFUA 4U1NA 1YEEH 5F2FA 4XO9A 3R0NA 1NEPA 3OJDB 4G6MH 1ADQL 2ENYA 5GGVY 3VH8G 3LB6C 5AAWA 4ADJA 2ZKXA 3W39B 5C0NC 2JKWA 1AANA 1F3JA 2OMXB 3BAIA 3L54A 3P9MA 5ILTH 3L3IB 3OZ9L 3BD5A 3DVGA 5FYLD 4XR8C 1AKJA 1S7VB 2F15A 1CK0H 1J05B 4I3GA 3HEIB 1S7QB 4YSRA 2OSXA 1KC5H 4MVBC 5HYSG 1LMKA 4NUQA 4JRXE 3L4XA 4H8WH 3WL9A 1DZ0A 3ARXA 1MFVA 1D5ZA 2XXGA 4PGBA 5HYSA 2YEVB 1A6VL 1UVQA 5CJOL 1KEMH 1LGVA 4HUXA 3WNJA 4JBSA 1DQVA 5AAWC 3W2DL 1T7WA 4X7SL 2C3HA 3IM1A 4PQXA 1O9WA 1XHHA 3WOVA 4WLCA 2AK1L 3W9DA 4WO4B 4FI7A 1BAGA 1TVDA 1JCVA 3PHQA 3N40P 1XCXA 1GGUA 3NFSL 5JXEC 2F5AH 4HWZA 3NTCL 1BFVL 4PP1C 2Y2YA 2J72A 3ZKNC 1TJMA 5DQDL 3TLRA 1DBAL 1WYJA 4NJAL 1NMAL 2VL5B 1FHGA 1A9EB 1JI2A 1TT6A 2ENQA 3DUSB 3HB3B 3HG1E 3ZDZF 2BVQB 1TJXA 4GKZA 4PJXE 2AEPH 3RYMA 4F27A 5JHDB 4KHXH 3WIIH 3KJ4B 5CHNA 1EAJA 2R0LH 3LMJL 5BUGA 4Z7VB 1MWAL 5EN2B 4PRID 4X6DB 3V4UL 3QXDA 4JVUA 3L3DA 1Q90A 4FQLL 4R7NB 4AUJA 4Q0XH 3QNYB 1PW3A 4MZ3A 5D1QE 6CGTA 3DXAE 1JNLH 4OLUL 5DHDA 2WQUA 4LCYB 4HKXA 4P8QA 1NM4A 2J73A 3N0AA 1BMZA 2C9RA 5AVWB 2F8IA 4HS3B 3RZWA 1A7BA 3HKFA 1C08A 1CFNA 1ET5A 4Z7VE 1GOGA 5EUOB 5J9PB 4FTVA 1FRGL 2Z35B 4HLJA 5AW9B 4PVNA 2DZEA 2IV8A 3ZOAA 1SMAA 1SQMA 1HEJC 4ADIA 3K4ZA 4YHZH 5D72H 1ZPUA 1U93A 4R3SB 5BO0D 5FO8B 2FBRA 4HKBB 3TNNB 5I1KH 1NBZB 3EJCA 4QLWA 3ZT5A 4UB0L 1QSEB 4PJ7B 1TNMA 1EZUA 1OV8A 1YEDA 3KCPA 4HT1H 1MW1A 4LSPH 1PAMA 3Q9PA 3QQDA 4XPFL 3ZDYF 2FHFA 3RBGA 2ZCKH 1G7LB 3WUWB 3B5HA 4E9SA 4JFDE 5LUMA 2ZSVA 4MLIA 1MY5A 3O2VL 1C8PA 3GNML 3MLRL 2MNUA 3F7YB 4XX5A 4PGEA 3ULUC 1PG7H 1CLZL 1SOKA 5CUSH 5CEZL 2C9QA 1SOXA 3L3IA 4U6VL 4JPKH 1M7IB 1XR9B 3MLZH 3EGXA 1M4KA 5IOPB 1DJGA 1WWCA 4NJ9L 5FKPA 5FLVA 2XFXA 4IJ3C 5TD4A 4WFHD 4M3JA 2D7QA 3R4DA 3IRPX 4KJWC 2QPEB 5DJ0B 2VLJD 5SWZD 3UP6A 5LGJB 1FZMB 2NQCA 5IQ7L 5D1QA 3MJ9A 4I0KA 1OZTG 1R0AH 5T33L 2OKMA 1UACL 5T1JA 4DETA 3WY3A 4DP2X 3PS6A 4P48A 5JPMC 2A6DA 2IGLA 3QDJB 1TZHA 1XWVA 2F58L 3DRTB 4S0SD 2VGLM 2Y7MA 1FVCA 4KQ3L 1G84A 3E3QE 4FFVD 2ZE0A 4FZ8L 3P3YA 1VDGA 5I8OL 3RIFK 4XCYA 3ULUE 4L4TD 3PWUB 1U8QA 2RD0A 3SOBL 2F61A 5ECJE 4B96A 2WJ7A 1GZQA 2VDKB 4AKPA 1D9KD 2ZYSA 3WIHL 4MJIE 1BBDL 1G7QA 3ULVL 5D4HA 5DK3A 1R5IA 4PJIF 2K8MA 3DETD 1FL6B 1JS4A 3VGHA 2H3XC 3I9IA 5AB1A 2B3IA 5KOVC 1A1MB 4DHLA 4N0FA 2ZOWA 1MCEA 2EZ0D 4PS7A 2W8CA 2DIJA 3UJTH 4Z7NB 1JWSB 1GZHA 4N85A 2DQUL 2FX9H 3KDMB 1H6UA 1OARL 3DO4A 4Q8BA 5HHOA 1FRGH 2OSYA 2W80C 5DMGC 4LLWA 3DDFA 4JFZH 4OSUH 1R46A 4URTB 3TV8A 4FQQB 4JMXA 2Y1YA 1IAIH 4UT7L 3LD8B 2XZZA 1M71B 4MA8H 4NQXB 3FT4A 4OZHB 4YSOA 4WTZG 1TEFA 3FONB 1OD7A 4M7KH 3QFDA 3SGKA 1MXGA 3W9EB 1X7QA 1FV1B 3D9AH 1F02I 1SOQA 3KBPA 4LPWA 3TWYA 1TFPA 2XTLA 4ODBD 4NUPA 2NCMA 2B20A 4HAGA 4PJ5E 1VACB 2BMKB 2BM3A 5DWUL 2W95A 2F08A 1PG7W 1SNRA 4OZIE 4B7IA 1JZ6A 1CFQB 2ZF8A 4NN6B 1MFMA 4QXTB 1H3GA 3EBAA 4QMEA 3BVNA 3QXWA 4ES9A 3HPJA 3FTGB 2CKBL 4HYTB 2EUXA 2TRYA 3VX1A 2EEBA 1ZHLB 1PBYA 3QFJB 1DN0A 3T0XA 2XV0A 4D0CA 4OV6F 3OMNB 4ETQB 5E7FA 4FG4A 4OW6A 5KYWB 4U05A 4W9EC 1QNZL 2GG1A 4K71C 2JI1A 3OM3B 3PQYA 4MJIA 3FUDA 3C5SB 3MBEB 4EVNB 3HI6H 3U0TA 2CR6A 3GM8A 2PCYA 1S9WB 2W0PA 2XI9A 2YSTA 4S1QH 3VGBA 1ZA6B 2VDQH 2X9ZA 4AYSA 3HI6L 1B0RA 1L7IH 2BVQA 2OYKA 3BEVA 1JHLH 5IB5A 4Y4HB 3AITA 1NCDH 1HL8A 2AEWA 2QELA 2DQCH 1KSRA 4MAYB 5AW3B 2L4OA 4M4RA 4Y9EA 4A6YH 2R69H 4CC4A 3RZCA 2Z1PA 4YVUA 1H8OA 3VJ6B 4JL2A 2WN3A 1KXQA 2DMKA 5H2BA 4RGMB 4NFDA 3I75B 3M86A 3RURA 1E4JA 4QR7A 4JB9H 4XC1L 3RVVD 3BGMA 5J11B 3IFNH 1IC7H 1PAZA 3Q8FA 2E8ZA 2VQUA 4F3FB 3UBXA 1MFCL 5BZDA 2FL5A 3VRJA 2IH9A 5D1XD 5BZXA 2R15A 1HXKA 1YYMH 3RAJH 3T65B 1NMCB 3LAFA 2OMWB 4LCCC 3ZTDC 3TYFB 4KMTL 5FWRA 3KYMA 3QISA 4QHUB 1X44A 4N8CL 4YDLC 4HIHA 4ZODA 3TZVC 2F7IA 4Z0BH 3X2QB 2J12B 1SYVA 2CGYA 5ICZB 3UYPA 5LGYA 1IT9L 1JN6A 2QADC 4IGBC 4NGHL 3K4DA 1NZRA 2V7HB 3QIWC 5TQ2H 3LQAL 1PDKA 4FQXC 3U2JA 3IFOB 4KUCF 3UO1H 2BY0A 1BOYA 2CWRA 1GAFL 2IEPA 4P5TA 1EVUA 3BPCA 3HN5A 1KPVB 5EC1B 2JELH 5BO1H 2EDDA 5LAXB 1NMBH 5IFJB 1IKOP 1RLBA 2K0RA 5KBKA 1NCGA 2ZAGA 3GJFA 4OU3A 3RUGF 3VWJD 4UTBA 2AERT 3K74B 4MMXB 4G7SB 2VR4A 3FSVA 1UA3A 2XY2A 3LZFL 3V0WL 3B7TA 2OTUA 4JPWL 4IBWA 4P23D 1BVLB 3VRIB 2JJTA 1JWMA 1H15B 3PXHA 1KXVC 3MMEA 4PRBA 5DGRA 2DQJL 4Y88A 4EOWH 4KC3B 2NZ1A 4JKMA 5BUAA 4BFJA 1ORSB 1YYLH 2QSTA 3IRCA 3Q1SL 3S36H 3FTVA 4DAGL 2XRAL 3T2OA 1GGCH 1WEJL 1BVZA 3SDDA 2X4PA 1I8MB 1J8KA 3QQ4B 3PDGA 4DFIA 2B5IC 1JK9B 4MAYD 5FKAB 1EEUA 1P7QB 2ICWI 1QO3B 3OB8A 3DUUA 4G8FA 5ESQB 3NA4A 1XBDA 4ZRGA 2VRAA 3H3PH 4LKXA 1JXJA 5JHDA 3EYOB 1KXVA 4X7TB 1IEBA 4L3EB 1IFHL 1UEMA 1DJXA 2NR6A 1MWAB 4HXAH 5KYYB 2GTWB 1AY1H 4X6DA 3NCWA 5F6HJ 3S5YA 5CD3B 1RUAH 3O3BA 3NJXA 3KR3L 5JORA 5BV7L 4F58H 3QP3A 3DMMB 1ZDQA 1BXVA 1WD9A 2IOIA 4HJJH 4M8UA 4B9IA 3HN3A 5C08E 1FPTH 1AHWB 4OGXH 4PV8A 3RHWK 4U6VH 1E5ZA 5JOPE 4L05A 3UROR 2MOQA 2EIMB 3EYFB 2IAMB 1T1XB 5E1HB 4AEFA 4B7LA 3WTVA 3RTQB 2BX5A 4K94L 3NJKA 2NUTB 1JHKL 2J1KA 5CIPB 5AG9A 2J8UE 2PWEA 4PRPA 1GJUA 2I07B 5I0VA 2YD5A 4PV9A 4S2SB 1OK0A 3O6FC 1MAML 3GI9L 1AZZC 3ECQA 3FOLB 3FC8A 4H0GA 2FT7A 1TQCB 4DKAA 3DIFA 1JK8B 1FNEB 1K2DA 2IADB 5HHOB 5I8EB 5INDB 5C3IA 1U95B 4YGAB 4PRHD 3QNFA 4EN3C 3X14A 5M94B 3TNNA 4TXVB 1NDGB 1A2YA 4I8DA 2V37A 5IQ9B 4FNLL 2UVFA 5IWLC 3VWJB 1FORH 1M7UA 5DZNA 4M1DH 5CD3A 1JMXA 1NCWH 3OR7A 5E1AB 4L9LC 1RU9H 2GW5A 1MG3C 5CP3H 1S4IA 1CXLA 5DJDB 3UO8B 2OCCB 1AO7A 4P9HC 3VXTA 2NY3C 4PJEB 3QA3B 4I5BB 5JIIA 2IQAB 2X44D 1PYWB 5CILH 5J1AB 4X6CB 1AQKH 2H6PB 4LDEB 4YIQB 4JQXA 3BPLB 3PWJB 1U8OB 1AGBB 4AYFA 5C07A 5PAZA 2WW8A 1XCTA 2ENSA 3PAUA 1OAQL 3GBNH 5J06A 3TBBA 2AJYH 2FGWH 3EH1A 5EF3A 2BOBB 4E0RA 1WEJH 1ZV9A 2EH7L 3TVMA 1AKPA 2DMGA 2R1XA 3OQ3B 1YY8A 2MCPH 3BUBA 1UADC 3HC0B 4P9ML 3VRLF 2FX9L 2EUWA 3PJSB 3CLFH 3NH7H 4U2YA 3SGDH 3U0TB 4YS4A 3WTYA 4TLSA 2ZIDA 1Q0EA 4IK6A 2NX5E 2ARJB 1I7TB 2I26N 2NY0D 1NCHA 4LCIH 4WFFE 4WI2A 4XNYL 4TSCL 4OJFH 3CPUA 5CZVL 2EABA 3C6SB 1J9RA 4EE2A 2GBUA 1ZT1A 3BP5A 3DI3B 4KZ0A 5D2LB 1E9OB 3DGGA 2X2JA 5JUEL 1WUZA 1A6VH 3EHBB 3HZKB 3AS1A 4KXBA 5AVXB 2EDBA 1VADA 2HLFC 2O26U 4J27A 4OZHE 3UC2A 5J6GA 4FKKA 4MBOA 2CGRH 2N3JA 2F8VA 4AT6B 5IFAL 1CYGA 2CNZA 3LNDA 4YSAA 1M7DB 5AKVA 3SBRA 2J21A 1U36A 4LOEA 1UXLA 4LPTA 3O11A 3ARBA 1AO7E 4IU2A 3MLVH 1G7PB 3TF4A 3A67H 5DUMH 4KMTH 3ZDXE 4M9OA 3PJLA 4KHXL 5C07D 4BIKA 3CFDA 1QPXA 5JIDA 1IEBB 5HHNB 4DP4X 3RVTD 2AEPL 4DQOH 1CVRA 2XA8L 1A6ZA 3N0PB 4CVZA 1WS7A 4WWNA 4CMMB 3QYCA 4EDXA 2WVVA 3ZR5A 3LY6A 1LMIA 1NL0L 1C12B 1M2VB 2GFBA 2PWGA 2BVOA 3RVUC 3SYAA 5I0ZA 2XQYG 3IXAB 5D1ZD 4FG2A 3S2CA 3ILEA 3MLZL 1MHPH 1Z9SA 4DKEH 2A73A 4LPCA 5F7EH 2NY6C 4ODWA 4XAKE 3DX1A 3SBQA 1UFGA 4NZUL 2YJLA 1QHOA 4IJTA 2AABH 2UUDH 1QQDB 5DJXB 2JB6A 1L3NA 1RIHL 1PKQA 3MRPA 2WXNA 4MAUL 3FU7B 1LO0H 2P4AB 4FGMA 3VDCA 2BSSB 1IARB 3A47A 3ZL2A 4EJ1C 2RA1A 1DQKA 3HJEA 5F8RC 4FQIL 1TVBB 4DGUA 2OZ4H 2FO1A 1BLNA 4G9FD 4LL1A 2MWCA 2ILLA 3GXTA 3VXQA 1A5FH 2K45A 1GTNA 5IK3B 1JYNA 4JMNA 2A0LD 1NIFA 4Q6KA 2A7BA 5IEKA 1B6DA 1OAYL 2XXFA 3L5IA 3EUUA 2R7EA 3HMWH 3NACL 4F2MA 4RBPK 1EZLA 3ULSB 4OLEA 4PG9B 4AXWA 1K4CA 4ANKA 2JCCF 5H35A 3GSRB 1K3ZA 4K55A 3VWKB 4D9QD 3WGUB 4OKVB 1A6AA 3B9DA 2IPKA 4MCMA 3LH8A 2YQ2A 1XGTA 1XH2A 2VXTH 1MCDA 1Q9KA 2XT1B 1OL0A 5I1JH 1QYGH 4GSUA 5IFAH 5T5FH 1SUHA 3CSBA 3RQ3A 3W11D 3IYLW 3NZSA 1KBWA 3MRQA 5DT1H 3FQWB 3V5HA 3WKPA 2Z7YA 1ZEAH 2DKUA 3UDWA 3MJ7B 4AE1A 3SYCA 1OCRB 1ZANH 3K0WA 3BZEB 3ZTEA 3M7OA 1AC6A 2GTWA 1EUTA 3KH3A 1CO1A 3GKWH 5AAPA 1ACYH 1BD2B 2VLLA 1LP9E 2OQJB 4RWYL 3POCA 4PJXF 5BW7C 1MH5B 2GJ6D 4TVPL 3V0GA 3OKYA 5CLTA 2XQBH 3ATFA 1DP0A 2DQFB 3GDBA 5AL8A 1B9KA 2Z65C 4E42B 4MD5B 1NGPL 4I2XE 3DPBB 3WXWL 3IDYC 2V2TB 3SQBB 4AV5A 1Y0LA 4MMXC 1BEYL 5FYJL 4IOFD 3HOGA 2FWSA 2YD6A 3WIHA 3KXFA 3RB5A 4TVUA 1U3HB 3HPLA 4R5VA 3ARYA 5EFIA 2C9SA 4RNRB 4LASL 3APFA 4ZMTA 4AZ8A 4BKLB 2C1OB 5LNDA 4F8LA 4XMZA 3IXTB 5BW7A 1KCVL 4ATWA 4MJ4A 4F57H 4EQ2A 4CGTA 2PR4H 3MNVB 1KBBA 1AH1A 4P5KA 3P11L 3OAZH 1OM3L 4DGIH 5DD1H 2FR4A 4PLOB 4W9IC 4I2XB 3NZHH 5IOKA 2B8OT 1OWRM 3DRQB 2I85A 2A4EA 1QBAA 1OWWA 3KNBA 1ZWIB 4TULL 2XA8H 2AJSH 4HUUB 2P48B 3DJ9A 1SXSA 1WCBA 3HIZA 5EUKA 4HG4K 4M7JH 1U8KB 4YPGB 2YOCA 5HBBA 3V8OA 1P4LB 3IJEB 4HUMB 1JZGA 1I53A 4LBEA 1QSVA 4JAMA 4V1DB 3P0YH 3H53A 1GC1L 4X8GA 2FYYA 2NYYC 1KIQB 1C5CL 4K5NA 1E4WH 4PGCB 5DHVA 4CN6A 5HHQA 4L4VE 1S7QA 2X4QB 3E6FA 4APXA 4BRVA 3ULVC 2OFQA 2WCGA 4YDZA 2GB2A 2HFEB 2QPSA 1AQHA 2Q86A 4ZAKC 4ES8A 1QRNE 2J4WH 3QUML 1JP5A 3QI9D 4YXKH 2Y07L 1K8IA 2DQIL 4RMSA 5E4EB 2BP3A 2HFGL 4BJLA 1BECA 4EUPH 5L2KD 4LMQE 4NKOA 2A9BA 2ZSWB 4BWWA 3RDJA 3PWLA 3WJJA 5D70L 4Z7OF 4PWJA 2K9FB 3KJ6H 2ZWSA 3VM5A 2GEQA 2ZXCA 3D30A 5F89B 4IOSA 3VSQA 5EN3A 4BGDA 4ZO7A 2YAQA 3GXFA 5J8OA 2Y7OA 3ARDB 4P9MH 3HI1A 2X1PA 4POZC 1E8XA 2VDPH 1SHSA 3HVNA 5MHSD 4HMCA 2ADIB 1B9ZA 1WBXB 2ALAA 4TQEL 5DS8A 3HZMA 3Q6FB 3DRTA 3US1A 1BMWA 1TPXC 2GSGA 3KPLA 2NNAB 5JHDD 3H4FA 2DWEB 3S37L 3AAZA 5E8EB 3K1KC 3DXAD 4KRMB 3RWGA 5GGUB 2CCVA 2IFGA 5BRZD 5KVFH 4JRWA 5K1JA 1X5IA 2JMRA 1QA9B 5IBTL 5C0JB 4U1HA 3DDGA 2EDXA 1AE6L 4XPAL 3HNTL 1NBYA 5IESL 2NNCA 4XP4L 3L4UA 5LJYH 3RBSA 3VM7A 1EAQA 1KXTA 1IKNA 4M6NH 2KT6A 4I87A 4YK4C 3OBAA 1TZIA 2I7SA 1L7TH 3D52A 4MS8C 4NIKB 4HWEH 3RWCA 4TLKA 3RGBA 3ECWA 4FCAA 2ZD0A 2A38A 2GI7A 1TENA 5I6KA 4NGHH 3FAXA 4P2YA 2ZWNA 5EC2B 4JHBA 5I0YA 2GTQA 4X4XB 2VQTA 4NT6A 3AS2A 4A55A 2HZHA 2CM6A 5TFSH 3ESPA 4OLZL 1H3TA 4JKNA 4PHXA 2GSIB 4G1MB 1IEHA 2GK0A 4NC2B 5AW4B 3TM6A 1FH5H 2A6JB 4H88H 2WLKA 3VH8A 4LFHG 4K23L 2VLRE 4N0CC 2XETA 3K5RA 3KDMA 2QSVA 4GRWE 1S7XA 3KYOA 4C83B 2ZX9A 3WDHA 4IKLA 4Z5RA 2RMNA 1OB0A 2RGSA 2E7LA 1I1AC 3AY4C 3FTZA 2YRLA 4ZMAT 1DSFL 3FB8B 1RP9A 4ZQKA 2EDLA 4XNQA 3R06B 2HFEA 3FFDB 5GRUL 1N67A 3KNBB 1NCTA 3NRFA 3NA9H 4QXUL 2UXFA 3C09B 4MXQC 1I7RB 5AYQA 4DN3H 2IH1B 2FHBA 2JSFA 2BHUA 3BZ4B 4M56A 3FO2A 3F5WB 5MI0C 2YD0A 2YUXA 3N04A 1DSYA 4K3EL 5I19H 4PJAE 1HK6A 4X7FC 1T3FA 3WG7B 5A6LA 3LNIA 2WXGA 3B3IB 4QTHB 4WW2C 4ANVA 3PL6B 3F12A 2DY2A 4DP8X 1GS8A 3H9YA 5TDPA 4I0CC 2YFOA 4F33A 4L8SB 5FW8A 1ZA3B 4RVBA 1VGEL 2MPAL 3F6LA 2AQRA 1ZRUA 3GMMA 3GYRA 1P6FA 4YSQA 2K8QA 5FS5A 4Q52A 4XT1C 1FNAA 2W60B 3BPNC 5DC0A 4AUYA 3QRGL 2VDKL 5J12C 4RFEA 5F9WC 5GISL 1KB9K 1HKFA 2IFFH 1KF9B 3EH2A 3SDCD 1E6JL 1HHGB 4WW2F 2ZCHH 4IRSB 1RFDL 1T0PB 1WHOA 1WWAX 1UM5H 5EOTA 1BF5A 4L3CB 1U3HA 3C2AH 3LDBC 4M6NL 2YUWA 3HNTH 1VPOL 1JZDC 4X83A 2OL3H 1YAZA 3BKYL 3HUJB 1M3JA 2A5UA 3LKSB 1S7WA 3VXUB 2YKLL 3C6LC 4G6AC 3S98A 4K9EH 3C5JB 3TBVA 5TQ0L 1UWYA 1KENL 1Z5LA 3KLKA 5L8JB 1NCAH 1WFNA 3O2WH 4AM0Q 3QUYB 3R19A 2L8AA 1IT9H 2Y36L 5F88B 3WXVL 4QRRE 5F6IB 3VXMD 1IZJA 1TZOA 3VFGH 3KLLA 3MACH 1G1OA 1XXFC 1TTUA 5I0WA 4NOBA 3PWPB 3LRSA 4RGNC 4N0YH 3V52L 4IRSD 3UTSB 4C56E 2CO1A 4HUWB 2OJZH 3KEDA 1OOAA 2YK1H 4P2RA 3OB0H 2JJVA 4PG9A 4V2BA 4N2CA 3AACA 3OGCA 2F1EA 1CLYL 5AUMA 1BEYH 1BJ1J 3GS0A 3L3JB 2E76C 1T5XA 2GJ6A 3BWSA 4GFTB 1ZLWK 1DJHA 1RPKA 1FVEA 3SY0B 5FX3A 4A2GA 3CMOH 4XCFL 3FQRB 3TPKA 5C0FB 3QO0A 5DJ6A 1ZS8B 1DLHA 1H9DA 1CR9L 1BQLL 5TH2A 2BW4A 2X4NA 2XNAB 5ALBL 3BKCH 3V0JA 4KKAC 4DP7X 5HPMB 2Z31D 3HB3C 1ZLUK 1P1VA 3LSOB 4LIQE 4YMPA 2I69A 4YHLL 3I74A 2C3VB 2Y6SD 5E08L 3VNYA 3QJUB 2G9KA 3BVTA 4P99A 5IW1B 1H3PH 1FYTD 3ZE1F 1WISA 4C47A 5CU5A 3I3EA 4LSRH 1DQLH 1INEH 2HUHA 1C5CH 5DUPL 2WLHA 2BNRE 1NGWA 3O6LL 3JV0A 2PXYD 2VQ1A 1JNHB 5EIQA 3D09A 4QKXB 4POZD 1XDTT 5D2NE 5J4MA 2VLJB 5SWZB 5HVHB 1A7NL 2Q3AA 4AYMC 3BWZA 1DJWA 2CIIB 2CKBA 1RZKH 1HCYA 2VDOB 4HU2A 4JO4L 4F8NA 3K6SB 3K71A 2YBRA 3UTQB 4CU6A 3EFDL 4GAYB 4PGBB 5F7WC 1I7RA 3NGBB 4WGKA 5BVJB 4FP8L 1T03L 3ZDYB 1B2WL 2B39A 2OR9H 2QQKL 4WW1A 2NY1B 5MI0B 1MCPL 3QW9A 3FHEA 5IMOA 3NCYP 5IJVB 1MHEB 4Y5VB 4U1LA 3ZL4L 4MYPA 2XWEA 3V2AR 4EPSA 1BFVH 4UINH 4B5EA 5FF6B 4M7KL 2MOGA 3MV9D 4QRSB 2GJ6E 5I1IH 3GMRA 3EBIA 4XO5A 4JS7A 3RJOA 1X5FA 3BIKA 1A7QH 1MRCL 1CU4L 4WEBH 3WN5B 1F3JB 2OMXA 1J1OH 2XDHA 3MNZA 3OKNB 3MA7B 2B9AA 2OZNA 1L0YA 3JUZA 1ZT1B 4QXGH 1Z7JA 5EU3A 3S6CA 1FH2A 1EJOH 1UD6A 3IMTA 5F7UA 2AABL 3S3CB 4TVPH 4N2DA 4JFDD 5FKPB 4PTTB 4ZAKB 2XX0A 4L18A 1BZ7A 3QEGL 4H8QA 4JFYA 5IT2L 3OTTA 4QYOB 1Z9PA 4GBXC 1CI5A 4RAUB 5BQ7B 2J5LB 3B7YA 2ISDA 2V3EA 2XIDA 4X6FB 2BNRA 2A2QT 4R4ND 1LNUA 4YSEA 1ZANL 1T7ZA 2YGNA 4U1HB 5TE4L 4H0LC 4TV3A 2HLEB 3Q5TA 2IGTA 5AWNH 5D55A 1TFHA 3EJSA 2KKQA 4MX7B 1KXTB 3TJPA 1QUNB 5DK0A 4GAJL 4ORGA 4UDTB 2Y3AA 3T3PB 1V7NL 3KLSA 3WXVH 5C2BL 4NYLB 1FZKA 1SRDA 3CSFA 4WF7A 4J1UB 1UGNA 4G8IB 1AZBA 4ZYKB 2A9NH 1GCFA 3E8VA 4MNQB 4C54A 1Q9OA 2BRRL 1GL4B 3D3VE 3RA7L 3WIFB 2ROYA 1SJXA 3S4SA 1S3KH 3WLWD 1MQKH 2O5XH 3QORD 1RSFA 3FU5A 3NJFA 2MNJB 2Z31C 4QYOA 2Z6FA 5C07B 3WL9B 5IQOA 4K71B 4YFLF 3QDGE 4JN2B 4NJ9H 3WTUA 1RFDH 3UJIH 4OLWL 3QPKA 4KKLD 4JPKL 2BY1A 5BZZA 5TH2B 3GHBH 1E27A 5GZOC 4KJYB 1HWGB 3QUXB 4M62L 2EDTA 3H4HA 1J1XL 2WIIA 1ZSHA 4G8EA 1KJVA 1HNGA 1BF2A 2YZ8A 1T0NB 3TA3A 2YQBA 5CCJA 3B2UD 5ICXB 4YH6A 4ZDHA 3LEVL 3DA0A 4FNUA 5EWIL 1UC6A 1CFSA 3DTXB 4MQ7A 2Z31A 4DGVL 3QULA 2R23B 3QAQA 2X5PA 3FB5A 3FRPA 3BKJL 4GAAA 1MFDH 4RFNB 1RUPH 2IH3A 3FT9A 4IBLT 4KRPD 3WELA 1JNHA 3GBEA 4HOZA 1XMEB 4PRAA 3G6JA 3RWFA 3FCGA 2XICA 3D51A 2OTWB 3CFUA 3O45A 2MOVA 3LPOA 2VW4A 4J4PC 1CFBA 2V17H 1GMEA 1P5UA 2R9HC 3KD4A 1J7VR 3QDMB 4YJZL 1EEYB 3LRMA 2Q8AH 2F0CA 1NKGA 3G5VB 2HUEA 3H2PA 4I85A 3ESVF 4PJFA 3DXAA 1ZPLA 3C6LD 4G6AD 1IQDB 3ROOB 3EJTA 4YHKL 1BQKA 2DI8A 4JQIA 2E9IA 1A6PA 4MTMA 3RPBA 1BEXA 3JWNC 3MYJA 4U1MB 4KZEH 1B4JL 1I8KB 1O9VA 2J2ZA 2I5YL 3EGDA 4F8QA 4LRNL 4DZ8A 2VZOA 1E7UA 2VXUL 3FU0A 1UFUA 4JDZB 1SY6H 4FTVE 5K1VA 3SDCA 4YDIL 1RZKC 1XFPA 3JTSA 1DUYA 1YNTA 4AKQA 2G5BB 1EHXA 4GAGL 4JPSA 3HAEB 3T0VA 3D48R 2Q10A 4I9WD 1OSPH 1JI1A 4RGOH 5KSBF 3FO1B 5B8CC 1OQOA 4RRPA 4MMZA 4RDQG 2EO7A 3WFCH 4UT6A 2Q3XA 4JZNA 4Q56A 3TIEB 3CZEA 2KMWA 5IG7B 3PNWB 4JO3L 5KG9A 5DI8A 1DVFA 5A40E 3WKMH 3MRMA 2WYZA 2D2CC 2EIDA 2D3JA 4ORGB 4UDTA 5B7FA 3QBTB 2HTLD 1O6TA 3D0LB 5EZIL 3UTZA 1QFUL 3F7YA 3HG2A 1QFHA 8FABA 3HE6C 3ENEA 4PJGA 1CS6A 4IMKC 1ITBB 1ZLEA 5TTRA 4GXVH 3DWTA 4PJ9C 4KTGA 3GXIA 4EN3A 1WC7A 1YDPA 5IIEB 3MV9A 3SQRA 3RILA 3WI9A 1P2CA 4BFIB 1JPGA 2H26B 3WN6A 1Q94A 1I9EA 3LNGA 2IG2H 4F80A 3BP4A 3HHRB 2SODB 1DVFC 4QHNB 4HPHA 1GW0A 4NQCB 5KJRH 1QSFB 4F1ZA 1F1GA 2PXYA 3OZ9H 4ZMNA 5L9DL 2FEEL 3QH3A 3FQYA 1WZAA 2XN9B 4MDJB 5F9OL 5HGHA 2VWEC 4U6YA 4X5XB 1UH3A 2VTFA 2C4FU 4HH8A 4GQRA 1GC1C 2NY0C 4PJBB 5EOCL 3J7HA 3CK0L 3WAJA 4XCYB 2IAND 4MS8D 3VMNA 3QNZA 4HD5A 1GYAA 2C3GA 8FABB 2CK0H 4YFDB 4WW1B 4D7BA 4M5YH 2IPTH 3AG3B 1JGLH 1ZV2A 3AWFA 3GIVA 4OF7A 1I4FA 4XWGH 3MGTA 5AL0A 3U25A 3MZTA 4KFZC 1JV2B 7FABH 1B2YA 3IU3B 2JKRM 1WAPA 2BHFA 5IHZA 4R90H 3VX0A 4NCC1 1HEZB 2N0KA 2ZWZA 3BGFB 1B6UA 3ELAT 2R8SL 3BGAA 2PNDA 4YDJA 5DD6B 5BMFH 3MRPB 4F91B 1MFAL 4KKAD 4DEPB 3DK0A 1OM9A 5CJ8A 5KYWA 4M8RA 4MB1A 4PSPA 1BPVA 4Z0BL 3OJ2C 3QIUA 5HYQB 3U1SH 2Z91A 3A4FA 4Q9QH 1MOEA 3AU1B 3M6DA 1MY7A 1YQVH 3PYCA 4UNIA 1OF2A 3CQQA 3MGAA 4KZCA 4KQ4H 2IGFL 2R1YA 1KGCD 2DWXA 2Y9RT 3RY6A 2BY2A 3MO1A 4E5XA 4P46A 1WIUA 2W0FA 3ALXA 3UC0L 4AMWA 1MAKA 2OJ1A 3MODH 3EADA 3IGAB 4MJ5B 3MGOA 1IQDA 5TF1H 3VSTA 4E42A 3GGWB 4ELME 1E7VA 2O61A 3TBYB 1OP5K 3QHZH 3HI5L 4JO2H 4PJ5A 4XZ4A 4GT0A 1NFDB 3LQZB 4OZIA 1N6UA 3BT2H 2OYLA 2GC7C 4OCNC 1UG9A 1U30A 1T1ZB 4I4WB 1TJGH 3PF2A 4JHZA 5AW0B 3VI4B 5FOJA 1YYLL 4XHJC 5AW1B 2C7UB 5EF2A 4DAGH 3IFLH 1IBGL 1SJEA 4JFVA 1G5GA 3BAKA 4DW2H 1JXKA 2WIIB 5C0AA 4U1GC 4GQ9H 3LN5B 5E99L 4DKDC 1P4IH 2NW3B 1HDMA 2CM5A 4Z7UA 3Q13A 1A7OL 3KGSA 3C8KB 3P0YL 4H2CA 5G55A 3NPZB 3BFWA 4GS7B 4OM1L 5I1CH 4ENED 3U9WA 4LBEB 2Y69B 4MJ5A 5CNHA 2DYRB 4HWBL 3QRFM 3PHSA 2A6KB 1WFOA 1JHTA 4AIZA 1ED3B 1WUNT 3SB3A 4AVIA 2XWDA 2G60L 3GSOB 3PWPD 4RQQA 4L8DB 3RNKB 3OPZH 4JG9A 3SQOL 2BVUA 4DN4L 3IDNA 3MBED 4JFFB 4LARL 4FLOA 4JG5A 2YEZB 5H37H 1AZVA 4FXGC 1X5YA 5CP7A 3VXOA 1ZLWH 1H8LA 3HRZB 3OG6B 1JK9A 5DO2C 2H2PD 1HAUA 1NFIB 2EIZB 2IDQA 3IGKA 3IN2A 5CAYB 5CEZE 5EOQL 3FCSB 4FFWD 4E9VA 3P1VA 3F65A 5TF0A 2W81C 1GGBH 5EU5B 2W91A 4PWEA 4UDUB 4OFIA 2KZBA 4RMUA 4WFED 4CVXB 4FHJA 4AC4A 1DHKA 1RUML 2NTFB 1L7TL 3HBPA 4JRLA 1A1OB 5B4MD 3SKNB 3UG3A 4DP0X 4TNGA 4HIIB 1OSZA 1UZ6F 3QIWD 4N0UB 1SXCA 2DIBA 1J05A 2B4CC 3ZLQC 2ZNWA 1NOFA 5JIQA 5FA4B 1K5NA 2BP5M 4HV8B 4K4KA 5DLLA 1AP2A 1NCDL 3C5ZD 3QCTL 3AREB 2FLMA 1JGDA 3QDGD 4XBMA 5F7MC 2CA3A 3VXSE 2EDYA 4UU9A 3MNWA 4WTXA 1LP9B 1JE6A 3NAAL 4KKBD 1GZPA 2FUTA 1ZE3H 4MKTA 4DO5A 1JGVH 1ZLVK 1HWHB 5HI3D 4NQSA 4QAMB 2OMVB 2W94A 3D4CA 4L3EE 4X6CF 2PW1A 3FCSA 3L1OL 4D3CL 1A7PL 4PIRF 2CBMA 4XXCC 2PN5A 1D6VL 1RV6X 2VW6A 4CVXA 4FI8A 2B0SH 1E30A 3NACH 1VFBB 3F7RA 4TULH 2B59B 4HF5H 4HKBA 3U4AA 5DHXB 2YRZA 3UGUA 3L9EA 5JHDE 2IAAC 4A6YB 2YA2A 2MKLC 1DVFB 3TO4C 3A6CH 4XN9A 1NEZA 4PWGA 3H9SD 1ZIAA 1A3RH 3BPLC 4X6DE 2X12A 3IKCB 4WGVB 4LVNB 3B2XA 3NMEA 1CDGA 1QAWA 4EI0A 3GRBA 1AYRA 1CVSC 3IDXL 4LAJH 2ZPKL 5SV4A 5I1AA 5JOEA 4IBTA 4P2QD 2ZKHL 1KCSL 3MJ9H 4LARH 5JUEH 3NCCB 1OPGL 1KYAA 3CFKB 5I8KH 4XPBL 3G5XA 4TQPA 2VDLH 2J4WL 1AJ7H 3GSOA 1IGIH 2V5YA 4X80H 1T2QL 3QARA 5B1KA 3CDCA 1DO6A 4RMWA 1XCTB 2B08A 4ODSH 4J3VA 3WJMB 4ZUVA 1YG9A 3I50H 1MFNA 4RWYH 5HHPB 2BVPB 2QPFA 4KJQC 4D9RD 1TQSA 1K5WA 4M6ML 4XNZB 3FQ2A 5E9DA 4AXWB 4ZUSB 3QI9C 4TSBH 3U9UB 1XGZA 4CJ1A 2XQYA 5E2UH 2FECL 3MV7D 2GITB 3LKOB 2YK1L 2XACC 3WJJC 1O5PA 3HKZA 4NBYB 4Y5YC 4YHMH 4L29A 3PABB 4WHDA 4AGPA 2FJFA 4N6QA 3UYOD 1CFMA 1KJMA 4KH2A 4MDIB 4UQDA 1XGPB 1CDYA 1ES0A 4NO0B 4MA3A 2CO2A 5T1LD 3W9DB 4ZFOB 3UCRA 4WY7H 4JDVA 4C83A 4U1LB 5T1KB 4I7ZC 4OIFA 5SWSB 3FT1A 4UAOC 4UIMB 3H9SA 3FQ1A 4BQCA 4E41E 3E9UA 2ODHA 5GSRA 5T3XL 1A0QL 3PWVA 5IMMA 5AVTB 1E2ZA 4A66A 1NMCC 1ZSDA 1ECYA 3ASWA 3KYAA 3HUJA 1KGIA 3ZR6A 1PX3A 3ARED 4GKSB 5E6YA 4P3DA 1FFRA 3VMPA 1Q0XH 4PUBH 3RVXC 4JFXA 2BNQA 4BDVB 4QOKD 1U58B 4IS6B 4Q7DA 4UV7H 4YLQT 1IM9D 3E2HC 5I5RA 4M4RB 3RZCB 3SDXF 2IDSA 4NO0D 2ZCLL 1W72B 3OQRA 4HEPG 1IGJB 1DEDA 4GINA 2C3XA 2DEYX 3EO1A 4G9DB 4KY2A 3UBGA 3IE9A 4NZTH 4Z3IA 4ZFGL 5HI3C 3O2VH 4UQ2A 3VFNA 1NBCA 3FPYA 2OP4L 4BCYA 2ZOTA 4PBXA 4WUKL 1MVYA 5BMFL 5FEBA 4V1DD 2YN5A 4JM0A 3MAWA 1E8WA 3IJSA 5EU7E 2R51A 1QBLL 2ZKYA 1SDYA 3JV4A 5BUPA 5C0EA 3E7JA 4NQEA 4WCYH 4ZUWA 3JV6B 5IQLA 1NC4A 2CAKA 3U1QA 1DQIA 3PFQA 4N0RA 1F86A 3KS0J 4YL9A 4NWUH 5KSUB 1KCWA 4OGYL 2WXPA 3ATEA 4HALA 2YRBA 1R24A 4QHMB 5EO9A 2ADJB 3WFZA 1A6TB 4Y2NA 5D1QB 4LPXA 2ZUWA 3SGJC 4XAWL 5B4MC 2VC2B 4Y4FD 3RWEB 3VW3H 3PQYB 4JKWA 3WY4A 4GIPD 2CBOA 5FB8B 3AY4A 4QRSA 1R3JA 2YS4A 3BZFB 5H94B 5E1QA 4K7PH 1IFRA 3NK4A 5IVZA 1R75A 1MNNA 2VLLB 3HUJE 2XZAH 4BSVB 4EN3D 3P0GB 4YHML 2UWEA 3RGVB 1CBVH 1V10A 3KLHD 3FB6B 3GMPB 4E9TA 3UOAB 1OSZB 3L5XL 3E6HA 5IJVA 3C8HA 4PN6A 4WHYG 4RGND 1I8UA 5D71H 3TBYA 5BXFB 5DLML 3UP1A 4FQQA 2SEBB 4KO7A 1ZT4B 3OPUA 4GO9A 2EE6A 1YMMD 2YD8A 3BO8B 4NJAH 4X98B 5LG6A 2IOMA 1U92B 4J28A 5EULV 3QNXA 2FJHB 4ODSL 1DBAH 43C9B 1PKQE 1MCSA 1U8NA 5JXAH 4XH2B 3ISWA 4R7DA 1KTRL 3PFUA 4D8PA 1BM3H 1NFIA 1J88A 2EIZA 2H2SC 2R0KL 5GHWL 4U7MA 2WXRA 5C6TH 1KLGB 3P4OB 2A83B 3FCTB 4ZXBB 4F3FA 1TTRA 3BP7A 4LCWA 4XBPB 2UXTA 1NCBH 1WFUA 5C0GB 2QVFB 3MSPA 2NY2D 2QPUA 1NIAA 2XBDA 3AY2A 4U1JA 4NKIL 3T2NL 1MZYA 1GGTA 3VXQB 1QLEB 5KUMA 1NEZG 5LG1A 1IBBA 4NZFA 2NW2A 3RL2B 4JFFE 15C8H 3BWAB 1U3HC 1UD5A 2NY6D 4N2AA 1I1AB 3C8DA 4WFGE 1CDUA 5HI5C 4AZ8B 3SSGA 4BKLA 4LNVA 3T1FB 3ROOA 1UJTA 4PD4K 4UOJA 2MHAA 3MNVA 4P2AA 4X9GA 3GI8H 3MREA 4U1MA 4QHKI 3K1DA 1D6EA 3BCFA 1AG6A 1MLCA 4NN6C 2NR6D 5CFHA 1FL3B 2I07A 4EAEA 2DQJH 5C09D 4ZTPL 4EOWL 1A4JB 2IDCA 1M1XA 3BJLA 4PB9H 1AGFA 3WV0A 4R7DB 3GSQA 4JPWH 1MNUL 4BFKA 4EXKA 2WLIB 2ZP0T 4R4BB 5EDSA 3LKPB 4GRLB 1PZBA 4G83A 1YEEL 2EVJA 2H32A 4N8PA 5HHME 3X14B 4HXBL 2C5DC 3PWNB 4X99A 5IJKC 2J71A 2D7MA 4E41B 3V9CA 1HSAB 1SJMA 1WVZA 3EDEA 3S97C 2D7OA 3LS5L 4ZDHB 3I6KB 1R17A 2VDQL 5DUPH 2ZOLA 1JJUA 3WFHA 1NEUA 2VDRL 4UIKL 5I74B 5KJ4A 1CFQA 1TLMA 3T0AA 2ZP9A 1T80A 2CUMA 1C1EL 25C8H 2ED8A 2MSPA 3TOPA 2Q76B 5IGXL 1JZIA 1CTOA 1KY7A 1QACA 4W9LC 2XZQH 2QADD 4PJAF 1K8IB 5C0ND 1P0SE 1JPTH 5JYMA 1AXSB 3S7GA 5F7NC 1W80A 4N0UA 3FQWA 4LCWE 4F92B 2L3BA 3MREB 5DO8A 4ZO9A 3QUXA 3ARUA 2EDOA 2OK0L 3O2DL 1N4XL 5GZND 4M1CC 4NO2B 3L7FB 5IY5B 4KI5C 4F7PB 3Q1EA 2EADA 2X09A 1NWOA 4H0IA 4YGVB 4YSSA 2VXQH 1CYWA 1U3NA 2YAPA 4IU3B 3N55A 5EEXA 1UM4L 3IFNL 1H5BB 4S1DD 1NGXB 1TU2A 3REWB 3STZB 5FYKE 3S88H 4QPEA 1OM3H 1NCNA 1M56B 1Z3GL 4FN0A 3C09C 1OP5H 5KANI 3MRKB 2FB4L 4N90D 3GJFB 5DMIH 2EQDA 1KN4L 4E9WA 5B21A 3QEHA 3L13A 4CW1A 1GHFH 4HZLA 1VFUA 5EFIB 3DROB 2WP3T 2NY3D 1X4ZA 3MCG1 4IGBB 5EF0A 4HEPA 1VFBA 5GJTL 2DM4A 4FE9A 3L5WB 4IBYA 1SBSL 3HHSB 1QFUH 1B88A 4OVUA 4PGDA 2Z8RA 4JO1H 4L4VA 4WI5A 3PGFL 2WXHA 4U31A 4AV4A 3E9TA 2AW2A 3KVQA 4K7PX 4OFPA 5CLWA 3FOMB 1L0QA 2NSQA 1T21A 4K5PA 4KK6C 3LXBA 2LT9A 2V6HA 3ZE2F 1BQLH 1VKXA 4GQ9L 4WHYH 5E99H 2LE9A 1INQA 3KLAB 4ANXA 1BV8A 1CDIA 3NIFF 3B2VL 4FLSA 3QRBA 4AEEA 2L7QA 4YDIH 4W68A 4XNQB 1E8YA 3I9PA 5IVXB 1SYSB 4HXAL 5EC2A 4FZ8H 4NHUB 3BVXA 4CVZB 2NZ9D 4LSTL 5I76B 5HYSB 3V0VA 3DSFH 3ARWA 3UTSA 1U95A 5I6MA 2JIXD 1DO5A 1P9MC 1RJLB 2VUYA 3TN0A 3V4VH 4BZYA 5ADOL 3I3BA 5I71C 3EXJA 5SWSE 2ERJC 3ML9A 3TTYA 2HT4C 3QUMB 4E5XG 3ZHDA 2NNXA 3D85D 3IDMA 2FX8L 3W0WA 5DC4B 3T4AA 4DN4H 3IFPB 1MCPH 3WLBA 1YECH 2HH0H 3I84A 1WDAA 5DDHA 3N1PC 2CDFA 3SPCA 3A21A 3UIZA 5HHOD 5IHWA 3DNKA 1Z0NA 3N1QC 3D0VA 2J1YA 4M6OL 4AQAB 3SKOB 3WD5L 1OT1A 1TVHA 3G08B 4HPYL 3BP6A 1OCWH 2D4DA 2C3VA 5KVDL 4NQQA 1SHXA 3RPIA 3NDYE 3QHFH 1N6QH 4NNXA 3SDAD 5SV3A 2NXZC 1WWBX 3QORB 1NGPH 2E86A 2TAAA 2YD9A 3DUUB 2P5EE 3LQAH 4G8FB 4PS4H 3UTTD 1YEIH 5FA3B 3B9KD 4ZMQA 1PJ9A 3QO1A 5I8OH 4GG6E 1NGZA 2PWHA 5GZOA 3Q48A 5C9JB 4HJUA 1LD9A 4X6CA 2XQYK 3JWOH 5DD5H 1CT8B 2B2XH 2VLKD 3MRFA 3W5NA 4FYTA 5I1DA 3CZUB 2A1WH 4XOAA 4LVOB 3IAPA 4NQDE 5F0MB 2JJSC 4XVSL 4F37K 1DVSA 1LJMA 1MFCH 3RVWC 4OGQC 2H9GA 4LOVA 4HCRL 4KI5F 3EZ8A 5J13B 3EHBC 1WLHA 1UTDA 4Y8DC 1QEWA 1S9YA 4G70B 1S9KC 2Y2WA 5CWSA 5GPRA 4MQXC 4A2MA 4BH7A 1G4MA 2VN5A 4N2KA 3W0WE 1OB1B 4MNHA 5HDBE 1LDPL 4DESA 3NN8A 1W15A 3UYRH 2AANA 3OR7B 3SE3C 4QCIA 2CUIA 1YY9C 3D9AL 4LP5A 3TEYA 1LDPH 5CKAA 3T2NH 2ZJSL 3MACL 4JPVH 1HXYB 4KTEL 1Q0YH 2FATH 1N0LA 1W0WB 1MRDH 5EH1A 3LPWA 1ML0A 2Z8VC 3RDTD 4UI2A 1VGKA 2VAAB 4XNYH 4GAFB 3EDJA 1HHJA 2IC2A 3VFTB 5AOZA 4FNPA 2G3MA 3IMSA 3MCKA 4AKOA 2JLLA 1QHQA 4BH8A 1AZCA 4ODUB 4UTAA 4WI3A 1G7QB 1ESOA 1K4CB 3ZKQD 1FQ9C 4G71B 3BEWA 4RETB 5D96B 3F7PC 4PSRA 3Q43A 1HH9A 4ZW3A 4JFWA 5EWIH 3T77B 3V4PB 5C0RL 3RNKA 1VFAB 4QYAA 4XPAH 4Z7WB 3B8YA 2DYPB 5G5DA 4TVPD 2WKLA 4OIBA 3PL6A 5EU4A 5DJ0A 3QJFA 3JVGA 1IBGH 4DW2L 2NY4B 1YQ2A 4NQDA 1CLOL 1ZA3A 2EO9A 4Z7QE 4OCSH 2YLHA 1KIUA 1FO0B 1JXGA 4FL4B 1GMIA 4JJHA 4G2AA 3HE6A 3BI9X 3GINA 4S1DC 5D7IA 1HDMB 3QCUL 4L4VD 1N64L 4QRRA 1J8RA 4K3EH 3P4MA 2LFEA 2VITA 4KI5D 4TQEH 3NPSB 3ZYZA 2X9WA 5I1GH 1KJ2H 3CN1A 2X70B 1I3VA 5F1NB 3WNIA 2AQ3A 4Y9GA 3EBHA 3MA7A 1QWHA 1OZUA