5D4OA

Structure of cpii, a nitrogen regulatory pii-like protein from thiomonas intermedia k12, bound to adp, amp and bicarbonate.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
b'AIKLYPLKKLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGKGSHGMYEGHLMFNEDDALIMIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHDIQVGRPIKFRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II
molecule tags Signaling protein
source organism Thiomonas intermedia (strain k12)
publication title Structure of CPII, a nitrogen regulatory PII-like protein from Thiomonas intermedia K12, bound to ADP, AMP and bicarbonate.
rcsb
total genus 21
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d4oA00
1XK8A 4Y65A 2J9DA 2ZFHA 5DRKA 1UKUA 1O5JA 2J9DE 1J2VA 4CO5A 3AH6A 1NAQA 2XULA 3AA9A 4RWWA 4YB6A 3X3UA 4OZLA 4R25A 2CZ4A 4USJC 5L9NA 3CE8A 1O51A 2GX8A 2O67A 4D3GA 1QY7A 4CO3A 5D4LA 2PIIA 4NYPA 2XG8A 2GNKA 2DCLA 3T9ZA 3NCPA 3N5BA 4USHA 2O66A 4WK1A 4AFFA 4D3HA 5D4PA 4ZK7M 1GNKA 2NUUG 3M05A 1NH7A 4RX6A 1V9OA 5D4OA 5D4NA 4IYQA 2V5HG 1NH8A 2J9EA 1VFJA 1KR4A 2J9CA 3OPKA 3O8WA 3DFEA 3TA2A 2JJ4D 1V3SA 2NS1B 2EG1A 1V3RA 4CO2A 4C3KA 4C3MA 1UMJA 4WK3A 3NCRA 3MHYA 4OZJA 4RLEA 1UFLA 4CNYA 5DS7A 4C3LA 4OZNA 2E66A 4RWXA 4CO0A 1Q1KA 1NZAA 1P1LA 1PILA 3TA0A 3AA8A 1HWUA 3NCQA 3L7PA 2EG2A 2NUHA 1H3DA 3GSDA 4CO1A 2XBPA 1V6HA 3HLUA 4NYOA 3O5TB 1UL3A 3AHPA 4CO4A 4Y6IA 2ZOMA 1OSCA 4USIA 3TA1A 2RD5C 3LF0A 1VHFA 4YB7A 4CNZA 2VD3A 3BZQA 2GW8A 4E98A 4YB5A 2Z0GA 2XZWA
chains in the Genus database with same CATH superfamily
3V6KA 1A0OB 1RWUA 2CVEA 1ZPVA 4OYWA 2I8EA 1Z2LA 2XI3A 3T6JA 3PDNA 1VRTB 2IVFB 3UDLA 4ZITA 3KMSA 1U49A 4WFZA 3E51A 4OI3A 4KJIA 4NI2B 4JI2F 3M6WA 2LXIA 1K73T 3UDCA 4WE1B 1EX8A 3MMBA 1UAWA 2H4WB 2Y3YA 4OIXA 3UW1A 4DZDA 2VPWB 5C25B 2KFZA 8AT1B 2V8PA 2AJ4A 2FHJA 2I5JA 4MYUA 4IQXA 1UZDA 5KFLA 2HYIB 5CHCB 1FFWB 2RQKA 2VU5A 1NHUA 1D0EA 2HQIA 2BA9A 1PYSB 3RBZA 4CYUA 1MN7A 1KKHA 2ZDOA 2YKMA 2DHSA 3ISND 2OSRA 4FYXB 2FQQB 2JLGA 3MR3A 4EO8A 2HQFA 3UPFA 1LXJA 4DUZF 4DV4F 4JI2J 1WG5A 4ZLNA 1VQLS 2WBRA 1RXOB 3D4JA 2I2YA 4F7VA 4MMOA 2CRLA 5KFZA 2KFYA 2CNKB 1VQMS 1UVJA 1NDPA 4H4KA 3G6XA 1HMVA 1PO6A 5FD1A 1R0AA 2CKWA 3OV7A 4FKYA 2KB2A 4XDCA 1T02A 3EGZA 2R2UA 1Q86T 3K0JA 3CMQA 3M32A 4G1QB 4R8UB 2AP6A 4MKVA 4CYUB 1NSKL 4F0MA 4C9DA 5IV3A 3DDIA 1RKJA 3CUNA 1CSJA 1QVFR 2GAHC 1WC3A 4M63A 4DUZJ 4DV4J 2HHPA 1RT7A 2AJ2A 3AJ2A 3JTPA 1WEYA 2I5JB 1E6VB 2CQDA 2FJEB 2VFVA 4NLOA 5KFTA 3A12A 1L3UA 3MECB 3RR8A 1UTAA 4KV8B 3R5GA 2B43A 2EKYA 5HROB 3FQKA 5ETTA 3BQ1A 3TARA 2BQRA 1L3VA 2L9NA 3N4WA 1V3SA 1TELA 1RWMB 1ULRA 1FA0A 2HFZA 2PEBA 3MMAB 2YPZA 2XY5A 2O01C 2RE1A 2W9CA 2GS8A 1TL4A 4OQJA 5C5JA 1V5IB 3DI6B 1T05B 3Q86A 2KG0A 1UMJA 4DR2J 4WK3A 4A47A 1SH3A 3EPGA 4FYDA 5KFUA 3D1QA 3ETOA 3EXYA 4ILLA 1UFLA 1XR5A 1DLOA 3JYTA 4DSLA 1BXNA 3VZIA 2BABA 3H5UA 3CCMS 4DFJA 1UJ4A 5DQIA 3EZOA 3BYPA 3LP0B 4UUWA 4DX5A 1L3KA 3DMJA 5IV4A 5IC6B 4KHMA 4RW7A 3T1AA 2F5GA 5IC4B 2Y1JA 5HMYA 3R5BA 4J9QA 1IBKJ 3UCUP 1UVLA 1S1XA 4PG7A 5HN0A 2KVQE 2Z2LA 3UCZP 1JK9B 3IG1A 1MNEA 5JVGQ 3UDEA 3NGDA 2DJWA 4DCJB 3OVAA 1PGZA 2VBWA 2LMIA 2XMKA 1NPKA 2NREA 4QYZK 4NCGB 4F26A 1SC6A 4AL5A 2MKIA 4DX7A 2LEBA 1VQ9S 1YBAA 1ZTWA 2ZHBA 2FLOA 2HVHA 1RHQB 4KIAA 1HWLA 2HHHF 4O44B 2J7KA 4RW7B 4C0HA 1KHWA 1JLBB 1JNZB 3HP6A 1NBEB 2QL5B 1U48A 1KSPA 4DL2A 3H5XA 2OD4A 1VIOA 2IJFA 2FZKB 2KHCA 3C19A 4GVLA 2DY1A 2EPIA 5EN1A 4RW6A 3KK3A 4YR2A 1RYRA 1JJCB 1DURA 4I69A 4NPOA 4DX6A 4F50A 4F3OA 1VQKS 2FIUA 2LXUA 2ZWPA 2VA2A 1MROA 4X66J 2B9XA 2RVJA 2ZE2B 1CLFA 1RI7A 3GG0A 2Z2ZA 4GMKA 2GZOA 4IKAA 2W9AA 2BQ3A 4DV6J 1VR6A 4X4OA 5FDLB 3KLFB 1XMOF 2Y8WA 2ZZTA 4B9VA 2C2EA 4DR5J 3MECA 4MJKA 3HXMA 4RW8A 5KG6A 2OPPA 5BR8J 2IBOA 2OPSB 2X51A 3MMCB 3ZTPA 5DGAA 2J7WA 4DUYJ 4LF6J 1AUSL 3IR6B 3UVJA 3DLJA 4P2SA 4MIBA 2K7JA 3UWTA 3KK1B 1RAEB 3DM2A 1Q5YA 1SQEA 5HAOA 4O4RA 4CLTA 4D3GA 1F9EB 1C0UA 3MOZA 1IKWB 4DV1J 3GLJA 2UXBJ 4EI2A 4B3OA 5KFEA 2X7IA 2MQPA 5L38A 1KP6A 1G3OA 2IFXA 4NXNF 3TX8A 3DRPA 2CDQA 1V3ZA 3M2RB 4RUHA 4EEYA 1HMVB 1RCOB 2NLWA 1RT5B 3DRSB 4O0NA 3OLBA 5JVHQ 1T0TV 1WHWA 3MZIA 2VBZA 4ZPCA 3NMAA 2NXNA 1GAOA 3CCLS 5A8KB 3H2VE 1ZA1B 5K20B 4RNOA 5SUHA 4U8VA 2A0FB 2GMLA 3SMZA 2FVPA 2AJ1A 3ZZPA 4RKUC 1UVIA 3FSXA 1S1TB 2JLFA 2CWKA 2V8VA 3P6YC 3H8YA 5L1KA 4N76A 1DFDA 3BEGB 3CD7A 5I4MA 4K0KJ 2N4DA 1H2VZ 1QSSA 3CJ0A 2D3ZA 4HVZA 4WU2A 2LQ5A 4BC7A 3ZNUA 4YB1P 5G0RA 2A2DA 5L1JA 2B9EA 2YQ3A 1H0HB 5B0BA 3TUZC 3FEXB 4ZJOA 1QTNB 1X4CA 1MU2A 1L3TA 2ZD1A 1O8BA 3K89A 5KFBA 1APSA 1U2FA 2BUNA 5HMXA 4I56A 2G2ZA 1NU4A 2M8HA 4NRTA 1CULB 2WVDA 4JB8B 4FPIA 4PYDA 2HHSA 2L9DA 2WSCC 4I64A 2W7OA 5CH7B 4LF9F 4B02A 1Q79A 2BYCA 2DNYA 4MFBA 2XMAA 1M90T 4A8XA 2XYHB 5D0RA 4N8NA 3JB9k 3RUBL 4B17A 3NCRA 4FPRA 4OZJA 1HW8A 4OHZA 2R7TA 3BQ0A 2SXLA 4EBEA 2VDIA 1IBMJ 2AWZA 3CD0A 4KY3A 2QLXA 4AL6A 2GA7A 2Z56B 3QRQA 2RKIA 1D09B 1NUEA 2ZH1A 4LF8F 5IQQA 3DRRB 1FNXH 3R7SB 2RT3A 3DXBA 4ZVHA 4PWUA 1OY8A 4IRCA 3FC9A 4ID5A 4JI3F 2Q79A 1TL7A 4OHXA 3MUMP 4OFZA 2XGQA 5J1PA 2CZVC 2H4YB 3TR5A 2MMYA 3CDBA 1KQSR 2KJVA 1XR7A 4NLPA 1Y5LB 1GMVA 3POTB 3CCTA 5M2UA 3TP2A 1DHMA 3ZXWA 1PC4A 4RU2A 1SC3B 3KUGA 3PEHA 2XGPA 1KTVA 5A76A 3RB0A 4UOCA 3W2WA 1JJ4A 2M0GB 2GVZA 3G71S 1S1WA 2RMLA 2G0CA 4CI0B 7FD1A 4J90A 1G6BA 1EP4A 3RB4A 2RHQB 1R7IA 4USIA 1RT1A 1CJTA 3GB0A 1FRLA 3M8PA 3P96A 5H9EK 4JI0F 2ROEA 4K4WA 5AT1B 3U1LA 3W9HA 2YKMB 2CJQA 3QJLA 3BJYA 2WW8A 3QIDA 1IQZA 2MGZB 1HBMB 4UTGA 5L39A 3ET6A 3PR4A 4ED0A 2RILA 2FVQA 2YNGB 4CM0A 3UE2A 4B9MA 2E9RX 2FTRA 3M1VB 4OZ3A 1UETA 1BQMB 1TKTA 4EYHB 2MZ1A 1K8AT 1REGX 3BGFA 5EWEA 3W8GA 3LAKA 2V4RA 2FYXA 4NLDA 2NXEA 4B9NA 3MMCA 3ZTQA 4JI5J 1VQ6S 2XB2D 4F8RA 4ED4A 5KFOA 3ZO7A 1URNA 5HLFA 4DL3A 2DR8A 1RTIB 1M5OC 3MEGA 4NLQA 2GVDB 4RWWA 3U1NA 3HPOA 3PX4A 4JV1A 3DOLA 3FFIB 1F5BA 1HNWJ 3R2DJ 1HBOB 1OQ6A 5DQHA 2DISA 1UPMB 2QLWA 3THPA 5EHHA 3G6VA 3DRXA 3TAPA 1O51A 1S0NA 4OL8A 3QAEA 2GIFA 1QY7A 3GYNA 4UOGA 1NK8A 2QLBB 3GR1A 2C3MA 4M5MA 4CWBA 1WC6A 3OL7A 5K8NA 2J5AA 3DLKA 2DR9A 2HAFA 3KG4A 3PHEA 1SCJB 2P8IA 3JSRA 1ZM2A 3P45B 3HSDA 5H9FJ 3R2CJ 3TOQA 3JSMA 1NDLA 1JLBA 1S4EA 3IBFB 3UR3C 3A3OB 3G9CA 2BEFA 4FYYB 2UV8A 2KG1A 3O1LA 2E5GA 3BDEA 3UDVA 2P9CA 4B9UA 1FF2A 5LXYA 1FHTA 2LYVA 1BD6A 1JLAA 1YJVA 4LBHA 4GRSA 1EETA 2VL1A 2WONA 2HBRB 4ZP6A 3V2UC 5CABA 2VA3A 2UXDF 3PJWA 3FZBA 3AQPA 3W5XA 2IA0A 1Z4UA 3GTYX 4P74A 4ZJQA 4NRUA 3UR0A 4UQGA 1LK7A 5CZXA 3ENAA 1RT5A 2L9WA 3DRSA 3OBIA 4C11B 4DBQA 1VJQA 3OTDA 2IYGA 1LWEA 1TKXA 1Y3KA 3CJ3A 1H6KX 4QIWD 1EP4B 1O0PA 3OPKA 3U7JA 3BGRA 3UQSA 5B09A 3SYZA 1I94J 4C8LA 1ZM3A 3ILOA 2OFGX 1ICEB 3IGVA 4JI1J 2EG1A 3FSYA 2HMIB 1RHUB 3MM8B 1SKWA 1D9AA 2HBZB 1UJ6A 3MPWA 4C3MA 4ANDA 3R97A 1I6JA 2LQBA 4X84A 4OZ2A 1HQEB 1JJ2R 2YNGA 5M2PA 1RTJA 4IFVB 2DNMA 4OZNA 1CPZA 4WBFA 1D8ZA 1IJEB 2HQGA 1Q1KA 4ED6A 3VQSA 3EICA 4AD6A 3DGPB 4RW9A 3TX0A 3DOMA 2MQQA 3CCES 2DNHA 3MMAA 5HMWA 4GVBB 1MSWD 1JLFA 3HO1A 1RUSA 4LSNB 4WXOA 3R1HA 1HWUA 3S6EA 4QR0A 2V6AA 3CGIA 2IA6A 2UVUA 2MY7A 3Q8RB 5AXKA 2BJ3A 1M1HA 4BS2A 2RU3A 4F4WA 1WOSA 2F8MA 2OEKA 2PGCA 3IC1A 4F4ZA 4DS5A 4DQSA 1VBYA 2VPZB 1FEHA 2HFSA 2VZ9A 1X5SA 3ITHA 3HHLC 1P27B 3KFWX 4B08A 2C22A 5CYMB 4U7UD 1NM2A 3PHTA 4UY85 1FRMA 2E29A 1OPZA 2QIFA 3NMRA 4NYOA 3M8PB 5LSLA 1RT4A 3EE3A 1XNRF 2DXEA 2J8AA 2MKCA 3JQKA 2JFDA 3MI7X 2BANA 2D7SA 1S0OA 4ELUA 3KLIB 3MCNA 4L72B 1NK4A 1HYSA 4LR8A 2YBVA 2QL9B 4UOFA 5KFNA 1Y9OA 2HZCA 1GT8A 2Z30B 5D78A 3FCVA 5K9FA 4Z7CA 3RAQA 3SFGA 1N33F 2X1GA 5FLXY 2K06A 2GGPA 2LKZA 2HBQB 4PKDB 3KHLA 4ECWA 2YH1A 4DQPA 1XMQJ 1BHNA 3EZ5A 5CXTA 1YJTA 1W25A 3DDKA 1HD1A 5HSPA 3M8RA 4ZLPA 2HNYA 4LRBA 1SQGA 3V6HA 2VC1A 4Q8EA 1XNRJ 3PFEA 2DT9A 2VQEJ 2JOQA 2ZFHA 2PDAA 2D3O1 1BQNB 1VQ8S 1X5TA 3CNQP 4IH6A 1N6QA 2POKA 2HNDB 4QR1A 1SL1A 4DR4J 4X4UA 3US5A 3I9V9 4PG8A 2KVIA 2JL9A 1N34J 2D74B 2K1RA 3PW5A 1FXRA 2B9YA 2QLFB 3HVWA 4DL0C 3KLGB 4NEZA 4U96A 2QA4S 4K5RA 1PCAA 1N0UA 3G4SS 4QIEA 2ZC3A 3OD2A 4ANCA 1I51B 1I1GA 2Y1LB 3KJVB 3LOUA 5GMDA 1XMQF 4DN0A 5A0YA 4ES3A 3DM2B 3NBPA 5KFFA 5HROA 9RUBA 5LOQA 4HL9A 4OZ0A 3VV2B 2LDIA 3QT8A 4LQ9A 2V63A 3EGNA 4I2PB 2XMMA 4URGA 1IKXA 2H3EB 2DKOB 1YKWA 2DO0A 5D0GA 3PFOA 1VQ7S 1NJXA 2QYGA 1NXIA 2QTWA 1RAOA 2DIUA 3PW7A 3PX6A 1VQNS 1GMWD 5ETMA 2CXEA 2W4PA 1NHKL 4DSFA 1YVFA 2M9KA 1OPIA 4ZS6A 4USHA 1N34F 3NGUA 5DLGA 2CZ9A 2LQ9A 3Q83A 3RBXA 3J80U 4ED7A 4NCAA 4PG5A 2IRXA 2R7RA 2VFTA 1HPZB 2YWEA 5HANA 4ZPAA 3CSKA 2DXDA 4V1Ak 4EWTA 4P7TA 4AT1B 1KFDA 1FRKA 1RAIB 2GC8A 2RUGA 3D6TB 3ITHB 3PEJA 2FUG9 4KFBA 1NLKL 4TXSA 2KI2A 4G1IA 4Y2KA 5D4OA 1A9NB 2DGVA 4IYQA 4DMZA 3D7SB 1KVJA 4KGXB 4FN5A 1RT6B 4KQZA 4QWAA 2F7VA 2CPIA 1LWFA 3QAUA 2OGUA 3THTA 2F9JA 2XQCA 1IWGA 1U4BA 4OZ5A 2HNZA 3DFEA 3RGIA 3KLFA 2HQCA 5GMKa 3BO2A 3R6GB 4A8QA 1V3RA 2N82B 7FDRA 5EWFA 3GP9A 1X4FA 2FZCB 5K14A 2OFHX 2P5VA 3MPDA 4A8WA 3GV8B 1YZ6A 3UVJB 2Z58B 4F2SA 5B0DA 3V81A 2CJBA 4M5IA 1DTTA 4NLTA 2OPSA 4X4SA 3QFHA 1TU0B 3KG0A 3FRZA 1LWXA 3CO9A 3NBPB 4H4MA 2J8SA 2BQUA 2AJ0A 3B82A 3L7UA 4AUKA 4ZN1A 2UVWA 1FEEA 1K47A 4OX7A 4AXJA 3OL8A 1BLUA 2CPDA 2FLNA 4X4QA 1JKHA 3FCWA 2EC2A 3NG8A 1SH0A 3QT7A 2H5EA 2K2PA 1T9YA 1GH8A 1HNIA 1UW9A 3F41A 3GIKA 4ED2A 5KG3A 2C3YA 3U1MA 3B8HA 3THVA 1CC7A 2ZH4A 2UXCF 3CJ2A 3OHAA 1H3DA 1U1LA 4BBYA 2LLZA 1K0VA 3KK3B 3IAS9 4Q44A 3QO9A 1N5VA 1WJ9A 2V8HA 2ZVSA 3LW5C 3ZZTA 2B3TB 4LF1A 3VF0B 1ZPWX 4H54A 1U8SA 1FXDA 2XBPA 1N88A 1Y00A 2GCFA 4I1TA 3HFZB 5IXUA 3F0NA 4OX9F 1DRZA 4DI6A 4X4RA 2CIMA 1U0HA 1MMLA 2R7UA 3TA1A 2CPXA 3J7YI 5J2MA 2ADBA 4DG1A 1NMEB 5KT6A 1TK5A 1LNQA 2UXCJ 3V81B 3UO0A 4CNZA 3CD6S 2F9DA 5KG2A 3LTOA 2QEXS 4Q0BB 5J2NA 2BX6A 3DDNA 1AROP 4PAAA 3T9NA 3KUEA 4E98A 3R7NB 1VHIA 5GAHI 1WEZA 4KTQA 2IVMA 3QO9B 2PMHA 4XTTA 5KFHA 3PW0A 2VODA 1HPZA 4FS1A 2Y9HA 1ZBTA 1RISA 4ZVFA 1HW9A 1Q8BA 1CJKB 1WEXA 2J9DA 2NXJA 3Q23A 1WSRA 3TAQA 1YWXA 3RAXA 2G4BA 3MM9B 1R31A 3MM7B 4U8YA 3G82B 5DRKA 2QSFA 3TEGA 3VGTA 4CLUA 3M9NB 2D69A 2VG7B 3TVYA 1UA1A 3W1YC 2XY7A 2ZM6F 4IG0A 2N7YA 3J81Y 1H74A 1MWQA 2EFNA 3GJSB 1SBRA 2CPFA 3QLHA 2GIQA 1R6VA 3NAHA 1IKXB 3B6BA 2QA2A 3X3UA 1BQNA 1P1TA 4DL5A 3VAHA 3LUYA 4GO5X 3M8QB 1JXEA 2PFFB 4R25A 3EM1A 2IM3A 4K59A 3D1HA 2KL8A 4YS2A 1WELA 3QT5A 5HATA 5K14B 2LECA 3VAFA 3BN4A 4CO3A 1NB7A 3A3PB 4ECYA 4K7QA 2XG8A 1W2BR 3HVTB 2OTLS 5HO4A 1QAIA 1FDBA 1KBRA 2G9OA 2HNDA 3IWLA 3MM8A 1X7VA 3DOKB 3DYAA 4IG0B 1FKOA 4ZCMA 2B56A 1UEVA 2HGNA 2WVEA 4KHRA 4WK1A 1JXVA 2N4CA 1F6TA 3I5BA 5JXSA 3FUYA 1U1QA 1T7PA 3H5YA 4FF1A 1S9EA 5D4PA 3EMTA 2MZQA 2NPIA 4KT0C 1NSQA 5IT4A 3LO3A 4P2MA 5IM0B 1ROFA 1GNKA 2E9TA 1VI7A 1U26A 5K8MA 4KO0B 4DQQA 5KT7A 4IFYB 1YZ7A 4PR6A 2UV8G 1KVIA 4NLRA 1HR0F 4B3SJ 2FZGB 4FDFA 4I6YA 3TNVA 4YY3F 1CJVB 3CIZA 4OHWA 3HJVA 3S1TA 2BOAA 2HFNA 5F41A 5GAGI 1U0HB 3KNGA 1FK9A 1VC5A 2VPYB 1FE4A 1H7WA 2KRRA 4A8OA 1IBKF 5KFVA 1RTHB 5HL7Q 1RT4B 5ETPA 3VWSA 3KLEB 1HNZJ 2JEGA 2CPJA 1IR2A 1SI9A 2O5DA 2AIRB 4N7TA 4DR5F 5E41A 1CS4B 1U24A 1KQKA 2M8DB 1ZAXA 4C48A 4TQRA 4B3MJ 1CQMA 4B3TJ 1H7XA 3MHYA 3DLEA 2JC0A 4W4MA 1IQTA 4ZVOB 2LFVA 3NLCA 1WHVA 3MEDB 1JLEA 2PFDA 3K58A 5DM7Q 2QV6A 1PG5B 3SCLE 5A8RA 1I5OB 2RF2A 3PYDA 2ASDA 4C2MA 1JLFB 4LF4F 2HG4A 1FJCA 1RWNB 2DY9A 4Y28C 2G2YA 4XAKA 2ZKUA 2EFVA 4DSEA 2ASLA 1M1KT 3C6TA 3HT3A 4YMEA 1UCNA 3BS9A 2NPFA 2XSJB 4JV0A 2CNNB 5T14A 5I42B 4DPOA 3MURP 4UUXA 4DF4A 3H4BA 1GMUA 1H73A 4Y2CA 3KWMA 4ZHRB 3DLLQ 2W2OP 3RR7A 4K0KF 2HHQA 1U6ZA 4P52A 4Q2LA 3C6UB 3FBCA 4FP9A 1WC1A 4X66F 1QAJA 1RE1B 2QJ3A 3BPDA 2ZOMA 4RW9B 1NK5A 2JEFA 2HNZB 1FWLA 3A8JA 3MCMA 4DV6F 5I3UA 3TJ9A 1XMOJ 3ZC4A 4AQYF 1HQUB 1OIAA 2CADA 2HLTA 2MJNA 4AYBD 1YRXA 4X65F 3PRDA 3VAMA 2KKHA 2FJVA 4JI4F 2V9WA 3DLGB 5BR8F 2PMZD 1SJ3P 4ENOA 2B51A 2LQJA 4X64F 2CJAA 1JMTA 2I9SA 3D6HB 5ITHA 2V2KA 2HS3A 1X0PA 3CCWA 1F9FA 1YG0A 2JWNA 2YWGA 3GFXA 2XM3A 3QRRA 4DR7F 3DHWC 3I0RA 2W7PA 4F4YA 2AEMA 3C6TB 2J9DE 4MAKA 4JI6F 3RYLA 4AQYJ 3DOMB 4X65J 2E5LJ 4DDFA 2W2MP 2E1MC 4ID8A 3LGNA 1EQMA 1KQFB 3KLVA 2AV5A 4ZVQB 5KAKA 4ITSA 1C2PA 4Y2IA 5L46A 5IOLA 3EDRB 2ZH8A 3F56A 4LF5F 3WX8A 1KNZA 2Q3PA 2VOPA 2YNFA 3H98A 4OYMA 5T7LA 3BR9A 3VQTA 1Q8IA 1VQOS 1RT3A 2KXHA 4LT6A 5F3TA 5LJ5Y 3MEEB 3IXQA 2YNHA 2RS8A 4IO9Q 3C15B 4MKAA 4ECUA 3DLGA 4UT4A 3TI0A 3I32A 3CWJA 4MFBB 4IO1A 4MTPA 3G6YA 1GEHA 3GE9A 1VBKA 1S57A 3QZ8A 5I3UB 3QIPA 1OJ4A 2GQ2A 3K2YA 1FO1A 2FJAB 2WSEC 2YWKA 1FVQA 2CQ2A 2DEJA 4YFUA 4JI0J 1AFIA 2GVZB 2C3PA 2W2NP 3OXGA 2AQ4A 3W2WB 2QSWA 2IRUA 7AT1B 4RZRA 5J2QB 2RUSA 3K5NA 3KUHA 1YJRA 2H54B 4NX9A 5KOXA 4NXMJ 4RX6A 2XYGB 3NY0A 4OJGA 3T1HJ 5AXLA 1EARA 2V5HG 4WJBA 5AE3A 2RDIA 5CD4H 1RYSA 3QPIA 1S1UB 1WF1A 3QGIA 3CCQS 4JI5F 4C6AA 1J5OB 2BOPA 2VG6B 2H48B 3FBFA 3PIPQ 1SUQA 1N32F 4KR0B 4LF7F 5MLCV 4NMLA 3BSOA 5IWAF 1S72S 3D66A 1YRTA 4XK8C 3TO8A 1VBXA 1HNWF 3D1OA 4NLSA 3D6FB 1C1CA 1RT1B 3LGMA 3S01A 2K3IA 3BGLA 1FRXA 4F2RA 1RK8A 3FDSA 3R5AA 2DR5A 4QU7A 2PA3A 2KT3A 4J9MA 4ZP7A 2BJ7A 1W7WA 2R7QA 3LPYA 2YX4A 1WUUA 3A8IA 3MM6A 1WHYA 2QE5A 2G0IA 3NXZA 4JOUA 5C24A 4PZVA 2W25A 5HQ8A 3KYLA 1U1PA 2FY1A 4CCHA 1R27B 5C7PA 5I42A 4F67A 3F73A 2DIVA 5J1EB 1EQ0A 1SKSA 1LFWA 1C1CB 3AB4B 4TY8A 3J7YU 2ZM6J 1FD8A 3MM7A 3R1LA 4J9VA 3OVBA 2GIRA 4UZCA 1UFWA 2LVWA 3HZEA 3ZZZA 3M9MB 2B9WA 2VG5B 3CC7S 4PWDB 3B4DA 1V6HA 3C16A 2ZZMA 5KFMA 3MM6B 1B0VA 2LXFA 1VLYA 3AB2B 3O5TB 2UXDJ 2BJ9A 3OFHA 5DJBA 4PQAA 2C2NA 3B4MA 3GCWP 3I87A 3JAMY 5EWGA 1NB2A 2YVSA 3GJQB 5CA5A 1S1UA 2RD5C 3MOJB 2IDEA 2B4PA 4C8NA 4OYOA 2HHUA 2BM1A 1I94F 3NNAA 4AXIA 2HHWA 2ZHOA 2XTJP 3HVTA 3D54A 3J81j 2VICA 1IKYB 2IAJB 1U6BA 4CLWA 1OMSA 1L5UA 4OHYA 3BGUA 5J2QA 4URQU 1FVSA 4LMZA 1DY3A 1XK8A 1Q8LA 3AAWB 3FSIA 2ZBIA 3PYFA 3W63A 1Y5IB 1G4CA 1VIXA 4HKQA 1K0TA 3BM7A 3IWNC 4MK9A 1K9MT 1RWKB 3A3NB 3C3LA 1J2VA 3D3BJ 3GFHA 3J81U 1BQXA 3IRWP 2JEJA 4WF9Q 2AKWB 2PT0A 4TYBA 3CCUS 1VMBA 4MK8A 3QATA 4BHQA 2XMUA 4DCOB 2P2CB 5KFKA 1HNIB 2MQMA 3F44A 4TLQA 3IS9B 3W7BA 1BGXT 3CJRA 4OZLA 1SXLA 1JKHB 4LF2A 4WWSA 2VIHA 1F60B 1V5VA 3MCOA 1RT3B 4KAIA 4UY8T 1X5PA 3BSAA 2MSSA 2GX8A 3LP2B 1GTEA 2HLUA 3GJTB 3VVTA 2VBYA 2WCXA 3QIPB 2D41A 2QLJB 2ZBRA 1O6XA 5D4LA 2RSQA 3QGGA 2ZVIA 1NKBA 2PMWA 2OPPB 2IVYA 4NOHA 2DNKA 2DH9A 4IQMA 4X2BA 2ZOFA 1HWJA 4DV2F 3GCXP 3OVSA 3GFYA 3EDQB 2ZDPA 3TEHB 1W2IA 2UVRA 4P6QA 2RIJA 4DEZA 4PXEA 2KU7A 2Z4PA 1UWAA 3U27A 3W65A 3HD2A 1LWFB 1R89A 1VYAA 2HWIA 4ZPTR 2RB7A 1RA6A 5THWA 3KK2A 2FGOA 4OI6A 2ZH2A 4ZVGA 1DARA 1VOMA 5KT5A 2BV3A 4J9NA 3JQMA 1N52B 4DPYA 1X8DA 2DCUB 5H9FK 5A8KA 3MM5B 5L9XA 4ETZA 2J9EA 3UI3A 4DV2J 2BKPA 1GFWB 2DNRA 4LVOP 4O44A 4L76A 4OYXA 4ATNA 4XPEA 2J9CA 1JIHA 2R2SA 1FJGJ 2C3UA 1J5EJ 1CBKA 1CJKA 2RDDA 1FRJA 2KT5A 3PIOQ 3V4IA 4LUBA 4KSEB 3CJKA 3L4BC 4KE5A 1A6LA 2UUAJ 4V19X 1VRUA 1VJWA 2ACMA 2W1BA 2APOA 3D5MA 1NNDA 4ZHRA 4KPYA 4I4BA 1N5SA 4ZVRB 4OI4A 3NWRA 4H4MB 2G1DA 3CJTA 2F4VJ 3KK2B 1F3VA 1TVRB 1MN9A 1RZMA 1TV6B 2OPRA 2V69A 2DH8A 4WP8A 2HGMA 1LFPA 5DS7A 4Y34A 5F8IA 5KT3A 1E6YA 4RWXA 2NSCA 2MYFA 3NAIA 2XNRA 2ZC4A 4WFBQ 5H9EJ 4EYIB 3MXHP 1FJGF 3EX7B 1CJVA 1WWHA 3HMJG 4X4VA 4WYLA 3KXDA 2UUAF 4O3SA 2IC3B 4L3KA 5ETRA 2AT1B 2R2TA 5HP1A 3I6PA 4UF4A 5D0HA 5LM7E 3RRKA 2NUHA 1E6VA 3PY8A 4ZVPB 3CD5A 2AJQA 3VGVA 1ITPA 5K5MA 1YITS 1LWCB 5F0UA 3OR2B 4PG6A 4CLKA 1Q5VA 2BRLA 4CO1A 2ILZA 4KGMA 1S9EB 5IQ6A 4Z37A 3KKFA 4KKOB 2VKRA 2YXLA 2CPEA 4X4TA 2CQCA 1SV5A 4I0WA 4USKA 2GV1A 2DHAA 1GMWA 2OH2A 3CJ8A 2GJ2A 5B0AA 4NCBA 3M9OB 2OHDA 3JQJA 3M30B 2HRYA 3ZTRA 4ED5A 1C0TA 2R2RA 3O44A 3K59A 1DLOB 2JVRA 2M4MA 3OR1A 4LBIA 4OYZA 1X4EA 3JYTB 2EFOA 3GZ7A 4YB7A 1S6UA 3TQ1A 1X4BA 1HKAA 2AD9A 1JWWA 2GW8A 2HVZA 5G0RB 4JI8F 5L1LA 3QMQA 3N6LA 3J7A1 4DV3J 1R3NA 4I2PA 2YTCA 3OLAA 2X1BA 1T03B 2QN6B 5B0EA 4ECXA 4ZVTB 2XZWA 3KJFB 4OYAA 5F8NA 1D3WA 1RTHA 3TRGA 2I0XA 1BUXA 1S1XB 1T9UA 3N6MA 4ZVSB 2KHDA 1HARA 2XLKA 3LH2S 3UN2A 2HPUA 2AZ3A 2X3GA 3WHIA 2PA8D 4ETXA 2MQLA 1RT7B 1FKOB 3E8OA 1UEUA 4J9KA 4L75A 2AGOA 1U8WA 3GONA 4MIWA 2ZJRQ 2A6MA 4N5SA 3EPIA 3CJ4A 1RHKB 1S6OA 2XULA 3FRYA 3RZAA 2QMUB 4YB6A 1S10A 3GYGA 1MMNA 4LSNA 3HJFA 1TTHB 4OJ3A 2JSXA 2DVIA 3NRBA 3WIUA 2CQPA 1PJ7A 1C0UB 2N3LA 3K17A 3Q8YA 3T41A 4OI2A 4YUDA 1VBZA 1X9MA 1QSLA 4BDPA 1FD2A 2M2BA 4M94A 3A13A 2VQFJ 5ETOA 1H98A 4RL1A 2BJEA 2XEXA 1Q81T 1XERA 2M52A 3NGTA 1HWKA 2ZNZA 3HT0A 3I5AA 2H5JB 3G87A 1YJUA 2LP4A 3L95X 1JQGA 5E2QA 2M88A 3M2UA 3NCPA 2OEMA 4FF2A 3VALA 4ICLB 3GV7B 4OX9J 2AEFA 3ENWA 4QIFA 1JLQA 4CP5A 3BB5A 3I56S 3BO4A 4OI0A 3T1YJ 3DGVA 2MB0B 3BGRB 5KG0A 2BANB 2RH3A 2LQ8A 3HD1A 4NYZA 4NA1A 1ZZNA 3AD9C 2P6SA 5CCMA 1YJ9S 2C2MB 3ZZ0A 4Z2XA 2FLPA 3OR2A 1FNMA 3PX0A 4NE9C 4PYAA 2MPUA 1U1MA 4ANEA 3UNGC 2VQFF 4A8KA 2C2RA 1CVJA 3P49B 1VC6A 1NEEA 3HM9A 2MXYA 4J9PA 1VDHA 2WONB 1S76D 2D3OR 4NI2A 3MR7A 4YR3A 5JMNA 4PUOB 3N5FA 3M8YA 2XO7A 4ECRA 1JXLA 2ZH7A 3PW2A 1F2GA 2B8QA 4C11A 3N6NA 3BKFA 2CA9A 3FQLA 4O3NA 1FXLA 2GHVC 4OYPA 3VR1A 4ZOSA 1TV6A 1TVRA 1FDAA 3CMES 3OXLA 3L3CA 4MH8A 1VS3A 1TUWA 3OJUA 1B64A 3K8VA 1KOOA 2F40A 3EVMA 4LSLA 4DG1B 4F0HA 1D9FA 1YDLA 2O1PA 5J2MB 1U45A 1S6PA 4S0MA 1Z2ZA 4ZA1A 2YPYA 2J0QD 4Y0FA 3HK2A 3PKMA 1RJJA 1R8AA 4DV5F 4USVA 3FFIA 4ES1A 5I3PA 1U7LA 2BJ8A 4PXBA 2MQ8A 3Q8QB 3OT9A 1FNOA 4WKRA 1XEZA 4PRFA 3WX4A 4USWA 2ERRA 3C15A 4LFBF 3R7BB 2Q43A 2DB1A 5KFJA 3AJDA 5LXRA 1X4AA 4MKYA 1MWYA 3A8EA 1VQ4S 1RU1A 2BKOA 3GSDA 2DYAA 2AMCB 1QD1A 1NO8A 3EVWA 1U09A 3O2IA 3S8SA 1KOHA 3PO4A 1ZM4A 2EKNA 4WFAQ 1H72C 1VLOA 2R8JA 1HBUB 2QFJA 4UW2A 2E1RA 2DH7A 1RLDA 2AYEA 1UEKA 2V4JA 1TZ0A 3B78A 4FXWA 4W98A 1YJWS 2IM1A 4KGVB 1RAFB 2VPXB 2FDNA 5F0WA 4ZVEA 1YBTA 3DCAA 1HR0J 4KV8A 4B3SF 4K5SA 2ATLA 3V6DB 5FIIA 3BBFA 1RT6A 1VHFA 3NKYA 5ETLA 5MAOA 2MKSA 1EB0A 2ZKTA 3FNNA 3T3FA 4DSJA 1BE4A 3CT9A 2HSEB 4TNOA 1PBAA 4IDKB 2Z57B 4YDXA 5B7WA 4FS2A 3L09A 1FKAF 2K7KA 2YWFA 3C14B 4C98A 5DG8A 3GV5B 3P5TL 1QAXA 4B3MF 1R8PA 2VG5A 3NS6A 5EX0A 4DR2F 2VC0A 4PWDA 1ACMB 4EBCA 2HVDA 3BKUA 4ZJLA 5JUMA 1L3SA 1C1BA 4DS4A 2ZEJA 2GFFA 4CO5A 5DQGA 2L08A 2ZJPQ 2J6SA 2MLXA 4DU7A 5HQLA 5E3PA 1WDDA 5HMZA 1TL1B 1IUJA 3DC2A 2DO4A 2HNYB 4J9SA 3QNWB 2IPOB 4BWMA 3D0HE 1AUDA 1PAEX 1S7HA 1SPBP 3E3XA 1EIYB 2IAJA 1FRIA 3L9ZA 4I6AA 1B4SA 4O0IA 3SV3A 2R8IA 3CDAA 5D0EA 5T41A 4TY8B 2PIIA 1M0SA 4DV0F 1KRPA 1S0VA 4DFMA 2K1RB 2MQOA 4A48A 2AF6A 4M5KA 1DQ8A 4NLWA 3CJQA 4YY3J 2DHGA 3I55S 4CLPA 1HNXJ 1G2EA 4M5DA 3CPWR 5BYSA 1YJ7A 1J27A 4U6PA 2O66A 1RT2A 3AD7C 2ASYA 5EUHA 4USMA 1LKZA 1Y7PA 1ZOTA 2CPYA 3CB4A 1HNZF 3BN7A 2C2OB 1LWEB 1TKXB 2UUWA 3K5PA 2IJNA 3NWGA 2VHGA 5ETSA 4JI4J 3HF5A 3ICLA 4ZK7M 3KLGA 5CZVA 3SCKE 1JX4A 5DGBA 3MEGB 2JHEA 4WIQA 5JJBA 5T7LB 1FKPA 4X4PA 2XCPA 1YGYA 2BDPA 1YSJA 1LQ9A 3EUNA 1D9DA 1SB6A 2CQ3A 3GU0A 3TZXA 1P8GA 3CIMA 2MJUA 1S1TA 4ZCLA 1FK9B 1YLXA 1KR4A 2F8EX 3FEZA 2DGSA 1N5YB 1B0TA 4QCLA 5F8JA 2MTLA 1FESA 1P9QC 1S12A 3MAAB 4L74A 4PPZA 4LF4J 2V8GA 3BSNA 3SSRA 2BBEA 4AL7A 4DV7J 5CCLA 2W7AA 2WZ1A 2BE2B 3UCGA 3PVXA 1BWEA 1R6YA 3OSNA 1URRA 1NK6A 5F8GA 4LRDA 1UJ5A 2DRAA 5A2QY 2RQMA 1RAGB 5LMUF 1S1VB 3N0VA 4C8MA 4C3LA 2DTJA 3R5CA 2E66A 1N0VC 4J37A 3WC0A 1NPPA 2R8KA 3I4HX 1PILA 5KT4A 2CWXA 2WB4A 2P6TA 3FMBA 2DNPA 1F3FA 2RJZA 1FWKA 2DITA 5KFGA 4FNIA 4HHUA 3M7VA 4HDGA 4J9UE 2FJWA 4HLBA 1CEZA 3C16B 1WF2A 4XDDA 3KTQA 3L7PA 1HLWA 3MUVP 2R8HA 5HLFB 1JLGA 2H51B 2IM2A 3LGHA 1XR6A 3OTBA 2AYBA 5KFYA 4TU9A 3G86A 2I6WA 2D9OA 3EVOA 1WTFA 5EX3A 4A8YA 4DL6A 2LEAA 4MYTA 4X64J 5IZHA 1HFEL 3BPSP 2XSJA 3KOAA 1HWIA 5A6WA 1HI1A 2XY6A 1ZM9A 1DTQA 3HFKA 3WIVA 1RSCA 4NXMF 1RBAA 1UL3A 2Z2MA 2OELA 2YNIA 2Y0BB 3QLHB 3BV8A 1OSCA 3ISNC 2HHTA 3OL6A 4JI6J 4YHHF 3RJMB 4H4OB 1TL5A 5DM6Q 2AHOB 1HQEA 2ZUGA 4B9TA 3BZQA 4FBTA 4LFCJ 2WTFA 5B0GA 5KFXA 2ROGA 5LSRA 4ZVUB 5EGYA 3LP2A 5C42B 2X1AA 3ZFVA 2Z0GA 2A3JA 3TAMA 4LF7J 1XN9A 3R8YA 3BGOP 1JLAB 1IKWA 2DK2A 3DU5A 5ETNA 4BCAA 3RTVA 1FJEB 2JH3A 4WIIA 1FJ7A 4Y65A 4QW9A 4O3RA 4GKJF 3QFWA 1TKZA 5KFCA 3CVKA 1XIQA 1U6FA 4OLPA 3W5ZA 2XLJA 4EZ6A 2HIYA 1O5JA 2OSQA 2V2QA 4WCEQ 3RB3A 4HEA9 2RQ4A 4I68A 1M5SA 4YHHJ 3JSMB 2KT2A 4LIWA 4R5PA 3OTOJ 2B7BB 1Q53A 4OJ1A 4RW4A 1BQMA 1TKTB 1ZYQA 2OP5A 2V94A 2RF2B 1RWXB 4E8UA 3GFZA 5A8RB 4DLGA 3T5LA 2D9PA 2CZ4A 2R7OA 2R42A 4J9RA 2NZ4A 5L9NA 2E5IA 3CE8A 1UW4A 2HHXA 2E5LF 3C46A 3NL0A 2FLLA 3VZHA 1WACA 3SV4A 1WOPA 2B4VA 3DOLB 5KTQA 2CPHA 3I5CA 2DCLA 2LU2A 4H4OA 1FDDA 1RLCL 4OLOA 2CVIA 3V4MA 1PYTA 1XQIA 2CQ1A 2QT7A 2OUGA 2XCAA 4V19J 1S6QB 2ALYB 1RP5A 2RHSB 3ILIA 1RAAB 4NLXA 4TVAB 2CPZA 4DPTA 2MZRA 3GSIA 1I3OB 3N9UC 4TY9A 3KLEA 2HFOA 2X1FA 4AFFA 4NASA 4WKYA 1TAUA 2IM0A 3TUIC 1S6PB 1SJFA 4K4XA 4JV5F 1P9YA 3BF4A 2J6UA 2Q1LA 2XS5A 5B0CA 5KFDA 2NUUG 5HVFA 1IM4A 4KHPF 3MD3A 4ZCIA 1PC5A 2VB6A 3LP1B 2HKEA 2CQ0A 3H42A 2FC9A 4QWEA 2I38A 4M5HA 1RA7A 3SSQA 3D28A 4CRJA 3ONQA 3DRRA 4OV6A 3R3TA 2HIQA 5DO2A 3M2UB 1ZAWA 1TL1A 4HI1A 4CIOA 3QT6A 1Q7YT 4USTA 1R8BA 3O8WA 4C0OC 2LCWA 3QGPA 2JDJA 3QYYA 2JJ4D 3SCJE 1ZH5A 5U47A 2PE8A 1UVNA 4FXDA 4C8ZA 1RAHB 3QWUA 2KN4A 2B0GA 2BW2A 1OQ3A 4DHVA 5E3QA 4ZCKA 3IM8A 3MPYA 4HR2A 5HI7A 3HHKA 5A2QU 3Q2SC 3SXLA 5KG5A 2KM8C 4N77A 4KHPJ 1F9HA 3RBDA 1RACB 2ROPA 4F04B 4ER8A 3DU6A 5BYQA 1NJZA 3E2EA 1TR0A 4OX8A 3V5RA 3OSPA 2DGOA 3SSSA 1IVZA 1NZAA 1XNQJ 4K2JA 2CG8A 3M8QA 2IMWP 2GQCA 1UVKA 1OY9A 1SJRA 2AJFE 2VBXA 4NCGA 4A8SA 4EFAC 5C2GA 4DUYF 3HHLB 2M5YA 4PPDA 4DJBA 1TKDA 2FHKA 3TZYA 3IG1B 4M5JA 2VV5A 3CMAS 2QGFB 2HWHA 4KGKA 4H4KC 1LW0B 3Q89A 1S0MA 3T5HA 1VRTA 2GMHA 2H5IB 5KG7A 1UP1A 3BREA 3KJVA 4RNNA 2XMJA 2XMWA 3AOCA 4NXNJ 2E44A 1DQ9A 2MKJA 3W64A 2WOMA 3Q8SB 3SZ2A 4M95A 1C0TB 1AXQA 3DYAB 3HHEA 3HKWA 4DWIA 1AFJA 4KH0B 1LOUA 2EBGA 3DRPB 3M2RA 3CCSS 1B7YB 5HP1B 2OTJS 2HRUA 4Y2AA 3PO5A 2L41A 4C7QA 1S4FA 3HSGA 5LJ3Y 5M2RA 3TJ8A 2CQIA 2WVCA 2BR0A 3KG1A 3BKTA 4YB5A 3UFCX 4WFNQ 2R9LA 3RW6A 2R8GA 2FJDB 2W01A 1KHVA 3D6MB 3R5DA 2HVIA 1LWCA 2HK2A 4ELVA 2E1AA 3FCHA 4QOTA 3TUPA 2EC0A 2DXFA 1KWMA 3NOCA 4FYWB 4RO0A 5BYRA 4C8YA 2FVSA 3NOGA 3J7AN 4QQBA 1UKUA 5E3AA 1VRUB 2YKQA 6FDRA 3BBCA 1MU2B 4A8FA 4GKKF 4NA3A 5B0FA 1RDRA 1RBLA 1BY9A 1LW2A 2YQ0A 3H0PA 3AODA 3NNHA 4LF9J 4J7CA 1B0PA 2FVCA 1MROB 5GMEA 3D2WA 3ENVA 1XMBA 2JX2A 3DLHA 1YK9A 4TU8A 1KDNA 2OPRB 1GXTA 4F3MA 4B3OB 3QZ7A 5IM0A 2XS2A 2HK3A 4OHVA 4BWJA 4USJC 2QA4G 3VTIA 1H2UX 2HVEA 4KB7A 1IBMF 3QBCA 2NYIA 1SKRA 1S9GA 1M5VC 4DQIA 3RU0A 3G6ES 4G3IA 4Q0BA 3WZ0A 2QC3A 4K8RA 4LF8J 1LXNA 5FLXU 4P7VA 1X4GA 4P2XA 1T3OA 4KH1B 3NGRA 4DR4F 1T9VA 3PKYA 1M5PC 5IT9Y 4P9SA 4ZPVR 5I3QA 3RAMA 1GXUA 2FJBB 3MD1A 1Q4RA 4ED3A 1J5EF 2NXCA 3SIPB 4DL4A 3MMJA 2KTQA 3ZZYA 1TMMA 1RCXB 2XC9A 3H40A 3LANA 1P6TA 1E6YB 1NRKA 2UZAA 1N5TA 1RB0A 2IHR1 3UN5A 4RUCA 3OFGA 1HI0P 2J0WA 2OMOA 4F36A 2VONA 2F4VF 3MDFA 1AW0A 3BO3A 1CG2A 4IG3A 1VQ5S 5E7OB 4R8UA 2KO1A 4ELTA 2E7WA 1PKUA 2FHMA 3PYEA 4PXCA 5A8WA 3CCRS 1WKLA 4F02A 1VFJA 1JLGB 2DNZA 3FGVA 5J2PA 2CJKA 4DR1J 1VK3A 2R3VA 2N7CA 1SH2A 5KFQA 1LW2B 2DGUA 1WI6A 2XMVA 3Q8VA 2KXFA 1DTTB 2BACA 3DNCA 4RBTA 5HJYA 2HURA 1DBDA 5AJ3J 2BE9B 5J2NB 5CYQB 1S59A 2YWWA 2P9GA 5GAEU 2MKKA 4G1PA 2QRRA 2J0SD 1RWWB 3GMGA 2XWYA 1IBLJ 2P9EA 3ENQA 4BLGA 4ZMMA 2DR6A 2IMOA 2EVZA 3J7Z5 1WNEA 2VH7A 3CJ5A 4J9OA 3QJPA 3CF5Q 3DMJB 1F2HA 2EXUA 4DR3J 4RBUA 3H2UB 2EW9A 2IY5B 4IFYA 5AJ3F 4ZPWR 3MR5A 1QUVA 4KYZA 4DV3F 1UWBA 4P75A 2GO8A 3GJRB 5F9NA 3KHHA 1ZA2B 3P5BP 1JNRB 1YHQS 1R0AB 3HLUA 1TMJA 4QWDA 3Q8UA 1LW0A 3JXOA 2ZBCA 2KH9A 1JLQB 3CCZA 3HKZD 4NZ0A 4Y00A 4NLGA 3NS7B 4CO4A 5KT2A 1WDTA 2FGCA 2IRYA 3M6XA 4HH0A 4ZP9A 3TVKA 2Y1IA 4LQ3A 3AOBA 4DU8A 2YNIB 4P73A 1HHSA 2I1RA 1Y0HA 2FHOB 3I31A 1NK7A 2Y8YA 4IOAQ 4JYAF 5HQMA 1TUGB 4FNHA 2VFUA 4O4GA 3HSJA 2HFVA 4TN2A 3G8SA 1KN6A 3M4XA 1AZSB 2IYIA 1S79A 2UUTA 2C1EB 5DDOC 4LJMA 2W9CB 2HQDA 2CFXA 4CLSA 2R4FA 2QZ8A 3T19A 4ED1A 1AT1B 2H1YA 5C2CA 4TQSA 1IKYA 1IXKA 4QYRA 3T5KA 4DL7A 5CYMA 1T3NA 2BMBA 2DNQA 1PSDA 2ZWOA 4JBCA 2WVFA 1KTQA 1XBWA 2U1AA 3K57A 5ADZA 2CUYA 1QLNA 3CCVS 4M1KA 5LL6d 2Z8QA 4A8MP 3R6LB 2AYGA 2FHJD 4K50A 1M5HA 4DUTA 1S5ZA 4RNMA 2F8HA 3G82A 3KLIA 1HYSB 1NAQA 5H1SV 3HX9A 3AA9A 4HHJA 4RR5A 5LSOA 2AEJA 3V6JA 3PNIA 3EGWB 4ILMA 3VGUA 1U1RA 1MWZA 2MLZA 2CQBA 3FMWA 2OI2A 1R43A 1AYEA 2V0NA 3GPAA 4PWWA 3TWZA 2J7UA 1XWLA 3OUYA 2QX0A 2B6AA 3FBBA 4EO6A 3FEYB 3HCXA 4PQUB 2F4FA 3AXKA 2HS0A 4M5GA 1S9FA 3D3CJ 1U1NA 2PI4A 4CQ1A 4IR9A 2QL7B 3AFGA 5F8LA 3M2VB 3KLHA 3JTNA 2RRBA 1HA1A 2RKIB 4LVNP 4CM2A 2E7XA 4CTAB 4KBIA 5A0YB 5RUBA 1T9WA 1S49A 2A6OA 1R0CB 1N36F 2W24A 4ES2A 4YR0A 3BYRA 2V4JB 1X0FA 4QPTA 3PZPA 4K4VA 4DZ6A 3TAMB 4WXWA 3TZZA 4ED8A 1KS2A 2DGQA 2MKYA 5LMNF 1U2RA 2HMIA 4O3OA 2V67A 3KNAA 2YKNA 1KLMA 2MSTA 3H90A 1NH8A 5KG1A 3W2VB 2XYPB 4CLFA 2CNLB 2WVBA 3LAMA 5KFAA 3CXCR 1WSVA 4DV5J 2UUBF 3ZNJ1 4C97A 2O3DA 4DN9A 2ASJA 1RGVA 2V9KA 4ILRA 3TA2A 2YNHB 4DSIA 1B7FA 2QO3A 2ZH5A 2Y0SD 1QDUB 2QMWA 1BWVA 3D0IE 5E3CA 2H9ZA 1U1OA 3O3LA 1RTDB 1GX5A 2Q66A 2XSFA 1IN0A 1FDNA 2NZCA 4FYVB 5HVGA 1VRQC 2GGPB 5GADI 3TQEA 1JLCB 1TP7A 2G13A 1ZETA 5IS2A 2VKZG 3SDEA 3ETMA 1F1BB 4P10A 5LMNJ 5FJ4A 3N01A 2XO6A 1CC8A 2A10A 4L3NA 3NP5A 1QUPA 3CJSA 3TA0A 4CH0S 1R8CA 3IR5B 1N54B 3PM9A 1SVDA 1UPPA 1IKVB 2AZ1A 2GAGC 1NJIT 3I0RB 2R7VA 2XNQA 3VAGA 1ELOA 1ZS6A 3IP0A 2KZZA 2V2VA 4ECZA 2E5JA 3JS9A 5D3GB 4QYZJ 2W2PP 4LRFA 2E1CA 2YKNB 3K7RA 1AB8A 3UD4P 1HIYA 4IG3B 2LEPA 4IRKA 1JLCA 2YNFB 3VHQA 3POTA 4CH1A 4QU6A 8ATCB 2LU1A 3I0SA 1SJQA 3MR2A 2JVOA 3I82A 1UA0A 4QW8A 2GVDA 4HHHA 2VDHA 1VK8A 2BZ2A 3AHPA 3NEKA 4G65A 4GVBA 3ZZUA 3CEDA 4EK2A 2C2ZB 4X62J 3QGHA 3AQOA 4PABA 2KYXA 2WHOA 3C6UA 3OW2R 2KYZA 3LF0A 4YN3B 1NSAA 3OFEA 1X31C 2E5HA 2HRTA 2UU9F 1CJTB 2GMJA 2HBYB 2VD3A 2ZE2A 2F65A 2RRNA 4WYWA 2HEKA 2DRDA 5E5NA 1GK8A 1RTZA 3PCOB 4X4NA 1FKPB 1Q78A 2EFGA 4N41A 2XHWA 2RDJA 3BBBA 4DR6J 4M5LA 1RAJA 4NZ6A 3ET6B 2M70A 4A4JA 4C8OA 3IS9A 4K4UA 2L48A 2VASA 3SQGA 1U1KA 1TK8A 2WSFC 4DV0J 1WC0A 2XI2A 2AX1A 2MQNA 5B08A 4O3PA 4X62F 1N6QB 1TL3B 4HACA 1X4HA 3W2VA 4J9LA 5DG7A 4IH5A 1HNXF 4ECQA 4HDHA 2L3MA 2G1HA 1WOOA 3CULA 2FY8A 2UU9J 1RWVB 1NJYA 1RHRB 4ID5B 4URSA 2B5JA 1S1VA 2EEYA 1YX2A 3DN9A 3M1VA 3OJSA 2ALZA 4CT9A 3A8KA 3ZZRA 1Y3JA 1HBMA 2BJDA 2WK4A 1GXLA 2O67A 2PN6A 3W66A 3FKBA 2JLEA 3M2VA 3KLHB 1SC1B 2B7CB 1KD1T 2BW7A 5DG9A 2DNNA 3MAAA 3T9ZA 3RRHA 2VUGA 5G4DA 2DHHA 2V4QA 1SJ1A 1WF0A 5CYJA 1TAQA 2RS2A 1KLNA 4O4GB 3W9JA 4PUOA 9ATCB 3OUYB 1SIWB 2PEHA 1S1WB 4HH1A 2EI5A 3JSYA 4QIVA 4ALZA 5SZTA 2UVVA 1JLEB 4U7CA 3OHBA 4K4SA 2GJIA 4DPWA 1EKSA 2DNLA 3MAQA 3SQGB 2D3UA 4R0JA 3OFFA 3I96A 3UD5A 3LWLA 2IJRA 2C2DA 4KKOA 3W5YA 3H20A 2DGWA 2PI5A 4JI7J 3JTOA 1SC4B 1Q8KA 1DAXA 1CS4A 1HHQA 1V9OA 2WW4A 4PG4A 4CLLA 2GO9A 5GAGU 5LMUJ 3OTCA 3CDWA 3MFIA 2VJUA 1CQNA 2FB0A 5GAEI 1MG7A 4Y2MA 1IBCB 4I2QA 2NR0A 3P4UB 4GKJJ 5CD4A 4TU7A 4XIUA 4DR7J 3HHLA 3TJAA 1U02A 2IC3A 3TVZA 1TFYA 3MUTP 2W8LA 4XPCA 3LPEA 2BVZA 2WBMA 2V2ZA 4LBPA 1LK5A 3EJMA 4P2FA 3OTOF 4CO2A 1KQGB 2OKQA 4DLEA 5KFRA 2MZTA 2V8DA 2BJ1A 4NL5A 2JFKA 1KVKA 4RLEA 4LF5J 2ZH6A 4Q43A 1WORA 2DNGA 3CCJS 2V50A 3ILLA 3W8PA 1NKEA 1YBUA 3ISZA 2ATCB 3VCDA 3PJXA 1P1LA 3OL9A 2A18A 4IUFA 3G8QA 1WC4A 3KJNB 2DNOA 3PYGA 2VG7A 3QWPA 2FVRA 2ZD1B 3L7OA 4U67Q 4HTIA 2HHVA 2KFNA 2VF3A 1NK9A 3OXFA 3UN3A 4NLUA 4EBDA 2RAQA 4GO7X 4EUVA 3HFVA 1FTRA 3CC2S 2HW3A 3E01A 4LFCF 3IO1A 4L6V3 3N28A 3PTWA 5K8OA 2HFUA 2ZITA 4TLRA 1N4LA 2E7VA 2MZSA 4OI1A 1U0SA 2DGXA 1RWOB 4Q8FA 3NGKA 4I7FA 4ERDA 4JV5J 1N5QA 3P8BB 3EGVA 2EFPA 2VOOA 2MDAA 3FBEA 4DX8H 3J80Y 1EZZB 4DPXA 4PCQA 2YX7A 3M30A 3EYZA 3Q22A 4Y6IA 3Q8PB 4RU9A 1ZAVA 3FJ2A 2B8PA 3IBWA 5KFSA 1IR1A 5E33A 4WP3A 5J2PB 1B3TA 4HYKA 4DF8A 3SBMA 5A8WB 3MM9A 1HI8A 3LP0A 3MTKA 1UVMA 1X60A 5EDWA 2BRKA 4DSKA 3MF5A 1HHTP 5IWAJ 1WD6A 2B4OA 3RW7A 2NCKL 2ZH9A 1H2TZ 3DI6A 5KFIA 1T05A 4OZ1A 4QIGA 5D15A 1ZTTA 1LEOA 2G0JA 5FDLA 1PYOB 2DGTA 1U25A 4ICLA 4U7UK 3TW0A 1YTYA 4R5PB 2Q6BA 3K5LA 2HHHJ 1XNQF 2B4UA 2R7SA 3NGSA 3HHLD 4M8LA 1U2CA 2MZJA 4LSLB 4HT7A 4BC9A 4WFXA 4LIRA 3GQCA 4B3TF 1OYEA 5A6PA 2ZBPA 2AW0A 5HJXA 3VAKA 3MPUB 1RHJB 1OO0B 2F3JA 4CH7A 4ZIVA 2YQ1A 3EXCX 4FVMA 3M32B 2FD2A 3KMQA 1KFSA 2N3OA 1TQLA 2C3OA 2CQHA 2YY3A 2RNEA 3IN5A 2LA6A 2HZVA 3EZUA 3BDPA 2U2FA 4NA2A 5E0OA 1WTBA 4F4AA 1RABB 3ILJA 1IBLF 3CDEA 1RU2A 3JAMU 1Y4ZB 3G8TA 2OLWA 4DXLA 1LV5A 2A2CA 5DDRC 4K4TA 4IR1A 3PV8A 1FRHA 1T94A 4EGLA 4B9SA 4ECTA 2LDYA 2D1CA 3IM9A 1GX6A 4I2QB 2WOMB 4OX6A 2UUCF 1W26A 3W60A 2JNJA 4Q7AA 4DV1F 2UXBF 1NH7A 4RW8B 3LP1A 2ACYA 2XZTB 3A1YG 2AYMA 3TANA 1OSDA 3GIMA 1AZSA 5D4NA 1IJFB 1Q16B 4G1QA 3WQPA 1FERA 3ZTSA 5GADU 1T8EA 1IR0A 3H59A 3EWGA 3TUJC 2QYCA 1NSPA 1T9TA 2RU9A 2VJVA 4C8KA 4MK7A 3ELHA 1T95A 5AE2A 1N8RT 3BH6B 4JV2A 2DRBA 3G96A 3AXMA 5L8RC 3HDSA 4GKKJ 1CJUB 3K5OA 4ZPBA 1VISA 1WG4A 2CQGA 2Y1RI 2PC6A 4DFPA 3OTEA 4ECSA 1A7GE 2COLA 2W8KA 1FCAA 3DLEB 4KFBB 3M6VA 3C66A 1SL0A 2UUCJ 5DZ6A 1G1XA 3H4DA 4I67A 1AA1B 3RBEA 5E3RA 2Q6CA 2F63A 2AGPA 3HHNB 2OEJA 2WB1D 1HQ2A 2NXUA 1D8YA 1EJ7L 4FXVA 2YX1A 2F1FA 4WTOB 4WFYA 3RRGA 4CO0A 2CJXB 2IBKA 1OYDA 1CJUA 3PRBA 1FE0A 3RG6A 2XS7A 1F5AA 2MLYA 4LR7A 3QRPA 1VQSA 3DKDA 3AA8A 4NLYA 2GHWA 1NKCA 3WDOA 2JZ5A 3WBZA 1RADB 1FTCA 3MCSA 2BM0A 5ETQA 3J7ZT 4WPAA 1X9WA 5GVQA 3MFHA 3HI9A 4F4XA 1N5YA 4I7FB 2DBBA 4LF6F 3PJ9A 4KGZB 3MGJA 1Q82T 3I9ZA 4UOHA 4O23A 1SV5B 2HQ3A 1TL3A 4HACB 1UFKA 2M3DA 3IBCB 1SIZA 5F8HA 4FBUA 4W90B 3H25A 2A1BA 2X3DA 4J91A 4ZDNA 2ZJQQ 3OR1B 2B5JB 4OYIA 3AD8C 3M8SA 3C2PA 1T9XA 2OD6A 3H2LA 3V4IB 2QA1A 3LALA 2BE7D 2PD1A 1RQ0A 4WE1A 5K8PA 3GIJA 3PW4A 1M1GA 5DDQC 4JI3J 2XLIA 1QVGR 1VQPS 2ILYA 2J6TA 3VAJA 3BR8A 1FI4A 1YRUA 2R7XA 4P71A 5DDPC 4N8OA 3PRVA 4FKXA 6AT1B 1NJWA 1HD0A 1XC9A 4IH7A 3KK1A 2HGLA 3T1HF 4B9LA 2KXNB 3AJ1A 3VAIA 4FZVA 1B70B 3IFEA 3IWXA 1DJ0A 2ADCA 3R27A 3SCIE 2C42A 2ZNYA 4QZVB 4U95A 3SEOA 5D8HB 4Q45A 1SQFA 3MEKA 2K8GA 3CJKB 3AH6A 5HVHA 4RUBA 3Q24A 5DLFA 1S6QA 5F8MA 1N32J 3T5JA 1XJWB 4WP9A 2CQ4A 4ZKAA 1SL2A 4A46A 1RTJB 4IFVA 4AE5A 8RUCA 1IKVA 3PG9A 2AGQA 2YKPA 3I4PA 2XHCA 3T6BA 4F3QA 4DR3F 2UP1A 4F0KA 1RBOB 1NCLA 1S9GB 2OO4A 3MR6A 1SJ4P 4C4WA 5F3ZA 2CNOB 5IFMA 2IIHA 4N56A 3QSYB 2LA4A 4K2XA 1SKUB 3IRXB 4F25A 2GQQA 5D3GA 2NQPA 2EWHA 2ZHAA 5KOWA 4IRDA 4RW4B 4IDKA 5AXMA 4QPXA 3W62A 4K4ZA 3IMQJ 1WG1A 3QSIA 3GILA 1HQUA 5HBMA 3N5BA 4DR1F 1PJ6A 1S7IA 3G2XA 3MM5A 1F0XA 3IA0A 3N79A 1S97A 1JJHA 3NS5A 1MW7A 3O6QA 1Y10A 4ZLJA 2RQCA 2YWHA 3GIRA 4D3HA 3W61A 4FF3A 2KZMA 2OPQA 6FD1A 2XMTA 1NPRA 4RPFA 3QQCD 3SDEB 2CJYB 2KJWA 1XTZA 4RUAA 3JSBA 5C25A 2FJXA 3E01B 3GWCA 5DZ7A 2ZBQA 3MMBB 4NWBA 2RRAA 4N47A 4CZCA 1HBOA 1K44A 2R7WA 2JC1A 3GYXB 1X4DA 4R0EA 5AXNA 2ZUAA 3CDUA 3M8WA 4LSZB 5F9LA 3X1LB 4OMFG 2NYHA 1QE1A 1NZ8A 1HBNB 4LR9A 3BSCA 3S7RA 4DQRA 2OIHA 3CC4S 1WC5A 1OWXA 4LREA 2FC8A 1Z1ZA 2QG9B 2W4DA 2GHPA 2NS1B 2V34A 3DLKB 5J1NA 2HAIA 5D77A 1NDCA 2V68A 4RNHA 2VFSA 2MEWA 2C28A 1QJHA 4EZ9A 4MT1A 3ZTOA 2DPIA 1YIJS 4NMXA 1X5OA 3HULA 3W3SA 1VGYA 1PJ5A 2PO4A 2PSZA 4PXDA 2HS4A 5ETVA 5J1EA 1NDKA 4G6VB 1K1SA 3QJJA 1YJNS 1ZZFA 3CO0P 1C4AA 2ZZNA 3C8YA 2H65B 4NEYA 1DTQB 2DPJA 3P3DA 1IM6A 4OJHA 5KFWA 3LWMA 1VC0A 4JYAJ 4PEOA 1HL6A 1FFGB 4Q2MA 1FX4A 3FZ2A 1WKJA 2EG2A 4HT5A 4ZP8A 1GQEA 3TYTA 1WKKA 3PXGa 1M5KC 4E2FB 4FF4A 3T1YF 3HHDA 1DZ5A 4F4KA 1DQAA 2WRMA 4P72A 2MGZA 1N36J 1S77D 4RNFA 1HNVA 1QM9A 3HVRA 3Q2TC 1C4CA 4M5NA 2K3KA 4GC7A 4UZBA 4I6WA 5HK4A 1H38A 3KDOA 3K8WA 4WZQA 5IT9U 2DD8S 4KC5A 1J5OA 4CTAA 1RTIA 4WTYA 4RJVA 1MMDA 4KRWA 4YEAA 1K1QA 1FT8A 2IDLA 4M5DB 1Q95G 1F5CA 1GTHA 3D67A 2KDOA 3FK4A 1FX2A 1B99A 3UNYA 4YQWA 3VGSA 2W9BA 2UUBJ 3A4TA 4DOZA 4YOEA 3DGPA 1YI2S 1TK0A 2B6AB 2YH0A 3CTRA 5IT0A 2CG4A 4NZ7A 4E0DA 4W92B 4HI2A 3MWBA 4QWBA 2JRSA 3I0SB 3IR7B 2W4CA 2HZAA 4LRCA 5LT5A 2FPHX 2G2OA 3Q0AA 1RKIA 3D68A 1NHVA 4XO0A 1UWBB 2W9BB 5C24B 4QBUA 1VCTA 2YKAA 4ECVA 3ULHA 4KPCA 4K4YA 3VVUA 1N56A 4EMDA 3HVAA 4JI1F 1EAYC 3MEDA 3DHXA 1HBNA 1N33J 2NSBA 1QE1B 2MKHA 5CAAA 3D0GE 4QJVA 4B3RF 2QMXA 2EK6A 2WAQD 3CW2C 4JUZA 3TZWA 3K5MA 3U02A 2MHEA 4L73A 4LRAA 4FVCA 2DR7A 4LFBJ 4LFAJ 1R0BG 2EBEA 4QR2A 5AE1A 3AT1B 3FVYA 3OQ2A 2BE2A 3W9IA 4Q5VA 3DXSX 4Z7YA 1JB0C 1Q0NA 2OMLA 2ZOGA 1EETB 1RWPB 2CAJA 1TUVA 4NYPA 3SFUA 3M8ZA 1SUQB 2GNKA 2EK1A 2VG6A 4USUA 2OPQB 1PBUA 2J0XA 4IOCQ 4PQUA 4IOBA 3B54A 1TL7B 2CYYA 1UZHA 2KM8B 4WZMA 1R8HA 3V6DA 4TYAA 1G7CB 2DHXA 4B3RJ 1D1UA 4C0BA 3GR0A 1TKZB 2CDRB 3R9LA 3AOAA 4CLZA 4RBVA 1PAUB 3DRYA 4KO0A 3KHRA 4LFAF 2AX0A 2MHNA 3MEEA 1RHMB 2ZH3A 1QAYA 1HBUA 3M05A 4HTJA 4ZIWA 3DLBA 2M7SA 4NLVA 1REVB 3GG1A 3SQOP 3BQ2A 2J76E 3R5JB 4DR6F 1RT2B 2DEIA 3D9BA 4YP3A 2XZDB 1S99A 1C1BB 5BXIA 3DOKA 1TFWA 1CULA 2BXJA 2GJFA 5DETA 3MAHA 2QFIA 4YDDB 2OJ3A 4QWCA 1EHWA 4JI8J 4EU0A 1PIEA 5BJRA 1FWPA 2E9ZA 3KHGA 3C14A 2W2QP 3MPVA 4J5OA 5L1IA 3UD3P 4U9RA 4JP8A 4C3KA 1MLAA 2EFQA 2JEIA 1KC8T 2KRBA 2CJ9A 1BMQB 3IRXA 2VQEF 4CLYA 1OS5A 4MKBA 4RW6B 4CNYA 5CYQA 1KEKA 2OAUA 3NNCA 3H7HB 5GAHU 5C42A 1WI8A 3KDNA 4ZN3A 3HZGA 4OV1A 3PACA 2Z2YB 1OY6A 2YKOA 4Y3CA 4TKTA 5HBMB 3ADAC 3PR5B 3RB6A 5KG4A 1X9SA 1EKRA 2ABYA 2XWXA 3NCQA 3SI8A 1U47A 1NK0A 1HNVB 1REVA 2E1PA 4CDIA 2AU0A 4DFKA 1VQYA 4ZLLA 5D6GA 1Q7LB 1Y5NB 1QTMA 4ZPDA 3LA0A 4DCPB 1S48A 4DPUA 3GIIA 3AY0A 3HSZA 1KONA 1RTDA 4O3QA 4JI7F 1T03A 1QSYA 1FFSB 5ETKA 5KFPA 2HWTA 3MTJA 4OYBA 3WC2A 1Y11A 3IGNA 3LQVA 5CQGA 4WU3A 1YQHA 2C2KB 3ZZOA 4GC6A 2BKNA 1KLMB 4MIAA 4CT8A 1N48A 1BC6A 1T11A 1IWAA 4UQTA 3BH7B 2MY8A 1WHXA 3H5SA 3IAM9 3M6UA 4DV7F 2VFRA 3KJQB
chains in the Genus database with same CATH topology
3V6KA 1RWUA 2CVEA 1ZPVA 2I8EA 1Z2LA 2XI3A 3T6JA 3PDNA 1VRTB 2IVFB 3UDLA 3KMSA 1U49A 4WFZA 3E51A 4OI3A 4KJIA 4JI2F 1K73T 3M6WA 2LXIA 3UDCA 4WE1B 3MMBA 1UAWA 4OIXA 3UW1A 2VPWB 5C25B 2KFZA 2AJ4A 2FHJA 2I5JA 4MYUA 4IQXA 5KFLA 2HYIB 5CHCB 2RQKA 1NHUA 1D0EA 2HQIA 2BA9A 2ZDOA 2YKMA 2DHSA 3ISND 2OSRA 2JLGA 3MR3A 4EO8A 3UPFA 1LXJA 4DUZF 4DV4F 1WG5A 1VQLS 2WBRA 2I2YA 4MMOA 2CRLA 5KFZA 2KFYA 1VQMS 1UVJA 4H4KA 3G6XA 1HMVA 1PO6A 5FD1A 1R0AA 2CKWA 3OV7A 2KB2A 4XDCA 1T02A 3EGZA 2R2UA 1Q86T 3K0JA 3M32A 4G1QB 4R8UB 2AP6A 4C9DA 1RKJA 3CUNA 1CSJA 4M63A 2HHPA 1RT7A 3AJ2A 3JTPA 1WEYA 2FJEB 1E6VB 2CQDA 2I5JB 2VFVA 4NLOA 5KFTA 1L3UA 3MECB 3RR8A 4KV8B 2B43A 2EKYA 1L3VA 3FQKA 3BQ1A 3TARA 2BQRA 2L9NA 3N4WA 1V3SA 4X84A 1ULRA 2HFZA 1FA0A 3MMAB 2O01C 2RE1A 2W9CA 1TL4A 4OQJA 5C5JA 3DI6B 1T05B 2KG0A 4FYDA 1UMJA 4WK3A 4A47A 1SH3A 3EPGA 5KFUA 3D1QA 3ETOA 3EXYA 4ILLA 1UFLA 1XR5A 1DLOA 3JYTA 4DSLA 3VZIA 2BABA 3H5UA 3CCMS 4DFJA 1UJ4A 5DQIA 4UUWA 3LP0B 1L3KA 3DMJA 4KHMA 4RW7A 3T1AA 2Y1JA 5HMYA 3R5BA 4J9QA 3UCUP 1UVLA 1S1XA 4PG7A 5HN0A 2Z2LA 3UCZP 1JK9B 3IG1A 1MNEA 5JVGQ 3NGDA 3OVAA 2DJWA 1PGZA 2VBWA 2LMIA 2XMKA 2NREA 4NCGB 4F26A 1SC6A 4AL5A 2MKIA 2LEBA 1VQ9S 1YBAA 1ZTWA 2ZHBA 2FLOA 2HVHA 4KIAA 1HWLA 2HHHF 4O44B 2J7KA 4RW7B 4C0HA 1JLBB 1JNZB 1KHWA 3HP6A 1U48A 3H5XA 1KSPA 4DL2A 2OD4A 1VIOA 2IJFA 2KHCA 2EPIA 5EN1A 4RW6A 3KK3A 4YR2A 1RYRA 1DURA 4I69A 4NPOA 4F50A 4F3OA 1VQKS 2FIUA 2LXUA 2VA2A 1MROA 2B9XA 2RVJA 2ZE2B 1CLFA 1RI7A 3GG0A 4GMKA 4IKAA 2W9AA 2BQ3A 4X4OA 5FDLB 3KLFB 1XMOF 4B9VA 2C2EA 3MECA 4MJKA 3HXMA 4RW8A 5KG6A 2OPPA 2IBOA 2OPSB 2X51A 3MMCB 5DGAA 2J7WA 3IR6B 3UWTA 3DLJA 4P2SA 4MIBA 2K7JA 3KK1B 3DM2A 1SQEA 4O4RA 4D3GA 1C0UA 3MOZA 1IKWB 4B3OA 5KFEA 2MQPA 5L38A 2IFXA 1G3OA 4NXNF 3TX8A 3DRPA 2CDQA 1V3ZA 3M2RB 4RUHA 4EEYA 1HMVB 2NLWA 3OLBA 1RT5B 3DRSB 5JVHQ 3NMAA 3MZIA 1WHWA 2VBZA 4ZPCA 1GAOA 3CCLS 5A8KB 3H2VE 4RNOA 5SUHA 3SMZA 1UVIA 2GMLA 2FVPA 2AJ1A 3ZZPA 4RKUC 3FSXA 1S1TB 2JLFA 2V8VA 3P6YC 3H8YA 5L1KA 4N76A 3BEGB 3CD7A 5I4MA 2N4DA 1H2VZ 1QSSA 3CJ0A 2D3ZA 4HVZA 4WU2A 2LQ5A 4BC7A 4YB1P 5L1JA 5G0RA 2A2DA 2YQ3A 5B0BA 1H0HB 3TUZC 3FEXB 1X4CA 1MU2A 1L3TA 2ZD1A 1O8BA 1APSA 5KFBA 1U2FA 2BUNA 5HMXA 4I56A 1NU4A 2M8HA 4NRTA 2HHSA 2L9DA 2WSCC 4I64A 2W7OA 5CH7B 4LF9F 4B02A 1Q79A 2BYCA 2DNYA 4MFBA 1M90T 4A8XA 4N8NA 3JB9k 4B17A 3NCRA 4FPRA 4OZJA 1HW8A 4OHZA 2R7TA 3BQ0A 2SXLA 4EBEA 2AWZA 3CD0A 2QLXA 4AL6A 2GA7A 2RKIA 2ZH1A 4LF8F 5IQQA 3DRRB 1FNXH 2RT3A 3DXBA 4ZVHA 4PWUA 4IRCA 4ID5A 4JI3F 2Q79A 4OHXA 3MUMP 4OFZA 2XGQA 5J1PA 2CZVC 3TR5A 2MMYA 3CDBA 1KQSR 2KJVA 1XR7A 4NLPA 1Y5LB 3POTB 3CCTA 5M2UA 3TP2A 1DHMA 4RU2A 1PC4A 3RB0A 3PEHA 2XGPA 1KTVA 1JJ4A 4UOCA 3W2WA 2M0GB 3G71S 1S1WA 2RMLA 2G0CA 4CI0B 7FD1A 1G6BA 1EP4A 3RB4A 1R7IA 4USIA 1RT1A 3GB0A 1FRLA 3M8PA 3P96A 4JI0F 2ROEA 4K4WA 3U1LA 2YKMB 2CJQA 3QJLA 3BJYA 2WW8A 3QIDA 1IQZA 2MGZB 1HBMB 5L39A 3PR4A 4ED0A 2RILA 2FVQA 2YNGB 4B9MA 3UE2A 2E9RX 2FTRA 3M1VB 1UETA 1BQMB 1TKTA 4EYHB 2MZ1A 1K8AT 3BGFA 5EWEA 2V4RA 3LAKA 4NLDA 1VQ6S 4B9NA 2XB2D 3MMCA 4F8RA 5KFOA 1URNA 5HLFA 4DL3A 2DR8A 1RTIB 1M5OC 3MEGA 4NLQA 4RWWA 3U1NA 3HPOA 3PX4A 4JV1A 3DOLA 3FFIB 1F5BA 1HBOB 1OQ6A 5DQHA 2DISA 2QLWA 3THPA 5EHHA 3G6VA 3TAPA 3DRXA 1S0NA 1O51A 4OL8A 3QAEA 3GYNA 1QY7A 1NK8A 3GR1A 2C3MA 3OL7A 5K8NA 2J5AA 3DLKA 2DR9A 3KG4A 3PHEA 3JSRA 1ZM2A 5H9FJ 3TOQA 3JSMA 1JLBA 3UR3C 3G9CA 2UV8A 2KG1A 3O1LA 2E5GA 3BDEA 2P9CA 4B9UA 1FF2A 5LXYA 1FHTA 2LYVA 1BD6A 1JLAA 1YJVA 4ZP6A 1EETA 2VL1A 2WONA 3V2UC 2VA3A 2UXDF 3PJWA 3FZBA 3AQPA 2IA0A 1Z4UA 4UQGA 4NRUA 3UR0A 1LK7A 5CZXA 1RT5A 2L9WA 3DRSA 3OBIA 4C11B 4DBQA 3OTDA 2IYGA 1LWEA 1TKXA 1Y3KA 3CJ3A 1H6KX 4QIWD 1EP4B 1O0PA 3OPKA 3U7JA 3BGRA 3UQSA 5B09A 3SYZA 4C8LA 1ZM3A 2OFGX 3IGVA 2EG1A 3FSYA 2HMIB 3MM8B 1SKWA 1D9AA 1UJ6A 3MPWA 4C3MA 1I6JA 2LQBA 1JJ2R 1HQEB 2YNGA 5M2PA 1RTJA 4IFVB 2DNMA 4OZNA 1CPZA 1D8ZA 1IJEB 1Q1KA 4ED6A 3VQSA 3CCES 4RW9A 2MQQA 3DOMA 1DFDA 1MSWD 2DNHA 3MMAA 5HMWA 1JLFA 3HO1A 4LSNB 4WXOA 3R1HA 1HWUA 3S6EA 4QR0A 2UVUA 3CGIA 2MY7A 3Q8RB 5AXKA 4BS2A 2RU3A 4F4WA 2F8MA 4DWIA 2PGCA 3IC1A 4F4ZA 4DS5A 4DQSA 1VBYA 2VPZB 1FEHA 2VZ9A 1X5SA 3ITHA 3HHLC 1P27B 3KFWX 4B08A 2C22A 5CYMB 4UY85 1FRMA 2E29A 1OPZA 2QIFA 3NMRA 4NYOA 3M8PB 5LSLA 1RT4A 1XNRF 2J8AA 2MKCA 2JFDA 3MI7X 2BANA 2D7SA 1S0OA 4ELUA 3KLIB 1HYSA 4L72B 1NK4A 5KFNA 1Y9OA 1GT8A 2HZCA 5D78A 5K9FA 1N33F 3RAQA 3SFGA 2X1GA 5FLXY 2GGPA 2LKZA 4PKDB 4ECWA 3KHLA 2YH1A 4DQPA 3EZ5A 5CXTA 1YJTA 1W25A 3DDKA 1HD1A 3M8RA 4ZLPA 2HNYA 3V6HA 2VC1A 4Q8EA 3PFEA 2DT9A 2JOQA 2ZFHA 2PDAA 1BQNB 1VQ8S 1X5TA 4IH6A 1N6QA 2POKA 2HNDB 4QR1A 1SL1A 4X4UA 3US5A 3I9V9 4PG8A 2KVIA 2JL9A 2D74B 2K1RA 3PW5A 1FXRA 2B9YA 3HVWA 4DL0C 2QA4S 3KLGB 4K5RA 1N0UA 3G4SS 4QIEA 2ZC3A 1XMQF 1I1GA 3KJVB 3LOUA 4DN0A 5A0YA 4ES3A 3DM2B 3NBPA 5KFFA 5HROA 4HL9A 4OZ0A 2LDIA 4LQ9A 3EGNA 4I2PB 2XMMA 4URGA 1IKXA 1VQ7S 1NJXA 2DO0A 2R8JA 3PFOA 1VQNS 2DIUA 3PW7A 3PX6A 2W4PA 4DSFA 1YVFA 2M9KA 1OPIA 4ZS6A 4USHA 1N34F 5DLGA 2LQ9A 4NCAA 4ED7A 4PG5A 2IRXA 2R7RA 2VFTA 1HPZB 2YWEA 4ZPAA 3CSKA 4EWTA 4P7TA 1KFDA 2RUGA 1FRKA 2GC8A 3PEJA 4TXSA 3ITHB 4KFBA 2FUG9 5D4OA 2KI2A 4G1IA 4Y2KA 1A9NB 2DGVA 4IYQA 4DMZA 1KVJA 4FN5A 1RT6B 4KQZA 4QWAA 2F7VA 2CPIA 1LWFA 3QAUA 3THTA 2F9JA 1U4BA 4OZ5A 2HNZA 3DFEA 3KLFA 5GMKa 3BO2A 4A8QA 1V3RA 2N82B 7FDRA 5EWFA 1X4FA 5K14A 2OFHX 2P5VA 4A8WA 4F2SA 3GV8B 5B0DA 3V81A 2CJBA 1DTTA 4NLTA 2OPSA 4X4SA 2BQUA 3KG0A 4H4MA 3FRZA 4MKYA 3CO9A 3NBPB 2UVWA 2AJ0A 3B82A 4AUKA 1FEEA 4OX7A 4AXJA 3OL8A 1BLUA 2CPDA 2FLNA 4X4QA 1JKHA 3NG8A 1SH0A 2H5EA 2K2PA 1HNIA 3F41A 3GIKA 4ED2A 5KG3A 2C3YA 3U1MA 3B8HA 3THVA 1CC7A 2ZH4A 2UXCF 3CJ2A 3OHAA 1H3DA 1U1LA 4BBYA 2LLZA 1K0VA 3KK3B 3IAS9 4Q44A 3QO9A 1N5VA 2V8HA 2ZVSA 3LW5C 3ZZTA 2B3TB 3VF0B 1ZPWX 4H54A 1U8SA 1FXDA 2XBPA 1N88A 1Y00A 2GCFA 4I1TA 5IXUA 1DRZA 4OX9F 4X4RA 2CIMA 1MMLA 2R7UA 3TA1A 2CPXA 3J7YI 5J2MA 2ADBA 4DG1A 5KT6A 1TK5A 3V81B 3CD6S 4CNZA 2F9DA 5KG2A 2QEXS 4Q0BB 5J2NA 3DDNA 4E98A 1AROP 3T9NA 5GAHI 4KTQA 1WEZA 2IVMA 3QO9B 2PMHA 5KFHA 3PW0A 2VODA 1HPZA 4FS1A 1ZBTA 1RISA 4ZVFA 1HW9A 1Q8BA 1WEXA 2J9DA 3Q23A 3TAQA 1YWXA 3RAXA 2G4BA 3MM9B 1R31A 3MM7B 5DRKA 2QSFA 3M9NB 2VG7B 3TVYA 1UA1A 2XY7A 4IG0A 2N7YA 3J81Y 3QLHA 2EFNA 1SBRA 2CPFA 2GIQA 3NAHA 1IKXB 4DL5A 2QA2A 3X3UA 1BQNA 1P1TA 3VAHA 3LUYA 4GO5X 3M8QB 1JXEA 2PFFB 4R25A 2IM3A 4K59A 3D1HA 1WELA 5K14B 2LECA 3VAFA 3BN4A 4CO3A 1NB7A 4ECYA 2XG8A 1W2BR 3HVTB 2OTLS 5HO4A 1QAIA 1FDBA 2G9OA 2HNDA 3IWLA 3MM8A 1X7VA 3DOKB 3DYAA 4IG0B 1FKOA 4ZCMA 2B56A 1UEVA 2HGNA 4KHRA 4WK1A 5JXSA 2N4CA 4N56A 1U1PA 3I5BA 5IT9Y 1U1QA 1T7PA 3H5YA 4FF1A 1S9EA 5D4PA 2MZQA 2NPIA 4KT0C 5IT4A 5IM0B 3LO3A 2E9TA 1ROFA 1GNKA 1VI7A 1U26A 5K8MA 4KO0B 4DQQA 5KT7A 4IFYB 4PR6A 2UV8G 1KVIA 4NLRA 1HR0F 3TNVA 4I6YA 4YY3F 3S1TA 3CIZA 4OHWA 2HFNA 5F41A 5GAGI 3KNGA 1VC5A 1FK9A 2VPYB 1FE4A 1H7WA 2KRRA 4A8OA 1IBKF 5KFVA 1RTHB 5HL7Q 1RT4B 3KLEB 3VWSA 2JEGA 2CPJA 2O5DA 1SI9A 4DR5F 5E41A 1KQKA 1U24A 2M8DB 1ZAXA 4TQRA 1CQMA 1H7XA 3MHYA 3DLEA 2JC0A 1IQTA 3NLCA 1WHVA 3MEDB 1JLEA 3K58A 5DM7Q 2QV6A 3SCLE 5A8RA 2RF2A 2ASDA 4C2MA 1JLFB 4LF4F 2HG4A 1FJCA 4Y28C 4XAKA 2ZKUA 2EFVA 4DSEA 2ASLA 1M1KT 3C6TA 3HT3A 4YMEA 3BS9A 2NPFA 2XSJB 4JV0A 5T14A 4DF4A 5I42B 4DPOA 3MURP 4UUXA 3H4BA 4Y2CA 3KWMA 4ZHRB 3DLLQ 2HHQA 3RR7A 4K0KF 1U6ZA 4Q2LA 4X66F 3C6UB 1QAJA 4FP9A 4RW9B 2JEFA 2ZOMA 1NK5A 2HNZB 4DV6F 5I3UA 3ZC4A 4AQYF 1HQUB 1OIAA 4X65F 2HLTA 2MJNA 4AYBD 1YRXA 2E5LF 3PRDA 3VAMA 2KKHA 2FJVA 4JI4F 2V9WA 3DLGB 5BR8F 2PMZD 1SJ3P 2B51A 2LQJA 4X64F 2CJAA 1JMTA 2I9SA 5ITHA 2V2KA 2HS3A 1X0PA 3CCWA 1F9FA 1YG0A 2JWNA 2YWGA 3GFXA 4DR7F 3DHWC 3I0RA 2W7PA 4F4YA 4MAKA 3C6TB 2J9DE 4JI6F 3RYLA 4DDFA 2E1MC 4ID8A 3LGNA 1KQFB 3KLVA 2AV5A 5KAKA 4ITSA 1C2PA 4Y2IA 4LF5F 2ZH8A 2VOPA 3F56A 1KNZA 2Q3PA 2YNFA 3H98A 5T7LA 3BR9A 3VQTA 1Q8IA 1VQOS 1RT3A 2KXHA 4LT6A 5F3TA 5LJ5Y 3MEEB 3IXQA 2YNHA 2RS8A 4IO9Q 4MKAA 4ECUA 3DLGA 3TI0A 3I32A 3CWJA 4MFBB 4IO1A 4MTPA