5D29A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a hydroxamate inhibitor jhu241
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
695
structure length
686
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unprecedented Binding Mode of Hydroxamate-Based Inhibitors of Glutamate Carboxypeptidase II: Structural Characterization and Biological Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 266
structure length 686
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2015-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 5d29A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5d29A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5d29A02
4IAVA 4P4BA 2PJAA 3IFEA 4WJBA 4K3NA 3WC6A 4DYOA 2V8HA 4YU9A 2JEWA 1JQGA 4G1PA 2O4HA 3SJGA 3GB0A 3PFEA 3B7IA 3PFOA 4NGRA 4WWVA 5LRGA 4UIBA 2CIJA 1LANA 3SI0A 4JYWA 3WC5A 2JBKA 3D7DA 5HXDA 4A94A 2RFHA 4CPAA 2PRQA 3D4UA 3I6SA 3KR4A 1HEEA 5CPAA 4C8CA 3PB6X 1ZLIA 1WVMA 2PIYA 3I1UA 5K8OA 5K8MA 2V8VA 2EK8A 4R76A 1FNOA 2OOTA 5THWA 4C9UA 2EWBA 4W9YA 4OMEA 2HC9A 2PJ5A 3WT4A 4OC1A 3NFZA 4ZYQA 4OC2A 2AFXA 1EE3P 3PB8X 2AFUA 3PRTA 2V8DA 4NGTA 3GUXA 1AMPA 3B3WA 4C9VA 3KL9A 1LCPA 4ZY0A 5I4MA 3SI1A 4P4DA 3ISXA 3SJFA 1LAMA 1Y0YA 1YSJA 3KZWA 3NH8A 4CDJA 1R43A 3DGVA 4ZX9A 4EWTA 3B35A 3T8WA 4TJXA 5LYDA 4IK2A 2XEIA 5DS0A 5HVFA 4TNUA 2C6CA 4NGPA 4FAIA 3IWWA 1AYEA 2GU2A 4CDKA 1ELMP 1BPNA 4TJVA 1OBRA 2JBJA 3PB4X 2GREA 4RUHA 2CTCA 4F8ZA 4H2KA 3HUVA 2ZEFA 3PBEA 1LAPA 1IGBA 2BCOA 3FEDA 1R3NA 3VARA 5JM6A 3FVLA 4P6YA 3B2YA 4MCSA 4PXEA 2VL1A 2F7VA 4P45A 4OP4A 3S9NA 1YLOA 1M4LA 1ARLA 5K8PA 4MCRA 4C99A 4PXCA 1Y0RA 3MRUA 1CG2A 4OC5A 4C9AA 3VTAA 2IJZA 1YW6A 2PJ8A 3KASA 3NH5A 2DEAA 4EMEA 2PJ3A 1XF1A 1ELLP 2OR4A 2ABZA 1TXRA 4FWUA 4C8UA 3BXMA 3LMSA 5F09A 4NGMA 1DTDA 1Y7EA 3IEHA 1RTQA 8CPAA 4ZI6A 3FJUA 5ELYA 1BPMA 4NGNA 2WZNA 4MMOA 2AFMA 1BAVA 4O23A 4Z65A 3CDXA 1ARMA 3WABA 4A38A 3PB9X 5CBMA 4C86A 4GM5A 4X3RA 1QQ9A 3D68A 2IQ6A 4YN3A 1Z2LA 2XEGA 1Q7LA 2PJBA 3D7HA 5J1QA 2CF4A 2ZOFA 3RZAA 4P4IA 4BD9A 1TF8A 4OC0A 2IMOA 2Q51A 3IJ3A 4P44A 2GLJA 2ZELA 3TC8A 1VHEA 4R8FA 4NJRA 4X2TA 3CPXA 1QMUA 4C8PA 2PJCA 3IIBA 4NFRA 5HVGA 4EFDA 3FH4A 3V7ZA 4PXBA 4NGQA 2XEFA 2NYQA 4ZY1A 4TWEA 4P4EA 4UEFA 1LFWA 3FMCA 2ZEGA 2PJ7A 4MHZA 1ZG7A 2EK9A 2CTBA 3H8EA 2NSMA 3N5FA 3B3CA 2J9AA 4MCQA 2PJ2A 3B3TA 4MXUA 3L2NA 2QJ8A 5LYLA 1XMBA 4MRIA 4JZ0A 3D7GA 4OIWA 2WYRA 3FX6A 2QYVA 3VATA 4A37A 4C8TA 3MN8A 4KSIA 3DLJA 4YWYA 3NA6A 2XEJA 5JGFA 4A39A 2QVPA 1CX8A 4C8AA 1VIXA 1XFOA 2ZOGA 4MHNA 4UIAA 3RAMA 4PPZA 3SJEA 5LYIA 2PJ4A 5LRJA 4Q7AA 5HVHA 1F2OA 2ZEDA 2FVGA 1YW4A 2I3CA 5JH9A 4C9RA 3H8FA 1VHOA 3K2KA 4R7MA 1PCAA 2Q4ZA 2V8GA 5LYFA 4ONWA 2ZENA 1FT7A 1ZLHA 3NH4A 2BOAA 1XRYA 3EIFA 3PB7X 3I74A 1XJOA 2O53A 1NSAA 4ZY2A 2GLFA 6CPAA 1Z5RA 3GLJA 2ZEHA 1TKJA 4C8FA 2PVWA 1F2PA 3S9LA 3CT9A 4UF4A 3KI9A 4KNGE 3KHZA 2PJ9A 4P10A 3BI0A 1H8LA 1GYTA 1PYTB 4B6ZA 4P4FA 4F9VA 2PE3A 4NJQA 4AXVA 2ZEEA 1CBXA 4OKOA 1ZG9A 2C1CA 4DJLA 1HDUA 3VH9A 2AFOA 1TKFA 2C6PA 3KHXA 3SI2A 1CPSA 3TX8A 4IHMA 4DUKA 3S9MA 2C6GA 4OC4A 3ISZA 4OIDA 4C85A 4OC3A 2PJ0A 4FBEA 3KQXA 1ZG8A 4R6TA 1BLLE 1V6CA 3ICUA 2AFWA 2BO9A 3B3SA 4MCPA 1HDQA 3PEIA 4F9UA 3KR5A 3HLPA 4MHPA 5D29A 3LWUA 2PIZA 4C9EA 2ZEOA 4P4JA 4PXDA 2PVVA 2PJ1A 3CPAA 3JRUA 4ZX8A 3BI1A 3IC1A 3D66A 1IY7A 2AFSA 2ZEPA 1F57A 2V77A 2ZEMA 2HB6A 4NGSA 1Z8LA 3KQZA 7CPAA 4FUUA 1TKHA 2F8HA 2AFZA 1LOKA 3V38A 4MHYA 2G9DA 3B3VA 4UEZA 4LQGA 1KWMA 1TF9A 3WC7A 1CPXA 1UWYA 4PQAA 3D67A 3IO1A 5D8NA 4C84A 5LRKA 2Q43A 3H8GA 3QNVA 3SJXA 2ANPA 1YMEA 3BHXA 2PJ6A 5IB9A 2PCUA 1Y9ZA 4UEEA 1CP7A 2POKA 1DE4C 3FF3A 3PBBA 3KGQA 1CP6A 3K9TA 3FEEA 4X8IA 3D7FA 1VGYA 5K8NA 3FECA 3RBUA 2RB7A 1XBUA
chains in the Genus database with same CATH superfamily
2OU2A 4FAIA 1TIQA 2PDOA 4P4BA 2PJAA 3GY9A 3IFEA 4IAVA 4JJXA 4UBRA 3TCVA 2Z3MA 2REEA 4KOUA 4WJBA 4K3NA 1VKCA 4PK2A 4XPKA 3WC6A 4AVAA 2V8HA 4YU9A 4DYOA 3GYAA 2JEWA 5DWNA 1JQGA 1YK3A 3MGDA 4G1PA 4R57A 3W6XA 2O4HA 3T0TA 4KSFA 2HI6A 3SJGA 2EZCA 3GB0A 4IUSA 4NF1A 3PFEA 2VEZA 3B7IA 3EC4A 4A32A 1NBWA 2PRBA 2Y0MA 4E94A 4U5YA 2B5GB 3S6HA 3VWDA 2WSAA 2OZGA 3P2HA 3QAYA 2XPLA 4CGLA 3PFOA 2BUEA 4NGRA 4COGA 4WWVA 1OZPA 5LRGA 2QIRA 5H86A 1Q2YA 4MFZA 4UIBA 4B10A 4KS9A 2VZZA 1IU8A 1MK4A 2CIJA 1MJAA 4UCPA 1MJBA 4HNYB 1LANA 1QSNA 2BEIA 3SI0A 4JWPA 4JYWA 3ZJ0A 1JDBC 2EO8A 3WC5A 2JBKA 3D7DA 2B4DA 2YGWA 4E2AA 3ZNIA 5HXDA 2Y1NA 4A94A 2RFHA 4CPAA 4UCNA 4CGNA 2PRQA 3D4UA 1EO0A 1YX0A 1YVHA 3KR4A 3I6SA 1HEEA 4PSWA 1NXJA 5CPAA 2Q4YA 3LODA 3PB6X 1Z8TA 1ZLIA 4C8CA 5H84A 5F46A 1WVMA 4A4CA 2PIYA 4KLVA 5AG7A 5F48A 3I1UA 1Z9EA 3HPGG 3PGPA 4CGOA 4LQ6A 5JQ4A 5K8OA 1X12A 1XF8A 5K8MA 2V8VA 2EK8A 4MI4A 2JDCA 1CM0A 4R76A 1FNOA 3BUOB 2OOTA 2WPWA 1Q2CA 5THWA 3BJ7A 2HWGA 1KC7A 4C9UA 2EWBA 2AUNA 4W9YA 4OMEA 2I79A 3DDDA 1RXTA 5G22A 2HC9A 4FD4A 2PJ5A 3RYOA 4OLLA 3T9YA 3WT4A 4ONUA 2Q0YA 5F9MA 2YJVA 1IIDA 4B14A 4A2ZA 4OC1A 4CYQA 1M4DA 3CZXA 3NFZA 4ZYQA 5IB0A 1JDEA 3SR3A 2EBJA 1Z8XA 3EO4A 1L0CA 4OC2A 2AFXA 5F13A 1EE3P 1Z8WA 3H4QA 2AFUA 3GKRA 1RO5A 3FRMA 3PB8X 2V8DA 3PRTA 4NGTA 3P2FA 4CGPA 3FIXA 4RI1A 1KEEB 3GUXA 2C27A 1AMPA 1IOIA 3B3WA 3KKWA 2R7HA 4C9VA 3KL9A 1QSOA 4MI1A 2NMTA 1LCPA 4MY0A 4ZY0A 2B4BA 3EZEA 4M3SA 2EZAA 3TT2A 5I4MA 1S7LA 3SI1A 2BL1A 2YNCC 2CY2A 3S6KA 5J8FA 3BJ8A 4P4DA 3ISXA 1WWZA 3SJFA 3VRRA 1PU9A 1LAMA 2VZYA 1Y0YA 1YSJA 4QUSA 2EUIA 2FT0A 3F8KA 3KZWA 3NH8A 4CDJA 1R43A 3O8ZA 3DGVA 4ZX9A 4EWTA 3IWGA 4Y49C 4KSAA 3B35A 3SHPA 3T8WA 4CYOA 1C30B 2ZW6A 4TJXA 1ZL0A 4BINA 2OZHA 2K5TA 4IK2A 4PSXA 5LYDA 1JWQA 2XEIA 4K30A 4CRYB 3CXQA 4IIYA 2FSRA 5DS0A 5HVFA 4TNUA 4NGPA 2C6CA 2J8MA 2GFQA 3IWWA 1AYEA 2GU2A 3RO0A 4A95A 3VRNA 4CAXA 2HUZA 3DR8A 4CDKA 1ELMP 4RS2A 1BPNA 2FIAA 4KOTA 5GCNA 2XPOA 2FE7A 1XE4A 3G23A 2VXKA 4TJVA 1OBRA 1I1DA 2DPSA 1K4JA 4KUAA 2JBJA 2B3VA 3PB4X 2GREA 3S6GA 4F0XA 4RUHA 2R82A 2CTCA 2ZW4A 4H2KA 4F8ZA 2OZUA 3PLFB 3HUVA 4A33A 3K9UA 5C88A 4KVXA 2ZEFA 5FD8A 2Z10A 3H5ZA 3PBEA 1LAPA 3VWEA 1IGBA 2G3TA 3OB1B 3FEDA 1R3NA 2BCOA 3PT1A 3VARA 4H89A 2HV2A 5JM6A 4AVBA 3FVLA 4P6YA 5JVLA 5F1YA 2HROA 3B2YA 4NSQA 3DR6A 1YVOA 4QVTA 4ZBGA 4MCSA 4PXEA 1B87A 2N3AB 4HPSA 2VL1A 1IB1E 2F7VA 2HQYA 1M6VB 1Z4RA 1VI4A 4P45A 2R8VA 2VKZG 4MHDA 4OP4A 3EXNA 3S9NA 1YLOA 1M4LA 5JYBA 1ARLA 4B13A 3R1KA 1PUAA 3A9LA 5K8PA 4MCRA 4F6AA 4C99A 5KTDA 4CAEA 4PXCA 1Y0RA 3MRUA 2G0BA 4R3KA 4UFWA 4M6GA 1CG2A 4HNWB 1EZBA 4OC5A 2GE3A 1XOVA 4C9AA 1KBLA 3VTAA 2CNTA 3VRPA 4YFJA 2IJZA 3TLGB 1YW6A 2PJ8A 3KASA 3NH5A 4II9A 2DEAA 3C26A 2Z3PA 1GGOA 4EMEA 3OAKA 3HPHE 1T36B 2AJ6A 3IWEA 2PJ3A 5ISVA 1XF1A 1ELLP 2OR4A 2ABZA 2O28A 1TXRA 3EY5A 4CAWA 1Y9KA 4FWUA 4C8UA 5AGEA 4DNCA 3BXMA 3LMSA 5F09A 4NGMA 4BPUB 1DTDA 1Y7EA 3IEHA 1RTQA 2F5IA 8CPAA 5JPHA 3SXNA 1N71A 4ZI6A 2PQ8A 3B8GA 3FJUA 5HH1A 1R61A 5BWAB 2ATRA 5ELYA 1BPMA 2X0SA 2ARHA 4M6IA 4NGNA 2P6EA 5CNPA 2WZNA 4MMOA 4PV6A 2AFMA 1VHSA 2A4NA 4XPDC 1BAVA 4HKFA 4O23A 2XPPA 3F9KC 2Q7SA 4Z65A 3CDXA 1ARMA 3WABA 4A38A 1BXRB 3PB9X 4MJXA 2C5QA 2AUMA 3KRVA 5CBMA 1C3OB 1KUYA 2YNCA 4C86A 4GM5A 4X3RA 1QQ9A 1Y7RA 3D68A 2IQ6A 3JTKA 4YN3A 1Z2LA 2D4PA 5KTAA 2XEGA 2FS5A 4H6ZA 1Q7LA 2UV8G 4BPXB 2PJBA 3D7HA 2X7BA 2Z11A 3E0KA 1NMTA 2CF4A 1S3ZA 2ZOFA 3IU1A 2FCKA 2PR8A 4KVOE 4BMHA 1NSLA 2IL4A 3RZAA 2EZBA 4P4IA 1S7NA 1S7FA 4BD9A 1TF8A 4IF5A 5HMNA 4OC0A 4JD6A 2IMOA 2Q51A 4YGOA 4KLWA 3IJ3A 5A28A 5IV0A 4FD6A 3OB2B 4P44A 4MFLA 4B5OA 2EVNA 2GLJA 2ZELA 3TC8A 1VHEA 4U9YA 4CYPA 4R9MA 4R8FA 4B5PB 1P0HA 1ZO0A 2CXAA 1MJ9A 4NJRA 4X2TA 3JUWA 3CPXA 1IYKA 5AG4A 1QSMA 1QMUA 4C8PA 2PJCA 3IIBA 4L89A 4NFRA 2PR1A 4XNHB 4R3LA 4BPWB 1ZRSA 1Q5XA 2PC1A 1GHEA 5HVGA 4EFDA 3BUNB 4MY3A 3FH4A 3V7ZA 4PXBA 4NGQA 2XEFA 2NYQA 2CNMA 3F0AA 2WUUA 4ZY1A 3R96A 4TWEA 4P4EA 2RC4A 3TLCA 4UEFA 1LFWA 3FMCA 4RR2B 4H6UA 1J4JA 4EYSA 3TLAA 1M1DA 2ZEGA 2PJ7A 3NE7A 4MHZA 1WJTA 1ZG7A 3DNSA 2DPTA 1I21A 4GXHA 2EK9A 4MFKA 1SQHA 1KUXA 3TTHA 2CTBA 3QB8A 1J3LA 1X10A 3H8EA 1BOBA 2D0PA 4BBHA 2NSMA 3N5FA 3B3CA 3F5BA 2J9AA 4MCQA 2PJ2A 2PCNA 4CAFA 3B3TA 4MXUA 4KOWA 4UFVA 4XPDB 3L2NA 3EZBA 2QJ8A 3D3SA 4C68A 5LYLA 3EFAA 2D0OA 4CYNA 3TO9A 2AE6A 1XMBA 1M4IA 4MRIA 4JZ0A 3T07A 3D7GA 2PSWA 4OIWA 2WYRA 3FX6A 2VQYA 4JXRA 3WR7A 2QYVA 4CO9A 1IICA 2G3AA 1CJWA 5K99A 3VATA 4A37A 1WK4A 4C8TA 3MN8A 4C2XA 4KSIA 3DLJA 5F49A 2OB0A 4YWYA 2Z3NA 1CE8B 3NA6A 2XEJA 5JGFA 4A39A 3VGOA 2QVPA 5J8CA 2FM4A 1CX8A 4C8AA 1VIXA 5J1QA 3OWCA 1XFOA 3TLBA 3CXPA 3NOJA 4M6HA 2ZOGA 1A2ZA 4ZGYB 3I3GA 2FL4A 4MHNA 2P0WA 4UIAA 3RAMA 3TLEA 3G3SA 4AVCA 2YNEA 2J8NA 3SJEA 3D2PA 2PJ4A 2VI7A 4GS4A 3LD2A 1P4NA 4PPZA 1YLEA 2ZPAA 5LRJA 2FIWA 4B11A 4Q7AA 4R87A 1XMTA 4UCMA 4B12A 2GP4A 1B6BA 2Q7BA 1YVKA 3TLYA 2OH1A 2ZXVA 4YRHA 4GPLB 5HVHA 1F2OA 2YNDA 2ZEDA 2FVGA 4BTFA 1YW4A 2I3CA 2B58A 5JH9A 3U1BA 4JLYA 4KOXA 4C9RA 3H8FA 1VHOA 3K2KA 3W6SA 2B0AA 4R7MA 1PCAA 2Q04A 2Q4ZA 3R95A 4E0AA 4A4BA 2V8GA 1M4GA 3I9SA 5LYFA 4ONWA 2ZENA 1Y9WA 3N7ZA 4KOYA 1FT7A 3SXOA 1ZLHA 3NH4A 4C2ZA 4LUAA 2BOAA 1XRYA 1CS0B 2B3UA 3EIFA 5HKZA 1B47A 3PB7X 2REFA 2P6FA 4J3GA 4M85A 3W91A 3I74A 2Z0ZA 4OADA 5J3XA 1S7KA 5HKWA 3T90A 1XJOA 2JLMA 3TLGA 2ZW5A 2O53A 1NSAA 3G8WA 4ZY2A 2GLFA 6CPAA 1Z5RA 3GLJA 2ZEHA 4AG9A 5F47A 4CRZB 1TKJA 2H5MA 2DIKA 4A31A 4J0NA 2DF5A 5KTCA 2PVWA 3FBUA 4AB7A 4C8FA 3TO6A 4NXYA 1F2PA 3S9LA 3CT9A 4UF4A 1XEBA 1U6MA 3KI9A 1YQEA 1ZYMA 2YJTA 3V8IA 1LRZA 2PJ9A 3KHZA 4KNGE 4P10A 3BI0A 1H8LA 1S5KA 2Z3KA 3C8OA 3HMJG 3QAHA 4XNHC 1GYTA 1DIKA 2MP0A 1PYTB 3PFVA 3IGRA 4B6ZA 4P4FA 2I00A 3FXTA 4ORFA 4C2YA 4F9VA 1XIXA 2PE3A 4NJQA 3EZAA 4UA3A 4AXVA 2ZEEA 4MFJA 4MFQA 3DSBA 4OAEA 2GIVA 2QECA 1CBXA 4FD5A 4OKOA 3U88C 1ZG9A 2C1CA 4DJLA 1HDUA 2CBLA 2AFOA 4QC6A 3FB3A 3VH9A 1TKFA 2C6PA 4XPLA 3KHXA 3SI2A 5EMIA 1CPSA 4NEXA 2Y1MA 3R9EA 4IHMA 4FD7A 4RN7A 1BO4A 3TX8A 4C7IA 4DUKA 3S9MA 2CNSA 5EBVA 1KZFA 2C6GA 5LYIA 4OC4A 3ISZA 4OIDA 4C85A 4OC3A 4HNXB 2PJ0A 4Q36A 2JDDA 2J8RA 4FBEA 1V0CA 5HKYA 3KQXA 4H1HA 5E96A 3FNCA 1AUGA 1ZG8A 4R6TA 3R9FA 1Z4EA 1BLLE 2ODFA 4M8DA 5IX3A 4IIXA 3GJZA 1V6CA 1Q2DA 2GANA 2WPXA 3ICUA 4KVME 1FBVA 1VBGA 3CXSA 5AG6A 3S6FA 2BO9A 2AFWA 3B3SA 4KORA 4MCPA 1HDQA 5BY0A 3PEIA 2BSWA 5IR2A 2XPNA 4F9UA 4UFXA 5EC4A 2DXQA 4L8AA 3KR5A 3ZZIA 4F0YA 2ZW7A 3HLPA 3TOAA 3D2MA 3IU2A 4MHPA 4COBA 2JEVA 3GIUA 5D29A 4NCZA 3UY5A 3TE4A 1IYLA 3LWUA 4CS0B 4MJ8A 4QB9A 4MFPA 2PIZA 4C9EA 2ZEOA 4P4JA 2P6GA 4PXDA 1QSTA 5AXIA 2PVVA 4JVOA 3FYNA 2KCWA 2PJ1A 2VBQA 3CPAA 3PP9A 4KZTA 5C82A 3T5MA 1NE9A 3RNZA 4E5SA 3JRUA 5G1ZA 3VRQA 4I49A 4Y49B 4ZX8A 3VROA 4E8OA 3BI1A 4INJA 1EZAA 4CZ1A 5AG5A 3IC1A 3D66A 1IY7A 3D8PA 4KOVA 2Z3LA 3BUWB 2AFSA 3TOBA 2ZEPA 5DWMA 1F57A 5G20A 2R98A 2V77A 2ZEMA 4LX9A 5I0CA 2HB6A 4NGSA 4CAVA 4EVYA 1QSRA 1Z8LA 3KQZA 7CPAA 4X5KA 1YREA 1TKHA 4FUUA 2F8HA 2AFZA 1LOKA 3V38A 1R57A 3NFQA 2D4OA 3TLZA 3JVNA 3BUMB 4MHYA 1M44A 2FXFA 2G9DA 3B3VA 4KUBA 4UEZA 4LQGA 3BLNA 1KWMA 1TF9A 3WC7A 5F5XA 4JXQA 1CPXA 4AG7A 5A27A 1UWYA 4PQAA 1KUVA 2OLSA 3BUXB 3T05A 3D67A 1VBHA 3IO1A 5D8NA 4C84A 1I12A 4Q38A 5LRKA 2Q43A 1IOFA 3H8GA 4QBJA 3QNVA 5G21A 3PZJA 2DLAA 3SJXA 2ANPA 1FY7A 1YR0A 1S60A 1YMEA 2E28A 3TFYA 3BHXA 2B4DB 2PJ6A 5IB9A 2Q4VA 2PCUA 3TO7A 1YGHA 4C7HA 4CGMA 4B5PA 2B4JC 2Q44A 4UEEA 1Y9ZA 1CP7A 1UFHA 1Z9UA 2POKA 1DE4C 1A9XB 3FF3A 4UWIA 4U9ZA 2QMLA 3NE8A 4UWJA 3PBBA 3KGQA 3K4IA 1CP6A 3TYXA 3OP0A 3K9TA 4KOSA 4PK3A 3FEEA 4X8IA 3D7FA 4MBUA 3R9GA 4A30A 2R1IA 1VGYA 5K8NA 3FECA 1ON0A 3RBUA 3LACA 2B5GA 2RB7A 5FVJA 2Z3OA 1XBUA
chains in the Genus database with same CATH topology
4IAVA 4P4BA 2PJAA 3IFEA 4WJBA 4K3NA 3WC6A 4DYOA 2V8HA 4YU9A 2JEWA 1JQGA 4G1PA 2O4HA 3SJGA 3GB0A 3PFEA 3B7IA 3PFOA 4NGRA 4WWVA 5LRGA 4UIBA 2CIJA 1LANA 3SI0A 4JYWA 3WC5A 2JBKA 3D7DA 5HXDA 4A94A 2RFHA 4CPAA 2PRQA 3D4UA 3I6SA 3KR4A 1HEEA 5CPAA 4C8CA 3PB6X 1ZLIA 1WVMA 2PIYA 3I1UA 5K8OA 5K8MA 2V8VA 2EK8A 4R76A 1FNOA 2OOTA 5THWA 4C9UA 2EWBA 4W9YA 4OMEA 2HC9A 2PJ5A 3WT4A 4OC1A 3NFZA 4ZYQA 4OC2A 2AFXA 1EE3P 3PB8X 2AFUA 3PRTA 2V8DA 4NGTA 3GUXA 1AMPA 3B3WA 4C9VA 3KL9A 1LCPA 4ZY0A 5I4MA 3SI1A 4P4DA 3ISXA 3SJFA 1LAMA 1Y0YA 1YSJA 3KZWA 3NH8A 4CDJA 1R43A 3DGVA 4ZX9A 4EWTA 3B35A 3T8WA 4TJXA 5LYDA 4IK2A 2XEIA 5DS0A 5HVFA 4TNUA 2C6CA 4NGPA 4FAIA 3IWWA 1AYEA 2GU2A 4CDKA 1ELMP 1BPNA 4TJVA 1OBRA 2JBJA 3PB4X 2GREA 4RUHA 2CTCA 4F8ZA 4H2KA 3HUVA 2ZEFA 3PBEA 1LAPA 1IGBA 2BCOA 3FEDA 1R3NA 3VARA 5JM6A 3FVLA 4P6YA 3B2YA 4MCSA 4PXEA 2VL1A 2F7VA 4P45A 4OP4A 3S9NA 1YLOA 1M4LA 1ARLA 5K8PA 4MCRA 4C99A 4PXCA 1Y0RA 3MRUA 1CG2A 4OC5A 4C9AA 3VTAA 2IJZA 1YW6A 2PJ8A 3KASA 3NH5A 2DEAA 4EMEA 2PJ3A 1XF1A 1ELLP 2OR4A 2ABZA 1TXRA 4FWUA 4C8UA 3BXMA 3LMSA 5F09A 4NGMA 1DTDA 1Y7EA 3IEHA 1RTQA 8CPAA 4ZI6A 3FJUA 5ELYA 1BPMA 4NGNA 2WZNA 4MMOA 2AFMA 1BAVA 4O23A 4Z65A 3CDXA 1ARMA 3WABA 4A38A 3PB9X 2C5QA 5CBMA 4C86A 4GM5A 4X3RA 1QQ9A 3D68A 2IQ6A 4YN3A 1Z2LA 2XEGA 1Q7LA 2PJBA 3D7HA 5J1QA 2CF4A 2ZOFA 3RZAA 4P4IA 4BD9A 1TF8A 4OC0A 2IMOA 2Q51A 3IJ3A 4P44A 2GLJA 2ZELA 3TC8A 1VHEA 4R8FA 4NJRA 4X2TA 3CPXA 1QMUA 4C8PA 2PJCA 3IIBA 4NFRA 5HVGA 4EFDA 3FH4A 3V7ZA 4PXBA 4NGQA 2XEFA 2NYQA 4ZY1A 4TWEA 4P4EA 4UEFA 1LFWA 3FMCA 2ZEGA 2PJ7A 4MHZA 1ZG7A 2EK9A 2CTBA 3H8EA 2NSMA 3N5FA 3B3CA 2J9AA 4MCQA 2PJ2A 3B3TA 4MXUA 3L2NA 2QJ8A 5LYLA 1XMBA 4MRIA 4JZ0A 3D7GA 4OIWA 2WYRA 3FX6A 2QYVA 3VATA 4A37A 4C8TA 3MN8A 4KSIA 3DLJA 4YWYA 3NA6A 2XEJA 5JGFA 4A39A 2QVPA 1CX8A 4C8AA 1VIXA 1XFOA 2ZOGA 4MHNA 4UIAA 3RAMA 4PPZA 3SJEA 5LYIA 2PJ4A 5LRJA 4Q7AA 2GP4A 5HVHA 1F2OA 2ZEDA 2FVGA 1YW4A 2I3CA 5JH9A 4C9RA 3H8FA 1VHOA 3K2KA 4R7MA 1PCAA 2Q4ZA 2V8GA 5LYFA 4ONWA 2ZENA 1FT7A 1ZLHA 3NH4A 2BOAA 1XRYA 3EIFA 3PB7X 3I74A 1XJOA 2O53A 1NSAA 4ZY2A 2GLFA 6CPAA 1Z5RA 3GLJA 2ZEHA 1TKJA 4C8FA 2PVWA 1F2PA 3S9LA 3CT9A 4UF4A 3KI9A 4KNGE 3KHZA 2PJ9A 4P10A 3BI0A 1H8LA 1GYTA 1PYTB 4B6ZA 4P4FA 4F9VA 2PE3A 4NJQA 4AXVA 2ZEEA 1CBXA 4OKOA 1ZG9A 2C1CA 4DJLA 1HDUA 3VH9A 2AFOA 1TKFA 2C6PA 3KHXA 3SI2A 1CPSA 3TX8A 4IHMA 4DUKA 3S9MA 2C6GA 4OC4A 3ISZA 4OIDA 4C85A 4OC3A 2PJ0A 4FBEA 3KQXA 1ZG8A 4R6TA 1BLLE 1V6CA 3ICUA 2AFWA 2BO9A 3B3SA 4MCPA 1HDQA 3PEIA 5IR2A 4F9UA 3KR5A 3HLPA 4MHPA 5D29A 3LWUA 2PIZA 4C9EA 2ZEOA 4P4JA 4PXDA 2PVVA 2PJ1A 3CPAA 3JRUA 4ZX8A 3BI1A 3IC1A 3D66A 1IY7A 2AFSA 2ZEPA 1F57A 2V77A 2ZEMA 2HB6A 4NGSA 1Z8LA 3KQZA 7CPAA 4FUUA 1TKHA 2F8HA 2AFZA 1LOKA 3V38A 4MHYA 2G9DA 3B3VA 4UEZA 4LQGA 1KWMA 1TF9A 3WC7A 1CPXA 1UWYA 4PQAA 3D67A 3IO1A 5D8NA 4C84A 5LRKA 2Q43A 3H8GA 3QNVA 3SJXA 2ANPA 1YMEA 3BHXA 2PJ6A 5IB9A 2PCUA 1Y9ZA 4UEEA 1CP7A 2POKA 1DE4C 3FF3A 3PBBA 3KGQA 1CP6A 3K9TA 3FEEA 4X8IA 3D7FA 1VGYA 5K8NA 3FECA 3RBUA 2RB7A 1XBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAV A;  4P4B A;  2PJA A;  3IFE A;  4WJB A;  4K3N A;  3WC6 A;  4DYO A;  2V8H A;  4YU9 A;  2JEW A;  1JQG A;  4G1P A;  2O4H A;  3SJG A;  3GB0 A;  3PFE A;  3B7I A;  3PFO A;  4NGR A;  4WWV A;  5LRG A;  4UIB A;  2CIJ A;  1LAN A;  3SI0 A;  4JYW A;  3WC5 A;  2JBK A;  3D7D A;  5HXD A;  4A94 A;  2RFH A;  4CPA A;  2PRQ A;  3D4U A;  3I6S A;  3KR4 A;  1HEE A;  5CPA A;  4C8C A;  3PB6 X;  1ZLI A;  1WVM A;  2PIY A;  3I1U A;  5K8O A;  5K8M A;  2V8V A;  2EK8 A;  4R76 A;  1FNO A;  2OOT A;  5THW A;  4C9U A;  2EWB A;  4W9Y A;  4OME A;  2HC9 A;  2PJ5 A;  3WT4 A;  4OC1 A;  3NFZ A;  4ZYQ A;  4OC2 A;  2AFX A;  1EE3 P;  3PB8 X;  2AFU A;  3PRT A;  2V8D A;  4NGT A;  3GUX A;  1AMP A;  3B3W A;  4C9V A;  3KL9 A;  1LCP A;  4ZY0 A;  5I4M A;  3SI1 A;  4P4D A;  3ISX A;  3SJF A;  1LAM A;  1Y0Y A;  1YSJ A;  3KZW A;  3NH8 A;  4CDJ A;  1R43 A;  3DGV A;  4ZX9 A;  4EWT A;  3B35 A;  3T8W A;  4TJX A;  5LYD A;  4IK2 A;  2XEI A;  5DS0 A;  5HVF A;  4TNU A;  2C6C A;  4NGP A;  4FAI A;  3IWW A;  1AYE A;  2GU2 A;  4CDK A;  1ELM P;  1BPN A;  4TJV A;  1OBR A;  2JBJ A;  3PB4 X;  2GRE A;  4RUH A;  2CTC A;  4F8Z A;  4H2K A;  3HUV A;  2ZEF A;  3PBE A;  1LAP A;  1IGB A;  2BCO A;  3FED A;  1R3N A;  3VAR A;  5JM6 A;  3FVL A;  4P6Y A;  3B2Y A;  4MCS A;  4PXE A;  2VL1 A;  2F7V A;  4P45 A;  4OP4 A;  3S9N A;  1YLO A;  1M4L A;  1ARL A;  5K8P A;  4MCR A;  4C99 A;  4PXC A;  1Y0R A;  3MRU A;  1CG2 A;  4OC5 A;  4C9A A;  3VTA A;  2IJZ A;  1YW6 A;  2PJ8 A;  3KAS A;  3NH5 A;  2DEA A;  4EME A;  2PJ3 A;  1XF1 A;  1ELL P;  2OR4 A;  2ABZ A;  1TXR A;  4FWU A;  4C8U A;  3BXM A;  3LMS A;  5F09 A;  4NGM A;  1DTD A;  1Y7E A;  3IEH A;  1RTQ A;  8CPA A;  4ZI6 A;  3FJU A;  5ELY A;  1BPM A;  4NGN A;  2WZN A;  4MMO A;  2AFM A;  1BAV A;  4O23 A;  4Z65 A;  3CDX A;  1ARM A;  3WAB A;  4A38 A;  3PB9 X;  5CBM A;  4C86 A;  4GM5 A;  4X3R A;  1QQ9 A;  3D68 A;  2IQ6 A;  4YN3 A;  1Z2L A;  2XEG A;  1Q7L A;  2PJB A;  3D7H A;  5J1Q A;  2CF4 A;  2ZOF A;  3RZA A;  4P4I A;  4BD9 A;  1TF8 A;  4OC0 A;  2IMO A;  2Q51 A;  3IJ3 A;  4P44 A;  2GLJ A;  2ZEL A;  3TC8 A;  1VHE A;  4R8F A;  4NJR A;  4X2T A;  3CPX A;  1QMU A;  4C8P A;  2PJC A;  3IIB A;  4NFR A;  5HVG A;  4EFD A;  3FH4 A;  3V7Z A;  4PXB A;  4NGQ A;  2XEF A;  2NYQ A;  4ZY1 A;  4TWE A;  4P4E A;  4UEF A;  1LFW A;  3FMC A;  2ZEG A;  2PJ7 A;  4MHZ A;  1ZG7 A;  2EK9 A;  2CTB A;  3H8E A;  2NSM A;  3N5F A;  3B3C A;  2J9A A;  4MCQ A;  2PJ2 A;  3B3T A;  4MXU A;  3L2N A;  2QJ8 A;  5LYL A;  1XMB A;  4MRI A;  4JZ0 A;  3D7G A;  4OIW A;  2WYR A;  3FX6 A;  2QYV A;  3VAT A;  4A37 A;  4C8T A;  3MN8 A;  4KSI A;  3DLJ A;  4YWY A;  3NA6 A;  2XEJ A;  5JGF A;  4A39 A;  2QVP A;  1CX8 A;  4C8A A;  1VIX A;  1XFO A;  2ZOG A;  4MHN A;  4UIA A;  3RAM A;  4PPZ A;  3SJE A;  5LYI A;  2PJ4 A;  5LRJ A;  4Q7A A;  5HVH A;  1F2O A;  2ZED A;  2FVG A;  1YW4 A;  2I3C A;  5JH9 A;  4C9R A;  3H8F A;  1VHO A;  3K2K A;  4R7M A;  1PCA A;  2Q4Z A;  2V8G A;  5LYF A;  4ONW A;  2ZEN A;  1FT7 A;  1ZLH A;  3NH4 A;  2BOA A;  1XRY A;  3EIF A;  3PB7 X;  3I74 A;  1XJO A;  2O53 A;  1NSA A;  4ZY2 A;  2GLF A;  6CPA A;  1Z5R A;  3GLJ A;  2ZEH A;  1TKJ A;  4C8F A;  2PVW A;  1F2P A;  3S9L A;  3CT9 A;  4UF4 A;  3KI9 A;  4KNG E;  3KHZ A;  2PJ9 A;  4P10 A;  3BI0 A;  1H8L A;  1GYT A;  1PYT B;  4B6Z A;  4P4F A;  4F9V A;  2PE3 A;  4NJQ A;  4AXV A;  2ZEE A;  1CBX A;  4OKO A;  1ZG9 A;  2C1C A;  4DJL A;  1HDU A;  3VH9 A;  2AFO A;  1TKF A;  2C6P A;  3KHX A;  3SI2 A;  1CPS A;  3TX8 A;  4IHM A;  4DUK A;  3S9M A;  2C6G A;  4OC4 A;  3ISZ A;  4OID A;  4C85 A;  4OC3 A;  2PJ0 A;  4FBE A;  3KQX A;  1ZG8 A;  4R6T A;  1BLL E;  1V6C A;  3ICU A;  2AFW A;  2BO9 A;  3B3S A;  4MCP A;  1HDQ A;  3PEI A;  4F9U A;  3KR5 A;  3HLP A;  4MHP A;  5D29 A;  3LWU A;  2PIZ A;  4C9E A;  2ZEO A;  4P4J A;  4PXD A;  2PVV A;  2PJ1 A;  3CPA A;  3JRU A;  4ZX8 A;  3BI1 A;  3IC1 A;  3D66 A;  1IY7 A;  2AFS A;  2ZEP A;  1F57 A;  2V77 A;  2ZEM A;  2HB6 A;  4NGS A;  1Z8L A;  3KQZ A;  7CPA A;  4FUU A;  1TKH A;  2F8H A;  2AFZ A;  1LOK A;  3V38 A;  4MHY A;  2G9D A;  3B3V A;  4UEZ A;  4LQG A;  1KWM A;  1TF9 A;  3WC7 A;  1CPX A;  1UWY A;  4PQA A;  3D67 A;  3IO1 A;  5D8N A;  4C84 A;  5LRK A;  2Q43 A;  3H8G A;  3QNV A;  3SJX A;  2ANP A;  1YME A;  3BHX A;  2PJ6 A;  5IB9 A;  2PCU A;  1Y9Z A;  4UEE A;  1CP7 A;  2POK A;  1DE4 C;  3FF3 A;  3PBB A;  3KGQ A;  1CP6 A;  3K9T A;  3FEE A;  4X8I A;  3D7F A;  1VGY A;  5K8N A;  3FEC A;  3RBU A;  2RB7 A;  1XBU A; 
#chains in the Genus database with same CATH topology
 2OU2 A;  4FAI A;  1TIQ A;  2PDO A;  4P4B A;  2PJA A;  3GY9 A;  3IFE A;  4IAV A;  4JJX A;  4UBR A;  3TCV A;  2Z3M A;  2REE A;  4KOU A;  4WJB A;  4K3N A;  1VKC A;  4PK2 A;  4XPK A;  3WC6 A;  4AVA A;  2V8H A;  4YU9 A;  4DYO A;  3GYA A;  2JEW A;  5DWN A;  1JQG A;  1YK3 A;  3MGD A;  4G1P A;  4R57 A;  3W6X A;  2O4H A;  3T0T A;  4KSF A;  2HI6 A;  3SJG A;  2EZC A;  3GB0 A;  4IUS A;  4NF1 A;  3PFE A;  2VEZ A;  3B7I A;  3EC4 A;  4A32 A;  1NBW A;  2PRB A;  2Y0M A;  4E94 A;  4U5Y A;  2B5G B;  3S6H A;  3VWD A;  2WSA A;  2OZG A;  3P2H A;  3QAY A;  2XPL A;  4CGL A;  3PFO A;  2BUE A;  4NGR A;  4COG A;  4WWV A;  1OZP A;  5LRG A;  2QIR A;  5H86 A;  1Q2Y A;  4MFZ A;  4UIB A;  4B10 A;  4KS9 A;  2VZZ A;  1IU8 A;  1MK4 A;  2CIJ A;  1MJA A;  4UCP A;  1MJB A;  4HNY B;  1LAN A;  1QSN A;  2BEI A;  3SI0 A;  4JWP A;  4JYW A;  3ZJ0 A;  1JDB C;  2EO8 A;  3WC5 A;  2JBK A;  3D7D A;  2B4D A;  2YGW A;  4E2A A;  3ZNI A;  5HXD A;  2Y1N A;  4A94 A;  2RFH A;  4CPA A;  4UCN A;  4CGN A;  2PRQ A;  3D4U A;  1EO0 A;  1YX0 A;  1YVH A;  3KR4 A;  3I6S A;  1HEE A;  4PSW A;  1NXJ A;  5CPA A;  2Q4Y A;  3LOD A;  3PB6 X;  1Z8T A;  1ZLI A;  4C8C A;  5H84 A;  5F46 A;  1WVM A;  4A4C A;  2PIY A;  4KLV A;  5AG7 A;  5F48 A;  3I1U A;  1Z9E A;  3HPG G;  3PGP A;  4CGO A;  4LQ6 A;  5JQ4 A;  5K8O A;  1X12 A;  1XF8 A;  5K8M A;  2V8V A;  2EK8 A;  4MI4 A;  2JDC A;  1CM0 A;  4R76 A;  1FNO A;  3BUO B;  2OOT A;  2WPW A;  1Q2C A;  5THW A;  3BJ7 A;  2HWG A;  1KC7 A;  4C9U A;  2EWB A;  2AUN A;  4W9Y A;  4OME A;  2I79 A;  3DDD A;  1RXT A;  5G22 A;  2HC9 A;  4FD4 A;  2PJ5 A;  3RYO A;  4OLL A;  3T9Y A;  3WT4 A;  4ONU A;  2Q0Y A;  5F9M A;  2YJV A;  1IID A;  4B14 A;  4A2Z A;  4OC1 A;  4CYQ A;  1M4D A;  3CZX A;  3NFZ A;  4ZYQ A;  5IB0 A;  1JDE A;  3SR3 A;  2EBJ A;  1Z8X A;  3EO4 A;  1L0C A;  4OC2 A;  2AFX A;  5F13 A;  1EE3 P;  1Z8W A;  3H4Q A;  2AFU A;  3GKR A;  1RO5 A;  3FRM A;  3PB8 X;  2V8D A;  3PRT A;  4NGT A;  3P2F A;  4CGP A;  3FIX A;  4RI1 A;  1KEE B;  3GUX A;  2C27 A;  1AMP A;  1IOI A;  3B3W A;  3KKW A;  2R7H A;  4C9V A;  3KL9 A;  1QSO A;  4MI1 A;  2NMT A;  1LCP A;  4MY0 A;  4ZY0 A;  2B4B A;  3EZE A;  4M3S A;  2EZA A;  3TT2 A;  5I4M A;  1S7L A;  3SI1 A;  2BL1 A;  2YNC C;  2CY2 A;  3S6K A;  5J8F A;  3BJ8 A;  4P4D A;  3ISX A;  1WWZ A;  3SJF A;  3VRR A;  1PU9 A;  1LAM A;  2VZY A;  1Y0Y A;  1YSJ A;  4QUS A;  2EUI A;  2FT0 A;  3F8K A;  3KZW A;  3NH8 A;  4CDJ A;  1R43 A;  3O8Z A;  3DGV A;  4ZX9 A;  4EWT A;  3IWG A;  4Y49 C;  4KSA A;  3B35 A;  3SHP A;  3T8W A;  4CYO A;  1C30 B;  2ZW6 A;  4TJX A;  1ZL0 A;  4BIN A;  2OZH A;  2K5T A;  4IK2 A;  4PSX A;  5LYD A;  1JWQ A;  2XEI A;  4K30 A;  4CRY B;  3CXQ A;  4IIY A;  2FSR A;  5DS0 A;  5HVF A;  4TNU A;  4NGP A;  2C6C A;  2J8M A;  2GFQ A;  3IWW A;  1AYE A;  2GU2 A;  3RO0 A;  4A95 A;  3VRN A;  4CAX A;  2HUZ A;  3DR8 A;  4CDK A;  1ELM P;  4RS2 A;  1BPN A;  2FIA A;  4KOT A;  5GCN A;  2XPO A;  2FE7 A;  1XE4 A;  3G23 A;  2VXK A;  4TJV A;  1OBR A;  1I1D A;  2DPS A;  1K4J A;  4KUA A;  2JBJ A;  2B3V A;  3PB4 X;  2GRE A;  3S6G A;  4F0X A;  4RUH A;  2R82 A;  2CTC A;  2ZW4 A;  4H2K A;  4F8Z A;  2OZU A;  3PLF B;  3HUV A;  4A33 A;  3K9U A;  5C88 A;  4KVX A;  2ZEF A;  5FD8 A;  2Z10 A;  3H5Z A;  3PBE A;  1LAP A;  3VWE A;  1IGB A;  2G3T A;  3OB1 B;  3FED A;  1R3N A;  2BCO A;  3PT1 A;  3VAR A;  4H89 A;  2HV2 A;  5JM6 A;  4AVB A;  3FVL A;  4P6Y A;  5JVL A;  5F1Y A;  2HRO A;  3B2Y A;  4NSQ A;  3DR6 A;  1YVO A;  4QVT A;  4ZBG A;  4MCS A;  4PXE A;  1B87 A;  2N3A B;  4HPS A;  2VL1 A;  1IB1 E;  2F7V A;  2HQY A;  1M6V B;  1Z4R A;  1VI4 A;  4P45 A;  2R8V A;  2VKZ G;  4MHD A;  4OP4 A;  3EXN A;  3S9N A;  1YLO A;  1M4L A;  5JYB A;  1ARL A;  4B13 A;  3R1K A;  1PUA A;  3A9L A;  5K8P A;  4MCR A;  4F6A A;  4C99 A;  5KTD A;  4CAE A;  4PXC A;  1Y0R A;  3MRU A;  2G0B A;  4R3K A;  4UFW A;  4M6G A;  1CG2 A;  4HNW B;  1EZB A;  4OC5 A;  2GE3 A;  1XOV A;  4C9A A;  1KBL A;  3VTA A;  2CNT A;  3VRP A;  4YFJ A;  2IJZ A;  3TLG B;  1YW6 A;  2PJ8 A;  3KAS A;  3NH5 A;  4II9 A;  2DEA A;  3C26 A;  2Z3P A;  1GGO A;  4EME A;  3OAK A;  3HPH E;  1T36 B;  2AJ6 A;  3IWE A;  2PJ3 A;  5ISV A;  1XF1 A;  1ELL P;  2OR4 A;  2ABZ A;  2O28 A;  1TXR A;  3EY5 A;  4CAW A;  1Y9K A;  4FWU A;  4C8U A;  5AGE A;  4DNC A;  3BXM A;  3LMS A;  5F09 A;  4NGM A;  4BPU B;  1DTD A;  1Y7E A;  3IEH A;  1RTQ A;  2F5I A;  8CPA A;  5JPH A;  3SXN A;  1N71 A;  4ZI6 A;  2PQ8 A;  3B8G A;  3FJU A;  5HH1 A;  1R61 A;  5BWA B;  2ATR A;  5ELY A;  1BPM A;  2X0S A;  2ARH A;  4M6I A;  4NGN A;  2P6E A;  5CNP A;  2WZN A;  4MMO A;  4PV6 A;  2AFM A;  1VHS A;  2A4N A;  4XPD C;  1BAV A;  4HKF A;  4O23 A;  2XPP A;  3F9K C;  2Q7S A;  4Z65 A;  3CDX A;  1ARM A;  3WAB A;  4A38 A;  1BXR B;  3PB9 X;  4MJX A;  2C5Q A;  2AUM A;  3KRV A;  5CBM A;  1C3O B;  1KUY A;  2YNC A;  4C86 A;  4GM5 A;  4X3R A;  1QQ9 A;  1Y7R A;  3D68 A;  2IQ6 A;  3JTK A;  4YN3 A;  1Z2L A;  2D4P A;  5KTA A;  2XEG A;  2FS5 A;  4H6Z A;  1Q7L A;  2UV8 G;  4BPX B;  2PJB A;  3D7H A;  2X7B A;  2Z11 A;  3E0K A;  1NMT A;  2CF4 A;  1S3Z A;  2ZOF A;  3IU1 A;  2FCK A;  2PR8 A;  4KVO E;  4BMH A;  1NSL A;  2IL4 A;  3RZA A;  2EZB A;  4P4I A;  1S7N A;  1S7F A;  4BD9 A;  1TF8 A;  4IF5 A;  5HMN A;  4OC0 A;  4JD6 A;  2IMO A;  2Q51 A;  4YGO A;  4KLW A;  3IJ3 A;  5A28 A;  5IV0 A;  4FD6 A;  3OB2 B;  4P44 A;  4MFL A;  4B5O A;  2EVN A;  2GLJ A;  2ZEL A;  3TC8 A;  1VHE A;  4U9Y A;  4CYP A;  4R9M A;  4R8F A;  4B5P B;  1P0H A;  1ZO0 A;  2CXA A;  1MJ9 A;  4NJR A;  4X2T A;  3JUW A;  3CPX A;  1IYK A;  5AG4 A;  1QSM A;  1QMU A;  4C8P A;  2PJC A;  3IIB A;  4L89 A;  4NFR A;  2PR1 A;  4XNH B;  4R3L A;  4BPW B;  1ZRS A;  1Q5X A;  2PC1 A;  1GHE A;  5HVG A;  4EFD A;  3BUN B;  4MY3 A;  3FH4 A;  3V7Z A;  4PXB A;  4NGQ A;  2XEF A;  2NYQ A;  2CNM A;  3F0A A;  2WUU A;  4ZY1 A;  3R96 A;  4TWE A;  4P4E A;  2RC4 A;  3TLC A;  4UEF A;  1LFW A;  3FMC A;  4RR2 B;  4H6U A;  1J4J A;  4EYS A;  3TLA A;  1M1D A;  2ZEG A;  2PJ7 A;  3NE7 A;  4MHZ A;  1WJT A;  1ZG7 A;  3DNS A;  2DPT A;  1I21 A;  4GXH A;  2EK9 A;  4MFK A;  1SQH A;  1KUX A;  3TTH A;  2CTB A;  3QB8 A;  1J3L A;  1X10 A;  3H8E A;  1BOB A;  2D0P A;  4BBH A;  2NSM A;  3N5F A;  3B3C A;  3F5B A;  2J9A A;  4MCQ A;  2PJ2 A;  2PCN A;  4CAF A;  3B3T A;  4MXU A;  4KOW A;  4UFV A;  4XPD B;  3L2N A;  3EZB A;  2QJ8 A;  3D3S A;  4C68 A;  5LYL A;  3EFA A;  2D0O A;  4CYN A;  3TO9 A;  2AE6 A;  1XMB A;  1M4I A;  4MRI A;  4JZ0 A;  3T07 A;  3D7G A;  2PSW A;  4OIW A;  2WYR A;  3FX6 A;  2VQY A;  4JXR A;  3WR7 A;  2QYV A;  4CO9 A;  1IIC A;  2G3A A;  1CJW A;  5K99 A;  3VAT A;  4A37 A;  1WK4 A;  4C8T A;  3MN8 A;  4C2X A;  4KSI A;  3DLJ A;  5F49 A;  2OB0 A;  4YWY A;  2Z3N A;  1CE8 B;  3NA6 A;  2XEJ A;  5JGF A;  4A39 A;  3VGO A;  2QVP A;  5J8C A;  2FM4 A;  1CX8 A;  4C8A A;  1VIX A;  5J1Q A;  3OWC A;  1XFO A;  3TLB A;  3CXP A;  3NOJ A;  4M6H A;  2ZOG A;  1A2Z A;  4ZGY B;  3I3G A;  2FL4 A;  4MHN A;  2P0W A;  4UIA A;  3RAM A;  3TLE A;  3G3S A;  4AVC A;  2YNE A;  2J8N A;  3SJE A;  3D2P A;  2PJ4 A;  2VI7 A;  4GS4 A;  3LD2 A;  1P4N A;  4PPZ A;  1YLE A;  2ZPA A;  5LRJ A;  2FIW A;  4B11 A;  4Q7A A;  4R87 A;  1XMT A;  4UCM A;  4B12 A;  2GP4 A;  1B6B A;  2Q7B A;  1YVK A;  3TLY A;  2OH1 A;  2ZXV A;  4YRH A;  4GPL B;  5HVH A;  1F2O A;  2YND A;  2ZED A;  2FVG A;  4BTF A;  1YW4 A;  2I3C A;  2B58 A;  5JH9 A;  3U1B A;  4JLY A;  4KOX A;  4C9R A;  3H8F A;  1VHO A;  3K2K A;  3W6S A;  2B0A A;  4R7M A;  1PCA A;  2Q04 A;  2Q4Z A;  3R95 A;  4E0A A;  4A4B A;  2V8G A;  1M4G A;  3I9S A;  5LYF A;  4ONW A;  2ZEN A;  1Y9W A;  3N7Z A;  4KOY A;  1FT7 A;  3SXO A;  1ZLH A;  3NH4 A;  4C2Z A;  4LUA A;  2BOA A;  1XRY A;  1CS0 B;  2B3U A;  3EIF A;  5HKZ A;  1B47 A;  3PB7 X;  2REF A;  2P6F A;  4J3G A;  4M85 A;  3W91 A;  3I74 A;  2Z0Z A;  4OAD A;  5J3X A;  1S7K A;  5HKW A;  3T90 A;  1XJO A;  2JLM A;  3TLG A;  2ZW5 A;  2O53 A;  1NSA A;  3G8W A;  4ZY2 A;  2GLF A;  6CPA A;  1Z5R A;  3GLJ A;  2ZEH A;  4AG9 A;  5F47 A;  4CRZ B;  1TKJ A;  2H5M A;  2DIK A;  4A31 A;  4J0N A;  2DF5 A;  5KTC A;  2PVW A;  3FBU A;  4AB7 A;  4C8F A;  3TO6 A;  4NXY A;  1F2P A;  3S9L A;  3CT9 A;  4UF4 A;  1XEB A;  1U6M A;  3KI9 A;  1YQE A;  1ZYM A;  2YJT A;  3V8I A;  1LRZ A;  2PJ9 A;  3KHZ A;  4KNG E;  4P10 A;  3BI0 A;  1H8L A;  1S5K A;  2Z3K A;  3C8O A;  3HMJ G;  3QAH A;  4XNH C;  1GYT A;  1DIK A;  2MP0 A;  1PYT B;  3PFV A;  3IGR A;  4B6Z A;  4P4F A;  2I00 A;  3FXT A;  4ORF A;  4C2Y A;  4F9V A;  1XIX A;  2PE3 A;  4NJQ A;  3EZA A;  4UA3 A;  4AXV A;  2ZEE A;  4MFJ A;  4MFQ A;  3DSB A;  4OAE A;  2GIV A;  2QEC A;  1CBX A;  4FD5 A;  4OKO A;  3U88 C;  1ZG9 A;  2C1C A;  4DJL A;  1HDU A;  2CBL A;  2AFO A;  4QC6 A;  3FB3 A;  3VH9 A;  1TKF A;  2C6P A;  4XPL A;  3KHX A;  3SI2 A;  5EMI A;  1CPS A;  4NEX A;  2Y1M A;  3R9E A;  4IHM A;  4FD7 A;  4RN7 A;  1BO4 A;  3TX8 A;  4C7I A;  4DUK A;  3S9M A;  2CNS A;  5EBV A;  1KZF A;  2C6G A;  5LYI A;  4OC4 A;  3ISZ A;  4OID A;  4C85 A;  4OC3 A;  4HNX B;  2PJ0 A;  4Q36 A;  2JDD A;  2J8R A;  4FBE A;  1V0C A;  5HKY A;  3KQX A;  4H1H A;  5E96 A;  3FNC A;  1AUG A;  1ZG8 A;  4R6T A;  3R9F A;  1Z4E A;  1BLL E;  2ODF A;  4M8D A;  5IX3 A;  4IIX A;  3GJZ A;  1V6C A;  1Q2D A;  2GAN A;  2WPX A;  3ICU A;  4KVM E;  1FBV A;  1VBG A;  3CXS A;  5AG6 A;  3S6F A;  2BO9 A;  2AFW A;  3B3S A;  4KOR A;  4MCP A;  1HDQ A;  5BY0 A;  3PEI A;  2BSW A;  5IR2 A;  2XPN A;  4F9U A;  4UFX A;  5EC4 A;  2DXQ A;  4L8A A;  3KR5 A;  3ZZI A;  4F0Y A;  2ZW7 A;  3HLP A;  3TOA A;  3D2M A;  3IU2 A;  4MHP A;  4COB A;  2JEV A;  3GIU A;  5D29 A;  4NCZ A;  3UY5 A;  3TE4 A;  1IYL A;  3LWU A;  4CS0 B;  4MJ8 A;  4QB9 A;  4MFP A;  2PIZ A;  4C9E A;  2ZEO A;  4P4J A;  2P6G A;  4PXD A;  1QST A;  5AXI A;  2PVV A;  4JVO A;  3FYN A;  2KCW A;  2PJ1 A;  2VBQ A;  3CPA A;  3PP9 A;  4KZT A;  5C82 A;  3T5M A;  1NE9 A;  3RNZ A;  4E5S A;  3JRU A;  5G1Z A;  3VRQ A;  4I49 A;  4Y49 B;  4ZX8 A;  3VRO A;  4E8O A;  3BI1 A;  4INJ A;  1EZA A;  4CZ1 A;  5AG5 A;  3IC1 A;  3D66 A;  1IY7 A;  3D8P A;  4KOV A;  2Z3L A;  3BUW B;  2AFS A;  3TOB A;  2ZEP A;  5DWM A;  1F57 A;  5G20 A;  2R98 A;  2V77 A;  2ZEM A;  4LX9 A;  5I0C A;  2HB6 A;  4NGS A;  4CAV A;  4EVY A;  1QSR A;  1Z8L A;  3KQZ A;  7CPA A;  4X5K A;  1YRE A;  1TKH A;  4FUU A;  2F8H A;  2AFZ A;  1LOK A;  3V38 A;  1R57 A;  3NFQ A;  2D4O A;  3TLZ A;  3JVN A;  3BUM B;  4MHY A;  1M44 A;  2FXF A;  2G9D A;  3B3V A;  4KUB A;  4UEZ A;  4LQG A;  3BLN A;  1KWM A;  1TF9 A;  3WC7 A;  5F5X A;  4JXQ A;  1CPX A;  4AG7 A;  5A27 A;  1UWY A;  4PQA A;  1KUV A;  2OLS A;  3BUX B;  3T05 A;  3D67 A;  1VBH A;  3IO1 A;  5D8N A;  4C84 A;  1I12 A;  4Q38 A;  5LRK A;  2Q43 A;  1IOF A;  3H8G A;  4QBJ A;  3QNV A;  5G21 A;  3PZJ A;  2DLA A;  3SJX A;  2ANP A;  1FY7 A;  1YR0 A;  1S60 A;  1YME A;  2E28 A;  3TFY A;  3BHX A;  2B4D B;  2PJ6 A;  5IB9 A;  2Q4V A;  2PCU A;  3TO7 A;  1YGH A;  4C7H A;  4CGM A;  4B5P A;  2B4J C;  2Q44 A;  4UEE A;  1Y9Z A;  1CP7 A;  1UFH A;  1Z9U A;  2POK A;  1DE4 C;  1A9X B;  3FF3 A;  4UWI A;  4U9Z A;  2QML A;  3NE8 A;  4UWJ A;  3PBB A;  3KGQ A;  3K4I A;  1CP6 A;  3TYX A;  3OP0 A;  3K9T A;  4KOS A;  4PK3 A;  3FEE A;  4X8I A;  3D7F A;  4MBU A;  3R9G A;  4A30 A;  2R1I A;  1VGY A;  5K8N A;  3FEC A;  1ON0 A;  3RBU A;  3LAC A;  2B5G A;  2RB7 A;  5FVJ A;  2Z3O A;  1XBU A; 
#chains in the Genus database with same CATH homology
 4IAV A;  4P4B A;  2PJA A;  3IFE A;  4WJB A;  4K3N A;  3WC6 A;  4DYO A;  2V8H A;  4YU9 A;  2JEW A;  1JQG A;  4G1P A;  2O4H A;  3SJG A;  3GB0 A;  3PFE A;  3B7I A;  3PFO A;  4NGR A;  4WWV A;  5LRG A;  4UIB A;  2CIJ A;  1LAN A;  3SI0 A;  4JYW A;  3WC5 A;  2JBK A;  3D7D A;  5HXD A;  4A94 A;  2RFH A;  4CPA A;  2PRQ A;  3D4U A;  3I6S A;  3KR4 A;  1HEE A;  5CPA A;  4C8C A;  3PB6 X;  1ZLI A;  1WVM A;  2PIY A;  3I1U A;  5K8O A;  5K8M A;  2V8V A;  2EK8 A;  4R76 A;  1FNO A;  2OOT A;  5THW A;  4C9U A;  2EWB A;  4W9Y A;  4OME A;  2HC9 A;  2PJ5 A;  3WT4 A;  4OC1 A;  3NFZ A;  4ZYQ A;  4OC2 A;  2AFX A;  1EE3 P;  3PB8 X;  2AFU A;  3PRT A;  2V8D A;  4NGT A;  3GUX A;  1AMP A;  3B3W A;  4C9V A;  3KL9 A;  1LCP A;  4ZY0 A;  5I4M A;  3SI1 A;  4P4D A;  3ISX A;  3SJF A;  1LAM A;  1Y0Y A;  1YSJ A;  3KZW A;  3NH8 A;  4CDJ A;  1R43 A;  3DGV A;  4ZX9 A;  4EWT A;  3B35 A;  3T8W A;  4TJX A;  5LYD A;  4IK2 A;  2XEI A;  5DS0 A;  5HVF A;  4TNU A;  2C6C A;  4NGP A;  4FAI A;  3IWW A;  1AYE A;  2GU2 A;  4CDK A;  1ELM P;  1BPN A;  4TJV A;  1OBR A;  2JBJ A;  3PB4 X;  2GRE A;  4RUH A;  2CTC A;  4F8Z A;  4H2K A;  3HUV A;  2ZEF A;  3PBE A;  1LAP A;  1IGB A;  2BCO A;  3FED A;  1R3N A;  3VAR A;  5JM6 A;  3FVL A;  4P6Y A;  3B2Y A;  4MCS A;  4PXE A;  2VL1 A;  2F7V A;  4P45 A;  4OP4 A;  3S9N A;  1YLO A;  1M4L A;  1ARL A;  5K8P A;  4MCR A;  4C99 A;  4PXC A;  1Y0R A;  3MRU A;  1CG2 A;  4OC5 A;  4C9A A;  3VTA A;  2IJZ A;  1YW6 A;  2PJ8 A;  3KAS A;  3NH5 A;  2DEA A;  4EME A;  2PJ3 A;  1XF1 A;  1ELL P;  2OR4 A;  2ABZ A;  1TXR A;  4FWU A;  4C8U A;  3BXM A;  3LMS A;  5F09 A;  4NGM A;  1DTD A;  1Y7E A;  3IEH A;  1RTQ A;  8CPA A;  4ZI6 A;  3FJU A;  5ELY A;  1BPM A;  4NGN A;  2WZN A;  4MMO A;  2AFM A;  1BAV A;  4O23 A;  4Z65 A;  3CDX A;  1ARM A;  3WAB A;  4A38 A;  3PB9 X;  2C5Q A;  5CBM A;  4C86 A;  4GM5 A;  4X3R A;  1QQ9 A;  3D68 A;  2IQ6 A;  4YN3 A;  1Z2L A;  2XEG A;  1Q7L A;  2PJB A;  3D7H A;  5J1Q A;  2CF4 A;  2ZOF A;  3RZA A;  4P4I A;  4BD9 A;  1TF8 A;  4OC0 A;  2IMO A;  2Q51 A;  3IJ3 A;  4P44 A;  2GLJ A;  2ZEL A;  3TC8 A;  1VHE A;  4R8F A;  4NJR A;  4X2T A;  3CPX A;  1QMU A;  4C8P A;  2PJC A;  3IIB A;  4NFR A;  5HVG A;  4EFD A;  3FH4 A;  3V7Z A;  4PXB A;  4NGQ A;  2XEF A;  2NYQ A;  4ZY1 A;  4TWE A;  4P4E A;  4UEF A;  1LFW A;  3FMC A;  2ZEG A;  2PJ7 A;  4MHZ A;  1ZG7 A;  2EK9 A;  2CTB A;  3H8E A;  2NSM A;  3N5F A;  3B3C A;  2J9A A;  4MCQ A;  2PJ2 A;  3B3T A;  4MXU A;  3L2N A;  2QJ8 A;  5LYL A;  1XMB A;  4MRI A;  4JZ0 A;  3D7G A;  4OIW A;  2WYR A;  3FX6 A;  2QYV A;  3VAT A;  4A37 A;  4C8T A;  3MN8 A;  4KSI A;  3DLJ A;  4YWY A;  3NA6 A;  2XEJ A;  5JGF A;  4A39 A;  2QVP A;  1CX8 A;  4C8A A;  1VIX A;  1XFO A;  2ZOG A;  4MHN A;  4UIA A;  3RAM A;  4PPZ A;  3SJE A;  5LYI A;  2PJ4 A;  5LRJ A;  4Q7A A;  2GP4 A;  5HVH A;  1F2O A;  2ZED A;  2FVG A;  1YW4 A;  2I3C A;  5JH9 A;  4C9R A;  3H8F A;  1VHO A;  3K2K A;  4R7M A;  1PCA A;  2Q4Z A;  2V8G A;  5LYF A;  4ONW A;  2ZEN A;  1FT7 A;  1ZLH A;  3NH4 A;  2BOA A;  1XRY A;  3EIF A;  3PB7 X;  3I74 A;  1XJO A;  2O53 A;  1NSA A;  4ZY2 A;  2GLF A;  6CPA A;  1Z5R A;  3GLJ A;  2ZEH A;  1TKJ A;  4C8F A;  2PVW A;  1F2P A;  3S9L A;  3CT9 A;  4UF4 A;  3KI9 A;  4KNG E;  3KHZ A;  2PJ9 A;  4P10 A;  3BI0 A;  1H8L A;  1GYT A;  1PYT B;  4B6Z A;  4P4F A;  4F9V A;  2PE3 A;  4NJQ A;  4AXV A;  2ZEE A;  1CBX A;  4OKO A;  1ZG9 A;  2C1C A;  4DJL A;  1HDU A;  3VH9 A;  2AFO A;  1TKF A;  2C6P A;  3KHX A;  3SI2 A;  1CPS A;  3TX8 A;  4IHM A;  4DUK A;  3S9M A;  2C6G A;  4OC4 A;  3ISZ A;  4OID A;  4C85 A;  4OC3 A;  2PJ0 A;  4FBE A;  3KQX A;  1ZG8 A;  4R6T A;  1BLL E;  1V6C A;  3ICU A;  2AFW A;  2BO9 A;  3B3S A;  4MCP A;  1HDQ A;  3PEI A;  5IR2 A;  4F9U A;  3KR5 A;  3HLP A;  4MHP A;  5D29 A;  3LWU A;  2PIZ A;  4C9E A;  2ZEO A;  4P4J A;  4PXD A;  2PVV A;  2PJ1 A;  3CPA A;  3JRU A;  4ZX8 A;  3BI1 A;  3IC1 A;  3D66 A;  1IY7 A;  2AFS A;  2ZEP A;  1F57 A;  2V77 A;  2ZEM A;  2HB6 A;  4NGS A;  1Z8L A;  3KQZ A;  7CPA A;  4FUU A;  1TKH A;  2F8H A;  2AFZ A;  1LOK A;  3V38 A;  4MHY A;  2G9D A;  3B3V A;  4UEZ A;  4LQG A;  1KWM A;  1TF9 A;  3WC7 A;  1CPX A;  1UWY A;  4PQA A;  3D67 A;  3IO1 A;  5D8N A;  4C84 A;  5LRK A;  2Q43 A;  3H8G A;  3QNV A;  3SJX A;  2ANP A;  1YME A;  3BHX A;  2PJ6 A;  5IB9 A;  2PCU A;  1Y9Z A;  4UEE A;  1CP7 A;  2POK A;  1DE4 C;  3FF3 A;  3PBB A;  3KGQ A;  1CP6 A;  3K9T A;  3FEE A;  4X8I A;  3D7F A;  1VGY A;  5K8N A;  3FEC A;  3RBU A;  2RB7 A;  1XBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...