5D29A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a hydroxamate inhibitor jhu241
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
695
structure length
686
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Unprecedented Binding Mode of Hydroxamate-Based Inhibitors of Glutamate Carboxypeptidase II: Structural Characterization and Biological Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 266
structure length 686
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2015-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 5d29A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5d29A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5d29A02
1CPXA 3D7HA 2Q4ZA 1YW4A 2JBJA 2ZEMA 8CPAA 1CX8A 2EWBA 5DS0A 2V8HA 4DYOA 1CP7A 3H8GA 1Z2LA 4WJBA 3S9LA 5K8PA 4KNGE 1XRYA 4IHMA 3S9MA 3SJGA 2IJZA 4BD9A 4YN3A 1UWYA 3L2NA 4MHZA 4X3RA 3I1UA 1HDUA 2PJ2A 1Y0RA 3DGVA 3D7GA 4Z65A 3NA6A 1LCPA 2V77A 4C8UA 4C86A 2OR4A 1VHEA 1DE4C 4YU9A 3KZWA 4OC4A 1BPMA 4F9VA 4DJLA 4P4DA 1NSAA 3KHXA 4PQAA 2PJ8A 3SJEA 4ZX9A 3PFEA 1JQGA 2WYRA 2ZENA 2ZEPA 4UEEA 5LYLA 2PJCA 4P4IA 3HUVA 5K8NA 4KSIA 3VATA 4TWEA 1R3NA 3N5FA 4R6TA 1VHOA 3H8EA 3NFZA 3KHZA 5HVFA 3SJXA 1YLOA 1Y0YA 2NYQA 4NGRA 1H8LA 3IFEA 4AXVA 1Z8LA 3KQZA 4TJVA 3FH4A 1ZG8A 4C8FA 2POKA 2BCOA 1LOKA 2HC9A 5D29A 2V8GA 1LAMA 1TF8A 2GLFA 3FVLA 5F09A 4OP4A 3RAMA 4RUHA 4UIAA 2HB6A 3IC1A 3SJFA 3S9NA 4MCPA 3VTAA 3MRUA 4TNUA 5JM6A 1V6CA 3PB4X 4C8CA 1ZLHA 4F9UA 1LANA 3T8WA 3TX8A 3K2KA 4C8TA 4C9UA 3GUXA 1CPSA 2J9AA 3ICUA 4B6ZA 2C6PA 1TKFA 1CP6A 2PVVA 1FT7A 3RBUA 3KI9A 2C6GA 3D67A 3PBBA 1Y9ZA 3BI1A 3B35A 4EMEA 4OIDA 3KR4A 4MCSA 4OMEA 1ELLP 4NGNA 1XJOA 2ZEOA 1PYTB 1XFOA 3IEHA 3H8FA 4W9YA 2PJ3A 4PXDA 5D8NA 4A37A 4UEZA 4G1PA 3WABA 3PBEA 1VIXA 2G9DA 2IMOA 4PPZA 2QYVA 2ANPA 2PJBA 1LAPA 3SI1A 3GLJA 3IO1A 2PIZA 2FVGA 1XF1A 3B3SA 1F2OA 2ZEDA 4C9AA 4A38A 2NSMA 4OC2A 4UEFA 5K8OA 4NGMA 5JH9A 4MHNA 3PFOA 2GU2A 1DTDA 3IWWA 5K8MA 2PVWA 4MCQA 2RFHA 1LFWA 2AFUA 3NH4A 4FBEA 4P4JA 4JZ0A 1TXRA 2PJ9A 2PJ4A 4PXCA 4C8AA 3PB7X 5THWA 3KQXA 1WVMA 4C99A 2GREA 7CPAA 4NGTA 4FUUA 4UIBA 4O23A 2AFMA 4Q7AA 1PCAA 4C8PA 2PJ6A 1HDQA 3FMCA 4ZYQA 3I6SA 5HVHA 3IJ3A 1XMBA 1YSJA 3JRUA 2XEIA 1TKJA 4NJRA 4R7MA 2AFOA 2VL1A 2WZNA 1TF9A 4H2KA 3B3TA 4IK2A 2PJAA 4EWTA 3FEEA 2Q43A 3DLJA 2PE3A 3B2YA 4C84A 2ZOFA 2CF4A 4UF4A 1KWMA 2I3CA 5LYFA 1F57A 2ZEHA 5LRGA 2PJ5A 4PXBA 5HVGA 4NGQA 3WC6A 4C85A 2JEWA 4ZX8A 3PB9X 3NH8A 2QVPA 3KL9A 1BPNA 1Q7LA 4P4BA 4ZI6A 3D68A 1Y7EA 3D4UA 4ZY2A 1AYEA 5LYDA 1ZLIA 4WWVA 1BLLE 3ISZA 3KR5A 3FF3A 4NFRA 4ZY0A 1ZG9A 3WC7A 1GYTA 3SI0A 1HEEA 2Q51A 3WT4A 4OC5A 4CPAA 4CDJA 5IB9A 4MXUA 3RZAA 1ARLA 2BOAA 2OOTA 4P4EA 3K9TA 2QJ8A 2PJ1A 4ZY1A 2IQ6A 2JBKA 5LRKA 1ELMP 4F8ZA 4C9RA 3B3WA 2F7VA 3BXMA 4P4FA 4LQGA 3MN8A 5I4MA 4JYWA 3ISXA 4GM5A 2AFWA 1OBRA 1ARMA 2ZEFA 3B3VA 3V38A 1TKHA 2PJ0A 4FWUA 4DUKA 3I74A 4C9VA 3CT9A 4OC1A 1YW6A 3B7IA 3LWUA 3FEDA 4TJXA 4PXEA 3BHXA 4P44A 2AFXA 2V8DA 2AFSA 4NJQA 3EIFA 4R8FA 1CBXA 4MCRA 3CDXA 2ABZA 3VARA 4FAIA 1Z5RA 2GLJA 3HLPA 1M4LA 4MMOA 5CPAA 4YWYA 2C6CA 2F8HA 1BAVA 4MHPA 4R76A 4IAVA 2PCUA 3KASA 4P6YA 5J1QA 4C9EA 2ZOGA 1IY7A 3PB6X 3PRTA 3PEIA 4K3NA 3LMSA 2PJ7A 3KGQA 3FECA 3CPAA 4OC3A 5HXDA 2XEJA 2PIYA 2XEFA 3D7DA 3QNVA 4MHYA 4X8IA 4NGPA 1F2PA 2O4HA 4X2TA 1EE3P 4P10A 3GB0A 5LYIA 1CG2A 6CPAA 1QMUA 2ZEGA 4MRIA 2V8VA 2O53A 3B3CA 1FNOA 4OKOA 1IGBA 4ONWA 2CTCA 1YMEA 2PRQA 4EFDA 3IIBA 2EK9A 5JGFA 1XBUA 2ZELA 3V7ZA 3WC5A 5CBMA 3SI2A 3TC8A 2RB7A 4CDKA 4A94A 1VGYA 4OC0A 3FX6A 2AFZA 4A39A 5LRJA 2ZEEA 2CIJA 2XEGA 1AMPA 3CPXA 1QQ9A 3D66A 3D7FA 2BO9A 3BI0A 1ZG7A 2DEAA 3PB8X 1R43A 2C1CA 2CTBA 3FJUA 2EK8A 5ELYA 1RTQA 3VH9A 3NH5A 4OIWA 4P45A 4NGSA
chains in the Genus database with same CATH superfamily
1CPXA 3D7HA 1Y7RA 2Q4ZA 4KOXA 1DIKA 4CZ1A 1YW4A 3SXOA 2JBJA 2ZEMA 4R9MA 2DIKA 3C8OA 4KORA 8CPAA 4HNYB 3QAYA 1CX8A 3D8PA 2EWBA 2OH1A 5DS0A 2V8HA 4DYOA 5HXDA 1CP7A 4RN7A 4MFJA 3H8GA 1Z2LA 2A4NA 2B4DB 4KOTA 4WJBA 3S9LA 2R8VA 5K8PA 4KNGE 1JWQA 1XRYA 2OZGA 3S9MA 4IHMA 4CGOA 1J3LA 3OWCA 3SJGA 2IJZA 2JEVA 2FE7A 1B47A 1B6BA 4B12A 4BD9A 4YN3A 1UWYA 2I00A 2P6EA 2ARHA 3L2NA 2FIAA 4MHZA 5KTCA 3VRQA 4E5SA 3F0AA 4X3RA 2D4PA 3I1UA 3K9UA 1HDUA 4HNWB 2PJ2A 1MJBA 1I12A 1OZPA 1Y0RA 3DGVA 3D7GA 4Z65A 1WWZA 2KCWA 3NA6A 4AB7A 3O8ZA 2EZCA 4KUBA 1LCPA 2BL1A 2V77A 2ZW6A 1NBWA 4C8UA 1NSLA 1M4IA 3RYOA 4B14A 2EZBA 4C86A 2OR4A 1VHEA 2AUMA 1DE4C 4YU9A 3KZWA 4OC4A 1BPMA 3VWEA 3NE8A 4F9VA 2P6GA 4DJLA 5AGEA 3OB2B 2X7BA 2ZXVA 4NEXA 4P4DA 1Q2CA 3T9YA 1S7LA 3TLBA 5HKYA 1NSAA 3KHXA 4U9YA 4PQAA 2WSAA 2Z3KA 2B4JC 4H89A 2PJ8A 3SJEA 4ZX9A 3PFEA 3FNCA 1JQGA 4A30A 2WYRA 2ZENA 2ZEPA 2EUIA 2OZHA 4UEEA 4C68A 5LYLA 1Q5XA 3S6HA 2PJCA 4P4IA 1IYLA 3EY5A 1I21A 3HUVA 3S6KA 5K8NA 4M6IA 4KSIA 3VATA 4UCNA 2XPNA 3EXNA 4KVME 1R3NA 4TWEA 4YRHA 2I79A 2Z3LA 3JVNA 3N5FA 1CJWA 4AVAA 3IGRA 4F6AA 4R6TA 4JXRA 1VHOA 1X12A 4E94A 3H8EA 3VROA 3NFZA 3KHZA 5HVFA 3SJXA 1YLOA 1Y0YA 4A32A 1CE8B 4MFKA 2NYQA 5GCNA 4NGRA 1Z9EA 1Z4RA 1H8LA 3IFEA 4AXVA 3SR3A 4A4CA 1Z8LA 3KQZA 4TJVA 3FH4A 1ZG8A 4C8FA 5IR2A 3FIXA 3I9SA 2PR1A 1GHEA 2POKA 2BCOA 4II9A 1LOKA 2HC9A 5D29A 2V8GA 1LAMA 2VEZA 1TF8A 4AVCA 4PSXA 3VRRA 1P4NA 2GLFA 4KSAA 4C7IA 3PGPA 3FVLA 1L0CA 3F8KA 5F09A 1TIQA 4HKFA 4OP4A 5G21A 2WPWA 3RAMA 4B5OA 4CGMA 3IU2A 4RUHA 5KTDA 4UIAA 1IOIA 2HB6A 1YQEA 3IC1A 3SJFA 2P6FA 5KTAA 1UFHA 3P2HA 4CGPA 2REEA 5ISVA 1CS0B 3S9NA 4UA3A 4MCPA 3VTAA 3VGOA 3MRUA 4TNUA 4KZTA 2FSRA 4KLVA 4DNCA 2PDOA 4MBUA 5JM6A 2VQYA 1V6CA 4H1HA 4NSQA 4RR2B 2HWGA 4M8DA 1BXRB 3KRVA 5J8FA 3T0TA 3PB4X 4Y49C 4C8CA 1V0CA 1ZLHA 4GXHA 4F9UA 1LANA 1S7FA 1XEBA 3T8WA 3TX8A 1WJTA 3K2KA 4MI1A 3R9GA 3HMJG 4C8TA 1IB1E 4C9UA 4KOSA 4F0XA 4IF5A 3GUXA 3S6FA 3HPHE 1CPSA 1WK4A 2J9AA 4QB9A 2CBLA 2Q44A 4JJXA 4CAEA 2K5TA 4ORFA 1VBHA 3ICUA 1FY7A 3DDDA 1NE9A 2CY2A 4KVOE 4B10A 4CAWA 3TOBA 2C6PA 4B6ZA 2Q7BA 1R61A 1TKFA 1CP6A 2ZW5A 4JLYA 3R95A 2PVVA 1FT7A 2EZAA 3RBUA 4BBHA 2H5MA 3KI9A 2WPXA 2C6GA 4BTFA 3D67A 3PBBA 2HI6A 4ONUA 5DWNA 1VI4A 3G23A 1PUAA 2FS5A 4AG7A 2PQ8A 3TE4A 1Y9ZA 3BI1A 5AG4A 1SQHA 4B5PA 4CGLA 3PT1A 1LRZA 3B35A 5IB0A 4EMEA 4OIDA 5F46A 3KR4A 2AUNA 3IWEA 4MCSA 4OMEA 1BO4A 1ELLP 3SXNA 4NGNA 1XJOA 2GFQA 2ZEOA 1PYTB 2DPTA 3BUNB 3BLNA 2R7HA 4NCZA 1Q2YA 4I49A 2Q4YA 1XFOA 2HV2A 1S7KA 2JDCA 3R96A 3EZAA 3IEHA 3H8FA 5F5XA 4UWIA 2CXAA 4W9YA 2PJ3A 2J8RA 4XPDC 4PXDA 5D8NA 4MY0A 3CXPA 3VRPA 3GIUA 1J4JA 4G1PA 4UEZA 3WABA 4A37A 3PBEA 1VIXA 2G9DA 4JXQA 3TO9A 1FBVA 2IMOA 2JLMA 4PPZA 2QYVA 2ANPA 2PJBA 1LAPA 3SI1A 3GLJA 4BPUB 1K4JA 1YGHA 2Z10A 1XIXA 4CYQA 2XPPA 3IO1A 3CZXA 2PIZA 4H6ZA 3NOJA 2FVGA 1XF1A 3B3SA 2Q7SA 2YNCA 3TLGA 3ZJ0A 1F2OA 2ZEDA 3H4QA 4EYSA 3G3SA 1KUYA 3S6GA 4CS0B 2GANA 3TLEA 4C9AA 2JDDA 2NSMA 4A38A 4OC2A 4UEFA 3FXTA 5K8OA 2DF5A 4NGMA 4B5PB 5JH9A 2YJTA 4MHNA 3H5ZA 3PFOA 2GU2A 3TO7A 3BUWB 1DTDA 4M6HA 4Q38A 4UCPA 2GIVA 3IWWA 4CYPA 3VRNA 2PVWA 5K8MA 2Z11A 4MCQA 2RFHA 1LFWA 4MFQA 3G8WA 1X10A 2AFUA 2Y1NA 2CNSA 3NH4A 3TTHA 4P4JA 4LUAA 4FBEA 4JZ0A 3PFVA 1TXRA 3R9FA 2PJ9A 2PJ4A 1ZO0A 2VKZG 4PXCA 3OB1B 5G1ZA 2B58A 5IX3A 4C8AA 2Z0ZA 3GJZA 3PB7X 3DNSA 4MHDA 4OAEA 5THWA 2Q0YA 2VZYA 1M1DA 4ZGYB 3KQXA 4UWJA 2QIRA 5F49A 4GS4A 1WVMA 1YVOA 2J8MA 2X0SA 4IUSA 2GREA 4CAFA 7CPAA 4NGTA 4FUUA 4C99A 3EC4A 3PLFB 4UIBA 3TLGB 4O23A 2AFMA 4Q7AA 2ZPAA 1PCAA 1VHSA 3W6SA 4JVOA 4C8PA 2PJ6A 1HDQA 3FMCA 4C2XA 1M4GA 4XNHC 4ZYQA 2VZZA 1S3ZA 3I6SA 5HVHA 3FB3A 3IWGA 3IJ3A 1Q2DA 4UFVA 3HPGG 4C2YA 1KC7A 1XMBA 1YSJA 4PK3A 3JRUA 3DR8A 2XEIA 1S5KA 4UBRA 1TKJA 4NJRA 2E28A 4R7MA 4QBJA 2AFOA 2VL1A 3BUXB 1MK4A 2WZNA 4MJXA 1TF9A 1YR0A 4H2KA 3B3TA 4IK2A 4XPKA 2PJAA 1MJ9A 4EWTA 1XOVA 3TLYA 2YNCC 4CAVA 4MFZA 2FM4A 2B3UA 2WUUA 2Z3NA 4PK2A 3FEEA 2Q43A 3DLJA 5H84A 4KUAA 5DWMA 1Z8TA 2PE3A 3B2YA 5JQ4A 4C84A 1MJAA 2ZOFA 5JYBA 2R82A 4Y49B 2PR8A 2CF4A 1CM0A 4UF4A 2D0OA 5F1YA 3EZEA 5A27A 4E2AA 1KWMA 2AE6A 2I3CA 1F57A 4MFLA 5LYFA 4PSWA 1T36B 2ZEHA 3FBUA 3JUWA 1RXTA 2Q4VA 5LRGA 3EZBA 4JD6A 4MJ8A 3UY5A 2PJ5A 4U5YA 1YLEA 2BSWA 4PXBA 5HVGA 4NGQA 3WC6A 3EFAA 4C85A 2C27A 4A95A 4RI1A 2BEIA 4OLLA 2JEWA 2D4OA 3TO6A 2B5GA 4CGNA 2J8NA 4KLWA 2GE3A 2FCKA 3BUMB 4ZX8A 1M6VB 2OU2A 1JDBC 3PB9X 3TLZA 3NH8A 2QECA 2QVPA 3DSBA 3KL9A 1RO5A 1BPNA 1Q7LA 2F5IA 3TCVA 5BWAB 2PCNA 4IIXA 1YVHA 4X5KA 4P4BA 3BJ8A 2NMTA 3D68A 4ZI6A 1Y7EA 3D4UA 5EMIA 1AYEA 2BUEA 4ZY2A 2YJVA 2DXQA 4A31A 1P0HA 5FVJA 1XF8A 2EBJA 5LYDA 4B13A 1ZLIA 2C5QA 3GKRA 3E0KA 4XPDB 1GGOA 3EO4A 4WWVA 3U88C 1BLLE 3ISZA 3KR5A 1C3OB 2D0PA 4IIYA 3TLAA 3QAHA 3FF3A 1QSRA 4NFRA 2Y1MA 3OAKA 1ZG9A 1QSTA 3BJ7A 3LD2A 5F47A 3WC7A 3D2PA 4J3GA 4ZY0A 1GYTA 3SI0A 2REFA 5IV0A 1HEEA 2Q51A 5BY0A 2B4DA 4BINA 3QB8A 1KBLA 3TT2A 4B11A 1AUGA 5HKWA 3TOAA 3WT4A 4OC5A 4CPAA 4HNXB 4E8OA 4CDJA 1IYKA 1ON0A 4FD6A 3BUOB 2B5GB 5IB9A 1NXJA 1EZBA 2O28A 4KOVA 4MXUA 4UFXA 1XE4A 3RZAA 5A28A 2XPOA 3IU1A 2GP4A 1ARLA 4XPLA 4A4BA 2CNTA 4H6UA 2YNEA 5F13A 2BOAA 2HQYA 4KOYA 2OOTA 4P4EA 2G0BA 3KKWA 3PP9A 4UFWA 3K9TA 2QJ8A 4R3KA 2PJ1A 2DLAA 4ZY1A 2Z3OA 2IQ6A 2ODFA 1Y9WA 3CXQA 2OLSA 2JBKA 1I1DA 5LRKA 1ELMP 4F8ZA 4C9RA 3B3WA 5AG5A 2F7VA 3BXMA 4P4FA 4LQGA 3MN8A 3NE7A 2P0WA 5I4MA 4JYWA 2EO8A 2RC4A 3F9KC 3B8GA 3ISXA 4GM5A 2AFWA 1OBRA 1ARMA 2B4BA 2ZEFA 3W91A 3B3VA 5F9MA 4MY3A 5HH1A 3V38A 2YGWA 1TKHA 4CRYB 3CXSA 2PJ0A 2ZW4A 4R87A 4C7HA 4INJA 4FWUA 4DUKA 4E0AA 3I74A 1QSOA 3T05A 4C9VA 1QSMA 3CT9A 4OC1A 1YW6A 2PC1A 4QC6A 3B7IA 3LWUA 1EO0A 5EC4A 3TFYA 2XPLA 2FT0A 3FEDA 2YNDA 3FRMA 4TJXA 4XNHB 3GY9A 3BHXA 1A2ZA 4PXEA 5JVLA 4P44A 3VWDA 1YVKA 2AFXA 2V8DA 4R3LA 4EVYA 5AG6A 4COBA 2AFSA 4NJQA 4NF1A 4R8FA 3EIFA 1CBXA 1A9XB 1M4DA 4MCRA 1NMTA 1Z8XA 2G3AA 2ABZA 2IL4A 3CDXA 3LODA 2PRBA 3VARA 4KSFA 4FAIA 1KEEB 1Z5RA 2PSWA 2GLJA 3HLPA 2UV8G 1Y9KA 5I0CA 3I3GA 2EVNA 2DPSA 1M4LA 4MMOA 4U9ZA 5CPAA 4YWYA 5CNPA 2OZUA 4CO9A 2C6CA 1KUXA 4FD4A 2ATRA 2F8HA 5HKZA 3T90A 3P2FA 1BAVA 4MHPA 2OB0A 4R76A 4IAVA 1S60A 5C88A 2PCUA 3KASA 4P6YA 5J1QA 4L89A 4C9EA 4COGA 2ZOGA 4ZBGA 3K4IA 3TYXA 4QVTA 3TLCA 4CRZB 3T07A 1IY7A 5AXIA 3PB6X 4J0NA 5J3XA 3A9LA 1ZYMA 4LX9A 5E96A 3PRTA 1YK3A 1M44A 1XMTA 2HUZA 3D3SA 3PEIA 4YFJA 3R1KA 3LMSA 2PJ7A 3KGQA 4K3NA 4MI4A 3FECA 2Q04A 3CPAA 1ZL0A 4OC3A 3V8IA 2XEJA 1KUVA 2XEFA 3D7DA 2PIYA 2FIWA 3QNVA 2R98A 4MHYA 2N3AB 4Q36A 5EBVA 1C30B 4X8IA 4M3SA 4NGPA 1YX0A 1B87A 1F2PA 2O4HA 2G3TA 1PU9A 4MFPA 5F48A 3R9EA 4PV6A 3U1BA 4K30A 4X2TA 1JDEA 1EE3P 4P10A 2VXKA 3C26A 3GB0A 1IIDA 1IU8A 5G22A 1YREA 5LYIA 1CG2A 4AVBA 6CPAA 1QMUA 2FXFA 2B0AA 2ZEGA 4MRIA 2V8VA 2O53A 3B3CA 1FNOA 4OKOA 1IGBA 2B3VA 3N7ZA 3W6XA 4FD5A 2QMLA 4ONWA 2CTCA 4QUSA 4YGOA 4AG9A 5C82A 1YMEA 4M85A 2PRQA 5HMNA 3OP0A 4EFDA 2CNMA 3IIBA 2Z3PA 1IICA 4JWPA 2EK9A 4NXYA 5JGFA 1XBUA 4BPWB 2ZELA 4FD7A 5H86A 3V7ZA 3WC5A 2HROA 1IOFA 5CBMA 3SI2A 2FL4A 3ZNIA 3TC8A 5FD8A 2RB7A 4CDKA 4A94A 4C2ZA 1VGYA 5G20A 1EZAA 4OC0A 3D2MA 3FX6A 3NFQA 3RO0A 1ZRSA 2AFZA 4CAXA 4A33A 4A39A 4BMHA 5LRJA 1QSNA 4CYOA 3DR6A 1KZFA 2AJ6A 1R57A 4KOWA 3WR7A 5JPHA 2ZEEA 2CIJA 1Z4EA 4KOUA 1N71A 4KVXA 3SHPA 3T5MA 2XEGA 1AMPA 3F5BA 4BPXB 5AG7A 4HPSA 3CPXA 1QQ9A 1Z8WA 3GYAA 3D66A 3PZJA 4L8AA 3D7FA 2BO9A 4LQ6A 3BI0A 1ZG7A 2DEAA 3JTKA 3PB8X 1R43A 1U6MA 2C1CA 4OADA 3MGDA 3LACA 5K99A 3ZZIA 4RS2A 2CTBA 3FJUA 4KS9A 2ZW7A 4UCMA 3RNZA 1Z9UA 3FYNA 2EK8A 1S7NA 4CYNA 5ELYA 2R1IA 2Y0MA 1VBGA 5J8CA 1BOBA 4R57A 1VKCA 2VBQA 4M6GA 4A2ZA 4F0YA 1RTQA 4GPLB 3VH9A 2VI7A 2MP0A 3NH5A 4OIWA 4P45A 2Z3MA 4NGSA
chains in the Genus database with same CATH topology
1CPXA 3D7HA 2Q4ZA 1YW4A 2JBJA 2ZEMA 8CPAA 1CX8A 2EWBA 5DS0A 2V8HA 4DYOA 1CP7A 3H8GA 1Z2LA 4WJBA 3S9LA 5K8PA 4KNGE 1XRYA 4IHMA 3S9MA 3SJGA 2IJZA 4BD9A 4YN3A 1UWYA 3L2NA 4MHZA 4X3RA 3I1UA 1HDUA 2PJ2A 1Y0RA 3DGVA 3D7GA 4Z65A 3NA6A 1LCPA 2V77A 4C8UA 4C86A 2OR4A 1VHEA 1DE4C 4YU9A 3KZWA 4OC4A 1BPMA 4F9VA 4DJLA 4P4DA 1NSAA 3KHXA 4PQAA 2PJ8A 3SJEA 4ZX9A 3PFEA 1JQGA 2WYRA 2ZENA 2ZEPA 4UEEA 5LYLA 2PJCA 4P4IA 3HUVA 5K8NA 4KSIA 3VATA 4TWEA 1R3NA 3N5FA 4R6TA 1VHOA 3H8EA 3NFZA 3KHZA 5HVFA 3SJXA 1YLOA 1Y0YA 2NYQA 4NGRA 1H8LA 3IFEA 4AXVA 1Z8LA 3KQZA 4TJVA 3FH4A 1ZG8A 4C8FA 5IR2A 2POKA 2BCOA 1LOKA 2HC9A 5D29A 2V8GA 1LAMA 1TF8A 2GLFA 3FVLA 5F09A 4OP4A 3RAMA 4RUHA 4UIAA 2HB6A 3IC1A 3SJFA 3S9NA 4MCPA 3VTAA 3MRUA 4TNUA 5JM6A 1V6CA 3PB4X 4C8CA 1ZLHA 4F9UA 1LANA 3T8WA 3TX8A 3K2KA 4C8TA 4C9UA 3GUXA 1CPSA 2J9AA 3ICUA 4B6ZA 2C6PA 1TKFA 1CP6A 2PVVA 1FT7A 3RBUA 3KI9A 2C6GA 3D67A 3PBBA 1Y9ZA 3BI1A 3B35A 4EMEA 4OIDA 3KR4A 4MCSA 4OMEA 1ELLP 4NGNA 1XJOA 2ZEOA 1PYTB 1XFOA 3IEHA 3H8FA 4W9YA 2PJ3A 4PXDA 5D8NA 4A37A 4UEZA 4G1PA 3WABA 3PBEA 1VIXA 2G9DA 2IMOA 4PPZA 2QYVA 2ANPA 2PJBA 1LAPA 3SI1A 3GLJA 3IO1A 2PIZA 2FVGA 1XF1A 3B3SA 1F2OA 2ZEDA 4C9AA 4A38A 2NSMA 4OC2A 4UEFA 5K8OA 4NGMA 5JH9A 4MHNA 3PFOA 2GU2A 1DTDA 3IWWA 5K8MA 2PVWA 4MCQA 2RFHA 1LFWA 2AFUA 3NH4A 4FBEA 4P4JA 4JZ0A 1TXRA 2PJ9A 2PJ4A 4PXCA 4C8AA 3PB7X 5THWA 3KQXA 1WVMA 4C99A 2GREA 7CPAA 4NGTA 4FUUA 4UIBA 4O23A 2AFMA 4Q7AA 1PCAA 4C8PA 2PJ6A 1HDQA 3FMCA 4ZYQA 3I6SA 5HVHA 3IJ3A 1XMBA 1YSJA 3JRUA 2XEIA 1TKJA 4NJRA 4R7MA 2AFOA 2VL1A 2WZNA 1TF9A 4H2KA 3B3TA 4IK2A 2PJAA 4EWTA 3FEEA 2Q43A 3DLJA 2PE3A 3B2YA 4C84A 2ZOFA 2CF4A 4UF4A 1KWMA 2I3CA 5LYFA 1F57A 2ZEHA 5LRGA 2PJ5A 4PXBA 5HVGA 4NGQA 3WC6A 4C85A 2JEWA 4ZX8A 3PB9X 3NH8A 2QVPA 3KL9A 1BPNA 1Q7LA 4P4BA 4ZI6A 3D68A 1Y7EA 3D4UA 4ZY2A 1AYEA 5LYDA 1ZLIA 2C5QA 4WWVA 1BLLE 3ISZA 3KR5A 3FF3A 4NFRA 4ZY0A 1ZG9A 3WC7A 1GYTA 3SI0A 1HEEA 2Q51A 3WT4A 4OC5A 4CPAA 4CDJA 5IB9A 4MXUA 3RZAA 2GP4A 1ARLA 2BOAA 2OOTA 4P4EA 3K9TA 2QJ8A 2PJ1A 4ZY1A 2IQ6A 2JBKA 5LRKA 1ELMP 4F8ZA 4C9RA 3B3WA 2F7VA 3BXMA 4P4FA 4LQGA 3MN8A 5I4MA 4JYWA 3ISXA 4GM5A 2AFWA 1OBRA 1ARMA 2ZEFA 3B3VA 3V38A 1TKHA 2PJ0A 4FWUA 4DUKA 3I74A 4C9VA 3CT9A 4OC1A 1YW6A 3B7IA 3LWUA 3FEDA 4TJXA 4PXEA 3BHXA 4P44A 2AFXA 2V8DA 2AFSA 4NJQA 3EIFA 4R8FA 1CBXA 4MCRA 3CDXA 2ABZA 3VARA 4FAIA 1Z5RA 2GLJA 3HLPA 1M4LA 4MMOA 5CPAA 4YWYA 2C6CA 2F8HA 1BAVA 4MHPA 4R76A 4IAVA 2PCUA 3KASA 4P6YA 5J1QA 4C9EA 2ZOGA 1IY7A 3PB6X 3PRTA 3PEIA 4K3NA 3LMSA 2PJ7A 3KGQA 3FECA 3CPAA 4OC3A 5HXDA 2XEJA 2PIYA 2XEFA 3D7DA 3QNVA 4MHYA 4X8IA 4NGPA 1F2PA 2O4HA 4X2TA 1EE3P 4P10A 3GB0A 5LYIA 1CG2A 6CPAA 1QMUA 2ZEGA 4MRIA 2V8VA 2O53A 3B3CA 1FNOA 4OKOA 1IGBA 4ONWA 2CTCA 1YMEA 2PRQA 4EFDA 3IIBA 2EK9A 5JGFA 1XBUA 2ZELA 3V7ZA 3WC5A 5CBMA 3SI2A 3TC8A 2RB7A 4CDKA 4A94A 1VGYA 4OC0A 3FX6A 2AFZA 4A39A 5LRJA 2ZEEA 2CIJA 2XEGA 1AMPA 3CPXA 1QQ9A 3D66A 3D7FA 2BO9A 3BI0A 1ZG7A 2DEAA 3PB8X 1R43A 2C1CA 2CTBA 3FJUA 2EK8A 5ELYA 1RTQA 3VH9A 3NH5A 4OIWA 4P45A 4NGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CPX A;  3D7H A;  2Q4Z A;  1YW4 A;  2JBJ A;  2ZEM A;  8CPA A;  1CX8 A;  2EWB A;  5DS0 A;  2V8H A;  4DYO A;  1CP7 A;  3H8G A;  1Z2L A;  4WJB A;  3S9L A;  5K8P A;  4KNG E;  1XRY A;  4IHM A;  3S9M A;  3SJG A;  2IJZ A;  4BD9 A;  4YN3 A;  1UWY A;  3L2N A;  4MHZ A;  4X3R A;  3I1U A;  1HDU A;  2PJ2 A;  1Y0R A;  3DGV A;  3D7G A;  4Z65 A;  3NA6 A;  1LCP A;  2V77 A;  4C8U A;  4C86 A;  2OR4 A;  1VHE A;  1DE4 C;  4YU9 A;  3KZW A;  4OC4 A;  1BPM A;  4F9V A;  4DJL A;  4P4D A;  1NSA A;  3KHX A;  4PQA A;  2PJ8 A;  3SJE A;  4ZX9 A;  3PFE A;  1JQG A;  2WYR A;  2ZEN A;  2ZEP A;  4UEE A;  5LYL A;  2PJC A;  4P4I A;  3HUV A;  5K8N A;  4KSI A;  3VAT A;  4TWE A;  1R3N A;  3N5F A;  4R6T A;  1VHO A;  3H8E A;  3NFZ A;  3KHZ A;  5HVF A;  3SJX A;  1YLO A;  1Y0Y A;  2NYQ A;  4NGR A;  1H8L A;  3IFE A;  4AXV A;  1Z8L A;  3KQZ A;  4TJV A;  3FH4 A;  1ZG8 A;  4C8F A;  2POK A;  2BCO A;  1LOK A;  2HC9 A;  5D29 A;  2V8G A;  1LAM A;  1TF8 A;  2GLF A;  3FVL A;  5F09 A;  4OP4 A;  3RAM A;  4RUH A;  4UIA A;  2HB6 A;  3IC1 A;  3SJF A;  3S9N A;  4MCP A;  3VTA A;  3MRU A;  4TNU A;  5JM6 A;  1V6C A;  3PB4 X;  4C8C A;  1ZLH A;  4F9U A;  1LAN A;  3T8W A;  3TX8 A;  3K2K A;  4C8T A;  4C9U A;  3GUX A;  1CPS A;  2J9A A;  3ICU A;  4B6Z A;  2C6P A;  1TKF A;  1CP6 A;  2PVV A;  1FT7 A;  3RBU A;  3KI9 A;  2C6G A;  3D67 A;  3PBB A;  1Y9Z A;  3BI1 A;  3B35 A;  4EME A;  4OID A;  3KR4 A;  4MCS A;  4OME A;  1ELL P;  4NGN A;  1XJO A;  2ZEO A;  1PYT B;  1XFO A;  3IEH A;  3H8F A;  4W9Y A;  2PJ3 A;  4PXD A;  5D8N A;  4A37 A;  4UEZ A;  4G1P A;  3WAB A;  3PBE A;  1VIX A;  2G9D A;  2IMO A;  4PPZ A;  2QYV A;  2ANP A;  2PJB A;  1LAP A;  3SI1 A;  3GLJ A;  3IO1 A;  2PIZ A;  2FVG A;  1XF1 A;  3B3S A;  1F2O A;  2ZED A;  4C9A A;  4A38 A;  2NSM A;  4OC2 A;  4UEF A;  5K8O A;  4NGM A;  5JH9 A;  4MHN A;  3PFO A;  2GU2 A;  1DTD A;  3IWW A;  5K8M A;  2PVW A;  4MCQ A;  2RFH A;  1LFW A;  2AFU A;  3NH4 A;  4FBE A;  4P4J A;  4JZ0 A;  1TXR A;  2PJ9 A;  2PJ4 A;  4PXC A;  4C8A A;  3PB7 X;  5THW A;  3KQX A;  1WVM A;  4C99 A;  2GRE A;  7CPA A;  4NGT A;  4FUU A;  4UIB A;  4O23 A;  2AFM A;  4Q7A A;  1PCA A;  4C8P A;  2PJ6 A;  1HDQ A;  3FMC A;  4ZYQ A;  3I6S A;  5HVH A;  3IJ3 A;  1XMB A;  1YSJ A;  3JRU A;  2XEI A;  1TKJ A;  4NJR A;  4R7M A;  2AFO A;  2VL1 A;  2WZN A;  1TF9 A;  4H2K A;  3B3T A;  4IK2 A;  2PJA A;  4EWT A;  3FEE A;  2Q43 A;  3DLJ A;  2PE3 A;  3B2Y A;  4C84 A;  2ZOF A;  2CF4 A;  4UF4 A;  1KWM A;  2I3C A;  5LYF A;  1F57 A;  2ZEH A;  5LRG A;  2PJ5 A;  4PXB A;  5HVG A;  4NGQ A;  3WC6 A;  4C85 A;  2JEW A;  4ZX8 A;  3PB9 X;  3NH8 A;  2QVP A;  3KL9 A;  1BPN A;  1Q7L A;  4P4B A;  4ZI6 A;  3D68 A;  1Y7E A;  3D4U A;  4ZY2 A;  1AYE A;  5LYD A;  1ZLI A;  4WWV A;  1BLL E;  3ISZ A;  3KR5 A;  3FF3 A;  4NFR A;  4ZY0 A;  1ZG9 A;  3WC7 A;  1GYT A;  3SI0 A;  1HEE A;  2Q51 A;  3WT4 A;  4OC5 A;  4CPA A;  4CDJ A;  5IB9 A;  4MXU A;  3RZA A;  1ARL A;  2BOA A;  2OOT A;  4P4E A;  3K9T A;  2QJ8 A;  2PJ1 A;  4ZY1 A;  2IQ6 A;  2JBK A;  5LRK A;  1ELM P;  4F8Z A;  4C9R A;  3B3W A;  2F7V A;  3BXM A;  4P4F A;  4LQG A;  3MN8 A;  5I4M A;  4JYW A;  3ISX A;  4GM5 A;  2AFW A;  1OBR A;  1ARM A;  2ZEF A;  3B3V A;  3V38 A;  1TKH A;  2PJ0 A;  4FWU A;  4DUK A;  3I74 A;  4C9V A;  3CT9 A;  4OC1 A;  1YW6 A;  3B7I A;  3LWU A;  3FED A;  4TJX A;  4PXE A;  3BHX A;  4P44 A;  2AFX A;  2V8D A;  2AFS A;  4NJQ A;  3EIF A;  4R8F A;  1CBX A;  4MCR A;  3CDX A;  2ABZ A;  3VAR A;  4FAI A;  1Z5R A;  2GLJ A;  3HLP A;  1M4L A;  4MMO A;  5CPA A;  4YWY A;  2C6C A;  2F8H A;  1BAV A;  4MHP A;  4R76 A;  4IAV A;  2PCU A;  3KAS A;  4P6Y A;  5J1Q A;  4C9E A;  2ZOG A;  1IY7 A;  3PB6 X;  3PRT A;  3PEI A;  4K3N A;  3LMS A;  2PJ7 A;  3KGQ A;  3FEC A;  3CPA A;  4OC3 A;  5HXD A;  2XEJ A;  2PIY A;  2XEF A;  3D7D A;  3QNV A;  4MHY A;  4X8I A;  4NGP A;  1F2P A;  2O4H A;  4X2T A;  1EE3 P;  4P10 A;  3GB0 A;  5LYI A;  1CG2 A;  6CPA A;  1QMU A;  2ZEG A;  4MRI A;  2V8V A;  2O53 A;  3B3C A;  1FNO A;  4OKO A;  1IGB A;  4ONW A;  2CTC A;  1YME A;  2PRQ A;  4EFD A;  3IIB A;  2EK9 A;  5JGF A;  1XBU A;  2ZEL A;  3V7Z A;  3WC5 A;  5CBM A;  3SI2 A;  3TC8 A;  2RB7 A;  4CDK A;  4A94 A;  1VGY A;  4OC0 A;  3FX6 A;  2AFZ A;  4A39 A;  5LRJ A;  2ZEE A;  2CIJ A;  2XEG A;  1AMP A;  3CPX A;  1QQ9 A;  3D66 A;  3D7F A;  2BO9 A;  3BI0 A;  1ZG7 A;  2DEA A;  3PB8 X;  1R43 A;  2C1C A;  2CTB A;  3FJU A;  2EK8 A;  5ELY A;  1RTQ A;  3VH9 A;  3NH5 A;  4OIW A;  4P45 A;  4NGS A; 
#chains in the Genus database with same CATH topology
 1CPX A;  3D7H A;  1Y7R A;  2Q4Z A;  4KOX A;  1DIK A;  4CZ1 A;  1YW4 A;  3SXO A;  2JBJ A;  2ZEM A;  4R9M A;  2DIK A;  3C8O A;  4KOR A;  8CPA A;  4HNY B;  3QAY A;  1CX8 A;  3D8P A;  2EWB A;  2OH1 A;  5DS0 A;  2V8H A;  4DYO A;  5HXD A;  1CP7 A;  4RN7 A;  4MFJ A;  3H8G A;  1Z2L A;  2A4N A;  2B4D B;  4KOT A;  4WJB A;  3S9L A;  2R8V A;  5K8P A;  4KNG E;  1JWQ A;  1XRY A;  2OZG A;  3S9M A;  4IHM A;  4CGO A;  1J3L A;  3OWC A;  3SJG A;  2IJZ A;  2JEV A;  2FE7 A;  1B47 A;  1B6B A;  4B12 A;  4BD9 A;  4YN3 A;  1UWY A;  2I00 A;  2P6E A;  2ARH A;  3L2N A;  2FIA A;  4MHZ A;  5KTC A;  3VRQ A;  4E5S A;  3F0A A;  4X3R A;  2D4P A;  3I1U A;  3K9U A;  1HDU A;  4HNW B;  2PJ2 A;  1MJB A;  1I12 A;  1OZP A;  1Y0R A;  3DGV A;  3D7G A;  4Z65 A;  1WWZ A;  2KCW A;  3NA6 A;  4AB7 A;  3O8Z A;  2EZC A;  4KUB A;  1LCP A;  2BL1 A;  2V77 A;  2ZW6 A;  1NBW A;  4C8U A;  1NSL A;  1M4I A;  3RYO A;  4B14 A;  2EZB A;  4C86 A;  2OR4 A;  1VHE A;  2AUM A;  1DE4 C;  4YU9 A;  3KZW A;  4OC4 A;  1BPM A;  3VWE A;  3NE8 A;  4F9V A;  2P6G A;  4DJL A;  5AGE A;  3OB2 B;  2X7B A;  2ZXV A;  4NEX A;  4P4D A;  1Q2C A;  3T9Y A;  1S7L A;  3TLB A;  5HKY A;  1NSA A;  3KHX A;  4U9Y A;  4PQA A;  2WSA A;  2Z3K A;  2B4J C;  4H89 A;  2PJ8 A;  3SJE A;  4ZX9 A;  3PFE A;  3FNC A;  1JQG A;  4A30 A;  2WYR A;  2ZEN A;  2ZEP A;  2EUI A;  2OZH A;  4UEE A;  4C68 A;  5LYL A;  1Q5X A;  3S6H A;  2PJC A;  4P4I A;  1IYL A;  3EY5 A;  1I21 A;  3HUV A;  3S6K A;  5K8N A;  4M6I A;  4KSI A;  3VAT A;  4UCN A;  2XPN A;  3EXN A;  4KVM E;  1R3N A;  4TWE A;  4YRH A;  2I79 A;  2Z3L A;  3JVN A;  3N5F A;  1CJW A;  4AVA A;  3IGR A;  4F6A A;  4R6T A;  4JXR A;  1VHO A;  1X12 A;  4E94 A;  3H8E A;  3VRO A;  3NFZ A;  3KHZ A;  5HVF A;  3SJX A;  1YLO A;  1Y0Y A;  4A32 A;  1CE8 B;  4MFK A;  2NYQ A;  5GCN A;  4NGR A;  1Z9E A;  1Z4R A;  1H8L A;  3IFE A;  4AXV A;  3SR3 A;  4A4C A;  1Z8L A;  3KQZ A;  4TJV A;  3FH4 A;  1ZG8 A;  4C8F A;  5IR2 A;  3FIX A;  3I9S A;  2PR1 A;  1GHE A;  2POK A;  2BCO A;  4II9 A;  1LOK A;  2HC9 A;  5D29 A;  2V8G A;  1LAM A;  2VEZ A;  1TF8 A;  4AVC A;  4PSX A;  3VRR A;  1P4N A;  2GLF A;  4KSA A;  4C7I A;  3PGP A;  3FVL A;  1L0C A;  3F8K A;  5F09 A;  1TIQ A;  4HKF A;  4OP4 A;  5G21 A;  2WPW A;  3RAM A;  4B5O A;  4CGM A;  3IU2 A;  4RUH A;  5KTD A;  4UIA A;  1IOI A;  2HB6 A;  1YQE A;  3IC1 A;  3SJF A;  2P6F A;  5KTA A;  1UFH A;  3P2H A;  4CGP A;  2REE A;  5ISV A;  1CS0 B;  3S9N A;  4UA3 A;  4MCP A;  3VTA A;  3VGO A;  3MRU A;  4TNU A;  4KZT A;  2FSR A;  4KLV A;  4DNC A;  2PDO A;  4MBU A;  5JM6 A;  2VQY A;  1V6C A;  4H1H A;  4NSQ A;  4RR2 B;  2HWG A;  4M8D A;  1BXR B;  3KRV A;  5J8F A;  3T0T A;  3PB4 X;  4Y49 C;  4C8C A;  1V0C A;  1ZLH A;  4GXH A;  4F9U A;  1LAN A;  1S7F A;  1XEB A;  3T8W A;  3TX8 A;  1WJT A;  3K2K A;  4MI1 A;  3R9G A;  3HMJ G;  4C8T A;  1IB1 E;  4C9U A;  4KOS A;  4F0X A;  4IF5 A;  3GUX A;  3S6F A;  3HPH E;  1CPS A;  1WK4 A;  2J9A A;  4QB9 A;  2CBL A;  2Q44 A;  4JJX A;  4CAE A;  2K5T A;  4ORF A;  1VBH A;  3ICU A;  1FY7 A;  3DDD A;  1NE9 A;  2CY2 A;  4KVO E;  4B10 A;  4CAW A;  3TOB A;  2C6P A;  4B6Z A;  2Q7B A;  1R61 A;  1TKF A;  1CP6 A;  2ZW5 A;  4JLY A;  3R95 A;  2PVV A;  1FT7 A;  2EZA A;  3RBU A;  4BBH A;  2H5M A;  3KI9 A;  2WPX A;  2C6G A;  4BTF A;  3D67 A;  3PBB A;  2HI6 A;  4ONU A;  5DWN A;  1VI4 A;  3G23 A;  1PUA A;  2FS5 A;  4AG7 A;  2PQ8 A;  3TE4 A;  1Y9Z A;  3BI1 A;  5AG4 A;  1SQH A;  4B5P A;  4CGL A;  3PT1 A;  1LRZ A;  3B35 A;  5IB0 A;  4EME A;  4OID A;  5F46 A;  3KR4 A;  2AUN A;  3IWE A;  4MCS A;  4OME A;  1BO4 A;  1ELL P;  3SXN A;  4NGN A;  1XJO A;  2GFQ A;  2ZEO A;  1PYT B;  2DPT A;  3BUN B;  3BLN A;  2R7H A;  4NCZ A;  1Q2Y A;  4I49 A;  2Q4Y A;  1XFO A;  2HV2 A;  1S7K A;  2JDC A;  3R96 A;  3EZA A;  3IEH A;  3H8F A;  5F5X A;  4UWI A;  2CXA A;  4W9Y A;  2PJ3 A;  2J8R A;  4XPD C;  4PXD A;  5D8N A;  4MY0 A;  3CXP A;  3VRP A;  3GIU A;  1J4J A;  4G1P A;  4UEZ A;  3WAB A;  4A37 A;  3PBE A;  1VIX A;  2G9D A;  4JXQ A;  3TO9 A;  1FBV A;  2IMO A;  2JLM A;  4PPZ A;  2QYV A;  2ANP A;  2PJB A;  1LAP A;  3SI1 A;  3GLJ A;  4BPU B;  1K4J A;  1YGH A;  2Z10 A;  1XIX A;  4CYQ A;  2XPP A;  3IO1 A;  3CZX A;  2PIZ A;  4H6Z A;  3NOJ A;  2FVG A;  1XF1 A;  3B3S A;  2Q7S A;  2YNC A;  3TLG A;  3ZJ0 A;  1F2O A;  2ZED A;  3H4Q A;  4EYS A;  3G3S A;  1KUY A;  3S6G A;  4CS0 B;  2GAN A;  3TLE A;  4C9A A;  2JDD A;  2NSM A;  4A38 A;  4OC2 A;  4UEF A;  3FXT A;  5K8O A;  2DF5 A;  4NGM A;  4B5P B;  5JH9 A;  2YJT A;  4MHN A;  3H5Z A;  3PFO A;  2GU2 A;  3TO7 A;  3BUW B;  1DTD A;  4M6H A;  4Q38 A;  4UCP A;  2GIV A;  3IWW A;  4CYP A;  3VRN A;  2PVW A;  5K8M A;  2Z11 A;  4MCQ A;  2RFH A;  1LFW A;  4MFQ A;  3G8W A;  1X10 A;  2AFU A;  2Y1N A;  2CNS A;  3NH4 A;  3TTH A;  4P4J A;  4LUA A;  4FBE A;  4JZ0 A;  3PFV A;  1TXR A;  3R9F A;  2PJ9 A;  2PJ4 A;  1ZO0 A;  2VKZ G;  4PXC A;  3OB1 B;  5G1Z A;  2B58 A;  5IX3 A;  4C8A A;  2Z0Z A;  3GJZ A;  3PB7 X;  3DNS A;  4MHD A;  4OAE A;  5THW A;  2Q0Y A;  2VZY A;  1M1D A;  4ZGY B;  3KQX A;  4UWJ A;  2QIR A;  5F49 A;  4GS4 A;  1WVM A;  1YVO A;  2J8M A;  2X0S A;  4IUS A;  2GRE A;  4CAF A;  7CPA A;  4NGT A;  4FUU A;  4C99 A;  3EC4 A;  3PLF B;  4UIB A;  3TLG B;  4O23 A;  2AFM A;  4Q7A A;  2ZPA A;  1PCA A;  1VHS A;  3W6S A;  4JVO A;  4C8P A;  2PJ6 A;  1HDQ A;  3FMC A;  4C2X A;  1M4G A;  4XNH C;  4ZYQ A;  2VZZ A;  1S3Z A;  3I6S A;  5HVH A;  3FB3 A;  3IWG A;  3IJ3 A;  1Q2D A;  4UFV A;  3HPG G;  4C2Y A;  1KC7 A;  1XMB A;  1YSJ A;  4PK3 A;  3JRU A;  3DR8 A;  2XEI A;  1S5K A;  4UBR A;  1TKJ A;  4NJR A;  2E28 A;  4R7M A;  4QBJ A;  2AFO A;  2VL1 A;  3BUX B;  1MK4 A;  2WZN A;  4MJX A;  1TF9 A;  1YR0 A;  4H2K A;  3B3T A;  4IK2 A;  4XPK A;  2PJA A;  1MJ9 A;  4EWT A;  1XOV A;  3TLY A;  2YNC C;  4CAV A;  4MFZ A;  2FM4 A;  2B3U A;  2WUU A;  2Z3N A;  4PK2 A;  3FEE A;  2Q43 A;  3DLJ A;  5H84 A;  4KUA A;  5DWM A;  1Z8T A;  2PE3 A;  3B2Y A;  5JQ4 A;  4C84 A;  1MJA A;  2ZOF A;  5JYB A;  2R82 A;  4Y49 B;  2PR8 A;  2CF4 A;  1CM0 A;  4UF4 A;  2D0O A;  5F1Y A;  3EZE A;  5A27 A;  4E2A A;  1KWM A;  2AE6 A;  2I3C A;  1F57 A;  4MFL A;  5LYF A;  4PSW A;  1T36 B;  2ZEH A;  3FBU A;  3JUW A;  1RXT A;  2Q4V A;  5LRG A;  3EZB A;  4JD6 A;  4MJ8 A;  3UY5 A;  2PJ5 A;  4U5Y A;  1YLE A;  2BSW A;  4PXB A;  5HVG A;  4NGQ A;  3WC6 A;  3EFA A;  4C85 A;  2C27 A;  4A95 A;  4RI1 A;  2BEI A;  4OLL A;  2JEW A;  2D4O A;  3TO6 A;  2B5G A;  4CGN A;  2J8N A;  4KLW A;  2GE3 A;  2FCK A;  3BUM B;  4ZX8 A;  1M6V B;  2OU2 A;  1JDB C;  3PB9 X;  3TLZ A;  3NH8 A;  2QEC A;  2QVP A;  3DSB A;  3KL9 A;  1RO5 A;  1BPN A;  1Q7L A;  2F5I A;  3TCV A;  5BWA B;  2PCN A;  4IIX A;  1YVH A;  4X5K A;  4P4B A;  3BJ8 A;  2NMT A;  3D68 A;  4ZI6 A;  1Y7E A;  3D4U A;  5EMI A;  1AYE A;  2BUE A;  4ZY2 A;  2YJV A;  2DXQ A;  4A31 A;  1P0H A;  5FVJ A;  1XF8 A;  2EBJ A;  5LYD A;  4B13 A;  1ZLI A;  2C5Q A;  3GKR A;  3E0K A;  4XPD B;  1GGO A;  3EO4 A;  4WWV A;  3U88 C;  1BLL E;  3ISZ A;  3KR5 A;  1C3O B;  2D0P A;  4IIY A;  3TLA A;  3QAH A;  3FF3 A;  1QSR A;  4NFR A;  2Y1M A;  3OAK A;  1ZG9 A;  1QST A;  3BJ7 A;  3LD2 A;  5F47 A;  3WC7 A;  3D2P A;  4J3G A;  4ZY0 A;  1GYT A;  3SI0 A;  2REF A;  5IV0 A;  1HEE A;  2Q51 A;  5BY0 A;  2B4D A;  4BIN A;  3QB8 A;  1KBL A;  3TT2 A;  4B11 A;  1AUG A;  5HKW A;  3TOA A;  3WT4 A;  4OC5 A;  4CPA A;  4HNX B;  4E8O A;  4CDJ A;  1IYK A;  1ON0 A;  4FD6 A;  3BUO B;  2B5G B;  5IB9 A;  1NXJ A;  1EZB A;  2O28 A;  4KOV A;  4MXU A;  4UFX A;  1XE4 A;  3RZA A;  5A28 A;  2XPO A;  3IU1 A;  2GP4 A;  1ARL A;  4XPL A;  4A4B A;  2CNT A;  4H6U A;  2YNE A;  5F13 A;  2BOA A;  2HQY A;  4KOY A;  2OOT A;  4P4E A;  2G0B A;  3KKW A;  3PP9 A;  4UFW A;  3K9T A;  2QJ8 A;  4R3K A;  2PJ1 A;  2DLA A;  4ZY1 A;  2Z3O A;  2IQ6 A;  2ODF A;  1Y9W A;  3CXQ A;  2OLS A;  2JBK A;  1I1D A;  5LRK A;  1ELM P;  4F8Z A;  4C9R A;  3B3W A;  5AG5 A;  2F7V A;  3BXM A;  4P4F A;  4LQG A;  3MN8 A;  3NE7 A;  2P0W A;  5I4M A;  4JYW A;  2EO8 A;  2RC4 A;  3F9K C;  3B8G A;  3ISX A;  4GM5 A;  2AFW A;  1OBR A;  1ARM A;  2B4B A;  2ZEF A;  3W91 A;  3B3V A;  5F9M A;  4MY3 A;  5HH1 A;  3V38 A;  2YGW A;  1TKH A;  4CRY B;  3CXS A;  2PJ0 A;  2ZW4 A;  4R87 A;  4C7H A;  4INJ A;  4FWU A;  4DUK A;  4E0A A;  3I74 A;  1QSO A;  3T05 A;  4C9V A;  1QSM A;  3CT9 A;  4OC1 A;  1YW6 A;  2PC1 A;  4QC6 A;  3B7I A;  3LWU A;  1EO0 A;  5EC4 A;  3TFY A;  2XPL A;  2FT0 A;  3FED A;  2YND A;  3FRM A;  4TJX A;  4XNH B;  3GY9 A;  3BHX A;  1A2Z A;  4PXE A;  5JVL A;  4P44 A;  3VWD A;  1YVK A;  2AFX A;  2V8D A;  4R3L A;  4EVY A;  5AG6 A;  4COB A;  2AFS A;  4NJQ A;  4NF1 A;  4R8F A;  3EIF A;  1CBX A;  1A9X B;  1M4D A;  4MCR A;  1NMT A;  1Z8X A;  2G3A A;  2ABZ A;  2IL4 A;  3CDX A;  3LOD A;  2PRB A;  3VAR A;  4KSF A;  4FAI A;  1KEE B;  1Z5R A;  2PSW A;  2GLJ A;  3HLP A;  2UV8 G;  1Y9K A;  5I0C A;  3I3G A;  2EVN A;  2DPS A;  1M4L A;  4MMO A;  4U9Z A;  5CPA A;  4YWY A;  5CNP A;  2OZU A;  4CO9 A;  2C6C A;  1KUX A;  4FD4 A;  2ATR A;  2F8H A;  5HKZ A;  3T90 A;  3P2F A;  1BAV A;  4MHP A;  2OB0 A;  4R76 A;  4IAV A;  1S60 A;  5C88 A;  2PCU A;  3KAS A;  4P6Y A;  5J1Q A;  4L89 A;  4C9E A;  4COG A;  2ZOG A;  4ZBG A;  3K4I A;  3TYX A;  4QVT A;  3TLC A;  4CRZ B;  3T07 A;  1IY7 A;  5AXI A;  3PB6 X;  4J0N A;  5J3X A;  3A9L A;  1ZYM A;  4LX9 A;  5E96 A;  3PRT A;  1YK3 A;  1M44 A;  1XMT A;  2HUZ A;  3D3S A;  3PEI A;  4YFJ A;  3R1K A;  3LMS A;  2PJ7 A;  3KGQ A;  4K3N A;  4MI4 A;  3FEC A;  2Q04 A;  3CPA A;  1ZL0 A;  4OC3 A;  3V8I A;  2XEJ A;  1KUV A;  2XEF A;  3D7D A;  2PIY A;  2FIW A;  3QNV A;  2R98 A;  4MHY A;  2N3A B;  4Q36 A;  5EBV A;  1C30 B;  4X8I A;  4M3S A;  4NGP A;  1YX0 A;  1B87 A;  1F2P A;  2O4H A;  2G3T A;  1PU9 A;  4MFP A;  5F48 A;  3R9E A;  4PV6 A;  3U1B A;  4K30 A;  4X2T A;  1JDE A;  1EE3 P;  4P10 A;  2VXK A;  3C26 A;  3GB0 A;  1IID A;  1IU8 A;  5G22 A;  1YRE A;  5LYI A;  1CG2 A;  4AVB A;  6CPA A;  1QMU A;  2FXF A;  2B0A A;  2ZEG A;  4MRI A;  2V8V A;  2O53 A;  3B3C A;  1FNO A;  4OKO A;  1IGB A;  2B3V A;  3N7Z A;  3W6X A;  4FD5 A;  2QML A;  4ONW A;  2CTC A;  4QUS A;  4YGO A;  4AG9 A;  5C82 A;  1YME A;  4M85 A;  2PRQ A;  5HMN A;  3OP0 A;  4EFD A;  2CNM A;  3IIB A;  2Z3P A;  1IIC A;  4JWP A;  2EK9 A;  4NXY A;  5JGF A;  1XBU A;  4BPW B;  2ZEL A;  4FD7 A;  5H86 A;  3V7Z A;  3WC5 A;  2HRO A;  1IOF A;  5CBM A;  3SI2 A;  2FL4 A;  3ZNI A;  3TC8 A;  5FD8 A;  2RB7 A;  4CDK A;  4A94 A;  4C2Z A;  1VGY A;  5G20 A;  1EZA A;  4OC0 A;  3D2M A;  3FX6 A;  3NFQ A;  3RO0 A;  1ZRS A;  2AFZ A;  4CAX A;  4A33 A;  4A39 A;  4BMH A;  5LRJ A;  1QSN A;  4CYO A;  3DR6 A;  1KZF A;  2AJ6 A;  1R57 A;  4KOW A;  3WR7 A;  5JPH A;  2ZEE A;  2CIJ A;  1Z4E A;  4KOU A;  1N71 A;  4KVX A;  3SHP A;  3T5M A;  2XEG A;  1AMP A;  3F5B A;  4BPX B;  5AG7 A;  4HPS A;  3CPX A;  1QQ9 A;  1Z8W A;  3GYA A;  3D66 A;  3PZJ A;  4L8A A;  3D7F A;  2BO9 A;  4LQ6 A;  3BI0 A;  1ZG7 A;  2DEA A;  3JTK A;  3PB8 X;  1R43 A;  1U6M A;  2C1C A;  4OAD A;  3MGD A;  3LAC A;  5K99 A;  3ZZI A;  4RS2 A;  2CTB A;  3FJU A;  4KS9 A;  2ZW7 A;  4UCM A;  3RNZ A;  1Z9U A;  3FYN A;  2EK8 A;  1S7N A;  4CYN A;  5ELY A;  2R1I A;  2Y0M A;  1VBG A;  5J8C A;  1BOB A;  4R57 A;  1VKC A;  2VBQ A;  4M6G A;  4A2Z A;  4F0Y A;  1RTQ A;  4GPL B;  3VH9 A;  2VI7 A;  2MP0 A;  3NH5 A;  4OIW A;  4P45 A;  2Z3M A;  4NGS A; 
#chains in the Genus database with same CATH homology
 1CPX A;  3D7H A;  2Q4Z A;  1YW4 A;  2JBJ A;  2ZEM A;  8CPA A;  1CX8 A;  2EWB A;  5DS0 A;  2V8H A;  4DYO A;  1CP7 A;  3H8G A;  1Z2L A;  4WJB A;  3S9L A;  5K8P A;  4KNG E;  1XRY A;  4IHM A;  3S9M A;  3SJG A;  2IJZ A;  4BD9 A;  4YN3 A;  1UWY A;  3L2N A;  4MHZ A;  4X3R A;  3I1U A;  1HDU A;  2PJ2 A;  1Y0R A;  3DGV A;  3D7G A;  4Z65 A;  3NA6 A;  1LCP A;  2V77 A;  4C8U A;  4C86 A;  2OR4 A;  1VHE A;  1DE4 C;  4YU9 A;  3KZW A;  4OC4 A;  1BPM A;  4F9V A;  4DJL A;  4P4D A;  1NSA A;  3KHX A;  4PQA A;  2PJ8 A;  3SJE A;  4ZX9 A;  3PFE A;  1JQG A;  2WYR A;  2ZEN A;  2ZEP A;  4UEE A;  5LYL A;  2PJC A;  4P4I A;  3HUV A;  5K8N A;  4KSI A;  3VAT A;  4TWE A;  1R3N A;  3N5F A;  4R6T A;  1VHO A;  3H8E A;  3NFZ A;  3KHZ A;  5HVF A;  3SJX A;  1YLO A;  1Y0Y A;  2NYQ A;  4NGR A;  1H8L A;  3IFE A;  4AXV A;  1Z8L A;  3KQZ A;  4TJV A;  3FH4 A;  1ZG8 A;  4C8F A;  5IR2 A;  2POK A;  2BCO A;  1LOK A;  2HC9 A;  5D29 A;  2V8G A;  1LAM A;  1TF8 A;  2GLF A;  3FVL A;  5F09 A;  4OP4 A;  3RAM A;  4RUH A;  4UIA A;  2HB6 A;  3IC1 A;  3SJF A;  3S9N A;  4MCP A;  3VTA A;  3MRU A;  4TNU A;  5JM6 A;  1V6C A;  3PB4 X;  4C8C A;  1ZLH A;  4F9U A;  1LAN A;  3T8W A;  3TX8 A;  3K2K A;  4C8T A;  4C9U A;  3GUX A;  1CPS A;  2J9A A;  3ICU A;  4B6Z A;  2C6P A;  1TKF A;  1CP6 A;  2PVV A;  1FT7 A;  3RBU A;  3KI9 A;  2C6G A;  3D67 A;  3PBB A;  1Y9Z A;  3BI1 A;  3B35 A;  4EME A;  4OID A;  3KR4 A;  4MCS A;  4OME A;  1ELL P;  4NGN A;  1XJO A;  2ZEO A;  1PYT B;  1XFO A;  3IEH A;  3H8F A;  4W9Y A;  2PJ3 A;  4PXD A;  5D8N A;  4A37 A;  4UEZ A;  4G1P A;  3WAB A;  3PBE A;  1VIX A;  2G9D A;  2IMO A;  4PPZ A;  2QYV A;  2ANP A;  2PJB A;  1LAP A;  3SI1 A;  3GLJ A;  3IO1 A;  2PIZ A;  2FVG A;  1XF1 A;  3B3S A;  1F2O A;  2ZED A;  4C9A A;  4A38 A;  2NSM A;  4OC2 A;  4UEF A;  5K8O A;  4NGM A;  5JH9 A;  4MHN A;  3PFO A;  2GU2 A;  1DTD A;  3IWW A;  5K8M A;  2PVW A;  4MCQ A;  2RFH A;  1LFW A;  2AFU A;  3NH4 A;  4FBE A;  4P4J A;  4JZ0 A;  1TXR A;  2PJ9 A;  2PJ4 A;  4PXC A;  4C8A A;  3PB7 X;  5THW A;  3KQX A;  1WVM A;  4C99 A;  2GRE A;  7CPA A;  4NGT A;  4FUU A;  4UIB A;  4O23 A;  2AFM A;  4Q7A A;  1PCA A;  4C8P A;  2PJ6 A;  1HDQ A;  3FMC A;  4ZYQ A;  3I6S A;  5HVH A;  3IJ3 A;  1XMB A;  1YSJ A;  3JRU A;  2XEI A;  1TKJ A;  4NJR A;  4R7M A;  2AFO A;  2VL1 A;  2WZN A;  1TF9 A;  4H2K A;  3B3T A;  4IK2 A;  2PJA A;  4EWT A;  3FEE A;  2Q43 A;  3DLJ A;  2PE3 A;  3B2Y A;  4C84 A;  2ZOF A;  2CF4 A;  4UF4 A;  1KWM A;  2I3C A;  5LYF A;  1F57 A;  2ZEH A;  5LRG A;  2PJ5 A;  4PXB A;  5HVG A;  4NGQ A;  3WC6 A;  4C85 A;  2JEW A;  4ZX8 A;  3PB9 X;  3NH8 A;  2QVP A;  3KL9 A;  1BPN A;  1Q7L A;  4P4B A;  4ZI6 A;  3D68 A;  1Y7E A;  3D4U A;  4ZY2 A;  1AYE A;  5LYD A;  1ZLI A;  2C5Q A;  4WWV A;  1BLL E;  3ISZ A;  3KR5 A;  3FF3 A;  4NFR A;  4ZY0 A;  1ZG9 A;  3WC7 A;  1GYT A;  3SI0 A;  1HEE A;  2Q51 A;  3WT4 A;  4OC5 A;  4CPA A;  4CDJ A;  5IB9 A;  4MXU A;  3RZA A;  2GP4 A;  1ARL A;  2BOA A;  2OOT A;  4P4E A;  3K9T A;  2QJ8 A;  2PJ1 A;  4ZY1 A;  2IQ6 A;  2JBK A;  5LRK A;  1ELM P;  4F8Z A;  4C9R A;  3B3W A;  2F7V A;  3BXM A;  4P4F A;  4LQG A;  3MN8 A;  5I4M A;  4JYW A;  3ISX A;  4GM5 A;  2AFW A;  1OBR A;  1ARM A;  2ZEF A;  3B3V A;  3V38 A;  1TKH A;  2PJ0 A;  4FWU A;  4DUK A;  3I74 A;  4C9V A;  3CT9 A;  4OC1 A;  1YW6 A;  3B7I A;  3LWU A;  3FED A;  4TJX A;  4PXE A;  3BHX A;  4P44 A;  2AFX A;  2V8D A;  2AFS A;  4NJQ A;  3EIF A;  4R8F A;  1CBX A;  4MCR A;  3CDX A;  2ABZ A;  3VAR A;  4FAI A;  1Z5R A;  2GLJ A;  3HLP A;  1M4L A;  4MMO A;  5CPA A;  4YWY A;  2C6C A;  2F8H A;  1BAV A;  4MHP A;  4R76 A;  4IAV A;  2PCU A;  3KAS A;  4P6Y A;  5J1Q A;  4C9E A;  2ZOG A;  1IY7 A;  3PB6 X;  3PRT A;  3PEI A;  4K3N A;  3LMS A;  2PJ7 A;  3KGQ A;  3FEC A;  3CPA A;  4OC3 A;  5HXD A;  2XEJ A;  2PIY A;  2XEF A;  3D7D A;  3QNV A;  4MHY A;  4X8I A;  4NGP A;  1F2P A;  2O4H A;  4X2T A;  1EE3 P;  4P10 A;  3GB0 A;  5LYI A;  1CG2 A;  6CPA A;  1QMU A;  2ZEG A;  4MRI A;  2V8V A;  2O53 A;  3B3C A;  1FNO A;  4OKO A;  1IGB A;  4ONW A;  2CTC A;  1YME A;  2PRQ A;  4EFD A;  3IIB A;  2EK9 A;  5JGF A;  1XBU A;  2ZEL A;  3V7Z A;  3WC5 A;  5CBM A;  3SI2 A;  3TC8 A;  2RB7 A;  4CDK A;  4A94 A;  1VGY A;  4OC0 A;  3FX6 A;  2AFZ A;  4A39 A;  5LRJ A;  2ZEE A;  2CIJ A;  2XEG A;  1AMP A;  3CPX A;  1QQ9 A;  3D66 A;  3D7F A;  2BO9 A;  3BI0 A;  1ZG7 A;  2DEA A;  3PB8 X;  1R43 A;  2C1C A;  2CTB A;  3FJU A;  2EK8 A;  5ELY A;  1RTQ A;  3VH9 A;  3NH5 A;  4OIW A;  4P45 A;  4NGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...