5D38A

Directed evolutionary changes in kemp eliminase ke07 - crystal 17 round 7-2
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
ALAKRIDAALIMKDGRVVKGSNFENLRDSGDPVELGKFYSEIGIDELSFWDITASVEKRKTMLELVEKVAEQIDIPITVGGGIHDFETASELILRGADKVEFNTAAVENPSLITQIAQTFGSQAVVVYIAAKRVDGEFMVFTYSGTKNTGILLRDWVVEVEKRGAGEIVLGSIDRLGTKSGYDTEMIRFVRPLTTLPIIAHRGAGKMEHFLEAFLAGADAAKADSVFHSREIDVRELKEYLKKHGVNVRLEGLGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords De novo kemp eliminase KE07 round 7-2
publication title Directed evolutionary changes in Kemp Eliminase KE07 - Crystal 17 round 7-2
rcsb
source organism Synthetic construct
molecule tags De novo protein, lyase
total genus 97
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 4.1.3.-:
pdb deposition date 2015-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5d38A00
4CCCA 4M7SA 4BI7A 4QJ1A 3R89A 2JBMA 4LU0A 5AYYA 3LHYA 3TXZA 1KTNA 3QQ1A 2ZZ7A 2ABAA 2FLIA 4MYXA 2BWGA 3TW6A 1FBAA 3NQEA 4Z1DA 4NUWA 2QUVA 1G7UA 3PSVA 5K7JA 1OX4B 3ABSA 4RXGA 1FX6A 4TX9A 3SGUA 1LRTA 3QPYA 3DENA 1KFCA 3S1XA 1MZHA 3LRLA 4CCEA 4ZZ9A 1VYRA 2GVJA 3NNTA 5MHBA 3FOKA 2ZQ0A 1HL2A 3W73A 4IOTA 1GZGA 4U4MA 3NM1A 4MIMA 3EKZA 3P8JA 3UWYA 1A5CA 4FNRA 3DFTA 2J88A 4DPQA 1XBXA 1FDZA 1IIGA 2I1OA 2D73A 4ZQMA 5K9XA 1OF8A 2Y6ZA 5HUPA 4PEKA 4Q4KA 5CPLA 4FEZA 1EUAA 2V5LA 4HHPA 3NAVA 1THFD 2ZA1A 3QMSA 1M7OA 1KM2A 3OA3A 1GVQA 3TNOA 5D30A 2NUXA 3FYOA 1H5YA 1L2UA 1XXXA 1EX5A 2DZVA 3NQGA 1SW3A 5HR6A 3W7LA 3IGXA 3WJZA 2HS8A 3HGRA 3M47A 1ZAHA 4LS0A 3P74A 5DELA 2ZTKA 1XBVA 4JGDA 3GDLA 4LUIA 1WA3A 1F6KA 4O15A 4O8RA 1EP2A 2VENA 2NX3A 5K9DA 3NXFA 3W84A 4POCA 3HQ1A 1EEPA 5F2GA 5IBXC 4JTJA 4CNPA 2EF9A 1TTQA 3W6YA 4RKAA 4O18A 3B03A 3TKFA 1UJPA 3U6WA 1SUXA 4QISA 1G6CA 2GVLA 5D33A 1MEHA 2KZHA 2NUYA 2QEZA 1J4EA 4WXZA 3NYZA 1XCFA 2Y63A 3TQKA 1SW7A 1F7BA 3CTLA 2ISVA 1D3GA 1OK4A 3GKFA 5DXYA 4FB7A 3W7KA 1SO5A 3GDRA 3F4WA 1MEIA 3B04A 3NQFA 2NWSA 3LXAA 1KM5A 4H6KA 2GJNA 5KZDA 4YLWA 8TIMA 4ZQPA 3G3DA 3LLDA 5I3GA 4K37A 3YPIA 3G22A 2CZDA 4FX6M 4OHQA 2DZTA 1QFEA 3C2RA 1H7NA 3ZFHA 2G95A 3G1VA 4UC5A 3IVSA 4LS2A 3Q37A 4M5PA 2R8WA 2V2HA 4WOQA 5D09A 1CX9A 4ADUA 1FCQA 1O4UA 3T78A 5HWNA 4FNTA 4DQWA 4JIQA 1I4NA 3GR8A 4Q33A 4JTFA 4Z1CA 5L6UA 3NR0A 1H50A 2X16A 2YW4A 4KWVA 3GXNA 4QIUA 4AXKA 2A6NA 2Z6JA 1Q6QA 2X2GA 2HSAA 4A2SA 2VKZG 1R2SA 2J9YA 3L21A 3PBYA 3S5NA 1I2NA 3NVTA 3GKAA 1JVNA 2FQIA 1RR2A 4JTHA 3R12A 4GXMA 1SU5A 3A24A 2BTMA 4DPPA 2ZA2A 3C0JA 3SZ8A 5J5DA 2CWNA 1YADA 4ZQCA 1HTIA 3CIWA 3N34A 4P2VA 5LNSA 3P82A 1LYXA 3AO0A 3A22A 3G1SA 2ABBA 1JUBA 4E2BA 1KBJA 5LGXA 6TIMA 2E6FA 3MW7A 1H60A 1O60A 4UTWC 4O0ZA 2LLEA 2V9DA 1EWEA 3W1NA 3GAKA 2QCGA 4EVZA 3EX3A 4WY0A 1KM1A 1SZNA 3W7PA 2C13A 5KZMA 3ANYA 3RNDA 4N9BA 1P1XA 2C18A 5C5YA 2VOMA 4IX2A 4UTMA 3P61A 2VFFA 2ZTJA 5I3FA 1EA0A 4MY9A 1Z48A 2V82A 4UTTC 1GYNA 4IJBA 2A2IA 3MYPA 3MWAA 3W87A 3MHFA 4LOCA 5EKYA 3MMTA 2V2DA 2TPSA 5CSSA 3KHJA 1XUUA 1SFLA 1VYSX 1VLIA 3LGEA 2QCLA 4PL1A 1VCFA 1KBIA 5F4WA 3S6DA 5KITA 1VHCA 4GUFA 2QR6A 1SZGA 4LC8A 1SQ7A 2A6LA 3NM3A 4JEQA 1EP1A 2VXNA 4XKYB 2JKEA 4S1FA 3LHVA 5A8GA 4YCOA 1OFOA 1Y0EA 4PC8A 2PRMA 2GOUA 4HSNA 4NJGA 1TTPA 4TU1A 3DHFA 3DZ1A 2Y7GA 4N4PA 5C54A 1JQXA 1TPWA 1G4PA 4J9JA 3N2MA 3LXBA 2NXHA 5CPMA 4LV4A 1PE1A 3G1FA 4L4LA 4UTIA 3M1ZA 3AJXA 3EWYA 1LORA 1OFPA 3NGJA 1FWTA 1EIXA 3C2FA 1LLWA 2WQPA 4ORIA 3LRMA 4MZYA 3QSRA 1RPXA 3GDMA 5HWMA 3U2OA 1WX0A 3EWZA 4N9DA 4N6EA 4K38A 3I7SA 4ONVA 2ZRZA 1YXDA 1H7XA 3G3MA 2YX0A 3LHZA 4UFMA 2NZLA 3P62A 1NF0A 4NXKA 3S1VA 4GUIA 2VFHA 3P81A 3QFEA 4Z1BA 3W7QA 1TQJA 4ICNA 1N55A 1TB3A 1VPXA 5KINA 2OX1A 4AF0B 1F05A 2WNQA 3C3NA 3DI1A 1NAL1 4LY8A 4Y90A 4O16A 2RHGA 3DFSA 3MP5A 5C55A 5D37A 2ZZ5A 5EMUA 1A53A 4I9AA 1IXOA 3LCIA 4LTSA 1QCWA 3A23A 3GNNA 1F73A 2YYUA 4ADSA 3EWBX 4NZJA 2A7NA 1VCGA 1X7FA 3RLUA 5CZTA 1AG1O 4A21A 2WPBA 3WFAA 3EWXA 1W1ZA 3B0PA 1B9BA 3TAOA 2YPIA 5AC8A 1OYBA 3HIJA 4IMGA 5K9CA 5D03A 5DY2A 3BG5A 3NZ1A 2Q3OA 1JRCA 4MY1A 1Q45A 1FWRA 2E6YA 4LVDA 4AB4A 1OX6A 4O4WA 4Y9AA 1OFAA 1OFQA 3IGUA 3INPA 2RDWA 1ICPA 2HTMA 2QCCA 3ELFA 3RLVA 3G1YA 3O07A 5G1YA 3N3MA 4O54A 3LHWA 3TE9A 1LTDA 3LHUA 1ADOA 5H91A 4IXXA 1X6UA 1RQBA 5F1UA 5DN1A 2QF7A 3HPXA 1EP3A 3V75A 4A3UA 1TJPA 1GG1A 4R7JA 3BARA 3CIXA 3MYOA 1PHQA 3N2XA 5E93A 3HO8A 3W2UA 3IVTA 1BWKA 2B0MA 4GE8A 3LOTA 1SZFA 3Q2DA 4IPJA 3GXTA 1C8VA 3L5MA 4ZVJA 5I3KA 4MVAA 1NEYA 4LT9A 3NQ6A 2H3BA 4MLJA 4GBUA 3PF3A 1OK6A 3S5ZA 1H62A 4LNYA 3CM4A 3TX9A 1BTMA 1ZAJA 3NA8A 5DBTA 3I6RA 3CWNA 3VI2A 1TREA 2R94A 3U8GA 1GTEA 3LLFA 2H3DA 3NO5A 4JTIA 1H7RA 5F4SA 1KFBA 4LS1A 2NUWA 3JRKA 1LBFA 3ATZA 4MFDA 2FB2A 3NQAA 3MHGA 2OJPA 2HMCA 2P10A 5H2ZA 3WK1A 4Q32A 1RVGA 1W3IA 4UMBA 2QCDA 2FDSA 3NQ7A 4OQVA 5AOUA 1TRIA 2CLHA 2Z6IA 3OVQA 4OV4A 3D0CA 3BLFA 2Y61A 5J5RA 3B06A 1G4EA 3RF9A 1KLZA 1ALDA 2DZXA 5DXXA 3P5YA 3S1WA 1GVSA 4JNMA 2CLOA 4JICA 4RZ6A 4HN4A 1UUMA 3BG9A 1OYCA 4AEOA 3W86A 3NPWA 1H7OA 2FPTA 3EEGA 2E5DA 1JULA 4NU7A 4BWLC 3WK3A 5U7SA 1WXJA 4JDBA 3TMQA 4XTDA 4L4MA 2CW6A 4H4IA 1FDJA 3ABQA 1GVFA 3WK0A 3UWVA 3UY7A 5G1TA 3SSJA 3C61A 2PE4A 4UFKA 3G8EA 4NX0A 5L9FA 2A5HA 3HJZA 5G4EA 1GEQA 1Z42A 1UCWA 3PG8A 4NJJA 5G2HA 2CLMA 3HBLA 1G67A 2WSQA 3UZJA 4MLRA 1K3UA 2FTPA 1KW1A 2PCQA 3C8FA 2UV8G 1WBHA 1WQ5A 2B7NA 4AHOA 1FCBA 3BW3A 1GVRA 3TQ0A 3M6YA 2GVGA 4KFOA 5CG7A 1L6YA 3LCHA 1BKSA 2WNNA 3GIYA 4DF0A 5K4ZA 1K7EA 2YSWA 2ZA3A 4AH7A 3L5AA 3P7YA 3H55A 3BGJA 3LTPA 3HGOA 1AL8A 4RZ5A 2ZCGA 1HG3A 3UD6A 4U28A 3P67A 1H51A 3O16A 3L2IA 3SIZA 4TIMA 1XBYA 3TW7A 3LI1A 2DJXA 2RH9A 3MBFA 2GUUA 3WJSA 2Y7FA 1DJNA 3EKLA 1VLWA 4D2JA 4JX6A 1P0KA 4EWND 3CPRA 2Y7DA 4PL2A 5F2IA 3M41A 3B05A 3N19B 1ZALA 3O8AA 4A29A 1FY6A 3SECA 2YDAA 3W7OA 1TPC1 4R33A 4W9TA 4O50A 2DORA 2FPYA 2CFFA 3W1RA 2BX7A 1G69A 5EL1A 3R2GA 5LZLA 3SFKA 4A2RA 1GWJA 4N4QA 1N7KA 4OV9A 4ZQRA 2ZZ3A 3UWWA 3UY8A 3NQVA 1XDMA 3BW2A 3VNDA 4JTEA 3MP3A 5EYWA 3QC3A 3EX4A 2A4AA 4UMAA 4ZL1A 3G0UA 1SR9A 3T40A 5CZSA 2EGZA 5D04C 5BW6A 4GC4A 4PODA 4JD4A 5FEPA 4UMCA 3PBVA 3QH2A 1R2TA 4FNQA 1L6WA 2F84A 4WOZA 3W1QA 2TSYA 1FXPA 5DCDA 1F5ZA 3LCFA 4CNOA 1B3OA 2OT1A 1AK5A 4FX7A 3TK7A 1PL9A 4O57A 3K30A 1NVMA 3TFXA 1GT8A 4PCFA 3W7DA 2WSYA 3B0VC 3FFSA 2O7QA 1KFLA 1EB3A 2E09A 1KM4A 4DO4A 1U5JA 3FJ6A 2PURA 3M43A 4ZMGA 1XM3A 1S3HA 2A7PA 2J6XA 3TA6A 1FWWA 1W5QA 3W23A 1JCMP 3NPUA 5D2VA 3M44A 2GQ8A 2QKFA 1QOPA 3HG5A 5CPOA 2Y7EA 1T8XA 3IIZA 4JYFA 1DHPA 4IMDA 4IUOA 4JN6A 2WJZA 1LROA 5HULA 4XZ9A 4RXFA 3W1LA 2X1UA 1RD5A 1QO2A 1VRDA 4Z1AA 3KFTA 1RV8A 5K4XA 2VEKA 5AFDA 1OF6A 4BWLA 3G0SA 3OEXA 2C0AA 4EF9A 1HO1A 2BXVA 4WJEA 4PH6A 4FXSA 5D2TA 3UXAA 3JS3A 3M5VA 5FEXA 4QNWA 1I2OA 2OCZA 2XFWA 4XWUA 3W2NA 1KTCA 4EIVA 3ATYA 5BMXA 3RMJA 1AL7A 4HIBA 3DAQA 3UNDA 1TSIA 4GNJA 1LBLA 1SW0A 4GUHA 3FS2A 3R13A 4AAJA 3W83A 1EUNA 2B7QA 3LERA 3TAKA 1M5WA 2BZNA 1SO3A 1X1ZA 3NQCA 4IMFA 3DH7A 4O4VA 3HF3A 1H1ZA 4NNBA 1VHNA 4ADTA 2VFGA 4IMEA 2B7OA 1Z44A 5DLCA 3G0XA 3PVFA 2JGQA 4MPQA 3WJXA 5TIMA 1ZJIA 1H7PA 1WAUA 2NX9A 2CLEA 5IM51 5BNKA 4O11A 4QSHA 3S9YA 1FWSA 3GNDA 4YCPA 1K8ZA 3PB0A 1BWLA 1XKYA 1ZENA 4NJHA 3TU9A 3VCRA 4NJKA 2NWRA 4UUIA 3DFNA 1PCWA 3W7MA 1W5PA 1VC4A 2C3ZA 3FYPA 5FESA 5AHFA 3HB9A 2GJLA 4GJ1A 3GZ3A 3LB0A 1NF7A 1FWNA 4OWGA 4NXSA 1JUKA 3TSMA 1AW2A 1QR7A 3C52A 1PHWA 2DJLA 3NOEA 1DL3A 4B5NA 1J2WA 1NFBA 4O10A 4YL2A 2XN2A 3C2EA 5F1VA 1Q6LA 3GK0A 4X3ZA 3CHVA 4FF7A 2PC4A 3E0IA 2C1HA 4QITA 2GQAA 2H90A 3HMJG 1SSGA 4JX5A 4WY0B 2O7SA 3W7NA 5G2IA 1P0NA 3W1MA 4MYAA 5G4WA 4LV9A 1DOSA 3BG3A 1YTEA 4LRSA 3EX2A 4CQ8A 3KVJA 3LXCA 4MY8A 2QAPA 2Q8LA 4AMAA 4OBTA 1XL9A 1OFDA 3MP4A 1QPRA 2DZPA 5IBXA 1FQ0A 2Y88A 3TH6A 2NV2A 5D2YA 1DV7A 3GYEA 1O95A 2WO5A 1M7PA 2E77A 3M0ZA 1ZFJA 2X1TA 3BO9A 3G1DA 4HNNA 4N02A 1W8SA 4Y8FA 1YDVA 3TUUA 2QCMA 2ALDA 2AGKA 5LNRA 5EA9A 2E5CA 4MJMA 1A50A 2RKXA 4MFEA 3LBMA 4JS3A 1XI3A 3GDTA 4UFHA 1TV7A 3DXIA 2DZSA 3IIOA 4CLMA 3B0UX 4KKXA 2Z2UA 3SI9A 4R34A 5FEZA 1GYLA 4FHAA 5LKYA 4MUZA 4QQ3A 1LDCA 2I14A 3TC7A 4GUJA 3STCA 5ABTA 5A5WA 2E68A 3M5ZA 1PCKA 1GTHA 3P84A 4UIOA 4N9CA 1C9DA 3NPVA 1TMHA 3W1XA 3TXVA 3O05A 1F6PA 1ME9A 1YPIA 2YGYA 3OVRA 4HPXA 3RK8A 1MXSA 2P1FA 3NG3A 2Q3RA 3KAOA 4UFJA 3A21A 2G5WA 1TPFA 4N2YA 2JK2A 4RZ4A 2QCNA 4LVBA 5AHLA 1YTKA 4DEFA 3KOFA 4O1AA 2QCHA 3IRDA 4JDYA 1JRBA 4O52A 6ALDA 1ZCOA 1YDNA 2VC6A 3UPBA 1WBJA 2QCEA 4LRTA 1AW1A 1QOQA 3P8IA 4A22A 5DCBA 1R2RA 1QMLA 3T7VA 5AC7A 1KM3A 2ZFAA 2EKCA 1PVNA 5D32A 4BI5A 5D02A 4NZFA 4UNLA 3PC0A 1VGAA 3OG3A 3QQ0A 3TCEA 3QW4B 4OU1A 2V2CA 4JTUA 3TSBA 3H53A 5HUOA 4UTKA 1QPNA 3C2OA 3R5EA 2OZ0A 3W1UA 1ZNNA 2JGYA 3KVLA 4UTWA 3W3OA 3W76A 1LRNA 4WD0A 5CKSA 4N6FA 3EXTA 1LOLA 4HT3A 1GOXA 4I7UA 2DP3A 1W56A 4YWIA 1MSSA 3W7RA 3IVUA 1RQEA 3LTYA 3DFOA 1LZOA 3CEPA 4HSOA 1YYAA 3IEBA 1K8YA 3PS7A 2GPTA 3W7CA 5CSRA 2YZRA 5E0KA 4NVTA 4JYDA 3BPWA 2V0TA 1W5NA 4UTTA 3M7WA 3EX6A 4KWWA 3BK0A 1G4TA 2QUTA 4O13A 3WJWA 4M6QA 4K8EA 4XBSA 1RZMA 3LI0A 4IMCA 3W70A 2QDGA 3O06A 2VEMA 2ATMA 3GX9A 4RCXA 5K3VA 3SGZA 5HR7A 3CT7A 3KRUA 4HKPA 3O6YX 3W75A 1KA9F 1W37A 2TRSA 3W7JA 3PULA 4DF1A 1KTBA 1B57A 2OMAA 3EWWA 3HPZA 4IQLA 4AWSA 4BK9A 3WJYA 3HOJA 5AHEA 1VR6A 3PUOA 3L0KA 1P5BA 1ONRA 5EBUA 4I7VA 1RQHA 1WDWA 3G1AA 3E12A 1ME7A 3L9CA 3JR2A 1IIHA 1GJPA 4K7VA 2AAMA 3A9IA 4UXDA 3LTSA 1K7FA 3T55A 4KFNA 2YR1A 3G1HA 3I68A 1O5XA 4DF2A 3MUXA 4AVFA 3TC6A 1TJRA 4JYEA 2V30A 1X8FA 1VZWA 5I3JA 3FLUA 3UWQA 5F2MA 4AWTA 3QEZA 4RLIA 1M6JA 3W2KA 1OABA 1W54A 2YCEA 1Q6RA 3PUDA 2CLKA 3CQ0A 4ML9A 3KRZA 1QAPA 3MI6A 1LP6A 1QNVA 3KRSA 1OX4A 4K6AA 2QCDB 4HNTA 2YW3A 1R30A 1JCXA 1EPXA 1V7YA 4JY9A 4LUJA 1IXNA 1TYGA 3A5VA 4LWWA 3W85A 2TMDA 3CC1A 4MOZA 4QAIA 1TTIA 3SR7A 5FF3A 1W5OA 1JUEA 3DKJA 1I2PA 1R46A 3CLMA 4H3DA 1F76A 4HNVA 4FO4A 4MKNA 2Z0IA 3L0NA 4GWEA 3T44A 3N73A 3CB8A 3HPSA 4UCGA 3I65A 1DQXA 3NL2A 2ZRUA 3GB6A 3BGGA 5AHIA 4X2RA 3QW3A 2I9EA 5AYZA 1F2JA 1VH7A 2BSLA 2QCFA 3NQMA 1SO4A 4S2BA 3WK2A 2ZBTA 1YDOA 3M16A 2Y85A 2ZRYA 4LVGA 4RK8A 4M6PA 1E51A 2C6QA 1PV8A 4MJZA 3I7RA 3UPWA 3TJLA 3W07A 2A1YA 1W3TA 1YPFA 1IXQA 1W3NA 1VCVA 3ZR4A 2CLFA 4DELA 2C19A 4K39A 4NJIA 3TFCA 3E02A 2Y89A 2ATSA 1H63A 2QUUA 3W7GA 2HS6A 4OT7A 1CW2A 4DBDA 3KVKA 3BLEA 2R91A 1TPB1 5BOOA 1JQVA 3PSWA 1K02A 3PUEA 2YFOA 5LSMA 5HQEA 1ML1A 2RDUA 1JR1A 3TQVA 3M9YA 3THQA 3STGA 3ZS4A 5FF7A 2RFGA 2YFNA 3O6DA 3P80A 4WUIA 5DBUA 4YXGA 1XUZA 3LCWA 5AB3A 2YXGA 1D3HA 4FNSA 3PAJA 3DGRA 1QO5A 4XUGA 5AYXA 1TIMA 4DO5A 1SFJA 3DBPA 2CZ5A 5TQLA 5LHEA 3DHDA 3PY2A 3L68A 4XQ6A 3TROA 5LNVA 3L67A 5D2XA 1ZY9A 3S5YA 4FIQA 1ICSA 4LVAA 2ZDRA 2EPHA 5C2XA 5FF0A 4K36A 3RFAA 4X22A 3DFPA 1FDYA 4DO6A 1LCOA 3TV8A 1AW5A 3OHIA 3VE9A 4DBEA 1SO6A 1PS9A 3QF0A 1UB3A 3HGSA 2CZFA 4M7TA 3OVPA 2CLIA 1B4EA 2WOQA 2H8ZA 2A85A 4UTJA 2QJHA 4Z08A 4BFAA 1CI1A 1VQTA 3QPZA 2A7RA 4NNCA 1GPWA 2WKJA 4BR1A 4KFPA 3M5XA 2W79A 4Z0JA 2CU0A 4JTGA 1YLVA 1OHLA 2B4GA 4OGZA 1V5XA 1JCNA 2Y70A 3VFLA 1DKWA 3L66A 2FPVA 1I2QA 3SY5A 1O94A 5FF2A 3P60A 3MBDA 5BRBA 1FCUA 4GFSA 1ZHAA 2X30A 3F1QA 1X1OA 3C56A 2VEIA 2A21A 4UFIA 1EWDA 5D05A 5F4XA 2B7PA 4WX2A 2ZRVA 3IIVA 1DORA 5AHNA 3T4CA 1KV8A 4CQ9A 1YTDA 4EOUA 1J5TA 5LHFA 4O53A 3W2JA 3MJYA 3I7QA 3STFA 5C6MA 5AN7A 4N9EA 3NQ8A 4ALDA 2ZYFA 2WSRA 3LHTA 3BV4A 4FXRA 5HMSA 2JKAA 2NX1A 2ZZ6A 2OT0A 3CWOX 3HGJA 3PG9A 4JTLA 4JIPA 1UASA 4JTSA 5D2WA 1LRQA 2EAWA 2G96A 1HO4A 4DXVA 3P5ZA 4FX8A 2VFIA 1DVJA 3KXQA 3W22A 4ORMA 4WY0F 4XKYA 1WV2A 3L0GA 1NSJA 1S5VA 4XTIA 3KX6A 1TCDA 5HNRA 4TR9A 5CPNA 1Q3NA 2ISWA 3TMLA 5G5IA 4EF8A 4O0KA 1KM0A 3TSDA 1YXYA 1MO0A 3L5LA 1I8JA 1PIIA 5CZJA 1H7WA 1WYIA 3M5YA 3PM6A 3ZWTA 1T96A 1S5WA 1FXQA 1OJXA 1I45A 2YYTA 1DJQA 4M19A 1TV5A 3S1UA 4IXHA 4IWWA 3W72A 3UWZA 3W1PA 3H54A 3ABRA 4O1DA 1OVDA 3B4UA 4C1KA 2C16A 3BW4A 2Z1BA 3S8HA 3HG2A 3Q58A 3GXPA 3EB2A 1SSDA 2J9ZA 4E0CA 1TPVA 1B4KA 3S42A 4MZ1A 4NNAA 2CLLA 3C4UA 4UNKA 1DQWA 2C14A 3E96A 4UFLA 4PFMA 2FB3A 5TBOA 3W7HA 2FIQA 2WV8A 3PBUA 4JY8A 5I3IA 3HG4A 1TRDA 4O28A 5HWJA 1HUVA 1OFRA 4FIRA 4AF0A 5GVJA 2QAFA 3NEVA 3O1NA 4JX4A 5FF4A 3W71A 3O15A 1L9WA 4RV8A 3G8RA 5AC6A 3IV3A 1R47A 1LOSA 1OFBA 2H8XA 3EXSA 4O17A 3W7EA 5CZ0A 3CU2A 4NX5A 3S5OA 5T26A 1GVOA 3NL5A 4ZQOA 4M6VA 2W6RA 3QSTA 4K7YA 2C15A 5KSWA 1G4SA 5EY5A 3DKLA 4O1BA 2J27A 3N9RA 3NL6A 3W1TA 1LM1A 4CNNA 1U83A 3W7IA 3W1AA 2IQTA 1P4CA 1UUOA 2W0UA 2V8ZA 2X1RA 1TV8A 4ZQNA 2VFDA 4RJEA 1T99A 2P0OA 3MI2A 4YMZA 2NXIA 3NL3A 3E49A 4S2CA 1Z41A 3O6CA 1O5KA 3STEA 1UBSA 3DU0A 4RX0A 2XN1A 3UXDA 3MO7A 2R14A 2NXGA 4Y6GA 3FJLA 1JJKA 3ABOA 1HFBA 1A5SA 3W2LA 3B8DA 1K7XA 3GR7A 1TQXA 4JR5A 2G97A 1YXCA 3TIMA 1SPQA 4UR7A 4HPJA 3LM7A 1D9EA 3R8RA 3QMTA 1IGSA 1QDSA 4UTHA 2QDHA 1W5MA 3QJAA 1XBZA 3PR2A 3THAA 3UZ5A 3UYCA 2E6DA 2J24A 5K2ZA 4GRSA 4QM1A 4UR8A 1T0OA 1W0MA 3EWUA 1DBTA 3NQ2A 4WXYA 1JCLA 3QZEA 3F03K 5SWUA 4NT0A 1TO3A 3EX1A 3HG3A 1AMKA 3G24A 3F4NA 3V1PA 5U4NA 4IGHA 3S0CA 4IPIA 1K03A 1QPQA 4O1CA 1TPUA 2F7FA 5AHMA 1LLZA 2V81A 4LW7A 3QYQA 3SJ3A 3L65A 3DI0A 2BLEA 3UWUA 4JTKA 4TMBA 1IF2A 1ME8A 2E1DA 1SZEA 3OIXA 5LNUA 4MZ8A 2QJIA 1QPOA 3GLCA 1L6SA 5FEWA 1C29A 4PA8A 1F74A 4NQ1A 1KM6A 3BLIA 3LCXA 2WNZA 4UTLA 2EHHA 3IIPA 4PTNA 3LCGA 3GVGA 4Z0SA 4AWUA 2A0NA 2ZRXA 1XC4A 4HNUA 1QWGA 1XFBA 2Y62A 3LV5A 3RU6A 3N9SA 3C6CA 2J9XA 1OYAA 2E6AA 4AHPA 4FNUA 4TO8A 4O12A 1OX5A 2AQWA 1FUYA 5CGQA 3OBKA 4Y96A 1TPDA 2DZWA 2ZZ4A 2CZEA 3W88A 5DCEA 5LNWA 3E9AA 4QNEA 1OFEA 2E5BA 4WZHA 3A5FA 1ZAIA 3EXRA 4XBKA 4CQAA 5FI8A 3QM3A 4E2DA 3GAYA 2V5BA 3FKKA 3ZWSA 5KZEA 4AHQA 3MI3A 1N8FA 5BMWA 5LGZA 2RDTA 3NQDA 1A5BA 3FKRA 4X9SA 3SW6A 1VYPX 1KFJA 3LV6A 2Q8ZA 2DZUA 1I2RA 1KFKA 2X1SA 3IIXA 2JKPA 7TIMA 3W9ZA 4R53A 4I7WA 1LBMA 4LVFA 4O14A 1BEUA 1WOBA 3LCLA 1FCVA 1Q6OA 1W31A 4CCDA 4RR4A 2QJGA 3USBA 1WOAA 2FFCA 5G2WA 4JXCA 3QMRA 2VEPA 4P61A 2H6RA 3FA5A 4OE7A 2TYSA 1GG0A 3W2MA 4JTTA 5D38A 3LRKA 5HINA 3C2VA 3MHUA 2PRLA 4O19A 3KVMA 1LOQA 1TPH1 2FJKA 1A5AA 5HJLA 2XN0A 1JCJA 3PBWA 5E1QA 1GQNA 3PWAA 2VFEA 3TDFA 4FNPA 3G1XA 3VE7A 5KMYA 3VKJA 1KV5A 4BF9A 2NV1A 1VJIA 1ICQA 3LBCA 1TPEA 1S5TA 5KTLA 4WQ6A 3FIGA 3O63A 3DFQA 4GUGA 4G1KA 3LDVA 4LC6A 2ZZ2A 1KFEA 2GQ9A 3IGSA 3N14A 1KLYA 4K8HA 5I3HA 5EPDA 3NDOA 4IX0A 3QRHA 1JCYA 3TJXA 3Q94A 3FEMA 2NLIA 2ZRWA 3CEUA 3UQNA 1IXPA 1G7VA 5F2LA 3NZRA 1K8XA 1XDLA 3BVJA 3NPXA 4BI6A 1TTJA 5DY3A 4E38A 4TMCA 4C1LA 3W74A 1OG0A 2VELA 2ZZ1A 3G18A 2PRHA 1VS1A 3LX9A 1MEWA 2ISSA 2DU2A 3GDKA 4UTUA 3PB2A 3TR2A 1H1YA 1H61A
chains in the Genus database with same CATH superfamily
2FZ9A 1EC8A 4M7SA 4IG2A 4BI7A 3R89A 3SQMA 5AYYA 4MYXA 2FLIA 4P7RA 5H6HA 4KCTA 2X05A 2XDFA 2VCBA 1O5RA 3UBPC 2OLHA 1KFCA 4LEQA 3S1XA 1TZ9A 4Q4PA 4ZZ9A 3VX1A 3UXKA 1TV3A 2V3DA 7PTDA 3HPFA 4H9UA 3EKZA 3P8JA 3UWYA 4JKMA 3V5CA 1XIEA 4DPQA 1LQ2A 4S3EA 1OF8A 1ZSXA 2V5LA 1THFD 2ZA1A 3QMSA 1M7OA 3WDIA 1ISXA 3OA3A 5FIPA 4H41A 5I79A 1OZMA 2HXUA 3VGDA 3WJZA 4E4UA 5HR6A 3PPFA 1GZJA 4NYUA 2HS8A 3HGRA 2FDMA 5HXMA 1FHVA 3P74A 2ZTKA 3M0JA 3RM4A 3VOIA 4L80A 4JGDA 3VYLA 1ITXA 1WA3A 1F6KA 4GNKB 4L9YA 5K9DA 3ONCA 2HCVA 2ZC8A 3AXKA 1MW0A 1IWPA 5F2GA 3A6OA 4MDOA 5IBXC 4ENLA 1TTQA 3U6WA 4QISA 1B3XA 3QGKC 2QEZA 2PLCA 2VP8A 4G8TA 4CNTA 1X6LA 1F7BA 4XD6A 4E4FA 3UGRA 1H4PA 4ZB2A 1OK4A 4Y8EA 1MUMA 4ZOBA 3NQBA 4C6JA 5AYBA 1UKQA 3HFYA 2G4JA 5F7UA 1OWQA 1TX2A 1K6AA 4ZQPA 3LLDA 3G22A 2CZDA 3WG6A 5BOFA 1UZDA 4W87A 4I3GA 3QYSA 3ZFHA 4TV5A 3G1VA 2E1WA 3IVSA 4LS2A 3Q37A 4L1XA 2V2HA 3T0TA 4ADUA 1FCQA 2DSWA 1SJCA 1IR1A 3WBEA 3AZSA 5AYIA 2VR5A 4FNTA 4D8LA 4NAFA 1Y5XA 3MU7A 4RDWA 3WLLA 2WVSA 4L9XA 4Q33A 4JTFA 4Z1CA 1RA5A 1UW9A 2YW4A 1PO9A 4KWVA 3WLQA 2HSAA 1UIPA 4JFVA 1R2SA 1E1FA 1I2NA 3NVTA 3R12A 3UETA 3LK6A 5I06A 4DPPA 2VD9A 2ZA2A 5M17A 4ZQCA 1YADA 5LNSA 5A1AA 4LGXA 1LYXA 3AO0A 3G1SA 1ZJBA 4KH2A 4B90A 2FMNA 4J2MA 3TOYA 1H60A 4UTWC 1HKIA 3PJUA 4GKTA 2V9DA 1EWEA 3BLLA 1ISYA 3VMNA 2VDGA 3QTPA 1KM1A 4WY0A 4F9JA 6REQB 1FH7A 3ANYA 4LAMA 3RNDA 4N9BA 1XIDA 3O2LA 1BG9A 3WD0A 2VOMA 3ZJ8A 3P61A 2VFFA 5FJRA 1PKNA 1EA0A 4DM2A 1Z48A 4MKSA 1FP8A 3WF2A 4XISA 4UTTC 1GYNA 2CC0A 2GUBA 2UY5A 3MWAA 3MHFA 4LOCA 1HP4A 3JZUA 5ABFB 1EJWC 1NFGA 3O9NA 4GINA 3E2SA 3LGEA 4PL1A 3THDA 1VCFA 1KBIA 4NYYA 5BXSA 5JBEA 1SQ7A 2A6LA 3NM3A 4AISA 2VXNA 4KGLA 2JKEA 3LHVA 3RX3A 2BY0A 4ZSTA 3UR8A 2PRMA 2GOUA 1TTPA 4TU1A 2ZC1A 4Q7BA 3UJRA 3GBDA 3WNNA 3QY6A 3EPOA 3KOYA 2NXHA 3SCQA 3G1FA 4L4LA 5D8WA 1TE1A 3M1ZA 1X98A 3OJGA 4D6FA 3AJXA 3EWYA 4WEVX 1US0A 1EJTC 1OFPA 2VVNA 3NGJA 3C2FA 1UG6A 4B2DA 4ORIA 1JZ7A 3QSRA 3GDMA 3N12A 5CC3A 1R6WA 4K38A 3I7SA 3S3GA 5I78A 5CAKA 4UZUA 2C1IA 2CKRA 1N82A 2YKKA 3F4VA 4YTRA 4W5ZA 1W9VA 1N55A 1TB3A 5KINA 2OX1A 2OODA 4AF0B 3SCVA 3RN6A 3DI1A 3SUSA 3W24A 1RBLA 3L2MA 4LY8A 3RAOA 4EWJA 3N17A 2RHGA 2FVMA 4TUFA 2GVYA 4WHBA 5D37A 2UY3A 4AD4A 2ZZ5A 1A53A 1IXOA 3SJNA 2YCLA 1MQQA 4JIHA 4LYKA 4ADSA 3AMGA 2A7NA 3RLUA 3CUIA 4NP7A 1JAEA 3TAOA 5CC7A 2OSYA 4EX4A 1OYBA 5K9CA 2A3HA 5D03A 4NI3A 2I5GA 3NZ1A 4MY1A 4A8IA 4B3KA 2E6YA 2FZNA 4O4WA 1KGXA 1LL6A 4HB7A 1OFQA 3B0YA 3IGUA 3INPA 1A0DA 4DWSD 2E67A 3H7UA 1KC7A 4FPSA 5G1YA 2QV5A 3ZR5A 1LG2A 4D1IA 1J0HA 1MUWA 2ON3A 1X6UA 2FMOA 1P6BA 1DIEA 4A3UA 2C1GA 1GG1A 1VFTA 2QGHA 2BY2A 3EEZA 1UBPC 3BARA 3CIXA 1R9YA 1K9TA 1F9CA 2CERA 4GE8A 3OYZA 3Q2DA 3MCMA 5I09A 4WKHA 3L5MA 2NQHA 1ECQA 1TVNA 3NQ6A 4MLJA 2IPGA 4GBUA 4D8ZA 1JFXA 3APTA 1H62A 2G3MA 3CNYA 3TX9A 2QVHA 3CWNA 3VI2A 1QBBA 2DQWA 3V36A 2R94A 3U8GA 4JTIA 3N4EA 1EL3A 3S46A 3PNUA 3TWAA 3RM8A 3NTYA 1XGZA 5F4SA 3KDOA 1J9YA 1HL9A 4MFDA 1PDYA 2FB2A 4IFKB 3NQAA 3LA4A 4H9ZA 3GH4A 3TYZA 3MHGA 2HMCA 1UR8A 3EDEA 1W3IA 3SCWA 4ICMA 3NQ7A 2DIEA 3VNIA 3BLPX 2RGMA 3ITCA 3OVQA 2CLHA 1QJWA 3PFMA 1KLZA 3U4FA 4RZ6A 5A2BA 1UUQA 4DXXA 1F3XA 3UERA 2QPSA 3CJPA 1KO0A 3BC9A 2WMIA 5PTDA 1AZ2A 5CC5A 1ONWA 3TMQA 4XTDA 3WNLA 3BICA 1BAGA 3URAA 1W1VA 3AIRA 4AD2A 3SSJA 4AG0A 1CPUA 4C60A 4UFKA 2WSPA 4KEUA 4W5UA 1Z42A 2XH7A 4NJJA 4RUBA 3HBLA 3II1A 3UZJA 2PWVA 4R5EA 3L4XA 1QUMA 2PCQA 3F2BA 1A5KC 1EQPA 2B7NA 4KEVA 1FCBA 2BBFA 3VA8A 3NDZA 3M6YA 2ZUVA 4DLFA 3U5UA 1WB0A 2W62A 2HVMA 2ZA3A 3L5AA 1ZBKA 3IGHX 4HMCA 3MPGA 3SN0A 3HGOA 3GHSA 2WJEA 3BWWA 1JD7A 1EJ7L 1H51A 4UQAA 4GZEA 3KBWA 4GX8A 3L2IA 3NZGA 3H8AA 4AVOA 3TW7A 4XZIA 2RH9A 2GUUA 1VLWA 4DUXA 3ARZA 6A3HA 1ZALA 1PZ1A 1FY6A 2YDAA 4E4PA 3U9IA 1QI4A 3VIKA 1S1PA 1DJWA 1YE4A 4X2PA 2DORA 1EGZA 2R24A 3E0VA 3W1RA 4K1GA 4DJFA 2F38A 1VBGA 1EFZA 1HF6A 1GWJA 5DEZA 4P5UA 5B7YA 1N7KA 3VIGA 4X0VA 3UWWA 4XZWA 3CH0A 4GYPC 3FCPA 4RZBA 4EANA 3GVWA 3MP3A 4JN7A 2C0HA 3EDJA 4Q8VA 3G0UA 1SR9A 4DO7A 5BW6A 4IG2B 3K1DA 4C6MA 4PODA 2I56A 3WLSA 5FEPA 1R2TA 1L6WA 2WB5A 4C6FA 4WOZA 4PYSA 4CNOA 4W88A 1DXFA 1AK5A 4XZHA 1PL9A 2BB0A 4O57A 1KRCC 3NZQA 2VOTA 1GT8A 5BYWA 4UWMA 5HBFA 2O7QA 2CESA 1LL4A 1PJ9A 9CGTA 1KFLA 4NIRA 3GXFA 2Z7GA 1XM3A 2XZ9A 1S3HA 1FWWA 3MUCA 2OO0A 4KERA 3NPUA 2V67A 1JGIA 1QOPA 3HG5A 1E6RA 3M0HA 5EBAA 4JYFA 4IMDA 2VTFA 5FJPA 3XINA 2OR2A 4H1ZA 1EXPA 3H7VA 1QO2A 4C90A 3KFTA 5G4HC 2ZWYA 2W67A 4J3WA 5CBIA 3G0SA 1R38A 2FZ8A 2ZE3A 5D2TA 4PH6A 1WXYA 3JS3A 1YW1A 3GS6A 2XFWA 2OCZA 3W2NA 4Q7NA 5BMXA 1OCNA 2JIWA 2ASHA 1SW0A 3BZJA 4XZNX 5GNZA 1XIBA 3R13A 3W83A 3TAKA 4DN1A 3DH7A 3WQPA 4O4VA 4NNBA 1VHNA 1CCWB 4BJHA 4IMEA 1JXJA 3VDBA 4F2UA 3H23A 4ZO7A 1E6SM 2XIBA 1V0MA 4HU3A 1EJUC 3WJXA 3BCFA 3PZOA 4FOJA 3TLLA 4GZ7A 5BNKA 1JYNA 2D2OA 4QSHA 4NAFB 1V3MA 3S9YA 1FWSA 1AJ2A 1BWLA 4WGXA 1XKYA 4NJKA 4YHEA 1W2VA 1JEZA 1U1HA 1GZ1A 2C3ZA 4NL1A 4RL3A 1KQZA 5FESA 3WQEA 4H7ZA 4GVHA 5BWFA 5C9XA 4F0KA 3GZ3A 1NF7A 4R3UA 9XIAA 1FWNA 3SCOA 1JUKA 5AZ1A 3TSMA 1QR7A 3C52A 1PHWA 1GHSA 4H7VA 1GORA 4B5NA 4GI8A 3RM9A 2INZA 5A95A 3C2EA 3UA3A 1Q6LA 4X3ZA 2PC4A 1VBRA 4QITA 2H90A 2VZUA 1XLBA 1SSGA 2PDNA 4WY0B 3W7NA 3VZXA 4KQNA 3SQSA 3W1MA 4MYAA 4LV9A 1NQKA 1DOSA 3M0XA 3MKVA 3WQCA 5DANA 4R85A 3KRBA 4G6CA 2NQ5A 2D69A 4AMAA 2VI0A 4GI6A 1FQ0A 2VX6A 3Q67A 1EJSC 3EDKA 5A6LA 3QKEA 3NSXA 1O95A 1F07A 3HA1A 5E0CA 2V5KA 4E6MA 1W6TA 4AEFA 2WHLA 3BLDA 3QXBA 3UU0A 4RNIA 3WFZA 4JS3A 1XI3A 3GDTA 2F2HA 1K9DA 3W28A 1TV7A 2OPJA 2DSVA 2GJXA 4KKXA 4MB3A 1XICA 2Z2UA 7A3HA 4QQ3A 1VEOA 3TC7A 2ZX6A 3PBGA 1JIBA 5A5WA 1B31A 1PCKA 2EXOA 4UIOA 4N9CA 3W1XA 2PCEA 1V0KA 2WAGA 3QKZA 5LA0A 4M1BA 3OVRA 1XLMA 2P1FA 4HHHA 2Q3RA 4UFJA 2G5WA 5A6TC 4N2YA 4D6CA 6TAAA 4RZ4A 4GO8A 4DEFA 5CLWA 2OWWA 1C92A 1C9WA 2OZ8A 4US5A 1ZCOA 1A4MA 2HBVA 1OIMA 3U2EA 2QCEA 4ZO8A 4HOWA 3GSMA 1W1YA 1QOQA 2O55A 3TEVA 5KZ6A 1KM3A 2ZFAA 3D3FA 3LM3A 1Z9AA 1PVNA 3G6MA 3CHFA 2H9AA 4BI5A 1KR0A 5D02A 4JFUA 4NZFA 4QG8A 2OEMA 3QQ0A 3ZJ7A 3TCEA 3QW4B 2OOGA 3TSBA 5DFAA 4KPLA 1CGTA 3VC6A 1EA9C 2DT2A 2OZ0A 3W1UA 4FR1A 2YCLB 5CKSA 4N6FA 3DERA 4PMNA 3EXTA 1LOLA 4O1FA 4YWIA 3VXGA 3IVUA 1R0MA 1NOWA 4EXBA 1MZRA 3PZTA 5A6MA 2DUZA 4HPHA 4PUMA 1UKPA 9XIMA 2XH2A 2V0TA 1GOMA 1W5NA 3KCOA 4XD5A 3M7WA 1M03A 1TWIA 3PP7A 3EX6A 2A3CA 1LWHA 3DBNA 1FWJC 4O13A 1ITUA 1H2JA 4K8EA 4MUPA 1EH9A 2CHOA 3LI0A 2F8QA 3W70A 2Z29A 3O06A 2QJNA 4P8XA 2ATMA 3AROA 5A6BD 1S46A 2G3IA 5A3HA 4B5WA 4DF1A 1B57A 1J6OA 3ES8A 4KF1A 3TN4A 3B8IA 3KBNA 1ISVA 4JCLA 3L0KA 3QGAC 2PUZA 1JDEA 1RQHA 1WDWA 2VX4A 1UR9A 2O4MA 1ME7A 1QK0A 3L9CA 1IIHA 4K7VA 1LWIA 2QYGA 3A9IA 3MMUA 2DZAA 3AMCA 1A5LC 1Q7MA 2YR1A 1Y8BA 2CBVA 5FJTA 3AU2A 3I68A 3FEQA 1V3IA 4FLSA 3EMCA 4GYFA 4KEMA 1VZWA 4KWOA 3FLUA 1JZ5A 4IQJA 5T9BG 4PMQA 4IIEA 2GJRA 2CLKA 3VAVA 3MI6A 1LP6A 1QNVA 3KRSA 1OX4A 2YW3A 1R30A 2YLLA 1BSIA 1JCXA 4CNSA 3W85A 1UD5A 2P53A 4UQBA 1W5OA 1QXLA 4E3TA 2WMIB 3CB8A 2F2KA 3USZA 2WYSA 4D72A 5AHIA 4X2RA 3OZOA 2HQAA 2BSLA 1F3EA 3NQMA 2G41A 4S2BA 4V1YA 3WK2A 2ZBTA 1CLVA 3QFWA 1N8WA 2ZRYA 2XIMA 3GC4A 1S5NA 2YBTA 4LVGA 1E51A 1WXZA 3K2GA 3QHMA 1YQ2A 8XIMA 1M41A 3E2QA 3TN5A 3WF1A 4GH1A 1IXQA 4UOZA 3QBUA 3ZR4A 4DELA 2O9PA 4K39A 3TONA 3E02A 1OSEA 2ATSA 3AMDA 4B5VA 1JDAA 2QUUA 3W7GA 2HS6A 3VMPA 4QROA 4DBDA 2VR2A 3QTGA 1TPB1 2WKGA 1K02A 2GOKA 1F8IA 1KBLA 2W63A 1HKVA 3TQVA 3THQA 2DY3A 1XLHA 4IT1A 3LPOA 1IZCA 2PC8A 3O6DA 4YXGA 1OM0A 4S3AA 3LCWA 1D3HA 4R7WA 4YWSA 1QO5A 2OVLA 4NZ4A 5AYXA 1TIMA 2OYLA 3DBPA 5CPQA 1E9ZB 5LHEA 4NRRA 1IWAA 1XX1A 3OZYA 3WBWA 4NILA 4JOMA 5CG0A 4AZ5A 1BYAA 3L67A 4Y9NA 1K9FA 2J4GA 2XFFA 3ITXA 1C8XA 4GIEA 2CBJA 4P7OA 1J10A 1NM9A 3OGRA 3RFAA 3DFPA 2I5IA 3TV8A 4DZHA 5BU6A 3DX5A 2PGWA 3VE9A 3LSCA 3LLXA 1SO6A 2FTYA 3HGSA 1M01A 2CLIA 2OGJA 4JFTA 1GOWA 1Z69A 1XYBA 4GXWA 3MC5A 3KW3A 4Z08A 1CI1A 4W8AA 1VQTA 3A4WA 3BMVA 2TAAA 3QPZA 2FYMA 4NNCA 2CLPA 3VD4A 1W3LA 1X96A 1UP0A 2Z24A 1OHLA 2OGYA 1E56A 4OGZA 1JCNA 3URBA 3CH9A 1RVKA 3L66A 1I2QA 1UPPA 3B8WA 3GTNA 1D8CA 1UKTA 1ZUAX 4CU8A 1FCUA 4GFSA 4ZBCA 2X30A 3F1QA 2VZVA 4HU0A 3C56A 2YDSA 2A21A 4UFIA 5F4XA 1XLIA 1UA3A 2PGFA 1PYFA 2PTDA 1GJWA 1Q63A 4IIBA 2V69A 4OTKA 2ZRVA 3TYBA 4V15A 5FD0A 3W6LA 1DORA 1S5MA 3T4CA 1KV8A 1VFLA 1QHOA 1LQ0A 1L0PA 2ZYFA 4XZMX 1LLOA 4LFYA 2ONEA 3HGJA 3ITLA 3PG9A 1UASA 4L4OA 2VDIA 3XIMA 3GIQA 1RK6A 4DXVA 2WK2A 1UH2A 3W22A 2V6AA 4PE8A 1M68A 3LMYA 1WV2A 1NSJA 1S5VA 3V7PA 3WLKX 1XPGA 3KX6A 1UC5A 4H2CA 5A6JA 1V6YA 4W85A 4M51A 3BZGA 3S4TA 3TMLA 5G5IA 2EG7A 4JQ2A 5I07A 3G77A 4C6OA 3LGGA 3M5YA 4I9MA 4KMQA 1DJQA 5HJXA 4Z1YA 3MTWA 4IMAA 1TV5A 1P6WA 4IXHA 3PWGA 3S1UA 3VM7A 3WF4A 4GOAA 5CCZA 1Z89A 3VKBA 4C1KA 3Q58A 3PZ9A 3CHEA 4Y9OA 4AD3A 3AUJA 3UR7A 3C4UA 1W9BM 4UNKA 4YHGA 4L6OA 1XDJA 4QS5A 2WV8A 4ICCX 5I3IA 1TRDA 4O28A 5HWJA 1HUVA 1B0IA 2MANA 3H4GA 1J18A 5GVJA 3CT2A 3NEVA 3O1NA 3FNDA 3QR0A 1W3JA 3W71A 1FHUA 1L9WA 2NVCA 4PMYA 4CD4A 3PZIA 3PUGA 1V03A 2FZDA 3IV3A 2VEFA 3EWCA 2H8XA 3R1ZA 1S3TC 5HA7A 4GYKA 3CU2A 1JPDX 2PPGA 5T26A 1EOKA 3LQLA 2W6RA 3QSTA 3S2JA 5KSWA 5EY5A 2FGBA 3JW7A 4G7EA 3K1GA 3WH8A 3WD2A 3W1TA 1LM1A 4B15A 2W91A 1PX4A 1NDYA 3QOMA 1E70M 2W0UA 4QR6A 4ERAA 7REQA 2V8ZA 4C6KA 2VFDA 4Y7EA 1TA3A 1E4IA 4YMZA 3ITOA 3E49A 1Z41A 3STEA 3I3EA 3HV9A 2R14A 3BV7A 4Y6GA 3FJLA 1JJKA 1ZJAA 4H8HA 3W2LA 3B8DA 1XCWA 1K7XA 2J13A 3R7MA 3PBMA 1TQXA 2BY1A 4XK2A 3EOEA 1SPQA 1KRAC 3R8RA 1IGSA 1QDSA 4UTHA 2QDHA 5IRPA 3QJAA 3SM0A 1UJQA 4HN8A 4XIAA 1TWZA 2J66A 2E6DA 3UYCA 4FZIA 3GFXA 4UR8A 1CEOA 4ATWA 3LSBA 1DBTA 3NQ2A 2DSZA 3QZEA 4S3BA 4H01A 3GY1A 3F4NA 1OT2A 4MMWA 3V5OA 2YB4A 1K03A 3UJ2A 2D3NA 2WMFA 1LLZA 2GJXB 2PDPA 4J27A 1P0EA 3HJEA 1EPVA 3L65A 4I6KA 3WQ6A 3FVMA 4Q3MA 3VVGA 1NY1A 2AL2A 4J3UA 1QI3A 1JZ6A 3BLIA 4PTNA 4BF7A 1FWEC 1ZB5A 4J35A 3CMJA 4Z2HA 4W4QA 1GW9A 4H9MA 4DJFC 2A0NA 2EPNA 6PTDA 1J6PA 3QN3A 3N9SA 2J9XA 3D3AA 3V0TA 3N25A 4FNUA 4TO8A 1AJZA 1OX5A 2OQLA 3OBKA 2VGGA 1VBUA 3W88A 2VMFA 3CPGA 4QNEA 1FWFC 2E5BA 3A5FA 3E2VA 1ZAIA 1E6QM 3GAYA 2V5BA 3LPGA 3N15A 4NG3A 2PDHA 3H6OA 3E74A 2INEA 3VDCA 1Q6FA 5FL1A 2H9AB 2J8FA 1DPMA 2QLYA 3B9DA 4X9SA 5HNNA 3VKDA 1TMLA 3GVVA 1WE5A 1VYPX 1IEQA 2DZUA 4PTWA 2PD5A 2X1SA 3IIXA 8CGTA 3T1GA 4LANA 4B9ZA 2JKPA 2ZXAA 4A4AA 1OT1A 3W9ZA 3CZKA 4I7WA 1LBMA 3DHUA 1BEUA 3LCLA 2J79A 1J11A 1FFRA 1W31A 2WCGA 3N13A 4AIBA 4YVXA 1J8VA 1VF8A 5G2WA 2HRWA 2EEXA 4LYPA 1GPFA 3B8VA 5C2GA 3EMZA 4OE7A 3RITA 4NZ3A 4P8WA 3VGBA 2PI6A 1PIGA 1CT5A 2QPUA 4Z2IA 3SUUA 3MHUA 3MUIA 3AUOA 1UIOA 2WJFA 3GWQA 3WDJA 5HPCA 1RSCA 1MNSA 1IEXA 1WPCA 1AD4A 3SCTA 3ARRA 4OKDA 2OEKA 1ICQA 3LBCA 5H8PA 4C6NA 4F3HA 3LDVA 4B3LA 1KFEA 3IGSA 1BF2A 1KLYA 3ZM8A 5I3HA 3ABXA 3VUSA 3CIVA 1JCYA 4G9PA 4IUGA 4GY0A 2XTKA 1NDVA 1GQKA 2Z1XA 1PXGA 3UQNA 1JI1A 3ANUA 1R9ZA 3D6NA 3NZRA 1X6NA 3RHGA 2VELA 1K9EA 2FTWA 2PRHA 2ZUMA 3ICJA 4AC7C 1UYQA 1VS1A 4LF2A 1CGXA 3GDKA 2Q71A 1G0CA 1H61A 4CCCA 3FHAA 4M8UA 3LPFA 4LU0A 5CEWA 1AVAA 3KBSA 3SUTA 1KTNA 4KCVA 4PEEA 2JQXA 3P3BA 1G7UA 4JEJA 4GCXA 1OX4B 3ABSA 4RXGA 1OINA 1YX1A 4TX9A 1AODA 3SGUA 3PWIA 4PB4A 1ODUA 4A3YA 5MHBA 3UG8A 1TMQA 1M65A 2WHJA 1REQA 4MIMA 1UZ1A 2BGSA 2EG6A 1KXTA 4INFA 3M64A 2I1OA 2PDGA 5HUPA 4M6UA 4Q4KA 1MQPA 2GWNA 3RIKA 4JTRA 4A8NA 1XSIA 1L2UA 3NQGA 1EX5A 2DV0A 4HU4A 3CUXA 1PZ0A 2X7VA 4LS0A 1XBVA 5C70A 2YZ5A 4HCHA 4LUIA 2R9RA 4AD0A 3UZWA 4BQ5A 3WH6A 4O8RA 4GVIA 2NX3A 2CXEA 1E0VA 1GQIA 2NVAA 3KOZA 3NXFA 4POCA 2O0TA 4JTJA 1FWAC 1XWYA 1UJPA 3GG7A 1J5SA 3ITYA 4DWDA 1SUXA 2GVLA 4JNYA 2KZHA 2NUYA 4IIDA 2HK0A 4WXZA 3NYZA 1JFHA 1SW7A 4J4KA 4PUUA 3R8GA 2O9TA 1Q66A 2VGFA 4FB7A 1PZ2A 3F4WA 4GGBA 3NQFA 2NWSA 1EJXC 5KZDA 8TIMA 3VKKA 5I3GA 2JEQA 3YPIA 3LEPA 1QFEA 1H7NA 2PDIA 1TG7A 1MRAA 2AMXA 3CMGA 4PTMA 4IJCA 4YPJA 2ACRA 2E8ZA 3UZYA 4WSKA 3N2TA 3T78A 2GFTA 3C0LA 2P0IA 5HWNA 3R25A 3UXLA 4AFYA 5L6UA 4FI4A 3HN3A 4PMRA 3NR0A 3UYIA 2X16A 4P7LA 3TTOA 4AXKA 1DWAM 2Z6JA 1YE6A 2X2GA 2OOFA 4V33A 2HE5A 3PBYA 3S5NA 4DUVA 5DF0A 3GKAA 1XRSA 1IZKA 3A24A 2IUZA 4QCFA 4HYVA 3OP2A 1E1EA 5M03A 5ECVA 3CIWA 3P82A 2OFJA 3A22A 1NWUA 4E2BA 3UEQA 1PEZA 5LGXA 4XVDA 5FJJA 6TIMA 2VM8A 2E6FA 4DLMA 1F3WA 2IW0A 1RALA 4LPCA 3U3HA 2LLEA 3UCCA 2PWFA 4IPLA 4EVZA 1IT0A 3EX3A 2PB1A 3LYEA 2C13A 1I60A 5KZMA 2AGTA 4IQDA 4AC1X 1ZJHA 1P1XA 3RYSA 3VCNA 2Y24A 1S2VA 1ZGDA 4HVXA 1RJPA 1LL7A 5CLTA 4CQDA 1XIHA 4UQDA 1FTXA 1F4HA 3GTFA 3FK4A 4OFCA 5EFFA 4CKQA 1UOZA 1XISA 1IWBA 4WGHA 5EKYA 3FY1A 3O3RA 3GH7A 1QNQA 4GBDA 2TPSA 3R11A 5CSSA 4LUTB 1RCQA 1VLIA 1QBAA 4LYQA 1LG1A 4PZVA 1VHCA 4R9OA 1X1NA 5CSUA 5A8GA 1OFOA 3GTIA 4PC8A 4TXEA 4HSNA 3N3TA 3V35A 3B0XA 2Y7GA 4C6IA 3WF3A 1TPWA 5C9RA 1OCQA 5CPMA 4F66A 2XIJA 3KCLA 2J6VA 1KBKA 2BHYA 5I24A 1LLWA 3VGHA 3BAJA 3KE0A 5M1TA 3DYOA 1RPXA 5HWMA 3U2OA 1WX0A 3EWZA 3DUGA 2WVUA 4N9DA 4ONVA 4H19A 4QP0A 5EMKA 1RJRA 3F7JA 3G3MA 2B31A 3P62A 1NF0A 4S3KA 5ECUA 4GUIA 3SCSA 3P81A 2IKJA 5IFTA 2HE8A 3QFEA 4XAYA 4A8RA 1TQJA 1VPXA 3A13A 4A8LA 1E3ZA 4ZOAA 1F05A 4HPGA 2FHFA 4GH3A 4K2SA 2RAGA 1RY0A 3ITVA 3UZXA 4S23A 1J0ZA 3S9ZA 4XD3A 2WCSA 1UA7A 4LTSA 1FHDA 3CZJA 3GNNA 3MSGA 1DWGM 2O4QA 4XO6A 4TTUA 3VO0A 4G7EB 4DWSA 2FGLA 4NZJA 3UESA 5CZTA 1AG1O 4A21A 3DG7A 3WFAA 1W1ZA 3VIPA 2DPEA 7REQB 2C71A 1EKOA 3WMCA 5DY2A 1TA3B 1Y7VA 1ZP4A 3ZVIA 2YL5A 1JRCA 1Q45A 4YTTA 1FWRA 4LVDA 4IGNA 4Y9AA 1UMLA 3G1YA 3N3MA 3GRIA 3WBXA 4O54A 3LHWA 2O92A 5ABHA 1ADOA 1J93A 1LQAA 3WLMA 2V3EA 2Y5SA 3WL0A 3K4AA 4ZE4A 1RQBA 5F1UA 2QF7A 1ZP3A 1XG4A 6XIMA 3HPXA 4UOQA 1TJPA 1SJBA 4R7JA 3N2XA 3HO8A 3W2UA 3IVTA 1WZAA 1YDYA 2ZX7A 3LOTA 4IPJA 4YNGA 1QRQA 2GJPA 1XLDA 1GCYA 1NEYA 4LT9A 1GW1A 2INFA 1BG4A 5DQPA 1E43A 2H3BA 4XAZA 3WCZA 6XIAA 5FJUA 3PF3A 4QG6A 4LNYA 3CM4A 3KZSA 2AL2B 1C91A 1BYCA 2BV9A 2RUSA 1BVNP 2XIIA 2Y8VA 1GTEA 4F2BA 3LLFA 2HPIA 2EPOA 1GONA 1HL8A 4DIAA 4G5DA 3VD5A 2OU4A 1M7JA 1H7RA 3W82A 4LS1A 1LBFA 1DEDA 1YNQA 1V02E 4LAOA 2PSNA 4RDYA 1ZLPA 4WF7A 4QJ5B 4UMBA 3L4UA 3OOQA 5AOUA 4OV4A 1HQTA 5C7VA 4XZLX 2Y61A 4LBUA 1W2PA 2DZXA 5DXXA 3P5YA 2CLOA 4JICA 4FOKA 4DBSA 4AEOA 1H7OA 4BF5A 2J7DA 2E5DA 3EEGA 4NU7A 4BWLC 5ABEA 1WDQA 1WXJA 4LYRA 5FJOA 4H4IA 1VFSA 4YJ5A 3QLDA 1KQYA 2PE4A 2Z26A 4NX0A 1L6GA 2CPUA 3HJZA 1UCWA 3PG8A 3VIFA 4ACZA 3CO8A 3CAWA 4XX6A 1VBJA 4WJ8A 2FTPA 4HHLA 1P1MA 2UV8G 5I23A 1US3A 3DYPA 4LCRA 4K1WA 1GVRA 2QUMA 1OZQA 5DX7A 2DUXA 1K7EA 8RUCA 3P7YA 3BGJA 2ZUUA 4PN2A 2X42A 4L65A 1UD3A 4AD1A 1S2UA 3QOKA 2IPWA 1JL8A 3P67A 1PSCA 1Q6DA 3EMQA 3VGFA 3TCSA 1XBYA 3QV7A 2DJXA 3AIUA 1PTGA 4MNLA 2EJAA 3TYEA 2Y7FA 2NSOA 1DJNA 1VBHA 2P8BA 2XUCA 2NV9A 3WD4A 3CPRA 2RDXA 3WMLA 5F2IA 3WQGA 1NWSA 3N19B 1JPMA 1SJDA 3O0FA 1TPC1 2DFAA 3J7HA 4R33A 4GG9A 4LUSA 2DSKA 3GXMA 4AZBA 2FPYA 1CB7B 2FHCA 2XVLA 2J7FA 5HK4A 1V6VA 3R2GA 5LZLA 3SFKA 4BA0A 4XAPA 1RBAA 1A3XA 4GZIA 2D22A 2PBGA 1JPKA 3VNDA 1A47A 5EYWA 1TV2A 2WZHA 4MAVA 1PX3A 5MF5A 4W93A 3W37A 4GC4A 3B8TA 3LGDA 4UMCA 1HP5A 4JL1A 1WKYA 3M07A 3W1QA 1FXPA 4IF2A 3NSMA 5DCDA 5C71A 1B3OA 1QHPA 1WNOA 4RW5A 4WKAA 3LNMA 3GU1A 4XSMA 1XYMA 1NVMA 1NP2A 3W7DA 3HZ3A 3G1RA 3THUA 1REQB 2PURA 2A7PA 4AX7A 4GACA 5D8ZA 1W5QA 4LF1A 5D2VA 3M44A 2GQ8A 2QKFA 3FYYA 1GQLA 4W8BA 3N9KA 2X0SA 3V16A 5CPOA 1T8XA 4L61A 3TW9A 3NGFA 3RRXA 4CGTA 4E8GA 4Q4RA 4J1OA 4JN6A 3CBWA 4HQVA 5C9WA 3L4WA 3UJSA 2NVDA 5HULA 2EKGA 4RXFA 3W1LA 4WKFA 2IKIA 1VRDA 4S3JA 2VEKA 2W5FA 3VOJA 1OF6A 3OEXA 3B8SA 4M56A 2Y5EA 2D2GA 4EF9A 2PA6A 3H2CA 4WJEA 3TZFA 4FXSA 3E5PA 3UXAA 2EPKX 4GK8A 2QS8A 1XRVA 3A4JA 4XWUA 3GE7A 4U33A 1KTCA 2YBUA 1ODZA 3ATYA 3OBEA 3CUJA 3RMJA 1BFNA 4HIBA 1EDGA 5EU9A 1M9HA 2VDHA 3MSDA 3CZEA 5T8GA 4AAJA 1EUNA 2B7QA 4PMZA 3G6LA 4HMEA 4RNFA 2XH4A 1R3WA 3HF3A 1CXEA 1I0BA 1Z44A 5DLCA 4N42A 4FP1A 1CBGA 5EGRA 4C65A 1BF6A 4QEHA 3PVFA 3IACA 2JGQA 4MPQA 2ZWZA 1I0DA 1ZJIA 2FVLA 4GIAA 3CZGA 1M1BA 2BODX 4PMUA 4IP4A 4O11A 3CL8A 1D8WA 3AJ7A 4YCPA 1ZENA 4OJYA 2NWRA 4M82A 2WANA 3DFNA 1EO5A 1O12A 2O9OA 5FSEC 1ZCCA 3U57A 1XC6A 1XYFA 2EO7A 1KGUA 4ZR8A 1HKJA 1NH6A 3NYDA 5E9XA 2VWSA 5JBFA 3OLDA 2DJLA 5AVNA 1J0JA 1VKFA 3MO4A 1SM9A 4C6LA 4KRZA 3ID7A 3WLTA 2QVNA 3CHVA 4FF7A 4HOZA 4AU0A 2C1HA 3IAPA 2GQAA 4MB5A 1WUFA 4KS0A 4ZE5A 2O56A 2AMGA 2QULA 1P0NA 2QUNA 3NO3A 4HSHA 4P7QA 1F3TA 3BG3A 2YCJA 2Y8KA 3EWDA 5DMYA 4E3VA 5XIMA 2QAPA 2Q8LA 3EKGA 1OFDA 3MP4A 4DI8A 1X97A 3WELA 2ZXBA 3TYCA 3WQ4A 1E73M 5BOEA 2E77A 3M0ZA 1ZFJA 2X1TA 3G1DA 3TUUA 2AOSA 1V08A 4RE0A 2ALDA 1XHGA 4MJMA 1QATA 3CQJA 1IGWA 5I7GA 1GYMA 4EE9A 1NU5A 2YBVA 1TWWA 4NRSA 4UFHA 3IIOA 4CLMA 4R34A 5FEZA 1GYLA 1GOQA 5LKYA 1B90A 2D0GA 2I14A 1E4MM 3LN3A 4GUJA 3GC2A 4PFHA 3M5ZA 3P84A 2CBIA 1GNXA 1RAKA 3GNOA 1ME9A 3RK8A 1MXSA 3WQOA 3KAOA 3P14A 3TP4A 4NF7A 1H5VA 2QCNA 5AHLA 1YTKA 4G7FA 3SCPA 3IRDA 4Z2GA 1JZ2A 1Q6CA 1JRBA 1QW7A 3IRSA 4JIRA 1E4LA 4MG4A 1WBJA 4LEFA 1EXBA 2XHYA 2I57A 3B9OA 5EMLA 1T7LA 3WD3A 3VOCA 3HQOA 1QMLA 4UQ9A 3PZGA 4DYJA 5AC7A 3P6LA 1TIWA 5D32A 2WC4A 4XIMA 2VGBA 3CQIA 1JG9A 1WKFA 4OU1A 3ERPA 3WNPA 3GTHA 1QPNA 2EJ1A 3LS9A 3KCJA 1CLKA 2JGYA 2YOCA 4AY8A 3APGA 3VABA 4WD0A 1U2YA 3SO7A 4HT3A 4UNIA 3VILA 4X63A 3W7RA 3EOLA 4DWSB 3VIIA 1RQEA 1VP5A 1GVIA 3LTYA 3DESA 1BPLB 5FACA 3IEBA 5J8LA 3H2EA 4H9XA 3PS7A 4LAKA 5CSRA 2Q8XA 5E0KA 3AZRA 3H2NA 2VURA 3R94A 3BPWA 3GU2A 5A6BA 1EF2A 3A64A 1XG3A 4ZEPA 1WKEA 3WQFA 1XH2A 3AIVA 4GY1A 1G4TA 3DEQA 4D6HA 4M6QA 1V7AA 4AUBA 1WDRA 1GGOA 2QDGA 2V3GA 1SZRA 4RCXA 3GX9A 2DVTA 5K3VA 3T07A 3CLWA 5TAOA 2XJ7A 2FFIA 4HKPA 1W37A 4H8UA 1XLLA 2CWXA 1UZ4A 2PMQA 1Z3NA 2ESCA 3T0CA 1B54A 4BK9A 3HOJA 3PAOA 3AALA 5AHEA 3MKKA 1FH8A 3PUOA 1E15A 3BSMA 2BHUA 3ZT7A 4IL0A 5XINA 3T55A 3LTSA 4D1JA 3SCRA 3G1HA 4JBRA 5GQBA 4DF2A 4X61A 3MUXA 3AZTA 4AVFA 4JYEA 3IUHA 1K4HA 1EYEA 3KM8A 5F2MA 4AWTA 3QEZA 1V6WA 2PF8A 1OABA 1W54A 3SSZA 2YCEA 1Q6RA 1VFMA 3CQ0A 4ML9A 4GC3A 2VNCA 4BS0A 4YTSA 3AHYA 1V7YA 4RW3A 4LUJA 1TYGA 3ZLFA 1W32A 1G5AA 1DIKA 2PLJA 4QAIA 3SR7A 4MPKA 1JUEA 1I2PA 1R46A 2J47A 1F76A 4HNVA 4FO4A 4RV3A 4GD0A 3KBJA 4NI8A 3O0KA 4OIFA 3NL2A 3EOUA 2QPXA 2WJDA 4KBXA 3QW3A 3AS3A 1F2JA 4FSAA 4PR4A 4EPBC 1JYXA 1VH7A 2QCFA 1SO4A 1J12A 1QASA 4YYFA 3M16A 3WQDA 1MXGA 3CYJA 2Y85A 4ACZB 4HMDA 4DAIA 4W89A 1PV8A 3UPWA 1VEPA 3E0LA 5EMYA 1W3TA 4GPNA 1W3NA 4J40A 1MNZA 1LT7A 1XS2A 2C19A 3I3DA 4H2HA 3TFCA 1UR2A 1R8LA 5CPSA 4AZIA 2YCKX 3BLEA 3W38A 2R91A 1JQVA 3AYVA 4MB1A 3KL3A 2BFGA 2ZXQA 3M9YA 4A3RA 3STGA 4QS6A 3H2FA 1BVZA 3NCOA 1O1ZA 2JF7A 2YFNA 4WUIA 3BOFA 4UB9A 2YXGA 5JIPA 3DGRA 1V6TA 1U1JA 1ZS2A 5XIAA 1SFJA 2PF0A 3DHDA 1KD0A 5D9PA 1XIFA 3L68A 4LUSB 3RLHA 5JUVA 3K8LA 1BXNA 5LNVA 2QT3A 3C2YA 3VOFA 2NQLA 4FIQA 3H2MA 5FF0A 2BOEX 1MMFA 4K36A 4REQA 2PDJA 3MJMA 4X22A 1FDYA 3URQA 2WZIA 3GU9A 3GNRA 1UB3A 2CZFA 4M7TA 4IQEA 4A3QA 4C7FA 1JZ8A 3Q45A 4W8LA 4BFAA 1WAWA 1UR1A 2X41A 1PZ3A 1UROA 4XAFA 2XFYA 1ADSA 3H26A 3WSUA 4Z0JA 2W79A 4S39A 1BGGA 4JTGA 3QQWA 2OKOA 4KCUA 5GNXA 2PP3A 4MTVA 3R0DA 1U5VA 2FPVA 4Q4OA 4HD5A 3PZQA 5FF2A 4HK5A 3WY1A 3M46A 4L4PA 4EAYA 4DWSC 1X1OA 4KRTA 5ENLA 5FCZA 3F2CA 1EWDA 3D5HA 3V1HA 4WX2A 4IHCA 4JTQA 2YXOA 4PCSA 1XQKA 5AHNA 3H4WA 1A49A 1YMYA 2I17A 4EOUA 5LHFA 3MJYA 3STFA 5C6MA 3WBYA 3LHTA 3BV4A 5HMSA 4GVGA 5H8MA 2ZZ6A 2OT0A 3P0XA 4OOUA 3CWOX 4JTLA 3ARQA 2E4TA 3CZLA 5D2WA 3RPMA 3R43A 2NQ9A 3V5FA 4GQBA 1DVJA 2PDMA 4O8AA 3L0GA 3AHXA 4ZO9A 1DWIM 5C0QA 4XTIA 5I5RA 1TCDA 5HNRA 4EPKA 1UR3M 2VX7A 4TR9A 1Q3NA 3CYVA 1AFSA 4PGLA 3TSDA 3G2GA 3T2QA 3GTXA 4LBSA 1PIIA 5CZJA 1WYIA 3PM6A 3ZWTA 5BROA 1T96A 2YYTA 5HMFA 3RX2A 4I5RA 1U22A 5HQLA 3B4UA 4H6QA 2Z1BA 3S8HA 3EA3A 3EB2A 2ZKMX 1SSDA 4E0CA 1TPVA 3IS4A 2E40A 3NZPA 3AMLA 4NNAA 5JIWA 3E96A 4UFLA 4PFMA 2FB3A 4QE4A 1VJSA 4RNHA 3UZZA 4JY8A 3HG4A 3RJXA 4JX4A 2HNEA 5FF4A 3O15A 4QQUA 1M04A 4U2YA 1IT7A 2WSKA 2R1NA 3G8RA 1PX8A 1JD9A 3LUTA 3EXSA 4O17A 1QNOA 3S5OA 4M29A 1RLCL 2VQUA 3T0BA 1GVOA 3NL5A 4ZQOA 3ME3A 1SFTA 4Q8PA 3D47A 3NL6A 4GMEA 1VB9A 3I10A 4S3DA 4PSRA 5AKQA 3PNZA 1B3VA 3B9EA 5I3DA 3WDPP 1T99A 1MW3A 2R1PA 3GVQA 4PTXA 2Z4GA 2Z2AA 3NL3A 4PUDA 4JTAA 1V3LA 3W81A 1UBSA 1KWGA 1R7AA 1RA0A 3HQPA 1RHCA 5JBDA 4JR5A 2G97A 4HPJA 1D9EA 3QMTA 5JU6A 4XG1A 3GNPA 4J3VA 3R6IA 4ROQA 3UZ5A 4DAFA 3B9AA 5K2ZA 4GRSA 3FJ4A 4GHRA 4JIEA 1W0MA 1VEMA 1X7IA 3IUIA 4WXYA 1JCLA 1E71M 3F03K 5SWUA 3VNJA 3G24A 2ANUA 4DRSA 3S0CA 1QPQA 4C6DA 5AHMA 2V81A 3SAZA 3QR3A 3SJ3A 2DDXA 7XIMA 1XCXA 4QDPA 1XLAA 4JTKA 3FSTA 4TMBA 1IF2A 3RPDA 1R85A 1VJZA 1W3HA 3AS2A 4MZ8A 2E9MA 4MADA 3PZNA 1QPOA 2DT1A 3WD1A 1C7SA 4NQ1A 4JFWA 3LCXA 1NWRA 4I5UA 2E25A 4TX6A 3T6CA 3UVAA 5ABGA 1JCTA 3GHUA 4URIA 4Z0SA 1QW9A 2ZRXA 3EB4A 3BXWA 2PWHA 4L9ZA 3LV5A 1PIFA 2P88A 2CYGA 4RE4A 3GIPA 2HXTA 4GXPA 1EGVA 3ES7A 2XZ7A 4Q8MA 5HMDA 3I3BA 4Y96A 1KNWA 2DZWA 2ZZ4A 4WDWA 3WH7A 1XYAA 1B3WA 2Q6ZA 4HK6A 4PCTA 3EXRA 4XBKA 4CQAA 3QM3A 2PU1A 3ZWSA 3U7BA 1W1IE 5KZEA 4AHQA 3BAIA 1G01A 1O1HA 1CENA 2Q8ZA 1I2RA 1KFKA 3GXDA 5J04A 2XSBA 7TIMA 1HW6A 2X7WA 1OC6A 4LVFA 4O14A 2XSAA 3QVQA 2OKTA 1I1XA 4JN8A 3CUGA 3GG0A 2X40A 1DE6A 1WOAA 1QTWA 2FFCA 3H70A 2VEPA 4PBFA 2UWFA 4W7UA 1C3FA 4TX8A 1GG0A 1YNPA 5CBBA 1EHAA 4CN6A 5E0FA 4JTTA 4CD5A 3LRKA 7ODCA 1OGBA 3SDOA 1ITQA 1XQLA 3T2PA 2PRLA 4JQ1A 3LD5A 1A5AA 1NQ6A 1D7KA 3PBWA 3RX4A 5E1QA 3LZ5A 2VRQA 3JUGA 3VE7A 5KMYA 3VKJA 4GKLA 2NV1A 1YKWA 2XGZA 4LAZA 4WQ6A 1DTNA 1YHTA 2VZSA 1NJJA 2ZZ2A 2GQ9A 3ITTA 3N14A 3VNKA 2PDFA 3Q94A 3FEMA 2EQDA 3ARXA 5F2LA 1E6ZA 3M4HA 1D2KA 1XLEA 1TTJA 5DY3A 4E38A 3W74A 4CN1A 1MEWA 3PB2A 3T2OA 3CWHA 4RE3A 3H4XA 2JBMA 1KRBC 4WCJA 4PUKA 3TXZA 3QQ1A 2ZZ7A 3CK5A 5A8NA 2BWGA 3TW6A 1FBAA 3P93A 4KIEA 3Q65A 2QGYA 3NQEA 4Z1DA 4XAGA 2QUVA 5D9MA 4NZ1A 3PSVA 2BASA 5K7JA 4MWAD 5KETA 2P76A 1FX6A 2Z27A 4HZ6A 3QPYA 1R86A 3DENA 2HJPA 2C91A 1WO2A 1EC9A 4I8YA 1MZHA 4CCEA 4ERIA 1VYRA 4LBRA 1IR2A 3FOKA 2ZQ0A 3QC0A 1HL2A 3W73A 4PRWA 4U4MA 3WUEA 4LNCA 3NM1A 4ZFMA 2DH2A 1A5CA 1XF0A 1OC7A 5IOBA 2Y2WA 3DFTA 2J88A 3MS8A 3W29A 1XBXA 5HQMA 1FDZA 5K9XA 2Y6ZA 5BRQA 2AKZA 3MANA 5CPLA 1EUAA 4HHPA 3NAVA 1PB0A 4C5ZA 2ZUTA 4P8UA 1KM2A 1W8GA 1GVQA 3TNOA 2XGIA 6ENLA 2NUXA 1IHIA 1H5YA 4IFOA 2OXNA 1CXKA 3QY8A 3H7RA 2QIIA 1SW3A 4MB4A 3W7LA 1H0IA 1CWYA 3M47A 5JH2A 1A0EA 3K4DA 5DELA 3JU2A 4U5IA 5FAGA 4O15A 1E6PA 2Y5JA 1EP2A 2VENA 3U2CA 1YPXA 3VM5A 4CD6A 3VD9A 5E6YA 5IXEA 1XD1A 3W84A 3HQ1A 1CB2A 9RUBA 2Q09A 4H6EA 3PTMA 4CNPA 2EF9A 3MSYA 3W01A 3W6YA 4O18A 3VIJA 3EOOA 5D33A 1V8EA 3WLPA 2V68A 1J4EA 1E0TA 3T4WA 3TQKA 3CTLA 2ISVA 3DHPA 1H1NA 1R3TA 1KXHA 4AIOA 3C3UA 1SO5A 1V3KA 5M2FX 1KM5A 2GJNA 2OQYA 3CMFA 2GGGA 2WM0A 4H7CA 3C2RA 1UWQA 3OYXA 4L56A 4UC5A 4M5PA 2D2JA 2R8WA 5D09A 3HPAA 4WOQA 4TQTA 4BZYA 1O68A 4DQWA 5TNVA 4JIQA 1BGAA 3GR8A 3N11A 3ALFA 2I9UA 2DEPA 3K8KA 4QIUA 3KWSA 4XSLA 3BURA 3N2OA 1N2VA 1J0IA 1Q6QA 1Z6KA 3ZOAA 5A8MA 4QXIA 2PS2A 2J9YA 3ISIX 3L21A 2VKZG 4WDXA 3RG6A 2DQXA 3MCOA 4CQBA 4EACA 4PMXA 2FQIA 1KCLA 4JTHA 5A6SA 4GXMA 1SU5A 2BTMA 3C0JA 2CWNA 1HTIA 4CN4A 3N34A 4L64A 4TTGA 4ZXOA 4XD4A 2ABBA 2AL1A 1KBJA 4Q8OA 1P43A 1H09A 2BVYA 4B9YA 3MSRA 3MW7A 3IUDA 1O60A 3W1NA 3CQKA 3BLOA 1SZNA 3W7PA 2EG8A 4F9DA 4RDVA 1A5OC 2C18A 2W3ZA 4IX2A 4UTMA 1DWHM 5I3FA 4MSSA 3TTYA 4GFIA 1H0GA 3IJ6A 4CQCA 2PWGA 4IJBA 2A2IA 3W87A 1H49A 1TV4A 3MMTA 1HN1A 2V2DA 3NFUA 1JGMA 2RGLA 1XUUA 3KHJA 1SFLA 2J8TA 3MB9A 3WDHA 5REQA 5A8QA 3S6DA 5KITA 3VIHA 1XFCA 1SZGA 4JEQA 1EP1A 4S1FA 1VPQA 4YCOA 2WCAA 1W17A 4NJGA 2XWEA 3A9BA 3DHFA 1W9UA 3DZ1A 2OO6A 5C54A 4J9JA 3VK5A 2J7CA 3N2MA 3LXBA 4LV4A 3B40A 2E7FA 3MUAA 1PE1A 2JF6A 4FXJA 4UTIA 3OODA 4AVNA 3S6OA 1JDCA 1EJRC 1LORA 1FFQA 2WQPA 3ZLHA 1FWCC 2DH3A 4LQ1A 4N6EA 3SUWA 4EK7A 2IXUA 2E9LA 3BCJA 1H7XA 3WLJA 3LHZA 2NZLA 4HZMA 1Q7ZA 2VFHA 3LZ3A 3W7QA 4ICNA 1KXQA 3W26A 1E6NA 2Y1HA 3C3NA 3S2LA 5BXTA 2PWEA 2POZA 1PAMA 2GWGA 4GQ0A 2WLYA 3DFSA 1Q8JA 3MP5A 5JXQA 5AY7A 2UBPC 3BTNA 3A23A 2YYUA 4DZ5A 1NWTA 1QNPA 1Q8AA 2WPBA 4HJWA 5FAJA 1B9BA 2YPIA 3ZSTA 4ZXLA 1WZLA 3BG5A 3UWEA 3A3WA 3BCDA 3MUY1 2Q3OA 5I02A 1OX6A 3MZ2A 3APYA 2D0HA 2IMRA 2RDWA 1ICPA 2HTMA 2QCCA 2ZUSA 1KBBA 2VO5A 3RLVA 3THCA 2YL9A 4NZ5A 3ECQA 4B3ZA 3WLNA 3TE9A 1RLDA 3CV7A 1LTDA 3LHUA 3LNPA 5H91A 4IXXA 3GC5A 1MDRA 3BSHA 1MQRA 2YCIX 4OUEA 4CVUA 3M0YA 4J7RA 3MYOA 4FK9A 4LX4A 1TZZA 1PHQA 5E93A 5GPRA 2D20A 4Q4SA 4YYCA 3GXTA 4ERGA 1C8VA 2OSWA 4ZVJA 3VDAA 4L7ZA 2CEQA 4AY7A 3IJIA 3FN9A 3I6RA 3TA9A 3GD6A 4JQ4A 1E72M 3NSNA 1TREA 4PCNA 1IYXA 3KTXA 2H3DA 3NO5A 2G0WA 4LXFA 2NUWA 3JRKA 1ZBWA 1SJAA 2CIPA 4ZENA 3WZ0E 4C7GA 2I7GA 1RH9A 4YVPA 2OJPA 2P10A 3WK1A 4Q32A 1RVGA 1GK8A 3AI0A 1U33A 2QCDA 2FDSA 3GW0A 2X2YA 1EC7A 2J25A 1TRIA 3WEZA 3D0CA 1P0BA 1GJUA 3BLFA 2GK1A 3U48A 3B06A 3W25A 3S1WA 1GVSA 4JNMA 1ZTVA 1KRMA 5CJ5A 2YB1A 4HN4A 3CL7A 2WPGA 3BG9A 1OYCA 1JPIA 4N7QA 3SY1A 1JULA 4R27A 3V3WA 2DT0A 3WK3A 2BOFX 1Q4NX 3VINA 4L4MA 2CW6A 1FDJA 1SVDA 3A47A 2XISA 3ABQA 3WK0A 3UWVA 5G1TA 3PTKA 4L1GA 2ZICA 1OADA 1M53A 1A5UA 4JFSA 3FDGA 5G2HA 3SADA 1XIJA 2WSQA 4HP5A 2C7FA 3VIOA 2PDBA 1K3UA 3C8FA 1WBHA 2RJHA 4AHOA 3BW3A 3U7VA 4IP5A 3VKAA 3TQ0A 2CITA 4KFOA 1ONEA 1L6YA 3MUZ1 1BKSA 2HROA 2WNNA 4G2DA 1GKQA 1HVQA 2YSWA 3HV8A 4AH7A 3H55A 3GFZA 4ZB5A 2FVKA 4AZGA 1UD2A 4IGSA 4C6BA 4F0LA 1AL8A 4RZ5A 5HOSA 2PDUA 1UWTA 1HG3A 1DQUA 3SIZA 4C6QA 4TIMA 4C6EA 3LI1A 1MW1A 4L1WA 2HBXA 1Q6EA 3EKLA 4D2JA 2VC5A 2ZIDA 4B91A 4MAZA 3M41A 2CKSA 2YL8A 4LJ3A 3WH9A 2J62A 2WBKA 4J3XA 2ALRA 1UWIA 4A29A 4EP8C 3VZZA 1B9ZA 2DT3A 3W7OA 1QT1A 3WFLA 3VD3A 3KBVA 4W9TA 4O50A 3WQ5A 4JQ3A 3R4IA 2CFFA 4TVDA 1G69A 1XPYA 2IS7A 1OCBA 3BE7A 1J96A 1VFUA 4ZTXA 4WLCA 4AIEA 3NQVA 2PGRA 1KKRA 4PUEA 4JTEA 4Z2KA 2ISDA 3QC3A 4UMAA 4GLEA 2R1KA 3KDNA 4JAWA 5CZSA 3IJQA 3PPHA 4V2XA 3KLKA 4C91A 3AIWA 4JD4A 3OB8A 4FA3A 2HDJA 3HM7A 3L4VA 1LWJA 3OHMB 1K6WA 2J7HA 3PZUA 4IPPA 3PBVA 4PTVA 3QH2A 1UD6A 2F84A 2D23A 2V38A 1WP6A 1B3ZA 2OT1A 5FOOA 3RGTA 4D6IA 2PP0A 4CCZA 1C93A 2CHRA 4FX7A 4C5YA 1R7OA 4F4RA 3K30A 1UQYA 2BGQA 1OIFA 2OB3A 3TFXA 2OELA 3OLIA 3T09A 1HGWA 3FFSA 4E2OA 2VL4A 4IGMA 2E09A 4IZGA 1JF5A 1KM4A 2PWUA 5A2CA 1U5JA 3R0UA 4ZMGA 1NP0A 2J6XA 2X1IA 3TA6A 2F61A 3W23A 4AEEA 1JCMP 4B16A 1OD8A 4GI9A 4XVEA 3IIZA 3O6AA 3MV11 4AD5A 3EPMA 3H2AA 4H00A 3L4YA 1LROA 1FKXA 1G1YA 2PEVA 5HANA 2XU2A 2PDKA 1XKJA 8A3HA 3WMSA 4PUJA 2BS9A 4BWLA 3M0MA 2C0AA 1JPHA 2Y4SA 1TE6A 3N29A 4KRUA 3M5VA 2Z00A 1JDFA 4QNWA 1I2OA 1BD0A 2UY2A 2G3NA 4RE2A 3SUVA 1AL7A 3DAQA 2V63A 3UNDA 1OEPA 1PTAA 1TSIA 4HBKA 2R1LA 4J5NA 3IWPA 3WNKA 4GNJA 1LBLA 2G4FA 4GUHA 3FS2A 2XGBA 4L5ZA 4LALA 3LQGA 1Q2RA 3WKZA 3W0KA 1XV8A 1SO3A 3BUVA 1X1ZA 3NQCA 4HTBA 3ZO9A 4ASTA 5IDZA 3TJIA 7TAAA 3ZIZA 3LPPA 2FZBA 5HDRA 3BGAA 4DJEA 4C7DA 3G0XA 2O9RA 3HURA 4AZ6A 3AYTA 1OC5A 1EDTA 1C7TA 1OG6A 1H7PA 5IM51 3EB3A 4YU1A 4L6DA 1P7TA 3GNDA 5IHSA 1DWFM 1K8ZA 3PB0A 3TU9A 4NJHA 1EJVC 1EIBA 2VC7A 5DT5A 3PPCA 3UNTA 3NDYA 4MNJA 1PCWA 1W5PA 4Z2JA 3FYPA 3TYUA 3HB9A 2PDWA 4S3CA 3ENLA 4TVCA 2GJLA 4GJ1A 5DMMA 3LB0A 2GDVA 3LENA 4OWGA 3BMXA 1E6XM 4NXSA 3SFWA 1AW2A 3NOEA 1Q5MA 1DL3A 5A6KA 2W9MA 3LG3A 1XYZA 4O10A 4YL2A 2VCCA 4RPQA 1CXIA 2XN2A 4CVWA 5F1VA 3WMBA 3I4KA 4D9