5D29A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a hydroxamate inhibitor jhu241
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
695
structure length
686
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unprecedented Binding Mode of Hydroxamate-Based Inhibitors of Glutamate Carboxypeptidase II: Structural Characterization and Biological Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 266
structure length 686
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2015-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 5d29A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5d29A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5d29A02
4A37A 4Q7AA 5HVGA 1CPSA 1ARMA 4TJXA 4ZI6A 4MCQA 2EK8A 2ZEMA 1VHOA 2ZELA 3ISXA 3B3WA 4C99A 3N5FA 4ZY1A 2IQ6A 3TX8A 1AMPA 4KNGE 3LWUA 1LFWA 4PPZA 3BXMA 4LQGA 3VH9A 4C8TA 1CBXA 3RBUA 3B3VA 1ZG8A 2JEWA 1R43A 3WT4A 4F8ZA 4P4BA 1UWYA 2ANPA 3K9TA 4C8FA 1VIXA 2XEJA 1DE4C 1Y9ZA 5LRGA 6CPAA 1Y7EA 1H8LA 4MHPA 2Q51A 2WYRA 1BLLE 5HVHA 3I6SA 4NJQA 5I4MA 1VHEA 3S9MA 5CBMA 1IGBA 3VARA 3GLJA 3PB9X 3S9LA 5J1QA 4TNUA 3SI2A 5D29A 4OC2A 2DEAA 3VTAA 1HEEA 1HDUA 3CDXA 2ZEHA 3EIFA 2V8DA 4BD9A 3PB8X 4NJRA 1YLOA 4B6ZA 4P4FA 3BI0A 2XEIA 3NA6A 3KASA 3D4UA 5LRKA 3V7ZA 3WC5A 5CPAA 1ZLIA 7CPAA 2ZEOA 2ZEDA 4YWYA 3B2YA 4P4JA 4C8PA 3IEHA 3GUXA 1F2PA 2CIJA 3T8WA 4FAIA 4WWVA 2PJBA 1R3NA 1QQ9A 3IC1A 3I1UA 4DUKA 1VGYA 4OC1A 5IB9A 3B3CA 3H8GA 3GB0A 4C9UA 1F57A 2PJ5A 4CDKA 5LRJA 3RAMA 5JH9A 1Z8LA 4MRIA 4MMOA 4PQAA 2GLFA 3KQZA 3KZWA 2RB7A 2PJ1A 2GREA 4ZX9A 4A94A 4UEZA 3SI0A 4JZ0A 3MN8A 5K8PA 4UEEA 1ZG9A 3PEIA 3CPXA 3KI9A 1CP7A 3FEEA 5THWA 2PJ3A 3FF3A 2ZEEA 2O53A 2CF4A 3ISZA 3KHXA 3FX6A 2ZEPA 4MHNA 1ARLA 2Q43A 3KGQA 8CPAA 4YN3A 3KL9A 4OC0A 2EK9A 1AYEA 4X3RA 1LANA 4CDJA 4O23A 4NGRA 2AFMA 2PJ2A 3L2NA 4MHZA 4OKOA 4YU9A 4P10A 4F9UA 1ZLHA 5K8MA 3D7FA 2ZOGA 2BOAA 4Z65A 1DTDA 5DS0A 2JBJA 3CPAA 4FUUA 2IMOA 2AFUA 3WC7A 2PJ9A 3IFEA 1TF8A 2PIYA 1BPMA 4R7MA 2EWBA 2BCOA 2F7VA 1LAPA 2QVPA 1EE3P 4FBEA 3IJ3A 4C9VA 1FT7A 5HVFA 2RFHA 1RTQA 4NGSA 4ZX8A 4IAVA 3FEDA 3FJUA 2VL1A 2GLJA 4UF4A 1CG2A 4P4EA 4MXUA 3MRUA 2PJ6A 1TF9A 3PFOA 4EMEA 4F9VA 1TKHA 2V8VA 3D7HA 1QMUA 2J9AA 3RZAA 3PB7X 3FECA 4R76A 1XMBA 2PJAA 4OIWA 4ZY0A 2PJ8A 1YMEA 2CTBA 3JRUA 4EWTA 3HLPA 1YSJA 1Z5RA 3H8EA 3QNVA 4PXEA 2PVWA 4X8IA 3PBEA 1OBRA 1PCAA 1ELLP 2OR4A 3DLJA 3KQXA 3NH4A 4C8CA 3D66A 1GYTA 2POKA 2Q4ZA 3PBBA 2PRQA 1Z2LA 2PCUA 4AXVA 4R6TA 1HDQA 4UIBA 4P44A 2IJZA 2I3CA 2AFWA 1XFOA 5LYLA 4OC4A 4G1PA 4P4DA 4W9YA 3BHXA 2GU2A 1XBUA 4MCRA 3IO1A 3PRTA 4MCPA 1V6CA 1CPXA 4C85A 4NFRA 2V8HA 3IWWA 2O4HA 4P45A 2QJ8A 3PB6X 4NGQA 4NGNA 1YW4A 2ZOFA 4EFDA 2WZNA 4OMEA 1IY7A 3D67A 4H2KA 3ICUA 3SJXA 4C9RA 2ZEGA 3NFZA 1XF1A 4C84A 4DJLA 2V77A 4IHMA 2XEFA 3FH4A 3NH5A 4UEFA 2F8HA 1CX8A 3V38A 5LYIA 5F09A 5K8NA 4C8UA 3SJGA 4ONWA 1NSAA 1Y0YA 4TWEA 1ELMP 3IIBA 3H8FA 4OC5A 1LCPA 4ZY2A 2AFXA 3TC8A 4MCSA 3B7IA 4PXBA 2HB6A 4KSIA 2BO9A 5JM6A 4R8FA 4DYOA 1XRYA 5LYFA 3S9NA 3WC6A 3D7GA 2XEGA 2ZENA 1LAMA 4P6YA 2NSMA 4C8AA 4NGTA 4PXDA 4FWUA 2PIZA 2ZEFA 1KWMA 4A39A 1BPNA 1FNOA 4UIAA 5LYDA 3NH8A 1JQGA 3HUVA 2PVVA 3I74A 1TKFA 1BAVA 3K2KA 2PJ7A 4OP4A 2AFSA 4JYWA 4GM5A 4PXCA 4RUHA 3PB4X 1TXRA 3PFEA 2PE3A 3D7DA 3FVLA 4TJVA 3SJEA 3KR5A 3B35A 3VATA 1Y0RA 4NGMA 4ZYQA 2C6GA 4C86A 1CP6A 2ABZA 2V8GA 3DGVA 4IK2A 2FVGA 4X2TA 2PJCA 5K8OA 4C9AA 3KHZA 2AFOA 3D68A 1TKJA 4OC3A 1F2OA 1LOKA 4P4IA 1XJOA 2AFZA 1Q7LA 2NYQA 2JBKA 1ZG7A 2CTCA 3BI1A 2OOTA 3SJFA 4A38A 4OIDA 4C9EA 5ELYA 3B3SA 2PJ4A 2HC9A 2C1CA 3SI1A 4K3NA 4CPAA 5HXDA 2C6CA 4WJBA 3KR4A 3FMCA 3WABA 1PYTB 3LMSA 5JGFA 3B3TA 2QYVA 3CT9A 2G9DA 5D8NA 1WVMA 2PJ0A 1M4LA 4NGPA 2C6PA 4MHYA 1YW6A
chains in the Genus database with same CATH superfamily
4A37A 4KUBA 3MGDA 4M85A 2OZUA 3K4IA 4Q7AA 5HVGA 1ZL0A 4E94A 2Z0ZA 1CPSA 1Q2DA 1ARMA 1IYKA 3H5ZA 1XOVA 2VZZA 4TJXA 3GKRA 3JUWA 4ZI6A 4QUSA 4MCQA 1EO0A 2EK8A 4B11A 4CGOA 4CYPA 2ZEMA 4E0AA 1VHOA 1IOIA 2HUZA 1PUAA 4PSXA 2ZELA 3ISXA 4PK3A 2XPOA 3OAKA 2FE7A 3B3WA 4C99A 2I00A 1EZBA 3N5FA 3PP9A 4B5PA 2IQ6A 3TX8A 4ZY1A 1YGHA 3BUNB 1AMPA 3LWUA 1LFWA 4PPZA 3BXMA 4CAVA 4KNGE 3T0TA 4E5SA 4LQGA 2X7BA 3VH9A 4F0XA 5F49A 3RBUA 1CBXA 4UWJA 1YLEA 3VWEA 1R57A 1ZG8A 3B3VA 4CS0B 4GPLB 1R43A 2JEWA 4MI4A 3WT4A 4QVTA 5F5XA 3P2HA 4P4BA 2CY2A 1UWYA 2ANPA 2GE3A 3K9TA 4GS4A 1VIXA 2XEJA 1DE4C 1S7LA 4JD6A 3N7ZA 4Y49C 1Y9ZA 5I0CA 1ZRSA 5LRGA 2Y1NA 3D3SA 2P6GA 1Y7EA 1H8LA 3CZXA 6CPAA 2QMLA 4MHPA 2Q51A 3R1KA 4CZ1A 2D4OA 2WYRA 3T05A 2ZW4A 4KLVA 1S3ZA 4HKFA 1BLLE 5HVHA 3BJ7A 4R3LA 3C8OA 3GIUA 4KOSA 5DWNA 1JDEA 3I6SA 4NJQA 3CXQA 5I4MA 1VHEA 3S9MA 2CNTA 4FD6A 4KOXA 4EFDA 2R7HA 3T90A 1IGBA 1QSRA 3VARA 5CBMA 3GLJA 2FXFA 4M6GA 4CYOA 3PB9X 5C82A 4EYSA 3NE8A 4H89A 3S9LA 5J1QA 3NE7A 4AVAA 2ZXVA 3CXPA 3TTHA 2FT0A 2I79A 5HKZA 2KCWA 4JXQA 4TNUA 3SI2A 1VI4A 4E2AA 4CRZB 1CM0A 3C26A 3GYAA 4UFXA 5F13A 5D29A 4OC2A 1Z9EA 1K4JA 2DEAA 4OLLA 4CGPA 1HEEA 2DPTA 1HDUA 3W91A 3CDXA 5ISVA 3VTAA 2VEZA 2ZEHA 3EIFA 1B47A 3F9KC 4U9YA 2V8DA 2G3TA 3VROA 2OH1A 4BD9A 2YNCA 4KZTA 3PB8X 3VRRA 1YLOA 2EUIA 4NJRA 2K5TA 2B0AA 3ZZIA 2HI6A 4B6ZA 4P4FA 4UBRA 3BI0A 2XEIA 4JVOA 3NA6A 2CNSA 3IWEA 4CAEA 3KASA 2P0WA 3TO9A 3D4UA 3DNSA 3FIXA 5LRKA 1J4JA 3DR6A 3EXNA 1I1DA 2HWGA 2J8MA 3F5BA 4IUSA 3V7ZA 4XPDC 5CPAA 3WC5A 4IIXA 1ZLIA 3LODA 2IL4A 7CPAA 3OB2B 2ZEOA 1BXRB 1IIDA 4ZGYB 2ZW5A 2ZEDA 5HKWA 3FBUA 4CGMA 4JWPA 4YWYA 1T36B 4KOYA 3B2YA 4P4JA 4KS9A 4CAXA 4M6IA 5EC4A 2E28A 4C8PA 3IEHA 3F0AA 4MY0A 2ODFA 3GUXA 1F2PA 2CIJA 2FS5A 2PQ8A 4KOTA 3T8WA 4WWVA 3ZJ0A 4FAIA 2C5QA 2PJBA 1R3NA 1QQ9A 1MJAA 3I1UA 3IC1A 4HNYB 4A30A 5IV0A 4DUKA 1VGYA 4OC1A 2Z3NA 4B10A 5IB9A 3B3CA 3H8GA 3GB0A 4C9UA 1F57A 2PJ5A 4K30A 4CDKA 3TOBA 5JQ4A 5LRJA 3RAMA 4C68A 1S7FA 1Z8LA 3OWCA 4RN7A 5AG5A 4MRIA 4XNHB 5FVJA 5A27A 3T5MA 4MMOA 4PQAA 3OB1B 2GLFA 3D2PA 1J3LA 3KQZA 1R61A 2AUMA 4YFJA 1TIQA 1LRZA 3FRMA 3KZWA 2FIAA 5DWMA 2RB7A 3PLFB 1XEBA 2PJ1A 5HMNA 4XPDB 2G0BA 2VKZG 5HH1A 4F6AA 4NF1A 1NE9A 2XPPA 1RO5A 2GREA 4J3GA 4ZX9A 2PRBA 4A94A 1IYLA 3SXNA 1C30B 5JVLA 1KBLA 4UEZA 3SI0A 2G3AA 4FD7A 4JZ0A 1YVOA 1JDBC 3MN8A 2DXQA 4B12A 2B58A 5K8PA 4UEEA 1ZG9A 4EVYA 3PEIA 2ARHA 3CPXA 2DF5A 3FB3A 3KI9A 4KVOE 1CP7A 4PK2A 3FEEA 5THWA 4QBJA 2PJ3A 4NSQA 5H86A 3FF3A 2ZEEA 2O53A 3TT2A 2CF4A 3ISZA 5F1YA 2Z3KA 5AXIA 4NEXA 4ZBGA 5KTAA 2EZAA 3KHXA 3FX6A 1B87A 3IWGA 1RXTA 3P2FA 4Y49B 2ZEPA 1M1DA 4KSAA 2Q4YA 2NMTA 2R82A 1UFHA 5IR2A 1X10A 4MHNA 1ARLA 2Q43A 1JWQA 3KGQA 8CPAA 4MFQA 3TLEA 4YN3A 3KL9A 4OC0A 2XPNA 3SXOA 2EK9A 1AYEA 2GIVA 4X3RA 4QC6A 4A4CA 1LANA 1KUYA 2VI7A 4O23A 4CDJA 4NGRA 1Z9UA 2AFMA 2PJ2A 3L2NA 4MHZA 2Y1MA 4OKOA 4YU9A 3F8KA 4P10A 5EMIA 2CBLA 1ZLHA 4E8OA 3FNCA 4F9UA 1M4GA 4C8TA 5K8MA 3LACA 3BJ8A 2VBQA 3D7FA 1Q2CA 4H6UA 3S6FA 1A2ZA 2ZW7A 2AUNA 1Z4RA 2ZOGA 5KTDA 2B5GA 2BOAA 3WR7A 2UV8G 3PGPA 1DTDA 4NCZA 5DS0A 4Z65A 3EZAA 2JBJA 2OLSA 3CPAA 2IMOA 2AFUA 4FUUA 4PV6A 3R96A 3WC7A 2PJ9A 2Z3MA 3IFEA 3BUWB 3EO4A 4HPSA 5JH9A 1TF8A 2P6EA 2PIYA 1BPMA 4RR2B 2CNMA 2B5GB 4R7MA 2EWBA 2BCOA 2F7VA 5G1ZA 1LAPA 2QVPA 1V0CA 1GGOA 4UCMA 1N71A 4HNWB 1YQEA 1EE3P 2R8VA 1CJWA 2BSWA 5FD8A 4FBEA 1Z8XA 3IJ3A 2YNDA 4C9VA 1FT7A 5HVFA 1IICA 1NMTA 3S6HA 5H84A 2AJ6A 2RFHA 1RTQA 4NGSA 3PZJA 4ZX8A 4IAVA 3S6GA 3FEDA 3FJUA 3V8IA 4CGLA 2VL1A 2GLJA 4JXRA 4UF4A 5G21A 1Y9KA 3SHPA 4CAWA 4KVXA 1Z8WA 2B3VA 2JLMA 1GHEA 2BEIA 4CO9A 1CG2A 4YGOA 4P4EA 2BL1A 4MXUA 3MRUA 5JPHA 2Q04A 1QSTA 2PJ6A 2YNEA 2JDDA 3PT1A 1TF9A 3PFOA 3RYOA 4AVBA 4EMEA 1TKHA 4F9VA 2V8VA 4J0NA 4R57A 3D7HA 3VRNA 2Y0MA 3G23A 1QMUA 4KVME 4U5YA 2J9AA 3OP0A 2Z11A 5G20A 3RZAA 4MJXA 3G3SA 3PB7X 3FECA 3DDDA 4R76A 3TO7A 2A4NA 1XMBA 2PJAA 5G22A 1VHSA 4OIWA 1ON0A 4A32A 4ZY0A 2PJ8A 3UY5A 1WWZA 1YMEA 2CTBA 2FIWA 2X0SA 3JRUA 4EWTA 1WK4A 2DIKA 2DPSA 2VQYA 3VRPA 2O28A 3HLPA 1YSJA 5IB0A 1YR0A 4KLWA 1Z5RA 3H8EA 4M3SA 3QNVA 4PXEA 1NBWA 1IOFA 2Z3LA 2QECA 2PVWA 4XPKA 1S5KA 4X8IA 3R9GA 3PBEA 1OBRA 1PCAA 4RS2A 1ELLP 4YRHA 2OR4A 5F47A 3DLJA 3KQXA 3H4QA 3NH4A 5AG7A 4C8CA 3D66A 1GYTA 2POKA 1CS0B 4MY3A 2Q4ZA 3R9EA 4BPUB 1FY7A 1BOBA 2GFQA 2PRQA 3PBBA 2EBJA 1Z2LA 2D4PA 2PCUA 4AXVA 4M8DA 2ZW6A 2FL4A 2VXKA 4R6TA 1HDQA 1VKCA 2EO8A 4GXHA 4UIBA 1KC7A 5J8FA 4LQ6A 5A28A 3HPGG 1QSMA 1M44A 2HV2A 4C2YA 5BWAB 2B3UA 3ZNIA 1S7NA 4P44A 3EFAA 2PC1A 2IJZA 2AE6A 2I3CA 2JEVA 2AFWA 4PSWA 1XFOA 1S60A 5LYLA 4OC4A 3U88C 4G1PA 5EBVA 3T07A 4P4DA 4W9YA 3QAHA 4QB9A 2H5MA 3BHXA 2GU2A 2PSWA 4C2ZA 2EVNA 3JTKA 1XBUA 4MCRA 3IO1A 3PRTA 4MCPA 2OB0A 1V6CA 3W6SA 4BBHA 5BY0A 4XPLA 1YREA 2ATRA 3CXSA 4MBUA 1CPXA 3D8PA 4UFWA 4C85A 4NFRA 4RI1A 1KUXA 2V8HA 3IWWA 3FXTA 1KEEB 2O4HA 4IIYA 4P45A 1Y7RA 2QJ8A 3PB6X 4BPXB 4NGQA 4MHDA 4CYNA 4NGNA 1YW4A 2ZOFA 3G8WA 2WZNA 4OMEA 1IY7A 3W6XA 3D67A 4KSFA 4AG9A 1MJ9A 3BLNA 4H2KA 4A95A 4CGNA 4C8FA 1VBGA 4COGA 1MJBA 3NFQA 4MFZA 4BMHA 3ICUA 3SJXA 1KUVA 1Z4EA 4C9RA 1NSLA 4B5PB 1S7KA 2ZEGA 3GY9A 3NFZA 4DNCA 3B8GA 1XF1A 4MFJA 4C84A 1SQHA 2Q44A 1P0HA 4HNXB 2WUUA 3A9LA 4DJLA 2V77A 1YX0A 4I49A 4IHMA 2XEFA 3FH4A 2N3AB 3NH5A 4UEFA 4AVCA 3TLZA 2F8HA 1CX8A 1YVHA 2Q4VA 3TLAA 1I21A 3V38A 4UCNA 1PU9A 5LYIA 5F09A 1XMTA 4IF5A 2YJTA 3GJZA 5K8NA 3EZEA 4C8UA 3SJGA 1MK4A 4ONWA 1NSAA 2PR1A 4A4BA 1Y0YA 4TWEA 4JJXA 1ELMP 3E0KA 5F46A 1U6MA 2EZBA 3IIBA 4CAFA 3TFYA 5J8CA 3H8FA 5AG4A 3TLBA 4OC5A 1LCPA 4NXYA 4ZY2A 1VBHA 3TO6A 1L0CA 2DLAA 3TLGA 1QSNA 2AFXA 3BUXB 3FYNA 2XPLA 3TC8A 2YJVA 3BUMB 4MCSA 3B7IA 4UCPA 5K99A 4COBA 4PXBA 2D0PA 3TYXA 2HB6A 3I9SA 3IU2A 4U9ZA 1CE8B 3TLCA 4KSIA 2BO9A 3DR8A 3VGOA 1Q2YA 3RO0A 4KOWA 4R8FA 4DYOA 5JM6A 2J8NA 1NXJA 1XRYA 1P4NA 5LYFA 3S9NA 2CXAA 5F9MA 4KUAA 3WC6A 5AGEA 3D7GA 1Z8TA 4H6ZA 2XEGA 2ZENA 1IU8A 1LAMA 4P6YA 3HPHE 2NSMA 4C8AA 4JLYA 4NGTA 3I3GA 4PXDA 2D0OA 2B4JC 4FWUA 2R98A 4LX9A 2PIZA 4F0YA 3QB8A 1IB1E 3U1BA 2ZEFA 2R1IA 3SR3A 5JYBA 2F5IA 4OADA 4BINA 1KWMA 4LUAA 2P6FA 4A39A 1B6BA 1BPNA 2YGWA 1FNOA 4L8AA 4UIAA 3NH8A 5LYDA 2FM4A 5C88A 1JQGA 2OZGA 3R9FA 2OU2A 3VRQA 3HUVA 2PVVA 4Q36A 4INJA 2B4BA 3I74A 1TKFA 1BAVA 4FD4A 1EZAA 3K2KA 4OAEA 1DIKA 1M6VB 2PJ7A 4CYQA 2Z3OA 3VWDA 4OP4A 2AFSA 1M4IA 4JYWA 3TLGB 4GM5A 3S6KA 2REEA 4H1HA 4F8ZA 1YVKA 3D2MA 4R87A 4PXCA 4RUHA 3PB4X 1TXRA 5E96A 3PFEA 3LD2A 2PE3A 3TOAA 1X12A 3D7DA 2FSRA 1AUGA 3FVLA 5IX3A 1Y9WA 4TJVA 3SJEA 3KR5A 4A31A 2GANA 2FCKA 3B35A 3IGRA 3TCVA 3VATA 1Y0RA 2OZHA 3HMJG 2C27A 4KORA 4A33A 4NGMA 2HROA 5KTCA 1FBVA 4MFKA 4ZYQA 3TLYA 2C6GA 4KOVA 4B13A 1Q5XA 4C86A 1CP6A 2ABZA 2V8GA 3DGVA 4C7HA 2YNCC 2Q0YA 2QIRA 1KZFA 3R95A 2MP0A 1WJTA 1XF8A 4FD5A 2EZCA 5HKYA 1QSOA 4IK2A 2FVGA 2B4DA 3JVNA 4X2TA 2PJCA 3DSBA 5K8OA 4Q38A 1ZYMA 3BUOB 4C9AA 3KHZA 3RNZA 2AFOA 4L89A 3D68A 1TKJA 3EY5A 3T9YA 4MI1A 2ZPAA 1XE4A 4OC3A 3KRVA 3TE4A 4C7IA 3EC4A 4BPWB 3O8ZA 3K9UA 1F2OA 1LOKA 4P4IA 2B4DB 1XJOA 2AFZA 1Q7LA 2NYQA 2JBKA 1BO4A 1ZG7A 4BTFA 2CTCA 2VZYA 2WPXA 2Z10A 3BI1A 2OOTA 2WPWA 2PR8A 3QAYA 4B14A 4MJ8A 5AG6A 3SJFA 4A38A 4AB7A 4XNHC 4OIDA 4UWIA 5F48A 4C9EA 5ELYA 3B3SA 2PJ4A 2HC9A 2Q7BA 2Z3PA 5J3XA 4AG7A 1A9XB 2C1CA 2HQYA 2J8RA 3KKWA 2PCNA 3SI1A 3IU1A 4A2ZA 4ONUA 2RC4A 4ORFA 4K3NA 4MFPA 3EZBA 3NOJA 4CPAA 5HXDA 4B5OA 2C6CA 4WJBA 2BUEA 3KR4A 3FMCA 3WABA 2GP4A 1PYTB 3LMSA 5JGFA 4KOUA 3B3TA 2QYVA 4X5KA 3CT9A 4R3KA 2WSAA 2PDOA 2G9DA 2REFA 4R9MA 4C2XA 5D8NA 1OZPA 1ZO0A 1I12A 2PJ0A 4CRYB 1WVMA 4MFLA 5GCNA 1M4LA 1M4DA 4NGPA 4M6HA 2C6PA 1XIXA 2Q7SA 4UA3A 5CNPA 4UFVA 4MHYA 4II9A 1YK3A 1C3OB 1YW6A 2JDCA 3PFVA
chains in the Genus database with same CATH topology
4A37A 4Q7AA 5HVGA 1CPSA 1ARMA 4TJXA 4ZI6A 4MCQA 2EK8A 2ZEMA 1VHOA 2ZELA 3ISXA 3B3WA 4C99A 3N5FA 4ZY1A 2IQ6A 3TX8A 1AMPA 4KNGE 3LWUA 1LFWA 4PPZA 3BXMA 4LQGA 3VH9A 4C8TA 1CBXA 3RBUA 3B3VA 1ZG8A 2JEWA 1R43A 3WT4A 4F8ZA 4P4BA 1UWYA 2ANPA 3K9TA 4C8FA 1VIXA 2XEJA 1DE4C 1Y9ZA 5LRGA 6CPAA 1Y7EA 1H8LA 4MHPA 2Q51A 2WYRA 1BLLE 5HVHA 3I6SA 4NJQA 5I4MA 1VHEA 3S9MA 5CBMA 1IGBA 3VARA 3GLJA 3PB9X 3S9LA 5J1QA 4TNUA 3SI2A 5D29A 4OC2A 2DEAA 3VTAA 1HEEA 1HDUA 3CDXA 2ZEHA 3EIFA 2V8DA 4BD9A 3PB8X 4NJRA 1YLOA 4B6ZA 4P4FA 3BI0A 2XEIA 3NA6A 3KASA 3D4UA 5LRKA 3V7ZA 3WC5A 5CPAA 1ZLIA 7CPAA 2ZEOA 2ZEDA 4YWYA 3B2YA 4P4JA 4C8PA 3IEHA 3GUXA 1F2PA 2CIJA 3T8WA 4FAIA 4WWVA 2C5QA 2PJBA 1R3NA 1QQ9A 3IC1A 3I1UA 4DUKA 1VGYA 4OC1A 5IB9A 3B3CA 3H8GA 3GB0A 4C9UA 1F57A 2PJ5A 4CDKA 5LRJA 3RAMA 5JH9A 1Z8LA 4MRIA 4MMOA 4PQAA 2GLFA 3KQZA 3KZWA 2RB7A 2PJ1A 2GREA 4ZX9A 4A94A 4UEZA 3SI0A 4JZ0A 3MN8A 5K8PA 4UEEA 1ZG9A 3PEIA 3CPXA 3KI9A 1CP7A 3FEEA 5THWA 2PJ3A 3FF3A 2ZEEA 2O53A 2CF4A 3ISZA 3KHXA 3FX6A 2ZEPA 5IR2A 4MHNA 1ARLA 2Q43A 3KGQA 8CPAA 4YN3A 3KL9A 4OC0A 2EK9A 1AYEA 4X3RA 1LANA 4CDJA 4O23A 4NGRA 2AFMA 2PJ2A 3L2NA 4MHZA 4OKOA 4YU9A 4P10A 4F9UA 1ZLHA 5K8MA 3D7FA 2ZOGA 2BOAA 4Z65A 1DTDA 5DS0A 2JBJA 3CPAA 4FUUA 2IMOA 2AFUA 3WC7A 2PJ9A 3IFEA 1TF8A 2PIYA 1BPMA 4R7MA 2EWBA 2BCOA 2F7VA 1LAPA 2QVPA 1EE3P 4FBEA 3IJ3A 4C9VA 1FT7A 5HVFA 2RFHA 1RTQA 4NGSA 4ZX8A 4IAVA 3FEDA 3FJUA 2VL1A 2GLJA 4UF4A 1CG2A 4P4EA 4MXUA 3MRUA 2PJ6A 1TF9A 3PFOA 4EMEA 4F9VA 1TKHA 2V8VA 3D7HA 1QMUA 2J9AA 3RZAA 3PB7X 3FECA 4R76A 1XMBA 2PJAA 4OIWA 4ZY0A 2PJ8A 1YMEA 2CTBA 3JRUA 4EWTA 3HLPA 1YSJA 1Z5RA 3H8EA 3QNVA 4PXEA 2PVWA 4X8IA 3PBEA 1OBRA 1PCAA 1ELLP 2OR4A 3DLJA 3KQXA 3NH4A 4C8CA 3D66A 1GYTA 2POKA 2Q4ZA 3PBBA 2PRQA 1Z2LA 2PCUA 4AXVA 4R6TA 1HDQA 4UIBA 4P44A 2IJZA 2I3CA 2AFWA 1XFOA 5LYLA 4OC4A 4G1PA 4P4DA 4W9YA 3BHXA 2GU2A 1XBUA 4MCRA 3IO1A 3PRTA 4MCPA 1V6CA 1CPXA 4C85A 4NFRA 2V8HA 3IWWA 2O4HA 4P45A 2QJ8A 3PB6X 4NGQA 4NGNA 1YW4A 2ZOFA 4EFDA 2WZNA 4OMEA 1IY7A 3D67A 4H2KA 3ICUA 3SJXA 4C9RA 2ZEGA 3NFZA 1XF1A 4C84A 4DJLA 2V77A 4IHMA 2XEFA 3FH4A 3NH5A 4UEFA 2F8HA 1CX8A 3V38A 5LYIA 5F09A 5K8NA 4C8UA 3SJGA 4ONWA 1NSAA 1Y0YA 4TWEA 1ELMP 3IIBA 3H8FA 4OC5A 1LCPA 4ZY2A 2AFXA 3TC8A 4MCSA 3B7IA 4PXBA 2HB6A 4KSIA 2BO9A 5JM6A 4R8FA 4DYOA 1XRYA 5LYFA 3S9NA 3WC6A 3D7GA 2XEGA 2ZENA 1LAMA 4P6YA 2NSMA 4C8AA 4NGTA 4PXDA 4FWUA 2PIZA 2ZEFA 1KWMA 4A39A 1BPNA 1FNOA 4UIAA 5LYDA 3NH8A 1JQGA 3HUVA 2PVVA 3I74A 1TKFA 1BAVA 3K2KA 2PJ7A 4OP4A 2AFSA 4JYWA 4GM5A 4PXCA 4RUHA 3PB4X 1TXRA 3PFEA 2PE3A 3D7DA 3FVLA 4TJVA 3SJEA 3KR5A 3B35A 3VATA 1Y0RA 4NGMA 4ZYQA 2C6GA 4C86A 1CP6A 2ABZA 2V8GA 3DGVA 4IK2A 2FVGA 4X2TA 2PJCA 5K8OA 4C9AA 3KHZA 2AFOA 3D68A 1TKJA 4OC3A 1F2OA 1LOKA 4P4IA 1XJOA 2AFZA 1Q7LA 2NYQA 2JBKA 1ZG7A 2CTCA 3BI1A 2OOTA 3SJFA 4A38A 4OIDA 4C9EA 5ELYA 3B3SA 2PJ4A 2HC9A 2C1CA 3SI1A 4K3NA 4CPAA 5HXDA 2C6CA 4WJBA 3KR4A 3FMCA 3WABA 2GP4A 1PYTB 3LMSA 5JGFA 3B3TA 2QYVA 3CT9A 2G9DA 5D8NA 1WVMA 2PJ0A 1M4LA 4NGPA 2C6PA 4MHYA 1YW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A37 A;  4Q7A A;  5HVG A;  1CPS A;  1ARM A;  4TJX A;  4ZI6 A;  4MCQ A;  2EK8 A;  2ZEM A;  1VHO A;  2ZEL A;  3ISX A;  3B3W A;  4C99 A;  3N5F A;  4ZY1 A;  2IQ6 A;  3TX8 A;  1AMP A;  4KNG E;  3LWU A;  1LFW A;  4PPZ A;  3BXM A;  4LQG A;  3VH9 A;  4C8T A;  1CBX A;  3RBU A;  3B3V A;  1ZG8 A;  2JEW A;  1R43 A;  3WT4 A;  4F8Z A;  4P4B A;  1UWY A;  2ANP A;  3K9T A;  4C8F A;  1VIX A;  2XEJ A;  1DE4 C;  1Y9Z A;  5LRG A;  6CPA A;  1Y7E A;  1H8L A;  4MHP A;  2Q51 A;  2WYR A;  1BLL E;  5HVH A;  3I6S A;  4NJQ A;  5I4M A;  1VHE A;  3S9M A;  5CBM A;  1IGB A;  3VAR A;  3GLJ A;  3PB9 X;  3S9L A;  5J1Q A;  4TNU A;  3SI2 A;  5D29 A;  4OC2 A;  2DEA A;  3VTA A;  1HEE A;  1HDU A;  3CDX A;  2ZEH A;  3EIF A;  2V8D A;  4BD9 A;  3PB8 X;  4NJR A;  1YLO A;  4B6Z A;  4P4F A;  3BI0 A;  2XEI A;  3NA6 A;  3KAS A;  3D4U A;  5LRK A;  3V7Z A;  3WC5 A;  5CPA A;  1ZLI A;  7CPA A;  2ZEO A;  2ZED A;  4YWY A;  3B2Y A;  4P4J A;  4C8P A;  3IEH A;  3GUX A;  1F2P A;  2CIJ A;  3T8W A;  4FAI A;  4WWV A;  2PJB A;  1R3N A;  1QQ9 A;  3IC1 A;  3I1U A;  4DUK A;  1VGY A;  4OC1 A;  5IB9 A;  3B3C A;  3H8G A;  3GB0 A;  4C9U A;  1F57 A;  2PJ5 A;  4CDK A;  5LRJ A;  3RAM A;  5JH9 A;  1Z8L A;  4MRI A;  4MMO A;  4PQA A;  2GLF A;  3KQZ A;  3KZW A;  2RB7 A;  2PJ1 A;  2GRE A;  4ZX9 A;  4A94 A;  4UEZ A;  3SI0 A;  4JZ0 A;  3MN8 A;  5K8P A;  4UEE A;  1ZG9 A;  3PEI A;  3CPX A;  3KI9 A;  1CP7 A;  3FEE A;  5THW A;  2PJ3 A;  3FF3 A;  2ZEE A;  2O53 A;  2CF4 A;  3ISZ A;  3KHX A;  3FX6 A;  2ZEP A;  4MHN A;  1ARL A;  2Q43 A;  3KGQ A;  8CPA A;  4YN3 A;  3KL9 A;  4OC0 A;  2EK9 A;  1AYE A;  4X3R A;  1LAN A;  4CDJ A;  4O23 A;  4NGR A;  2AFM A;  2PJ2 A;  3L2N A;  4MHZ A;  4OKO A;  4YU9 A;  4P10 A;  4F9U A;  1ZLH A;  5K8M A;  3D7F A;  2ZOG A;  2BOA A;  4Z65 A;  1DTD A;  5DS0 A;  2JBJ A;  3CPA A;  4FUU A;  2IMO A;  2AFU A;  3WC7 A;  2PJ9 A;  3IFE A;  1TF8 A;  2PIY A;  1BPM A;  4R7M A;  2EWB A;  2BCO A;  2F7V A;  1LAP A;  2QVP A;  1EE3 P;  4FBE A;  3IJ3 A;  4C9V A;  1FT7 A;  5HVF A;  2RFH A;  1RTQ A;  4NGS A;  4ZX8 A;  4IAV A;  3FED A;  3FJU A;  2VL1 A;  2GLJ A;  4UF4 A;  1CG2 A;  4P4E A;  4MXU A;  3MRU A;  2PJ6 A;  1TF9 A;  3PFO A;  4EME A;  4F9V A;  1TKH A;  2V8V A;  3D7H A;  1QMU A;  2J9A A;  3RZA A;  3PB7 X;  3FEC A;  4R76 A;  1XMB A;  2PJA A;  4OIW A;  4ZY0 A;  2PJ8 A;  1YME A;  2CTB A;  3JRU A;  4EWT A;  3HLP A;  1YSJ A;  1Z5R A;  3H8E A;  3QNV A;  4PXE A;  2PVW A;  4X8I A;  3PBE A;  1OBR A;  1PCA A;  1ELL P;  2OR4 A;  3DLJ A;  3KQX A;  3NH4 A;  4C8C A;  3D66 A;  1GYT A;  2POK A;  2Q4Z A;  3PBB A;  2PRQ A;  1Z2L A;  2PCU A;  4AXV A;  4R6T A;  1HDQ A;  4UIB A;  4P44 A;  2IJZ A;  2I3C A;  2AFW A;  1XFO A;  5LYL A;  4OC4 A;  4G1P A;  4P4D A;  4W9Y A;  3BHX A;  2GU2 A;  1XBU A;  4MCR A;  3IO1 A;  3PRT A;  4MCP A;  1V6C A;  1CPX A;  4C85 A;  4NFR A;  2V8H A;  3IWW A;  2O4H A;  4P45 A;  2QJ8 A;  3PB6 X;  4NGQ A;  4NGN A;  1YW4 A;  2ZOF A;  4EFD A;  2WZN A;  4OME A;  1IY7 A;  3D67 A;  4H2K A;  3ICU A;  3SJX A;  4C9R A;  2ZEG A;  3NFZ A;  1XF1 A;  4C84 A;  4DJL A;  2V77 A;  4IHM A;  2XEF A;  3FH4 A;  3NH5 A;  4UEF A;  2F8H A;  1CX8 A;  3V38 A;  5LYI A;  5F09 A;  5K8N A;  4C8U A;  3SJG A;  4ONW A;  1NSA A;  1Y0Y A;  4TWE A;  1ELM P;  3IIB A;  3H8F A;  4OC5 A;  1LCP A;  4ZY2 A;  2AFX A;  3TC8 A;  4MCS A;  3B7I A;  4PXB A;  2HB6 A;  4KSI A;  2BO9 A;  5JM6 A;  4R8F A;  4DYO A;  1XRY A;  5LYF A;  3S9N A;  3WC6 A;  3D7G A;  2XEG A;  2ZEN A;  1LAM A;  4P6Y A;  2NSM A;  4C8A A;  4NGT A;  4PXD A;  4FWU A;  2PIZ A;  2ZEF A;  1KWM A;  4A39 A;  1BPN A;  1FNO A;  4UIA A;  5LYD A;  3NH8 A;  1JQG A;  3HUV A;  2PVV A;  3I74 A;  1TKF A;  1BAV A;  3K2K A;  2PJ7 A;  4OP4 A;  2AFS A;  4JYW A;  4GM5 A;  4PXC A;  4RUH A;  3PB4 X;  1TXR A;  3PFE A;  2PE3 A;  3D7D A;  3FVL A;  4TJV A;  3SJE A;  3KR5 A;  3B35 A;  3VAT A;  1Y0R A;  4NGM A;  4ZYQ A;  2C6G A;  4C86 A;  1CP6 A;  2ABZ A;  2V8G A;  3DGV A;  4IK2 A;  2FVG A;  4X2T A;  2PJC A;  5K8O A;  4C9A A;  3KHZ A;  2AFO A;  3D68 A;  1TKJ A;  4OC3 A;  1F2O A;  1LOK A;  4P4I A;  1XJO A;  2AFZ A;  1Q7L A;  2NYQ A;  2JBK A;  1ZG7 A;  2CTC A;  3BI1 A;  2OOT A;  3SJF A;  4A38 A;  4OID A;  4C9E A;  5ELY A;  3B3S A;  2PJ4 A;  2HC9 A;  2C1C A;  3SI1 A;  4K3N A;  4CPA A;  5HXD A;  2C6C A;  4WJB A;  3KR4 A;  3FMC A;  3WAB A;  1PYT B;  3LMS A;  5JGF A;  3B3T A;  2QYV A;  3CT9 A;  2G9D A;  5D8N A;  1WVM A;  2PJ0 A;  1M4L A;  4NGP A;  2C6P A;  4MHY A;  1YW6 A; 
#chains in the Genus database with same CATH topology
 4A37 A;  4KUB A;  3MGD A;  4M85 A;  2OZU A;  3K4I A;  4Q7A A;  5HVG A;  1ZL0 A;  4E94 A;  2Z0Z A;  1CPS A;  1Q2D A;  1ARM A;  1IYK A;  3H5Z A;  1XOV A;  2VZZ A;  4TJX A;  3GKR A;  3JUW A;  4ZI6 A;  4QUS A;  4MCQ A;  1EO0 A;  2EK8 A;  4B11 A;  4CGO A;  4CYP A;  2ZEM A;  4E0A A;  1VHO A;  1IOI A;  2HUZ A;  1PUA A;  4PSX A;  2ZEL A;  3ISX A;  4PK3 A;  2XPO A;  3OAK A;  2FE7 A;  3B3W A;  4C99 A;  2I00 A;  1EZB A;  3N5F A;  3PP9 A;  4B5P A;  2IQ6 A;  3TX8 A;  4ZY1 A;  1YGH A;  3BUN B;  1AMP A;  3LWU A;  1LFW A;  4PPZ A;  3BXM A;  4CAV A;  4KNG E;  3T0T A;  4E5S A;  4LQG A;  2X7B A;  3VH9 A;  4F0X A;  5F49 A;  3RBU A;  1CBX A;  4UWJ A;  1YLE A;  3VWE A;  1R57 A;  1ZG8 A;  3B3V A;  4CS0 B;  4GPL B;  1R43 A;  2JEW A;  4MI4 A;  3WT4 A;  4QVT A;  5F5X A;  3P2H A;  4P4B A;  2CY2 A;  1UWY A;  2ANP A;  2GE3 A;  3K9T A;  4GS4 A;  1VIX A;  2XEJ A;  1DE4 C;  1S7L A;  4JD6 A;  3N7Z A;  4Y49 C;  1Y9Z A;  5I0C A;  1ZRS A;  5LRG A;  2Y1N A;  3D3S A;  2P6G A;  1Y7E A;  1H8L A;  3CZX A;  6CPA A;  2QML A;  4MHP A;  2Q51 A;  3R1K A;  4CZ1 A;  2D4O A;  2WYR A;  3T05 A;  2ZW4 A;  4KLV A;  1S3Z A;  4HKF A;  1BLL E;  5HVH A;  3BJ7 A;  4R3L A;  3C8O A;  3GIU A;  4KOS A;  5DWN A;  1JDE A;  3I6S A;  4NJQ A;  3CXQ A;  5I4M A;  1VHE A;  3S9M A;  2CNT A;  4FD6 A;  4KOX A;  4EFD A;  2R7H A;  3T90 A;  1IGB A;  1QSR A;  3VAR A;  5CBM A;  3GLJ A;  2FXF A;  4M6G A;  4CYO A;  3PB9 X;  5C82 A;  4EYS A;  3NE8 A;  4H89 A;  3S9L A;  5J1Q A;  3NE7 A;  4AVA A;  2ZXV A;  3CXP A;  3TTH A;  2FT0 A;  2I79 A;  5HKZ A;  2KCW A;  4JXQ A;  4TNU A;  3SI2 A;  1VI4 A;  4E2A A;  4CRZ B;  1CM0 A;  3C26 A;  3GYA A;  4UFX A;  5F13 A;  5D29 A;  4OC2 A;  1Z9E A;  1K4J A;  2DEA A;  4OLL A;  4CGP A;  1HEE A;  2DPT A;  1HDU A;  3W91 A;  3CDX A;  5ISV A;  3VTA A;  2VEZ A;  2ZEH A;  3EIF A;  1B47 A;  3F9K C;  4U9Y A;  2V8D A;  2G3T A;  3VRO A;  2OH1 A;  4BD9 A;  2YNC A;  4KZT A;  3PB8 X;  3VRR A;  1YLO A;  2EUI A;  4NJR A;  2K5T A;  2B0A A;  3ZZI A;  2HI6 A;  4B6Z A;  4P4F A;  4UBR A;  3BI0 A;  2XEI A;  4JVO A;  3NA6 A;  2CNS A;  3IWE A;  4CAE A;  3KAS A;  2P0W A;  3TO9 A;  3D4U A;  3DNS A;  3FIX A;  5LRK A;  1J4J A;  3DR6 A;  3EXN A;  1I1D A;  2HWG A;  2J8M A;  3F5B A;  4IUS A;  3V7Z A;  4XPD C;  5CPA A;  3WC5 A;  4IIX A;  1ZLI A;  3LOD A;  2IL4 A;  7CPA A;  3OB2 B;  2ZEO A;  1BXR B;  1IID A;  4ZGY B;  2ZW5 A;  2ZED A;  5HKW A;  3FBU A;  4CGM A;  4JWP A;  4YWY A;  1T36 B;  4KOY A;  3B2Y A;  4P4J A;  4KS9 A;  4CAX A;  4M6I A;  5EC4 A;  2E28 A;  4C8P A;  3IEH A;  3F0A A;  4MY0 A;  2ODF A;  3GUX A;  1F2P A;  2CIJ A;  2FS5 A;  2PQ8 A;  4KOT A;  3T8W A;  4WWV A;  3ZJ0 A;  4FAI A;  2C5Q A;  2PJB A;  1R3N A;  1QQ9 A;  1MJA A;  3I1U A;  3IC1 A;  4HNY B;  4A30 A;  5IV0 A;  4DUK A;  1VGY A;  4OC1 A;  2Z3N A;  4B10 A;  5IB9 A;  3B3C A;  3H8G A;  3GB0 A;  4C9U A;  1F57 A;  2PJ5 A;  4K30 A;  4CDK A;  3TOB A;  5JQ4 A;  5LRJ A;  3RAM A;  4C68 A;  1S7F A;  1Z8L A;  3OWC A;  4RN7 A;  5AG5 A;  4MRI A;  4XNH B;  5FVJ A;  5A27 A;  3T5M A;  4MMO A;  4PQA A;  3OB1 B;  2GLF A;  3D2P A;  1J3L A;  3KQZ A;  1R61 A;  2AUM A;  4YFJ A;  1TIQ A;  1LRZ A;  3FRM A;  3KZW A;  2FIA A;  5DWM A;  2RB7 A;  3PLF B;  1XEB A;  2PJ1 A;  5HMN A;  4XPD B;  2G0B A;  2VKZ G;  5HH1 A;  4F6A A;  4NF1 A;  1NE9 A;  2XPP A;  1RO5 A;  2GRE A;  4J3G A;  4ZX9 A;  2PRB A;  4A94 A;  1IYL A;  3SXN A;  1C30 B;  5JVL A;  1KBL A;  4UEZ A;  3SI0 A;  2G3A A;  4FD7 A;  4JZ0 A;  1YVO A;  1JDB C;  3MN8 A;  2DXQ A;  4B12 A;  2B58 A;  5K8P A;  4UEE A;  1ZG9 A;  4EVY A;  3PEI A;  2ARH A;  3CPX A;  2DF5 A;  3FB3 A;  3KI9 A;  4KVO E;  1CP7 A;  4PK2 A;  3FEE A;  5THW A;  4QBJ A;  2PJ3 A;  4NSQ A;  5H86 A;  3FF3 A;  2ZEE A;  2O53 A;  3TT2 A;  2CF4 A;  3ISZ A;  5F1Y A;  2Z3K A;  5AXI A;  4NEX A;  4ZBG A;  5KTA A;  2EZA A;  3KHX A;  3FX6 A;  1B87 A;  3IWG A;  1RXT A;  3P2F A;  4Y49 B;  2ZEP A;  1M1D A;  4KSA A;  2Q4Y A;  2NMT A;  2R82 A;  1UFH A;  5IR2 A;  1X10 A;  4MHN A;  1ARL A;  2Q43 A;  1JWQ A;  3KGQ A;  8CPA A;  4MFQ A;  3TLE A;  4YN3 A;  3KL9 A;  4OC0 A;  2XPN A;  3SXO A;  2EK9 A;  1AYE A;  2GIV A;  4X3R A;  4QC6 A;  4A4C A;  1LAN A;  1KUY A;  2VI7 A;  4O23 A;  4CDJ A;  4NGR A;  1Z9U A;  2AFM A;  2PJ2 A;  3L2N A;  4MHZ A;  2Y1M A;  4OKO A;  4YU9 A;  3F8K A;  4P10 A;  5EMI A;  2CBL A;  1ZLH A;  4E8O A;  3FNC A;  4F9U A;  1M4G A;  4C8T A;  5K8M A;  3LAC A;  3BJ8 A;  2VBQ A;  3D7F A;  1Q2C A;  4H6U A;  3S6F A;  1A2Z A;  2ZW7 A;  2AUN A;  1Z4R A;  2ZOG A;  5KTD A;  2B5G A;  2BOA A;  3WR7 A;  2UV8 G;  3PGP A;  1DTD A;  4NCZ A;  5DS0 A;  4Z65 A;  3EZA A;  2JBJ A;  2OLS A;  3CPA A;  2IMO A;  2AFU A;  4FUU A;  4PV6 A;  3R96 A;  3WC7 A;  2PJ9 A;  2Z3M A;  3IFE A;  3BUW B;  3EO4 A;  4HPS A;  5JH9 A;  1TF8 A;  2P6E A;  2PIY A;  1BPM A;  4RR2 B;  2CNM A;  2B5G B;  4R7M A;  2EWB A;  2BCO A;  2F7V A;  5G1Z A;  1LAP A;  2QVP A;  1V0C A;  1GGO A;  4UCM A;  1N71 A;  4HNW B;  1YQE A;  1EE3 P;  2R8V A;  1CJW A;  2BSW A;  5FD8 A;  4FBE A;  1Z8X A;  3IJ3 A;  2YND A;  4C9V A;  1FT7 A;  5HVF A;  1IIC A;  1NMT A;  3S6H A;  5H84 A;  2AJ6 A;  2RFH A;  1RTQ A;  4NGS A;  3PZJ A;  4ZX8 A;  4IAV A;  3S6G A;  3FED A;  3FJU A;  3V8I A;  4CGL A;  2VL1 A;  2GLJ A;  4JXR A;  4UF4 A;  5G21 A;  1Y9K A;  3SHP A;  4CAW A;  4KVX A;  1Z8W A;  2B3V A;  2JLM A;  1GHE A;  2BEI A;  4CO9 A;  1CG2 A;  4YGO A;  4P4E A;  2BL1 A;  4MXU A;  3MRU A;  5JPH A;  2Q04 A;  1QST A;  2PJ6 A;  2YNE A;  2JDD A;  3PT1 A;  1TF9 A;  3PFO A;  3RYO A;  4AVB A;  4EME A;  1TKH A;  4F9V A;  2V8V A;  4J0N A;  4R57 A;  3D7H A;  3VRN A;  2Y0M A;  3G23 A;  1QMU A;  4KVM E;  4U5Y A;  2J9A A;  3OP0 A;  2Z11 A;  5G20 A;  3RZA A;  4MJX A;  3G3S A;  3PB7 X;  3FEC A;  3DDD A;  4R76 A;  3TO7 A;  2A4N A;  1XMB A;  2PJA A;  5G22 A;  1VHS A;  4OIW A;  1ON0 A;  4A32 A;  4ZY0 A;  2PJ8 A;  3UY5 A;  1WWZ A;  1YME A;  2CTB A;  2FIW A;  2X0S A;  3JRU A;  4EWT A;  1WK4 A;  2DIK A;  2DPS A;  2VQY A;  3VRP A;  2O28 A;  3HLP A;  1YSJ A;  5IB0 A;  1YR0 A;  4KLW A;  1Z5R A;  3H8E A;  4M3S A;  3QNV A;  4PXE A;  1NBW A;  1IOF A;  2Z3L A;  2QEC A;  2PVW A;  4XPK A;  1S5K A;  4X8I A;  3R9G A;  3PBE A;  1OBR A;  1PCA A;  4RS2 A;  1ELL P;  4YRH A;  2OR4 A;  5F47 A;  3DLJ A;  3KQX A;  3H4Q A;  3NH4 A;  5AG7 A;  4C8C A;  3D66 A;  1GYT A;  2POK A;  1CS0 B;  4MY3 A;  2Q4Z A;  3R9E A;  4BPU B;  1FY7 A;  1BOB A;  2GFQ A;  2PRQ A;  3PBB A;  2EBJ A;  1Z2L A;  2D4P A;  2PCU A;  4AXV A;  4M8D A;  2ZW6 A;  2FL4 A;  2VXK A;  4R6T A;  1HDQ A;  1VKC A;  2EO8 A;  4GXH A;  4UIB A;  1KC7 A;  5J8F A;  4LQ6 A;  5A28 A;  3HPG G;  1QSM A;  1M44 A;  2HV2 A;  4C2Y A;  5BWA B;  2B3U A;  3ZNI A;  1S7N A;  4P44 A;  3EFA A;  2PC1 A;  2IJZ A;  2AE6 A;  2I3C A;  2JEV A;  2AFW A;  4PSW A;  1XFO A;  1S60 A;  5LYL A;  4OC4 A;  3U88 C;  4G1P A;  5EBV A;  3T07 A;  4P4D A;  4W9Y A;  3QAH A;  4QB9 A;  2H5M A;  3BHX A;  2GU2 A;  2PSW A;  4C2Z A;  2EVN A;  3JTK A;  1XBU A;  4MCR A;  3IO1 A;  3PRT A;  4MCP A;  2OB0 A;  1V6C A;  3W6S A;  4BBH A;  5BY0 A;  4XPL A;  1YRE A;  2ATR A;  3CXS A;  4MBU A;  1CPX A;  3D8P A;  4UFW A;  4C85 A;  4NFR A;  4RI1 A;  1KUX A;  2V8H A;  3IWW A;  3FXT A;  1KEE B;  2O4H A;  4IIY A;  4P45 A;  1Y7R A;  2QJ8 A;  3PB6 X;  4BPX B;  4NGQ A;  4MHD A;  4CYN A;  4NGN A;  1YW4 A;  2ZOF A;  3G8W A;  2WZN A;  4OME A;  1IY7 A;  3W6X A;  3D67 A;  4KSF A;  4AG9 A;  1MJ9 A;  3BLN A;  4H2K A;  4A95 A;  4CGN A;  4C8F A;  1VBG A;  4COG A;  1MJB A;  3NFQ A;  4MFZ A;  4BMH A;  3ICU A;  3SJX A;  1KUV A;  1Z4E A;  4C9R A;  1NSL A;  4B5P B;  1S7K A;  2ZEG A;  3GY9 A;  3NFZ A;  4DNC A;  3B8G A;  1XF1 A;  4MFJ A;  4C84 A;  1SQH A;  2Q44 A;  1P0H A;  4HNX B;  2WUU A;  3A9L A;  4DJL A;  2V77 A;  1YX0 A;  4I49 A;  4IHM A;  2XEF A;  3FH4 A;  2N3A B;  3NH5 A;  4UEF A;  4AVC A;  3TLZ A;  2F8H A;  1CX8 A;  1YVH A;  2Q4V A;  3TLA A;  1I21 A;  3V38 A;  4UCN A;  1PU9 A;  5LYI A;  5F09 A;  1XMT A;  4IF5 A;  2YJT A;  3GJZ A;  5K8N A;  3EZE A;  4C8U A;  3SJG A;  1MK4 A;  4ONW A;  1NSA A;  2PR1 A;  4A4B A;  1Y0Y A;  4TWE A;  4JJX A;  1ELM P;  3E0K A;  5F46 A;  1U6M A;  2EZB A;  3IIB A;  4CAF A;  3TFY A;  5J8C A;  3H8F A;  5AG4 A;  3TLB A;  4OC5 A;  1LCP A;  4NXY A;  4ZY2 A;  1VBH A;  3TO6 A;  1L0C A;  2DLA A;  3TLG A;  1QSN A;  2AFX A;  3BUX B;  3FYN A;  2XPL A;  3TC8 A;  2YJV A;  3BUM B;  4MCS A;  3B7I A;  4UCP A;  5K99 A;  4COB A;  4PXB A;  2D0P A;  3TYX A;  2HB6 A;  3I9S A;  3IU2 A;  4U9Z A;  1CE8 B;  3TLC A;  4KSI A;  2BO9 A;  3DR8 A;  3VGO A;  1Q2Y A;  3RO0 A;  4KOW A;  4R8F A;  4DYO A;  5JM6 A;  2J8N A;  1NXJ A;  1XRY A;  1P4N A;  5LYF A;  3S9N A;  2CXA A;  5F9M A;  4KUA A;  3WC6 A;  5AGE A;  3D7G A;  1Z8T A;  4H6Z A;  2XEG A;  2ZEN A;  1IU8 A;  1LAM A;  4P6Y A;  3HPH E;  2NSM A;  4C8A A;  4JLY A;  4NGT A;  3I3G A;  4PXD A;  2D0O A;  2B4J C;  4FWU A;  2R98 A;  4LX9 A;  2PIZ A;  4F0Y A;  3QB8 A;  1IB1 E;  3U1B A;  2ZEF A;  2R1I A;  3SR3 A;  5JYB A;  2F5I A;  4OAD A;  4BIN A;  1KWM A;  4LUA A;  2P6F A;  4A39 A;  1B6B A;  1BPN A;  2YGW A;  1FNO A;  4L8A A;  4UIA A;  3NH8 A;  5LYD A;  2FM4 A;  5C88 A;  1JQG A;  2OZG A;  3R9F A;  2OU2 A;  3VRQ A;  3HUV A;  2PVV A;  4Q36 A;  4INJ A;  2B4B A;  3I74 A;  1TKF A;  1BAV A;  4FD4 A;  1EZA A;  3K2K A;  4OAE A;  1DIK A;  1M6V B;  2PJ7 A;  4CYQ A;  2Z3O A;  3VWD A;  4OP4 A;  2AFS A;  1M4I A;  4JYW A;  3TLG B;  4GM5 A;  3S6K A;  2REE A;  4H1H A;  4F8Z A;  1YVK A;  3D2M A;  4R87 A;  4PXC A;  4RUH A;  3PB4 X;  1TXR A;  5E96 A;  3PFE A;  3LD2 A;  2PE3 A;  3TOA A;  1X12 A;  3D7D A;  2FSR A;  1AUG A;  3FVL A;  5IX3 A;  1Y9W A;  4TJV A;  3SJE A;  3KR5 A;  4A31 A;  2GAN A;  2FCK A;  3B35 A;  3IGR A;  3TCV A;  3VAT A;  1Y0R A;  2OZH A;  3HMJ G;  2C27 A;  4KOR A;  4A33 A;  4NGM A;  2HRO A;  5KTC A;  1FBV A;  4MFK A;  4ZYQ A;  3TLY A;  2C6G A;  4KOV A;  4B13 A;  1Q5X A;  4C86 A;  1CP6 A;  2ABZ A;  2V8G A;  3DGV A;  4C7H A;  2YNC C;  2Q0Y A;  2QIR A;  1KZF A;  3R95 A;  2MP0 A;  1WJT A;  1XF8 A;  4FD5 A;  2EZC A;  5HKY A;  1QSO A;  4IK2 A;  2FVG A;  2B4D A;  3JVN A;  4X2T A;  2PJC A;  3DSB A;  5K8O A;  4Q38 A;  1ZYM A;  3BUO B;  4C9A A;  3KHZ A;  3RNZ A;  2AFO A;  4L89 A;  3D68 A;  1TKJ A;  3EY5 A;  3T9Y A;  4MI1 A;  2ZPA A;  1XE4 A;  4OC3 A;  3KRV A;  3TE4 A;  4C7I A;  3EC4 A;  4BPW B;  3O8Z A;  3K9U A;  1F2O A;  1LOK A;  4P4I A;  2B4D B;  1XJO A;  2AFZ A;  1Q7L A;  2NYQ A;  2JBK A;  1BO4 A;  1ZG7 A;  4BTF A;  2CTC A;  2VZY A;  2WPX A;  2Z10 A;  3BI1 A;  2OOT A;  2WPW A;  2PR8 A;  3QAY A;  4B14 A;  4MJ8 A;  5AG6 A;  3SJF A;  4A38 A;  4AB7 A;  4XNH C;  4OID A;  4UWI A;  5F48 A;  4C9E A;  5ELY A;  3B3S A;  2PJ4 A;  2HC9 A;  2Q7B A;  2Z3P A;  5J3X A;  4AG7 A;  1A9X B;  2C1C A;  2HQY A;  2J8R A;  3KKW A;  2PCN A;  3SI1 A;  3IU1 A;  4A2Z A;  4ONU A;  2RC4 A;  4ORF A;  4K3N A;  4MFP A;  3EZB A;  3NOJ A;  4CPA A;  5HXD A;  4B5O A;  2C6C A;  4WJB A;  2BUE A;  3KR4 A;  3FMC A;  3WAB A;  2GP4 A;  1PYT B;  3LMS A;  5JGF A;  4KOU A;  3B3T A;  2QYV A;  4X5K A;  3CT9 A;  4R3K A;  2WSA A;  2PDO A;  2G9D A;  2REF A;  4R9M A;  4C2X A;  5D8N A;  1OZP A;  1ZO0 A;  1I12 A;  2PJ0 A;  4CRY B;  1WVM A;  4MFL A;  5GCN A;  1M4L A;  1M4D A;  4NGP A;  4M6H A;  2C6P A;  1XIX A;  2Q7S A;  4UA3 A;  5CNP A;  4UFV A;  4MHY A;  4II9 A;  1YK3 A;  1C3O B;  1YW6 A;  2JDC A;  3PFV A; 
#chains in the Genus database with same CATH homology
 4A37 A;  4Q7A A;  5HVG A;  1CPS A;  1ARM A;  4TJX A;  4ZI6 A;  4MCQ A;  2EK8 A;  2ZEM A;  1VHO A;  2ZEL A;  3ISX A;  3B3W A;  4C99 A;  3N5F A;  4ZY1 A;  2IQ6 A;  3TX8 A;  1AMP A;  4KNG E;  3LWU A;  1LFW A;  4PPZ A;  3BXM A;  4LQG A;  3VH9 A;  4C8T A;  1CBX A;  3RBU A;  3B3V A;  1ZG8 A;  2JEW A;  1R43 A;  3WT4 A;  4F8Z A;  4P4B A;  1UWY A;  2ANP A;  3K9T A;  4C8F A;  1VIX A;  2XEJ A;  1DE4 C;  1Y9Z A;  5LRG A;  6CPA A;  1Y7E A;  1H8L A;  4MHP A;  2Q51 A;  2WYR A;  1BLL E;  5HVH A;  3I6S A;  4NJQ A;  5I4M A;  1VHE A;  3S9M A;  5CBM A;  1IGB A;  3VAR A;  3GLJ A;  3PB9 X;  3S9L A;  5J1Q A;  4TNU A;  3SI2 A;  5D29 A;  4OC2 A;  2DEA A;  3VTA A;  1HEE A;  1HDU A;  3CDX A;  2ZEH A;  3EIF A;  2V8D A;  4BD9 A;  3PB8 X;  4NJR A;  1YLO A;  4B6Z A;  4P4F A;  3BI0 A;  2XEI A;  3NA6 A;  3KAS A;  3D4U A;  5LRK A;  3V7Z A;  3WC5 A;  5CPA A;  1ZLI A;  7CPA A;  2ZEO A;  2ZED A;  4YWY A;  3B2Y A;  4P4J A;  4C8P A;  3IEH A;  3GUX A;  1F2P A;  2CIJ A;  3T8W A;  4FAI A;  4WWV A;  2C5Q A;  2PJB A;  1R3N A;  1QQ9 A;  3IC1 A;  3I1U A;  4DUK A;  1VGY A;  4OC1 A;  5IB9 A;  3B3C A;  3H8G A;  3GB0 A;  4C9U A;  1F57 A;  2PJ5 A;  4CDK A;  5LRJ A;  3RAM A;  5JH9 A;  1Z8L A;  4MRI A;  4MMO A;  4PQA A;  2GLF A;  3KQZ A;  3KZW A;  2RB7 A;  2PJ1 A;  2GRE A;  4ZX9 A;  4A94 A;  4UEZ A;  3SI0 A;  4JZ0 A;  3MN8 A;  5K8P A;  4UEE A;  1ZG9 A;  3PEI A;  3CPX A;  3KI9 A;  1CP7 A;  3FEE A;  5THW A;  2PJ3 A;  3FF3 A;  2ZEE A;  2O53 A;  2CF4 A;  3ISZ A;  3KHX A;  3FX6 A;  2ZEP A;  5IR2 A;  4MHN A;  1ARL A;  2Q43 A;  3KGQ A;  8CPA A;  4YN3 A;  3KL9 A;  4OC0 A;  2EK9 A;  1AYE A;  4X3R A;  1LAN A;  4CDJ A;  4O23 A;  4NGR A;  2AFM A;  2PJ2 A;  3L2N A;  4MHZ A;  4OKO A;  4YU9 A;  4P10 A;  4F9U A;  1ZLH A;  5K8M A;  3D7F A;  2ZOG A;  2BOA A;  4Z65 A;  1DTD A;  5DS0 A;  2JBJ A;  3CPA A;  4FUU A;  2IMO A;  2AFU A;  3WC7 A;  2PJ9 A;  3IFE A;  1TF8 A;  2PIY A;  1BPM A;  4R7M A;  2EWB A;  2BCO A;  2F7V A;  1LAP A;  2QVP A;  1EE3 P;  4FBE A;  3IJ3 A;  4C9V A;  1FT7 A;  5HVF A;  2RFH A;  1RTQ A;  4NGS A;  4ZX8 A;  4IAV A;  3FED A;  3FJU A;  2VL1 A;  2GLJ A;  4UF4 A;  1CG2 A;  4P4E A;  4MXU A;  3MRU A;  2PJ6 A;  1TF9 A;  3PFO A;  4EME A;  4F9V A;  1TKH A;  2V8V A;  3D7H A;  1QMU A;  2J9A A;  3RZA A;  3PB7 X;  3FEC A;  4R76 A;  1XMB A;  2PJA A;  4OIW A;  4ZY0 A;  2PJ8 A;  1YME A;  2CTB A;  3JRU A;  4EWT A;  3HLP A;  1YSJ A;  1Z5R A;  3H8E A;  3QNV A;  4PXE A;  2PVW A;  4X8I A;  3PBE A;  1OBR A;  1PCA A;  1ELL P;  2OR4 A;  3DLJ A;  3KQX A;  3NH4 A;  4C8C A;  3D66 A;  1GYT A;  2POK A;  2Q4Z A;  3PBB A;  2PRQ A;  1Z2L A;  2PCU A;  4AXV A;  4R6T A;  1HDQ A;  4UIB A;  4P44 A;  2IJZ A;  2I3C A;  2AFW A;  1XFO A;  5LYL A;  4OC4 A;  4G1P A;  4P4D A;  4W9Y A;  3BHX A;  2GU2 A;  1XBU A;  4MCR A;  3IO1 A;  3PRT A;  4MCP A;  1V6C A;  1CPX A;  4C85 A;  4NFR A;  2V8H A;  3IWW A;  2O4H A;  4P45 A;  2QJ8 A;  3PB6 X;  4NGQ A;  4NGN A;  1YW4 A;  2ZOF A;  4EFD A;  2WZN A;  4OME A;  1IY7 A;  3D67 A;  4H2K A;  3ICU A;  3SJX A;  4C9R A;  2ZEG A;  3NFZ A;  1XF1 A;  4C84 A;  4DJL A;  2V77 A;  4IHM A;  2XEF A;  3FH4 A;  3NH5 A;  4UEF A;  2F8H A;  1CX8 A;  3V38 A;  5LYI A;  5F09 A;  5K8N A;  4C8U A;  3SJG A;  4ONW A;  1NSA A;  1Y0Y A;  4TWE A;  1ELM P;  3IIB A;  3H8F A;  4OC5 A;  1LCP A;  4ZY2 A;  2AFX A;  3TC8 A;  4MCS A;  3B7I A;  4PXB A;  2HB6 A;  4KSI A;  2BO9 A;  5JM6 A;  4R8F A;  4DYO A;  1XRY A;  5LYF A;  3S9N A;  3WC6 A;  3D7G A;  2XEG A;  2ZEN A;  1LAM A;  4P6Y A;  2NSM A;  4C8A A;  4NGT A;  4PXD A;  4FWU A;  2PIZ A;  2ZEF A;  1KWM A;  4A39 A;  1BPN A;  1FNO A;  4UIA A;  5LYD A;  3NH8 A;  1JQG A;  3HUV A;  2PVV A;  3I74 A;  1TKF A;  1BAV A;  3K2K A;  2PJ7 A;  4OP4 A;  2AFS A;  4JYW A;  4GM5 A;  4PXC A;  4RUH A;  3PB4 X;  1TXR A;  3PFE A;  2PE3 A;  3D7D A;  3FVL A;  4TJV A;  3SJE A;  3KR5 A;  3B35 A;  3VAT A;  1Y0R A;  4NGM A;  4ZYQ A;  2C6G A;  4C86 A;  1CP6 A;  2ABZ A;  2V8G A;  3DGV A;  4IK2 A;  2FVG A;  4X2T A;  2PJC A;  5K8O A;  4C9A A;  3KHZ A;  2AFO A;  3D68 A;  1TKJ A;  4OC3 A;  1F2O A;  1LOK A;  4P4I A;  1XJO A;  2AFZ A;  1Q7L A;  2NYQ A;  2JBK A;  1ZG7 A;  2CTC A;  3BI1 A;  2OOT A;  3SJF A;  4A38 A;  4OID A;  4C9E A;  5ELY A;  3B3S A;  2PJ4 A;  2HC9 A;  2C1C A;  3SI1 A;  4K3N A;  4CPA A;  5HXD A;  2C6C A;  4WJB A;  3KR4 A;  3FMC A;  3WAB A;  2GP4 A;  1PYT B;  3LMS A;  5JGF A;  3B3T A;  2QYV A;  3CT9 A;  2G9D A;  5D8N A;  1WVM A;  2PJ0 A;  1M4L A;  4NGP A;  2C6P A;  4MHY A;  1YW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...