5D4YA

A psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
331
structure length
314
Chain Sequence
QGLKDAYKDYFKIGVAVNNRNVADPDQIKVVLREFNSITAENAMKPQPTEPKKGEFNWEDADKIADFCRANGIKMRGHTLMWHSQIGSWMYQGNLLSKEEFYANMKHHIQAIVNRYKDVVYCWDVVNEAVADSPVYPGRPELRNSPMYQIAGEEFIYKAFEYAHEADPDALLFYNDYNDAEPAKSQRIYNLVKRMKDAGVPIDGIGMQAHYNVYGPTMKEVDDAIKLYSTVVDHIHLTELDIRINEVSDWERTLQQDQYVQLFKVLRKHKDVIDCVTFWNVSDKDSWLGVRNYPLLFDENYKPKQAYNAVKNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase
publication title Structural insight into potential cold adaptation mechanism through a psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase.
pubmed doi rcsb
source organism Environmental samples
molecule tags Hydrolase
total genus 120
structure length 314
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5d4yA00
2ZXDA 3SCPA 1CGTA 1QI2A 2B31A 1FA2A 3ALFA 1OIFA 4GO8A 1UA3A 1ITCA 1XV8A 2UY4A 5I3DA 5A2BA 4QCFA 2V3EA 3MSGA 2WHJA 1AQMA 3VIJA 1W2PA 3VPLA 1R87A 1FFQA 2XUCA 1OGBA 3OB8A 4W5ZA 1QNRA 1W3LA 3L4WA 2XYLA 4FF5A 3PZNA 1LL4A 1B3WA 1FHDA 2CKSA 4GO9A 1VB9A 1R7AA 3O6AA 3CUJA 2G3NA 1OD0A 1QHZA 3CHCA 4B16A 3ZM8A 4J28A 4Z2IA 2VTFA 5DF0A 1C91A 1TVPA 1W9XA 1CDGA 2IXVA 3CZKA 1XCWA 4TTGA 1W3HA 1CEOA 1CTNA 3NDZA 2VQUA 4PTXA 2G3JA 4HMDA 4JKLA 3ARXA 5I5RA 5BCAA 4TVUA 1JYWA 4TX8A 3UG4A 2O9TA 2YJQA 3CGTA 5A95A 4H8UA 3VUPA 2J74A 2OSWA 1J18A 3N1AA 5I2UA 3F5JA 2HISA 1UD2A 3VGBA 2WC3A 1UR1A 5A6LA 2YDSA 2ZUVA 1LL6A 3UR8A 5LA0A 4PYSA 1E6PA 5E70A 4DWSA 2VX5A 5HXMA 4WF7A 2D22A 3WNLA 2Y8VA 1UWRA 2WWCA 5AC5A 1M53A 1VIWA 5D9MA 3KL0A 5E0FA 1J9YA 7A3HA 3MU7A 2CERA 3AQUA 5CGMA 3MMDA 1UD5A 1BVZA 5BXTA 2PWDA 5ABHA 3DYMA 2D3LA 2ZUSA 1UKPA 4XV0A 1EA9C 1UWSA 5FD0A 4JAWA 2DSZA 2YLAA 2CYGA 2XVPA 1V6UA 4UFHA 3MKKA 4JL1A 2DSKA 5A8NA 1H4PA 1EQCA 1WZLA 3AHYA 1JXKA 2JEQA 5C70A 4J3SA 1W1TA 4ZE4A 1UKSA 2YL6A 4U3AA 4EK7A 6A3HA 4EE9A 1W91A 3GYCA 5A2CA 4IM4A 2CCRA 4PN2A 3K8MA 1W1YA 2J7GA 1XH0A 1E0WA 2CBVA 2VJXA 1ZJAA 2X0YA 3RPMA 4AZCB 1B0IA 4E4PA 1BYCA 1XCXA 3TA9A 3GNPA 2BHUA 1V6XA 4W8AA 4OBRA 2WMHA 2Q8XA 5AYBA 4C7FA 1FH8A 2QLYA 2W62A 1E70M 3A47A 5A6KA 2J8FA 5F7UA 3WKZA 2WHKA 3VGHA 3HU7A 1BPLB 3GXDA 1XHGA 2WXDM 3TOPA 2VL4A 3ARPA 1JI2A 3VX1A 1R85A 4PCTA 1OD8A 3RCNA 3GXFA 3CTTA 3O9NA 3KEHA 1HP4A 2WWDA 1C8YA 3LPGA 3FNDA 1HT6A 3VMOA 2VC9A 3W0KA 1XYFA 4W86A 5A6MA 5BROA 2BVDA 2QMJA 2E0PA 3AOFA 1O7AA 3CZLA 4NI3A 1A3HA 2E9BA 2YBTA 4AD0A 3B8SA 1Q6GA 3B9DA 4GZJA 1RPKA 4DM1A 4HOWA 3RIKA 4HU8A 4P7OA 4H2CA 1UWQA 1CIUA 1XD1A 3VDHA 2XTKA 1EDQA 2WKLA 4A3YA 3MV01 4HA4A 1HNYA 4N0RA 4W7VA 1KQYA 4GZEA 2DT1A 5GQBA 4ZFMA 4CVUA 1JDDA 3QOKA 4TOQA 5E0CA 1WCGA 1UOKA 2D3NA 2UY3A 4JKMA 3L4UA 1IT0A 2UY2A 3WH6A 4AZ5A 1CXIA 3MANA 1ODUA 3WDIA 3W6LA 2DGAA 4U33A 3CPUA 1YQ2A 5A6JA 4MB3A 8CGTA 1UHVA 2V5CA 2VZVA 3IAPA 3UG3A 3SEPA 1XRVA 1BQCA 2E8YA 4D6GA 4YN5A 1UKQA 3VMPA 2YLLA 3KWXA 1JF6A 1RH9A 4ACYA 3WF0A 1VFFA 2Y5EA 1M03A 3ZIZA 1ZJBA 1EDGA 2J7DA 1J11A 4H8VA 2NW0A 2RGLA 1TA3A 4OJYA 3FHAA 2OWWA 2YDRA 2VURA 2NSXA 3CIVA 2DH2A 1VF8A 2XWDA 2WMFA 4P7QA 3AMLA 3WD3A 4HZ7A 4M56A 1ZL1A 2XVNA 1HIZA 2VZTA 1QNQA 3K4DA 1UD6A 3BLKA 1HJSA 4GXPA 1B1YA 1EDTA 4JZ5A 3U7VA 1PZ2A 3BAXA 1J0YA 1VFMA 4CD4A 1OM0A 1E1FA 2FHCA 1V02E 2D2OA 2DT2A 4E2OA 3WDHA 1V03A 2YIHA 4MJ4A 5E09A 3IANA 5BWFA 1E71M 2JFEX 3AMGA 4PTVA 4TTUA 1F4HA 5JUVA 1NWTA 1WP6A 2IXUA 4W7UA 1HJVA 3CUGA 2FDMA 2EO7A 1MW1A 4GINA 2XFRA 1KXVA 1GJUA 3MV11 1H5VA 2Y8KA 3W82A 2J7BA 3VD4A 4JFVA 4N42A 3WF2A 4CUCA 3MUAA 2TAAA 4AW7A 4KWUA 1CBGA 2A3CA 2W66A 1KGXA 4IPNB 4Z2KA 3POCA 1CGXA 3ARVA 4J27A 4GPNA 2G4FA 2V3FA 2X1IA 3K4AA 2PWHA 4UQ9A 5JBFA 4QFUA 3VM7A 3ARUA 3VKKA 3N17A 2A3BA 2Y2WA 4CD7A 1MW0A 4MNKA 3BXWA 4CN6A 3WD2A 4X0NA 2CKRA 5ABGA 1G5AA 3PZUA 1JF5A 1B2YA 3ZOAA 5A6BD 3ZJ7A 1V6WA 3VX0A 3CBWA 4PSRA 2OYKA 4OUEA 3T09A 4GI6A 4ZE5A 2YDQA 2VI0A 2RGMA 4UFMA 2WZEA 2X05A 1QW8A 1BYAA 5DEZA 3K46A 1MFUA 4UQBA 5IFPA 1VEOA 2ZICA 3BMWA 3VILA 3CHFA 3ZT7A 6TAAA 4S3JA 2Y4SA 1VENA 1VAHA 2WMKA 4HP5A 1J0JA 3L4VA 2GUYA 4XUYA 4AIUA 4CD5A 2XWEA 2J8GA 3W29A 2O92A 5CLWA 2J7HA 4BQ3A 2YL5A 1GCYA 1PX8A 1GHRA 3AS2A 2XVLA 4BQ4A 1MQRA 3T08A 1KBBA 5CG0A 3VGGA 1HVXA 4KRUA 1I75A 2XGBA 4HZ6A 5BXPA 3PTMA 4PUDA 2J75A 2J25A 2FH8A 4UFKA 3BGAA 4GQQA 2CNCA 1QI5A 2D1ZA 4PSPA 3WD0A 1FP8A 4JKKA 3F5KA 1MW2A 1E0XA 3T0BA 3VIPA 2PF0A 2E40A 2DQXA 3UR7A 3HN3A 4UQEA 1UR0A 4UQCA 4H04A 1EHAA 1QBAA 3UERA 4R27A 4KGLA 3RM4A 1W32A 3AXHA 3AIUA 2J78A 3WFLA 3CHDA 4M81A 3QHMA 2WVUA 3BCDA 4HMEA 1XSKA 1BVNP 1W9PA 1R8LA 1QNPA 1E4LA 1E6RA 2OWXA 3WMBA 1E6NA 2C8NA 5A6BA 2DSVA 2X2YA 4UZUA 4AZCA 1DWIM 4DUVA 1YHTA 4WLCA 4CGTA 1OT1A 1V3IA 4P8UA 1TUXA 1KQZA 2CEQA 4JCLA 1LJYA 2VCBA 4FLRA 3WEOA 4D1IA 2VNCA 4JHZA 1E56A 4CD6A 1JYNA 3WDQA 1ZU8A 3ZJ6A 4PMZA 3RDKA 4NF7A 2DIJA 3MMUA 2XSBA 1Q4NX 4DWSD 2PWFA 1LF1A 4MJ2A 3LPOA 1J0IA 3I3EA 3VIFA 2VVNA 3WF1A 2CITA 3SCTA 2GJPA 3WUEA 1UH2A 1C7TA 2BXZA 4F79A 2G8ZA 3WY1A 1KR1A 2WHMA 1G01A 1WDPA 2J7CA 3SUVA 3VIIA 3WMCA 1FH7A 1E3XA 2ZX8A 3BSHA 1NQ6A 1AQHA 2G41A 2E9LA 2EPKX 3CHEA 2QMKA 5FOOA 1M7XA 3W26A 4YPJA 2XM1A 5FL0A 3VIHA 4HOXA 1CGVA 4UOZA 1ZBWA 5KZ6A 1E4NA 2EQDA 5LA2A 2ZUTA 3FXYA 5IXEA 2DT0A 3OGRA 3OZPA 2ZWZA 2PWEA 2MANA 4ZXOA 1UYQA 4MDOA 2WSPA 1QBBA 1R7OA 3KL5A 1CZ1A 2BFGA 4HZ8A 3MO4A 3THCA 3OLEA 3BCFA 4W87A 4JHOA 4U31A 3GNOA 2XM2A 4W89A 1ESWA 1NOFA 2D23A 1ISYA 5BRQA 3WL0A 1GVIA 1LG2A 2VX6A 5CGTA 4FLSA 4PMNA 3U5YA 3VDBA 1TR1A 1CLXA 1TVNA 4LPCA 2GDUA 1JYVA 4B9ZA 1SR0A 1TMQA 3VTRA 5E6YA 3N15A 2O9OA 1XGZA 1WNOA 1B3VA 5DO8A 1OCQA 2WBGA 4GI8A 4AD2A 1GW1A 1KWKA 5JIPA 3AHVA 3GBDA 1KXTA 5I79A 2ZX5A 3PZMA 1JIBA 2WYSA 3GM8A 3WF4A 2PBOA 3WUFA 3WDRA 3KL3A 3A4AA 1G0CA 1QI3A 3GBEA 1Q6FA 4UTFA 1L0PA 5BRPA 1EO7A 2XIBA 3ARZA 4CCEA 3VDAA 2XVKA 2CESA 4PMOA 3TTOA 4MDPA 4B3LA 4PMXA 1C3FA 4W93A 4HA1A 3WDPP 5GPRA 2JIWA 2BHZA 2ZXQA 1FFRA 3O2LA 2PC8A 4W8LA 4LYQA 3SCQA 2HVMA 2OYLA 5I77A 4J3WA 2V3GA 3ZSSA 1AQ0A 4AEFA 1V6YA 4Z2JA 2PB1A 1EOKA 3W81A 1U2YA 2J62A 3SUWA 3T0DA 1R86A 3BAJA 1GNXA 4KH2A 4U5KA 2CETA 4CVWA 4EAMA 4WKAA 4E8CA 4V2XA 2WVSA 1E40A 1OB0A 3UEQA 3AISA 1ZS2A 4BQ2A 2WC4A 2WZIA 1BYBA 1PBGA 4E8DA 2WLZA 3AHZA 3AIWA 1UD8A 1XD0A 3RM9A 2Z1KA 1US3A 3VIOA 4UFJA 3W4RA 1CYGA 4B15A 2CBUA 1UQZA 4PRWA 3VNZA 3GH7A 1KGUA 3PZTA 2DSWA 1JG9A 3IJ7A 1Q6DA 1W1PA 3VIGA 2J7FA 5CPQA 3PBGA 1GOOA 3N11A 2Z1SA 1GOMA 4JFSA 3WQ8A 4AIOA 2CHNA 3IJ8A 1FH9A 5M3WA 5LYRA 2VRJA 1QHPA 3AI0A 1UWUA 4WIWA 3BAWA 1XSJA 1J10A 4NRRA 4MTVA 1B3XA 2OSXA 4OOZA 3MS8A 3AICA 1UD3A 3UETA 3W37A 2VVSA 1PPIA 1WO2A 1US2A 2PBGA 1DEDA 3PZ9A 3U5UA 1BGAA 3AROA 1NARA 1E6XM 4IUGA 1V08A 1JD7A 3DYPA 1RD6A 1V02A 1AMYA 3JUGA 1HP5A 3VMNA 3NYDA 2DH3A 1P6WA 1GHSA 1KXHA 3ZMRA 4MNJA 2WHLA 1U33A 1ZB5A 3VGFA 4GKLA 3HMCA 4D1JA 3WQWA 5IFTA 2FGZA 3CMJA 2BXYA 1X1NA 4AWEA 3WQ6A 1UR4A 4UR9A 3DECA 3GZAA 2WMJA 1C7SA 4DM2A 1G94A 3ARQA 4AC1X 3SIMA 4AZHA 3AMDA 3IJ9A 2QPUA 2WM0A 2VT0A 2WANA 3PHAA 3CH9A 2ZE0A 3K8KA 8A3HA 2QPSA 2JF6A 1GQLA 2WVVB 4WJXA 1DWFM 5A6SA 1V3JA 2AAAA 2XGIA 4QLJA 4W7WA 3NUKA 3CMGA 1OGSA 2WNWA 1NWRA 1JXJA 3LPPA 2YL8A 4HU0A 1VJZA 1EO5A 4PMRA 4UCFA 1CPUA 3APGA 1D3CA 3AZSA 1M01A 3IAQA 2W92A 1K6AA 3QOMA 4WSKA 3NSNA 1WDQA 1QHOA 4NZCA 4JFWA 2DPEA 2A3EA 1E72M 2CBJA 4MADA 4ZXLA 1RP8A 1V3KA 1HKKA 1QOXA 4MNLA 3OZOA 4WSJA 3SCSA 1C93A 2WPGA 2FHFA 1TG7A 5JBDA 3AIQA 3VD9A 5A6AA 3ZT5A 1V3LA 4TX6A 4RE4A 5M17A 3CZEA 4LX4A 3SCVA 1H41A 3DYOA 3RMEA 5C8BB 5EMYA 1UKTA 1OINA 1E5JA 2AMGA 1CLVA 1QNOA 4ATLA 5FCZA 5HPCA 5E6ZA 3AS0A 2WCAA 4IPLA 3KZSA 3RJYA 3W28A 4CCDA 3CZ8A 1XSIA 5AYIA 1NM9A 1DWHM 1GORA 4L4OA 4CU8A 1OT2A 3PN8A 1GJWA 2BY3A 1CWYA 4F8XA 3CLWA 2VX4A 2BNJA 4NSBA 4H8HA 1UH4A 1KFWA 4LQ1A 1KCLA 4NRSA 2OYMA 2QV4A 1B3YA 2WMIB 1TE1A 4MB4A 3IK2A 4ACZB 1NH6A 3GXMA 2ZXAA 1E6ZA 1LWJA 4Q22A 3PZOA 4PMUA 2NT1A 3OIHA 3PZQA 4WKFA 3WQ4A 3WFZA 4PTMA 1B30A 1M04A 4F66A 3L2LA 4UNIA 1EGZA 1KR0A 1C92A 5DMYA 3WENA 4JFUA 1QI0A 3RO8A 2F8QA 4ATWA 1CGUA 1GUVA 1VFUA 1OWQA 2VMFA 4AXNA 2VRKA 2E3ZA 4URIA 1TFVA 5CLTA 1UWTA 9CGTA 3E1F1 1HKJA 3L4YA 1WB0A 1E43A 1BGGA 1CXEA 4YHGA 3AHTA 3SUSA 3SURA 3AXIA 3BC9A 4TUFA 2YBUA 3CZJA 1JZ4A 1BF2A 1PIFA 3ECQA 4PCSA 2J4GA 3BH4A 2EEXA 1JDAA 5A3HA 3MUZ1 3WH8A 1OGGA 5AY7A 4AZIA 3FAXA 4BCEA 2UWFA 1A47A 4CD8A 4OIFA 3SCNA 1MQQA 5CJ5A 1RP9A 2F2HA 1WDSA 4HA3A 4A3HA 4BF7A 3EDJA 1TZ7A 4XZWA 5C71A 1UH3A 4TVDA 1JGIA 1E0VA 4FMVA 1B9ZA 3WQ5A 1E5NA 2XFYA 5I6SA 1CXLA 2XJ7A 4AISA 4HOZA 4AD4A 4M80A 3WNMA 4HTYA 1FHLA 4UZSA 4CU7A 5A69A 1F4AA 2JALA 1IZKA 1NP2A 1H0GA 4ML4A 1JI1A 4CN4A 1J0KA 4GZIA 3WD4A 1OBAA 3RILA 4WKHA 4W84A 3WEMA 3PZVA 1W9UA 3D3AA 3OA5A 2ZIDA 1X6NA 2DEPA 1LG1A 2V5DA 3W25A 4V27A 3CUIA 4GQRA 2BVTA 1E3ZA 5IDIA 1H09A 4PMQA 1Z32X 3TP4A 1UZ1A 1ISXA 1O6IA 4M82A 4MAZA 3ZT6A 3WD1A 4OKDA 5FKYA 1TCMA 1QI4A 1H0IA 1MQPA 2VR4A 4AEEA 1EOMA 1QPKA 4LGXA 4U2ZA 4AZGA 2E9MA 2FGLA 2WKGA 1J0HA 3VIKA 3T2QA 2WC7A 1BTCA 2OSYA 3WNNA 3WL1A 3GH5A 4W88A 3GH4A 3K1DA 4FK9A 1G9HA 2VZUA 1EQPA 3LPFA 3NIYA 2OLHA 1HN1A 3WBEA 1WZKA 1GVYA 5EFFA 1CXFA 4D6DA 5I23A 1DWJM 2W61A 2J79A 1N82A 2ZWYA 3ZSTA 3EDEA 5BXSA 2XVGA 1V0MA 1HF6A 4OBSA 4B9YA 5D9OA 1W9BM 1H3GA 1ISWA 1NOUA 1VBRA 1W9VA 3PZGA 4D6HA 1L8NA 1JNDA 2WCSA 3A4XA 3AIRA 3EDKA 4J3VA 4D72A 3VINA 5A8QA 2VCAA 3SCWA 5A94A 3S6TA 1JYXA 4UFIA 1VBUA 5IHRA 1UD4A 3A6OA 2VUYA 3VD7A 3VDCA 3AJ7A 3BAYA 5LA1A 1V3MA 1HKMA 3WEZA 3CUHA 3GNRA 1WE5A 3ARTA 1PJ9A 1HJQA 1GZJA 1D2KA 2JIEA 5A2AA 2IUZA 3M7SA 4DWSC 4XX6A 2WVVA 1HJUA 5A8OA 1VJSA 3KE0A 1D7FA 3GTNA 3WMSA 4J3UA 4C7DA 2A3AA 2DSUA 4AD3A 2G3IA 4P8VA 4QAWA 3MUIA 4BA0A 3A3HA 4AZBA 2V3DA 1SFSA 3BMVA 4K68A 3CUFA 3OLDA 1U30A 2YOCA 4W5UA 3AYSA 2FH6A 4U3CA 1WDRA 3B9AA 3VVGA 4Q7NA 5DT5A 3F5LA 1J0ZA 2YKKA 4U5IA 1I1XA 3AZTA 2ZX6A 1HL8A 2WVTA 3OGVA 3PTQA 2XPKA 2CXGA 2Y24A 2J47A 1W1VA 1KB3A 3CZGA 1KBKA 3W38A 3WELA 3ALGA 3UCQA 4UOJA 5I78A 5HBFA 1JZ6A 5D8ZA 5ABFB 1MWOA 2VZOA 4D6CA 1J01A 1OSEA 2GK1B 3VGEA 3ARWA 4PMYA 3EMQA 1VFOA 2QF8A 3M07A 3DHUA 3FN9A 2EJ1A 2YA2A 2VO5A 5EB8A 3CO4A 5ABEA 3BSGA 2ZUUA 4OOUA 3WQVA 2GFTA 1E9LA 1GQKA 2BY2A 3GXIA 1FP9A 4RE3A 2GJRA 3VM5A 1E4IA 2ZOXA 4M8UA 2D0FA 3VNYA 2PI6A 2WAGA 1UKOA 3M6DA 3W24A 4QCEA 3WUGA 3ARYA 1V0LA 1DWAM 5GNXA 3T2PA 1Y7VA 2WMIA 2ZX9A 3LMYA 4AIEA 3FY1A 5A8MA 4P7RA 4ACZA 3ZJKA 4AYSA 4GIAA 3POHA 4QDMA 2BV9A 1CXHA 1C90A 5EBAA 4BS0A 1JD9A 4M24A 1UWIA 4MAVA 1SYTA 5EFDA 1UR8A 4CN1A 1CENA 3PTKA 1KWGA 1JFXA 3QHOA 4WK9A 1W2VA 2VRQA 3N04A 2EBNA 2BS9A 1GOQA 4LXFA 5A8PA 1MVYA 4HPGA 4KRTA 1V3HA 4P7NA 2D24A 1FOBA 3WN6A 1NP0A 2CHOA 3OLGA 2GVYA 3FHQA 3WNPA 1WAWA 1XH2A 3II1A 2ZXBA 2AOSA 1NOWA 2XFFA 3SCRA 2QHAA 4OZOA 4Y7EA 3MUY1 4ZENA 3SCOA 1GOWA 4H7VA 2CBIA 2ZUMA 2GJXB 4JCMA 1JAKA 1JL8A 5ECUA 4P8XA 3NSXA 3A4WA 4RE2A 3EDDA 1DWGM 1EXPA 5BYWA 4YHEA 4EKJA 1K9FA 2NT0A 4L4PA 3QR3A 1Q6EA 2VZSA 2BY0A 1JZ3A 1PEZA 1B90A 4PBGA 3UESA 2X0HA 4M1RA 3SCUA 3NSMA 3OGSA 3WBAA 1E4MM 5GNZA 1JNEA 5HPOA 4AD1A 1S46A 1W9DM 2W5FA 1BSIA 1UR9A 1V0KA 4M29A 5CQ1A 3WF3A 3EMZA 4S3KA 1E73M 4AMCA 1GOKA 1BG4A 2VQTA 1ECEA 4MB1A 7CGTA 5FL1A 4D6EA 1UQYA 1JZ8A 2EPLX 5IHSA 4XB3A 1V6VA 3AXXA 1B31A 2C0HA 3AS1A 4KGJA 4J3TA 4PMDA 3HJEA 3TTSA 3RJXA 1H11A 2UY5A 3AHXA 3ZR6A 2W67A 4AZ7A 5HOSA 1SMDA 4D6IA 1BFNA 3VO0A 1ISVA 1E15A 4UQAA 3UG5A 4D6FA 4TVCA 1AVAA 2W91A 4TXEA 1W3KA 4UQDA 2A3HA 4GI9A 5TD4A 1HJXA 4CCCA 1IZJA 6CGTA 2BY1A 2O9RA 4MNMA 3QGVA 1HKIA 5CZKA 4JL2A 1GOIA 1MYRA 1JDCA 2XSAA 3I3BA 3W6MA 4X9YA 3MMWA 1GQIA 3L4ZA 2J7EA 1G1YA 4BQ5A 2BVYA 2G3MA 2DDXA 2PWGA 1ZBKA 4DWSB 5D9NA 4A4AA 1X6LA 4Z2GA 2XIIA 4C7GA 3ZO9A 4LYPA 4W8BA 4QLLA 1XC6A 3TTQA 1WZAA 4HPHA 4Z2LA 4R5EA 3FAWA 4F9DA 1K9EA 1JFHA 3AS3A 3DC0A 4X0VA 2X09A 2D20A 2OWCA 3WNOA 5KEZA 1ISZA 1CECA 2BHYA 2EPNA 2V38A 4D71A 3F4VA 3T0AA 1IV8A 2XHYA 4AY1A 1MFVA 4W85A 1HX0A 1PZ3A 1CGWA 5D8WA 4LYRA 1XYZA 3N13A 5JBEA 3I3DA 1K9DA 4RL3A 2VR5A 3WNKA 2C7FA 2ZUWA 3OLIA 4QP0A 4UFLA 2J77A 1EIBA 3AIBA 3VU2A 2E4TA 2DIEA 1MXDA 1E1EA 3BLPX 3EBVA 4JFTA 4Z2HA 3AYRA 2E8ZA 1LQ0A 1VEPA 3VIMA 1E55A 3WH7A 5A1AA 3AFBA 3VD3A 4QLKA 3N12A 2WCGA 4EANA 2W63A 1B3ZA 3SUTA 4MB5A 1H2JA 4BZYA 1PAMA 1E6SM 4DUXA 3MSDA 2WMGA 1BG9A 2F61A 3W53A 2VOTA 2JEPA 1HL9A 4P7LA 3EYPA 1J12A 1GPFA 2YL9A 4MPKA 2CPUA 2YA0A 4CKQA 1HXJA 1CGYA 3FW6A 3WH5A 1GQJA 1QVBA 1JZ5A 3AMCA 1UUQA 3L4TA 1DHKA 3N18A 1LLOA 3BAIA 3QHNA 3NJ3A 3PZIA 4IISA 3WIJA 1H1NA 3NDYA 4DUWA 1QW9A 1SMAA 3EDFA 5I0DA 3AIEA 3WUBA 3U7BA 1ZBCA 5GNYA 3RM8A 3OBAA 1W3JA 4ATDA 5D9PA 4AZ6A 5HDRA 4D6JA 3ZR5A 1MW3A 4XZBA 5DT7A 3AZRA 4U2YA 1JZ7A 3TTYA 4JIEA 4KMQA 3VGDA 2FHBA 5I24A 3VD5A 4P8WA 3OG2A 1PX4A 5ABFA 3G6MA 3SUUA 3THDA 3VOCA 1NWUA 1WPCA 2GK1A 3ZJ8A 2EXOA 3M46A 2WSKA 3K8LA 3U57A 1Q6CA 5BXRA 4FLQA 5FIPA 4PEEA 2VCCA 1KXQA 1BAGA 1ODZA 1KCKA 5CPSA 5D4YA 3G6LA 2X8RA 2WB5A 4B3KA 4PUEA 1JAEA 1BLIA 2XG9A 4PMVA 2GDVA 3ZQ9A 2ZUNA 1XH1A 1UA7A 5CSYA 1UR2A 1PX3A 1C8QA 3W27A 3S2CA 3WSUA 1BHGA 2WK2A 3ARRA 1I1WA 2D0HA 1H49A 1V0NA 3L2MA 2GSJA 4J3XA 3L4XA 1EHNA 4J7RA 1E6QM 1ZBVA 2DT3A 1CNVA 2D0GA 1UG6A 1UZ4A 4V28A 1OIMA 7TAAA 2WW5A 1MXGA 4FLOA 5E9AA 1PIGA 1LL7A 4HMCA 1TA3B 3AMKA 2W4XA 2WZHA 3D5HA 3AIVA 1BYDA 2EPOA 1JZ2A 2ZX7A 1EH9A 2JF7A 2JE8A 3WH9A 5AC4A 3NCOA 2CIPA 3B9EA 2ESCA 1ITXA 3EMCA 2WBKA 1K9TA 1VEMA 1VRXA 2YA1A 1LWHA 3WDJA 1WKYA 1KGWA 4AD5A 1WZMA 3GDBA 4H41A 1GONA 3DHPA 1DTUA 3ARSA 1CXKA 5DFAA 4CU6A 4ZEPA 5CPTA 4F9JA 2GJXA 3TONA 3BAKA 1NWSA 5CXPA 5JIWA 1HVQA 5CSUA 2WLYA 2O9PA 1HJWA 5HNNA 3T2OA 3N9KA 4UOQA 5M03A 1DP0A 2EPMX 3J7HA 1QNSA 5M5DA 1C8XA 2VX7A 4PTWA
chains in the Genus database with same CATH superfamily
4RK8A 1P43A 2I5IA 3O06A 1FA2A 1DIKA 3OEXA 3W87A 1B4KA 3OA3A 5D2YA 3KXQA 5HMDA 1W2PA 3FSUA 4WDXA 4YWSA 4Q33A 3OHMB 1P6CA 1KM5A 4FOKA 2XYLA 2VEMA 3WZ0E 3DHDA 4ZTYA 2HROA 3FEQA 1FRBA 1VB9A 4BF5A 3O6AA 4F2BA 2G3NA 2OLAA 3T81A 4OHQA 2XSXA 1OFBA 1C91A 2IXVA 3FIGA 3C2VA 1UZDA 5GJPA 4R9XA 3FOKA 3NDZA 3MI3A 4PTXA 5CJMA 1GGOA 4JX6A 3OPSA 4HMDA 3FYYA 3TR9A 1UW9A 3IK4A 4C1NB 1X38A 2YJQA 2Q71A 1YTKA 5A95A 5GVJA 1F3XA 3CWHA 2J74A 2OSWA 3N1AA 5I2UA 3VOGA 4QJ4B 2WNZA 4GG9A 4ZA0A 2PTZA 2YZ5A 3U48A 6REQB 5A6LA 3NQEA 2ZUVA 1FWDC 3IV3A 3UR8A 5HXMA 1GKRA 3IUDA 5AC5A 3O63A 4HPXA 4JY9A 5I03A 3KL0A 3E2SA 2CERA 1F05A 4DF2A 2BWGA 3UD6A 1JCLA 3DYMA 2ZUSA 5FD0A 4FIRA 5BU6A 2DSZA 4LCSA 3W2JA 5L6UA 4L5ZA 4JICA 1X96A 2YLAA 2A79A 5KZEA 2XVPA 1TJ1A 3MKKA 2XZ9A 3V36A 4KCVA 3V5FA 3QLDA 2ZZ7A 4IZGA 4GJJA 1WZLA 5C70A 1DBTA 4JN7A 4UXDA 4ZE4A 1KM4A 3HZ3A 1H7NA 2B7NA 2QPXA 3R12A 5A2CA 3QKZA 1ONWA 3LBOA 3KTCA 4XKYB 1Y5VA 3WLHA 2AQWA 2X0YA 3PF3A 1PDYA 5DMLA 4S3AA 2XGZA 3TA9A 4EF8A 1V6XA 4OBRA 3WBXA 2QUVA 2BB0A 1EJVC 4FIQA 4PUWA 2W62A 1E70M 3A47A 1LP6A 2J8FA 1FWTA 3NM3A 2PDCA 1V79A 1AQFA 1JI2A 3KRBA 4KBXA 3O9NA 1HP4A 3FJ4A 1YX1A 3ANYA 1AH0A 4OECA 1HT6A 1RBAA 2HK0A 1XYFA 4FX8A 4QG6A 1RALA 5A6MA 7REQA 3GU9A 2QMJA 3HG4A 1KKRA 1GVSA 3RUBL 1RV8A 2YBTA 2XIJA 1OFPA 4P2VA 2DZXA 3B9DA 4NP7A 3T44A 3S5ZA 3V0UA 3IACA 1D3HA 3LX9A 4GOAA 4H2CA 4C6IA 1FVPA 1XLAA 3P93A 3MV01 4N0RA 3M41A 1ICSA 4GZEA 4Q8OA 1VD6A 4O1EA 5C9RA 1UOKA 1YBQB 5G4WA 5LHFA 2D3NA 3QMSA 2YYUA 2H9AB 2PSNA 3GNXA 3NZRA 2PMQA 1TWSA 3ENLA 1IT0A 2UY2A 4FZIA 2OT0A 2X1TA 4G6CA 3XINA 1LROA 3BDKA 1CXIA 4EAYA 3DZ1A 1UHVA 2GWGA 5I02A 3UG3A 3FDGA 1W17A 2E8YA 1LZOA 2DY3A 2YLLA 3KWXA 3DGBA 3N4FA 1TIWA 2YXGA 4RCXA 5AKQA 1M7OA 1WKDA 1M03A 3A4JA 5FJOA 1ZJBA 1J11A 2NW0A 3EWCA 4LU0A 3FHAA 2YDRA 2VURA 2NSXA 3CIVA 4P7QA 4YJ5A 4AVOA 3UF9A 3HIJA 3K4DA 3C2OA 5A6TC 4X61A 4KF1A 5FEPA 4O14A 5XIMA 3U7VA 1PZ2A 4WUIA 1NSJA 3H2AA 2E25A 1VFMA 3W01A 4UB9A 4YYFA 4TQTA 4A3RA 1JEZA 4BJHA 3V0TA 2HMCA 4NQ1A 5C9ZA 1E71M 5ECVA 4TTUA 5D03A 3U0HA 3E12A 1NWTA 2IXUA 3UWUA 3W82A 3VD4A 5DMNA 5GJMA 1QPOA 3C2YA 3I4EA 1YIXA 4AW7A 2W0UA 2PP1A 1V51A 1Z42A 3XIMA 3POCA 1RQBA 4ECLA 4B91A 3QPEA 2PWHA 4UQ9A 5JBFA 4QFUA 4R88A 3VM7A 1Q85A 4R34A 3W1TA 3GX9A 3KM8A 4MNKA 4H8NA 5LNRA 4R85A 2CKRA 3HPSA 3FJLA 2IKJA 4RZ6A 1L6GA 2C91A 5TBOA 3GDMA 1YE6A 3IVTA 3ZOAA 5K3VA 4CNSA 1ZQ5A 1V6WA 3ITLA 3A9BA 3VNMA 1Z44A 1DJQA 1ITUA 2ZRVA 2RGMA 2WNQA 3BARA 4UTWC 5DEZA 1MFUA 4UQBA 1S5WA 3N2TA 4OV9A 1DJNA 1BXNA 3BMWA 4X22A 4AC7C 1QW7A 4S39A 2NWRA 5F2LA 6TAAA 2ZZ6A 4ZOEA 2Y4SA 3ATZA 2OTDA 3EA3A 4XUYA 3U9IA 6REQA 3G24A 3CL7A 4A8LA 2HSAA 4WEVX 2GOUA 4HK6A 1TTJA 2J7HA 4I5RA 4C6DA 1K3UA 5JVLA 4KERA 2A1YA 2XVLA 3VAVA 2DVTA 2Z1VA 3S9ZA 4GC4A 2ADAA 3LXAA 3T08A 3Q65A 1KBBA 2HV5A 5CG0A 1XXXA 3UJRA 4GCXA 4PUDA 2J75A 5C9WA 3MZNA 3IIZA 2D2JA 4GQQA 2X16A 2D1ZA 4PSPA 1GW9A 3WD0A 1R5YA 1DV7A 1E0XA 1DJHA 2PF0A 3MWAA 1JDEA 2QGHA 4HKPA 3LCFA 2DQXA 4G8TA 4DJDC 3QYQA 3HN3A 3CAVA 4UQEA 5CPLA 2E77A 1R0MA 3VZYA 4LVBA 3TU9A 2XISA 1RY8A 4M81A 4O0QA 1W1IE 1XSKA 3LBCA 4WRHA 1R8LA 1XPYA 3I6EA 5AC8A 1EJUC 3KVMA 3E5PA 1FWBC 1HKWA 2X2YA 4GE8A 4UZUA 4DUVA 1MRQA 4JCLA 1LJYA 2VCBA 3EA2A 3WDQA 1ZU8A 2GUUA 1WOBA 3PUOA 3H6OA 1JDFA 4MJ2A 1P4CA 3I3EA 3LPOA 4UTJA 3T55A 3WLLA 2Y7GA 2BXZA 4F79A 2G8ZA 4DBUA 3WLPA 1AQHA 3PWIA 2WZTA 2FMNA 3W26A 2VC6A 4H83A 3VIHA 3H4WA 1TYGA 2Y8UA 3FA3A 3QTGA 3JR2A 2MANA 1UYQA 4MDOA 3P80A 4CQCA 1O4UA 1R7OA 3KL5A 4CQ8A 1CZ1A 2YFOA 3MKCA 2BFGA 4HZ8A 3UZYA 3OLEA 5T26A 1SVDA 4U31A 3LHWA 3GNOA 1SSDA 3ZYZA 4M1BA 1YBQA 4MIMA 5DLCA 1MNZA 2D23A 1ISYA 2H9AA 2DZTA 4PMNA 4XIMA 3ABSA 5LGZA 1TR1A 1CLXA 2FVKA 1FDZA 1XFCA 1PWMA 2R1MA 1ZLPA 3BG5A 1A5CA 4DAFA 1ZFJA 4WR3A 1TMQA 2B7QA 2OJPA 3VTRA 5E6YA 1TSIA 3DFOA 3TTEA 1XGZA 5AC7A 1ECQA 4NL1A 1B3VA 1OCQA 4ZBCA 1GW1A 3GBDA 4DZAA 3ERPA 3H4XA 3GTIA 1KXTA 5I79A 3G1DA 3GHRA 3WF4A 1S1RA 1QI3A 3GBEA 1L0PA 3G0UA 4J3ZA 1EO7A 5BU9A 1I0DA 4PMOA 1OCNA 4MDPA 3H2NA 3S2LA 2GJLA 4PMXA 1EP2A 3MQTA 4XAYA 4PUJA 3M0KA 3IJIA 3NQVA 4MG4A 5GPRA 4NZ4A 2JIWA 2ZXQA 4NZFA 2OKTA 3IIOA 2NUYA 3A24A 3MDWA 3SCQA 3DOPA 3O8AA 1SJAA 4XZ9A 1GVEA 5G1TA 2OYLA 4CEXC 3ZSSA 5I77A 1JPKA 1V6YA 5LSMA 3MUXA 2ZZ2A 3LOTA 2OU4A 4KFOA 4KH2A 3UW6A 4XSMA 2WNNA 4B5UA 3EXSA 4E8CA 4V2XA 1Q7QA 2I9EA 4BQ2A 4QQUA 3AALA 1PBGA 3JZEA 3FFSA 2F6UA 3W6YA 5TF0A 5FI8A 5BZAA 3AHZA 4AFYA 3I7QA 7TIMA 4PCPA 1NEYA 1GVRA 1WKEA 4XAPA 4R3UA 1ZSXA 4UFJA 3W86A 5F2IA 4LRSA 3PY2A 4B15A 5AHFA 1XRFA 4PRWA 4O8RA 5I7GA 3GH7A 2DSWA 2AGKA 2GGJA 2PDPA 4PGLA 1Z6KA 2J7FA 2OOFA 5CPQA 2Z1SA 4MUPA 4K8HA 4AIOA 5M3WA 4C65A 5LYRA 2VRJA 3AI0A 1XSJA 1J10A 1E0UA 1K7FA 2CLHA 4S3GA 4Q6JA 2AKZA 3RU8X 3O0KA 3UETA 3H70A 2VVSA 2DJLA 1WO2A 1US2A 1XLDA 3BOLA 2PBGA 3PZ9A 4B90A 3ZVHB 4NJKA 1BGAA 3DG3A 2FPVA 2YFNA 5H91A 1LYXA 2QXWA 2W3ZA 1A50A 3UWWA 1E6XM 1UZHA 1V08A 4EXAA 3G22A 4O10A 4RX0A 1RD6A 4DO6A 3VNLA 2BZNA 4RXFA 3RCMA 3CPRA 1GHSA 1U33A 1AODA 3MVTA 2TMDA 4D1JA 1TRDA 5IFTA 2FGZA 2V0TA 2BXYA 3L21A 5HR6A 2GGGA 4AWEA 1UR4A 4UR9A 3T78A 3NPWA 2WMJA 1C7SA 1TX2A 2P0OA 3M9YA 3NGFA 3LEPA 3T05A 3B8TA 4Q4MA 4JTGA 4P61A 1XIDA 4CCZA 4UBPC 4OE7A 3S47A 1DWFM 2PCQA 1H7WA 5A6SA 5TAOA 2XGIA 4QLJA 3LM3A 4L1GA 4W7WA 3CMGA 3GR4A 5LNVA 4UIOA 3N2CA 3MC5A 2YL8A 3PUGA 1VJZA 2DVUA 2NVAA 3S5YA 4IG2B 4PRRA 3APGA 2NLYA 3UNDA 3IJ6A 2NVCA 1L6YA 4BI6A 3PVFA 1I2NA 3AZSA 5T8GA 4LFYA 3C6CA 5HQEA 3QY7A 4IXXA 3IAQA 3TYEA 2W92A 4HMNA 3NZGA 2ZDRA 5J5DA 3L5AA 3N19B 3DFPA 4C6CA 1TKKA 1CT5A 2A3EA 4CNPA 4POCA 1RP8A 6ENLA 3MCNA 4XZMX 1NY1A 3THAA 4UTKA 4WSJA 3B04A 3ISIX 2WPGA 2REQB 4CLMA 2Q3RA 5C2XA 4IFRA 3CQIA 3S0CA 4Q8UA 1ENUA 2YDAA 3QYSA 4IMDA 3CZEA 4LX4A 1R3RA 1QOQA 1UKTA 2FQIA 3T42A 4DX3A 4XVDA 1ZP4A 3WLRA 5FCZA 1VS1A 5E6ZA 4C6LA 3H22A 4IPLA 1NM9A 2R9RA 3U2EA 3V18A 1NAL1 3HV9A 1QT1A 3TQ0A 4DN1A 1U5HA 2BY3A 1CWYA 3M43A 3CLWA 2BNJA 2JKEA 2RJHA 1XLEA 2P53A 1RLDA 3G3DA 4I5XA 2H3DA 2HJPA 1B3YA 2QV4A 4E4FA 4U28A 2HPMA 2R82A 3VC5A 1NH6A 7ENLA 4PMUA 2NT1A 2NQ5A 2E7FA 2VM8A 4H01A 1C9DA 4F66A 3OVGA 4UNIA 2ACQA 3P14A 5D2VA 3WENA 4WCJA 1FKWA 3O0FA 1CGUA 2OODA 2VMFA 3KS6A 2VRKA 1GZGA 2P8CA 2E3ZA 3IJQA 4URIA 1TFVA 4FNQA 9CGTA 4OT7A 1WB0A 1F2JA 1BGGA 3INPA 1KNWA 2VC5A 1YPIA 3SURA 3AXIA 3BC9A 2A6NA 3R6IA 4TUFA 1FY6A 1YNPA 3E5BA 3OQ8A 1BF2A 1PIFA 1XP3A 2J4GA 3TDFA 3BH4A 3W2KA 1HUVA 4JQ1A 2HE8A 5E5CA 3O7UA 5HINA 2RAGA 5GJNA 2OO0A 3MUZ1 1EEPA 5AY7A 3FAXA 3UNTA 2R6OA 4CD8A 2J6XA 3RPTA 5C55A 3NG3A 4HSHA 3SCNA 1AL8A 2WJDA 2Z7GA 5CJ5A 2C1IA 4GACA 4O1CA 4L9XA 4XZWA 4TVDA 4FMVA 1B9ZA 3S5OA 4GIEA 5I6SA 1CXLA 3GXTA 4L80A 4OV4A 2ZZ5A 5LHEA 4HTYA 3MSYA 1AW5A 1FHLA 3VCRA 4S2BA 1ZPTA 1F4AA 5C2GA 3EB2A 1QJWA 2PUZA 1IZKA 4ML4A 2SFPA 4IPJA 1PB0A 3BJTA 2FVMA 2VWTA 2ZC8A 3K30A 4HB7A 3WD4A 3NVTA 4W84A 3WEMA 3BLFA 3VKJA 1K4HA 3GAYA 3NA8A 1E3ZA 1EZ2A 1H09A 4PMQA 3ZT6A 1O6IA 1QI4A 1H0IA 1P0BA 1PCWA 2NX3A 2QGYA 1TJRA 4LEQA 3SQMA 1JRCA 4AEEA 3R8HA 4LGXA 4IMFA 1O68A 2A7RA 2E9MA 2FGLA 1EKOA 1QK2A 2JGYA 4S23A 1BTCA 3GH5A 4UUIA 3GH4A 1XIFA 2ZFAA 4GYJA 1S5TA 5HULA 1C8VA 3HQPA 1TJPA 1TPB1 2H90A 1WZKA 1GVYA 1X1OA 4I90A 4RJEA 3ZVHA 3SN4A 3QF0A 1D7KA 1N82A 4HNLA 2ZWYA 4WJEA 2R1NA 3ZWSA 4EPBC 1W9BM 1ZNNA 2VR2A 4Q8VA 1R3TA 4QJ1A 5CC5A 1V6TA 4MWAB 3KS5A 4R33A 3I7SA 3G18A 4LALA 3LENA 1ADDA 1Q2SA 2I5QA 3DBPA 4J3VA 1VYRA 5A94A 3WO8A 3C8FA 5IHRA 2DZVA 4KETA 3A6OA 2OGYA 3EX4A 4GJ1A 1XGEA 4UCGA 3OW1A 3GNRA 1WE5A 3S8HA 3G5EA 2NUXA 1D2KA 1TRIA 3LERA 4UTMA 2WKJA 2Q01A 2MUCA 1F8MA 2AQVA 2G3IA 3W1MA 3KFTA 3LZ5A 1DQUA 4F40A 4DAIA 4IG2A 3E2VA 1QPRA 3OLDA 2QZRA 1XLKA 3UJEA 1BWVA 3CTLA 1WDRA 1GK8A 3VVGA 4A3UA 2E5BA 1OYBA 5DT5A 2NQLA 1ZP3A 4NXKA 4PUUA 3AZTA 2ZX6A 1XG3A 3I10A 2FJUB 4HCHA 1FTXA 3OGVA 4ZR8A 2CXGA 1GVFA 3P0XA 4O19A 1FWAC 1TV4A 4MZ8A 4DEFA 4EWJA 1KBKA 1F3TA 2REQA 3ALGA 4UOJA 1A53A 3VNDA 3B0YA 5HBFA 1JZ6A 1XRTA 5ABTA 1J01A 1OSEA 2GK1B 4ZL1A 1X8FA 1MDLA 1VFOA 2C14A 3EMQA 3M07A 3GLCA 4QR6A 2VO5A 3RAOA 2POZA 2P10A 4IXHA 5ABEA 2ZUUA 1EJRC 1OFOA 1FHVA 4JTIA 2IPWA 1PSCA 3GXIA 2WQPA 3G1FA 3S6OA 3C2RA 1E4IA 4M8UA 2D0FA 2PODA 4NVTA 2DORA 3VNYA 4HT3A 7XIMA 3WBWA 2QYGA 1UKOA 5EKYA 1AJ2A 3NQGA 2DJXA 1ZGDA 3TX9A 5REQB 1ADSA 1DWAM 3KW3A 1S5NA 1Y7VA 4NY2A 3DHFA 3FY1A 4AIEA 4QDMA 1CXHA 1C90A 3MBDA 5CBJA 1OZQA 3RR1A 4BS0A 4A8IA 1JD9A 3NO3A 1MZHA 4MAVA 3WJZA 5DN1A 4Z1DA 1QMLA 1JFXA 5HQMA 3SO7A 3NGJA 4WK9A 5I3KA 2BS9A 4O16A 4V15A 2VFDA 2TRSA 2VEPA 3LDVA 4L9ZA 5AYZA 3RCYA 2P8BA 1WAWA 3II1A 1W5QA 3KBSA 1SJDA 2GLKA 4QAIA 2XIOA 1PO9A 2FZDA 4L9YA 3ZWTA 4ZQMA 4H7VA 4JCMA 1IF2A 4P8XA 3ITXA 3LV5A 3NQ6A 3QPZA 1IIGA 1DWGM 1W1B1 3NTYA 9XIAA 4FHAA 4YHEA 1K9FA 2PTXA 4TX9A 1BTMA 2IKIA 4D2JA 1ZY9A 2VZSA 3EX6A 1O1HA 2BY0A 1JZ3A 3UESA 1TUFA 4QDWA 4F2TA 3OGSA 4HCLA 1S46A 1PHWA 3CIWA 1EJXC 4IHCA 4QE4A 4QJ5B 1BG4A 4XTIA 3G0XA 3DI0A 3TJIA 1E9ZB 4ML9A 3UZZA 4BF9A 3P82A 4XB3A 3AXXA 1BKHA 5CPMA 4KCTA 4UTHA 2ZCGA 3U6WA 3URBA 1FX6A 3SY1A 1E9IA 3S2JA 3TN6A 2V5JA 4NAEA 3TTSA 3GNNA 5KSWA 2W67A 4JQ2A 1Q8AA 1UIPA 3P74A 4JYEA 1BFNA 3CU2A 3WLSA 2PGWA 4UQAA 4D6FA 1H7PA 4TXEA 4TVCA 4LAOA 3NPXA 4WDUA 4QISA 4UQDA 2A3HA 1YEYA 1W6TA 4CCCA 6CGTA 1MDRA 1TPEA 4MNMA 1R3QA 3QGVA 1VBJA 1HKIA 2QCNA 4JL2A 1GOIA 5CZKA 3R8RA 3RF9A 3R0KA 5AZ0A 4TMCA 2J7EA 3NL2A 3H7VA 2BVYA 5G5IA 3QEZA 4H1ZA 4LTSA 4Z2GA 2XIIA 3ZO9A 4LYPA 1SJBA 4KWVA 4EIVA 1OVDA 3B9OA 4QLLA 4PL2A 4KEZA 4NG3A 4DLMA 3JW7A 1A5KC 1FKXA 1TIMA 3M0YA 3FAWA 4EPDC 4LCQA 1TE6A 4L1XA 4C6PA 4X0VA 2X09A 2OWCA 3WNOA 5KEZA 2PDWA 1QWKA 2OLSA 2XHYA 1HX0A 3WK1A 2CWXA 2ZE3A 3Q45A 3I4KA 3N13A 3I3DA 1K9DA 4RL3A 4MWAA 2E6AA 1QASA 2J77A 2V5LA 5CZJA 3VU2A 3TW6A 1OFAA 2DIEA 1MXDA 3BLPX 1N2VA 3RPDA 2Z00A 3QC3A 5D09A 2VGGA 3SM0A 1LQ0A 4H9UA 1LOLA 3E02A 3WH7A 3VD3A 5J04A 2WCGA 4CQBA 4EANA 3KZPA 1B3ZA 3SUTA 4BZYA 1PAMA 4O1AA 2YW4A 3A13A 1LCOA 3TYBA 4P7LA 1XFBA 1HO1A 4Y2WA 4JIRA 3TQVA 1GPFA 2CPUA 5DBTA 2QKFA 3GC2A 4QROA 1CGYA 2A3LA 3FW6A 3UXDA 1IR1A 3AMCA 2BVWA 1T41A 1VYSX 1DHKA 2AKMA 3D6NA 3LM7A 3PSWA 2PDQA 4UTLA 3GVRA 3LNMA 4AQLA 2NX1A 3BJFA 5I0DA 2PDBA 4A05A 3U7BA 3RM8A 2Z24A 3MA8A 4AZ6A 4D6JA 4MFDA 1GWJA 2DVXA 3UQNA 4US5A 3N29A 2B7OA 5G4EA 2FHBA 5I24A 4UR7A 3NO5A 4P8WA 4IFKA 2WSYA 3KTXA 3SUUA 3A5FA 4ZTXA 2GK1A 1F3EA 2EXOA 3SDOA 3L66A 2NSOA 2R1KA 3DFTA 5IRPA 4F0RA 5AYXA 9XIMA 2RH9A 2VELA 2PCEA 1ODZA 5CPSA 5D4YA 3G6LA 4ADTA 4IX0A 4PUEA 1JAEA 1BLIA 4PMVA 1G4PA 1LLWA 4GY1A 2AL2A 2R1LA 5REQA 4B5TA 3SZ8A 1C8QA 2VDIA 3WSUA 3ARRA 1UIOA 1YXDA 4JTKA 3W1QA 4DQWA 5HR7A 3QY6A 4ZB2A 2Y7FA 4A3QA 4A29A 2J6VA 3L0KA 1JPHA 1OIMA 1MXGA 4FLOA 4Q4PA 3WLKX 4QTGA 1MUCA 4HMCA 2W4XA 3WJWA 1T6MA 1EPXA 2DUZA 2J88A 3CV1A 2G4JA 3BLLA 3WH9A 5AC4A 1L2QA 2PGFA 3P5YA 1VGAA 2EG7A 3EMCA 5AECA 1VRXA 5LKYA 3B03A 4H41A 3ARSA 4IQDA 1CXKA 3KVJA 3DG7A 2Y7EA 4LJ3A 4F9JA 3TONA 2XFWA 1NWSA 4NHVA 3CAKA 2O4QA 4GVFA 4Q32A 3C2EA 4BI7A 5HWJA 2FLIA 1OCBA 1XYBA 3T2OA 3N9KA 5M03A 1XUZA 3KCLA 5HANA 5DCEA 2ZXDA 1CGTA 4N6EA 3RYSA 1QI2A 2B31A 4QG8A 1TWIA 5I3DA 2ALRA 3HQNA 2WHJA 3BUVA 4M7TA 3IJDA 4O4WA 1FFQA 2PU0A 2GJNA 4IQEA 4CNTA 4W5ZA 1KM6A 4ZO9A 3PZNA 4KEMA 4V1XA 1R7AA 5IOBA 3H24A 1P48A 1OD0A 4FI4A 1NDWA 1QHZA 3CHCA 4B16A 2DIKA 2HWGA 1AUSL 1JVNA 4D9PA 2VTFA 4M19A 3W7IA 1TVPA 2W27A 1CDGA 3O3RA 1ALDA 1XCWA 3URQA 1CEOA 3VFLA 1R46A 2VQUA 3GDRA 3ARXA 3WLNA 3MMTA 3GHTA 3HQ1A 4TX8A 4I5UA 2EPHA 3FYOA 1J96A 4RDYA 1AZ2A 1T99A 4DRSA 2NZLA 4HNCA 3PUDA 3W73A 2HISA 4K1GA 1UR1A 1QPNA 4HNVA 3UYCA 5LA0A 5E70A 1MEIA 4NZ3A 4WF7A 3WNLA 4JYFA 2Y8VA 3ME3A 1XIMA 1IWBA 2WWCA 3KOWA 3EWWA 1M53A 5D9MA 5E0FA 3V1PA 3MU7A 3MMDA 1BVZA 1G6CA 1OCJA 1I45A 1HTIA 4YTQA 5ABHA 1UWSA 4N4PA 3GR8A 5HA7A 4H7CA 1TTQA 2CYGA 1A5BA 4KEVA 4UFHA 3PPHA 3MPGA 1S2CA 1FWCC 2DSKA 2PDIA 3AUJA 4MSSA 3PNUA 5FEZA 1EQCA 2JEQA 4J3SA 1W1TA 3LZ3A 4OWGA 2P5NA 4JQ3A 3LBMA 4U3AA 4EE9A 1GG0A 3H23A 3H8AA 2ICSA 1HG3A 4IM4A 1YE4A 3VOIA 4PN2A 4G56A 3W84A 4AWUA 2QDDA 3K8MA 1W1YA 5HNRA 1T0OA 1E0WA 2CBVA 2VJXA 3U2OA 3Q2DA 4AB4A 1UUMA 3AYVA 4QIUA 3NO1A 3C4UA 1PKMA 3W75A 1BYCA 4NAFB 4FA3A 4W8AA 2XN1A 5F4SA 4G7EB 3UZJA 4M6PA 3WQEA 3VUSA 1T8QA 2F6KA 4OUIA 3WKZA 3HU7A 1BPLB 2WXDM 3TOPA 2VL4A 4RV8A 3ARPA 3VX1A 1OD8A 1PKLA 3RCNA 4B5WA 3FK4A 3CTTA 3KEHA 4IJRA 4QM1A 2WWDA 1C8YA 3LPGA 3SQLA 5K7JA 4HK5A 3S9YA 4Y9NA 2VEKA 3LB0A 5BROA 3USZA 1RA5A 1F9CA 2EG6A 3CM4A 3S3GA 4NNBA 3E9AA 3KBVA 5CAKA 2E0PA 5BWAA 2WM1A 1XDLA 1VLWA 1UJQA 3EAUA 4IMCA 4MWAD 4H00A 4GZJA 5D33A 1S1PA 4LH8A 4HU8A 4PB5A 1UWQA 1CIUA 3CT2A 1XD1A 2XTKA 3S1XA 1EDQA 2WKLA 4GWEA 2QJIA 1W5NA 4HD5A 2DT1A 5GQBA 4CVUA 1JDDA 1XRSA 3QOKA 2GVJA 3B05A 4TOQA 5E0CA 3URAA 3RMJA 1DORA 2CLFA 2O4MA 3BQ5A 4YVPA 4LRTA 3B06A 3KCOA 5LNSA 4IX2A 4IUOA 4C6JA 2Y89A 3MANA 1PWLA 2VZVA 3IAPA 4B4FA 3SEPA 5IDZA 1NDYA 3GYEA 1EGMA 1UKQA 4N9CA 3A3XA 3SFKA 4XZNX 5AN7A 4ACYA 3ITGA 2Y5EA 4L1WA 3V3WA 1EDGA 2J7DA 2YB1A 4JY8A 2CZ5A 4H8VA 2OX4A 4F0MA 4JTDA 1YDOA 2DH2A 1VF8A 2HVNA 2XWDA 4K1WA 2NQHA 3A22A 4HZ7A 1B57A 3GKFA 1ZL1A 2WOQA 3BWWA 3LK6A 3VCCA 4A21A 1QNQA 1UC4A 3DFSA 1SFJA 1IE7C 3BLKA 3W1NA 3TMQA 4BWLA 4US5D 3UT0A 4H6KA 1EWDA 3KVKA 2HBVA 1E1FA 4PCNA 2FHCA 3KAOA 2CWNA 4TR9A 1PV8A 5E09A 3C61A 2A6LA 2KX9A 5FF2A 2JFEX 3N34A 1IEVA 4PTVA 1F4HA 4DO4A 2GOKA 5JUVA 3P84A 5CBIA 1WP6A 4AHOA 5EMLA 3CYVA 4JN8A 3NOEA 3D3FA 1GJUA 3MO7A 3FJ6A 2J7BA 4JFVA 4PL1A 3CV7A 5DXYA 1RZMA 4M7SA 5HK4A 2W66A 1ZCCA 1CGXA 2QUMA 3DFHA 3EX2A 2Y62A 3ARUA 4E3VA 2C13A 3N17A 1VKFA 4TU1A 3BXWA 4C6NA 4XD3A 1OX5A 1AG1O 3WD2A 3LY0A 3QN3A 4LBSA 5C7VA 5ABGA 2GVEA 4YL2A 3PZUA 4HIBA 3QV9A 2G37A 4PB3A 2NQ9A 3VX0A 4GI6A 4ZE5A 1WDWA 4UFMA 2BGSA 4HHMA 1QW8A 3WQOA 2CLLA 3KBWA 1BYAA 2QCDB 4G5DA 2ZICA 5G4HC 2KAUC 4IOTA 3ZT7A 4GI4A 1CB2A 1DJXA 3PUEA 2WMKA 4EWND 1J0JA 2OO6A 4AIUA 2VFFA 4EVZA 4BY3A 2XWEA 3M0VA 2J8GA 1M6JA 2EKGA 2O92A 4ERAA 3TC3A 4HSNA 3S1UA 2YL5A 4GCAA 4UTTA 1NELA 1S2UA 1PX8A 2DZPA 2BP1A 4BQ4A 1MQRA 4YMZA 2Z6JA 4O8AA 3VGGA 1I75A 3PTMA 4XISA 1H7XA 2J25A 2FH8A 2CNCA 1XI3A 2R24A 4LUTB 1FCBA 1ICPA 3B0XA 3U3HA 1MW2A 4JYDA 1JCXA 1Z48A 3N6HA 4ZFCA 3M47A 1H7RA 4DJEA 4HGXA 1CX9A 1LBLA 2O55A 5AHMA 3STEA 1UR0A 4BEQA 3UERA 3W70A 1O5XA 1XIEA 4R27A 4KGLA 3AXHA 3AIUA 1VP5A 2J78A 3CHDA 2WVUA 1GYNA 2QDGA 1Q66A 3RLHA 2H8ZA 3F4WA 2JGQA 3CAWA 3IS4A 2Q02A 1AMKA 4ADUA 1BVNP 1DHPA 2UV8G 1W9PA 2QVHA 3GKAA 5FESA 1QNPA 4A35A 2DW6A 1GTHA 1JJKA 5A6BA 2ABBA 2DSVA 3W22A 3FCPA 1DXEA 2J13A 1DWIM 4PE8A 4NAFA 3EOSA 5B7YA 1YHTA 4N7QA 4GJIA 4CGTA 1XQKA 3ATYA 4G7EA 2HRWA 1LTDA 4FLRA 4LBUA 3AYTA 3WEOA 2BBFA 1EJSC 1XBYA 1QOPA 3ZJ6A 4NF7A 2DIJA 3MMUA 2QNEA 2XSBA 4Q8QA 2PWFA 5ENLA 2Z6IA 2Y0FA 3C3NA 3HV8A 4IH3A 3WUEA 2CITA 3SCTA 2GJPA 1OQFA 1C7TA 2VFGA 2QCMA 4H6RA 1G01A 4GMEA 1GKPA 1FH7A 1Z41A 1NQ6A 2H3BA 1LOQA 3N14A 1M1BA 5FOOA 2ALDA 4XUGA 4BEUA 2FZ8A 1H7OA 1M7XA 2XM1A 1Y65A 2C71A 1U1HA 3VNIA 5KZ6A 1E4NA 5D04C 2ZUTA 2DT0A 4C6OA 3LG3A 4LCRA 3PAJA 2ZWZA 1Z8AA 3UR5A 2V8ZA 1L2UA 3IUHA 4NILA 1YW1A 1QBBA 4YLWA 5C5YA 4MF4A 1EB3A 1BXCA 4IP5A 1IZCA 3BCFA 4W87A 4Q8MA 4ADSA 1Z89A 1ESWA 1NOFA 1Q3NA 3BSMA 3WL0A 4WDWA 4IL0A 4GIYA 4AMAA 2ZRXA 5CGTA 4RZBA 1MEHA 3G8RA 4CQAA 1TVNA 3W02A 1OX4B 3A9IA 2VDGA 4DY1A 1XF0A 1XLLA 3DXIA 4G7FA 3T0TA 3F2DA 1R2SA 4PEKA 2XZ7A 2QULA 2WBGA 1OJXA 1CI1A 5JIPA 1W1A1 3EKGA 2W79A 2Q3OA 1I6NA 2WYSA 4RNHA 1YMYA 4RR4A 3UWVA 4LNYA 3KL3A 3A4AA 4HHHA 4X63A 1R38A 1LT7A 1TR9A 1MXSA 5AYYA 3OJGA 2XIBA 4CCEA 2PLMA 3N3MA 3PS7A 3MVIA 2BOFX 1BEUA 3C3UA 1B5TA 1REQB 4HA1A 3C56A 1EA0A 2BHZA 2GQ9A 1FFRA 1J8VA 2PC8A 1I9CB 4LSBA 3L7RA 5DMMA 1DOSA 4JD4A 1KV5A 3IJLA 4HA0A 4Z2JA 2D2HA 2PB1A 4XVEA 3WJXA 2D69A 1TQJA 1U2YA 3TN5A 2CC0A 2QEZA 3NZPA 4Z1AA 1R86A 2HEJA 1KRCC 1L6SA 4U5KA 5C0QA 5FEWA 4WKAA 1YDVA 1E40A 4AHQA 3UEQA 1FWJC 1ZS2A 3SFWA 2PTYA 4KESA 3LLFA 2WZIA 4E8DA 5MHBA 1BXBA 3BLIA 3IRDA 3BG9A 2FZBA 3H2MA 1OFEA 2Z1KA 1RJPA 3W4RA 1KM3A 2PEVA 2CBUA 2PDGA 1UQZA 3VNZA 1KGUA 4H19A 1JG9A 5D37A 3IJ7A 4JPGA 1W1PA 3PBWA 2ZADA 3N11A 3QVQA 1HKVA 1KW1A 2CHNA 1XL9A 2QCDA 4O4VA 3KWSA 2P0IA 1SU5A 3SGZA 3FA4A 4MTVA 2DW7A 2OSXA 3TSBA 2G5WA 2PU1A 3W37A 1A5SA 3DERA 1PPIA 5H1WA 1JR1A 4I3GA 3GXNA 4DWDA 1IWAA 2ACSA 1L6FA 2WO5A 3KHJA 4L61A 4GBUA 3N6QA 1DYSA 1KD0A 3DKJA 4IUGA 1K8XA 3O07A 4M0XA 3EX1A 1IQ8A 3SN0A 1EC9A 4OTKA 4XAFA 1HP5A 3VMNA 2DH3A 3NVDA 1P6WA 4XK2A 4C91A 2ZA3A 4LUTA 5I09A 1M9HA 4IJBA 3NYZA 5CZTA 4DBWA 2QJHA 3ITVA 2QCEA 3GC5A 3SIMA 4AZHA 3H12A 3WK0A 2WM0A 1UP0A 2WANA 5D02A 1RHCA 1TWZA 3VI2A 3CH9A 3UGVA 4INFA 3HF3A 3ANUA 2YYTA 8A3HA 2QCGA 3OZMA 4GNJA 1V3JA 2AAAA 3MDUA 2PTDA 3NUKA 1OGSA 1XR2A 1TTIA 3UGRA 1JXJA 2VEIA 5CC6A 4HU0A 4ZGYA 3CAQA 4UCFA 2NVDA 1NFGA 4NJHA 2NQZA 3W7RA 1D3CA 4ENLA 3LQGA 1NF7A 1K6AA 2YX0A 1QHOA 4HPNA 3LCLA 3LLDA 1KC7A 2CBJA 4ZXLA 3K4WA 5K9DA 4Q4RA 1HKKA 3CB8A 1QOXA 4MWAC 1C93A 4ZB0A 5C9UA 1FWSA 2QJMA 1V3LA 3ABZA 3SCVA 4GUHA 2QAPA 3OO2A 3SY5A 3TCSA 4LS2A 1OINA 1TPWA 1XLGA 2AMGA 1QNOA 1LQAA 3OIXA 3QTPA 3KLLA 3KZSA 3RJYA 4Y8EA 2CHRA 4BK9A 5BRBA 1DWHM 4DJED 4Q8NA 5HMEA 1GORA 1LLZA 2EGZA 5D32A 4XSLA 4F8XA 2VX4A 1QDSA 4UMBA 3GVVA 1UH4A 1KFWA 4Q7IA 4NRSA 2WMIB 1ML1A 4KIRA 2PRHA 3VKCA 3F03K 3AC0A 3RLUA 4NYYA 3GHUA 2F9RA 3BO9A 4K8EA 3AAMA 1RA0A 3T4WA 1XYLA 3VC6A 2R8WA 1EGZA 3MP3A 1C92A 3E2RA 5DMYA 4JFUA 5LIWX 2PTWA 4PRTA 3H4GA 4WOZA 3M5VA 1Q63A 2F8QA 3HURA 1OWQA 6XIMA 1TREA 3CJPA 4I8DA 3L4YA 1E43A 5AOUA 3GUGA 2GVLA 3R4IA 4DJFA 1JPMA 2FDSA 4LNCA 4HYWA 4L64A 5I07A 3SUSA 2WSQA 5I3GA 2VFEA 1WDDA 1SFLA 5CEWA 3F7JA 5A3HA 1KM2A 7REQB 1REQA 1YPFA 2QUTA 3DKLA 4YVXA 4ZZ9A 2HE5A 4MLRA 3DU0A 1RVGA 3L23A 3G8EA 1W5PA 1BKSA 2UWFA 2BGNE 3K2GA 3T1GA 1SO4A 1U83A 2ZZ1A 4BF7A 3EDJA 3EOUA 1JGIA 4G9PA 2OZ8A 3NXFA 2XFYA 1EJTC 2XJ7A 4L7ZA 4AD4A 4OGZA 4M80A 5CBBA 1RBOB 4RDVA 4X9SA 1AL7A 3SECA 3OOQA 3NPVA 4DELA 1NP2A 1KRAC 1A80A 1J0KA 3W00A 4GZIA 3PZVA 1W9UA 3GG1A 2DEPA 2X2GA 2V5DA 3W25A 2IPGA 4GABA 4V27A 3CUIA 4ROQA 4LYKA 4S3EA 2YGYA 4MAZA 2YCLB 1ITQA 5FKYA 3O6DA 3W7PA 2V2HA 1IHIA 3TJXA 1N8IA 1QPKA 3PPCA 2ZKMX 2V82A 3B8DA 3TYAA 1NTHA 3ITOA 2I56A 3UPBA 4JEQA 3BICA 1AK5A 1G9HA 1FWRA 1J79A 4HNTA 1FDYA 2VZUA 4JIHA 4KWOA 1HN1A 1X97A 4D6DA 1TZ9A 2XVGA 3W7QA 1V0MA 2Z1WA 4OBSA 4B9YA 5D9OA 1ISWA 1G7VA 3AO0A 1UASA 5DX7A 4DBDA 3PZGA 3GC4A 3RXZA 3W7EA 1WXYA 2OVLA 1JNDA 4WY0A 2H6RA 3AIRA 3MCOA 5TQLA 3KUMA 4LVFA 4D72A 3VINA 3CQ0A 2VCAA 3SCWA 5A8QA 1KM1A 4H6QA 1JYXA 1VBUA 3BPWA 3LCXA 1VCGA 2VUYA 3VD7A 3VDCA 5LA1A 1UMLA 5CZ0A 1OADA 2NV2A 3RLVA 4G1KA 2X30A 5U4NA 2WJEA 1GZJA 2VP8A 3M7SA 4XX6A 1HJUA 3CXOA 3ZS4A 1VJSA 5LGXA 3CQKA 1B9BA 1D7FA 3URNA 3WMSA 4WXYA 1AA1B 4AD3A 5CCZA 2VC7A 3A3HA 2V3DA 2E67A 1VR6A 1GTEA 2FZNA 3DENA 3W7CA 3PB2A 3IIPA 4KCWA 4U3CA 3F5LA 5HAOA 2Z26A 1J0ZA 4U5IA 4JTHA 1HL8A 3PFRA 1PKNA 4WQ6A 1YDYA 2J47A 4E0CA 4QEHA 1P7TB 5IBXA 3OVQA 4ZQOA 5D8ZA 2P1FA 1XDMA 3H2OA 1MWOA 3BLDA 1FWHC 4C5YA 1J93A 3HMJG 2V68A 3FN9A 3VE9A 2EJ1A 3DI1A 3NQFA 3GS6A 4OOUA 1J4EA 2G3FA 3C0QA 3CQHA 3ABXA 1XYAA 4O52A 1KFLA 2BY2A 1FP9A 3VM5A 4RDZA 2ZOXA 1N7KA 2OX1A 4YTSA 2Y88A 2WAGA 3M6DA 3W24A 3ARYA 4AU0A 2W6RA 4XAGA 1JUKA 3WLQA 3NQCA 4PFMA 2WMIA 5EMJA 1XLBA 3SRHA 3ZJKA 4GIAA 1Y8BA 1FWFC 4ZQCA 2PD9A 2QJJA 4KIEA 4M24A 2G96A 2XIQA 4QS5A 4AF0B 3B40A 5A8PA 3HB9A 1V3HA 1NFBA 4LT9A 3WK3A 1TTPA 3OLGA 2QCLA 1ZENA 1XH2A 2ZXBA 1EIXA 1VPXA 1HGWA 2AOSA 1NOWA 1F5ZA 3C86A 4WZHA 2QHAA 1F73A 2FB2A 2QV5A 4ZENA 4RKAA 3FVDA 1JAKA 1JL8A 3LSCA 5ECUA 1IEQA 3TN3A 2X1SA 1YTEA 1EXPA 3CUZA 4GQ0A 3DESA 4L4PA 3QR3A 1Q6EA 3PJTA 2X0HA 4GZ7A 4M1RA 3SCUA 3WBAA 1E4MM 4AD1A 1W9DM 3W2NA 1XUUA 4ZQNA 4ORIA 2W5FA 3I6TA 1UR9A 2NV9A 1IEWA 4M29A 3KBMA 3B4YA 3EMZA 4S3KA 3MI2A 4XAZA 3MBFA 2BOGX 4AAJA 3JZUA 3LGEA 1ZUAX 4LOCA 1UQYA 4YVVA 1JZ8A 5IHSA 3TE9A 1B31A 2C0HA 2DZBA 3NAVA 1R30A 3PPGA 2OGJA 4BWLC 2CLKA 2GDQA 1H11A 4C6EA 2X0SA 1SMDA 1W5MA 4D6IA 3T40A 3P62A 2TPSA 3GG8A 3MWCA 1ISVA 3UG5A 1M3UA 3SR7A 2GWNA 1WXZA 4DJFD 4MMWA 1SO6A 3N4EA 1IZJA 2BY1A 3DGRA 3U8GA 3RRAA 3B9NA 4U4MA 1JDCA 2XSAA 2YCLA 3W6MA 4X9YA 3L4ZA 1VFTA 2OPJA 3NEHA 4BQ5A 2G3MA 1EYWA 1ZBKA 2WPBA 3QZ6A 5D9NA 4C60A 4C7GA 4W8BA 3FLUA 5K4XA 1ICQA 2PZNA 4O54A 5XIAA 1K9EA 2RDUA 4GA8A 4A2SA 3DC0A 4GYPA 3TLQA 3MHUA 3D0CA 3FV9A 2D20A 2BHYA 2EPNA 3AWNA 3LS9A 5DBUA 1L8PA 4W85A 4WGXA 1IIHA 3R5EA 4AG0A 2VR5A 1LT8A 1K1DA 1T7LA 3G1HA 2EF9A 3GD6A 1IXNA 2E4TA 4RW5A 1QK0A 5D2WA 5FSEC 3GG0A 1GVOA 4HQVA 4QHRA 1LDCA 2GGIA 2DZWA 4FNRA 3E6EA 1E55A 5T91A 4Z1BA 1XJBA 2X41A 5CSSA 1E0TA 1MO0A 3N12A 3THUA 2X7WA 2W63A 5LIKX 4HU3A 4GC3A 5C9XA 1H2JA 1OF8A 3MSDA 2WMGA 1W1ZA 1BG9A 3W53A 2NUWA 4IMEA 3N2OA 2JEPA 4UTTC 1JCYA 3ELFA 3EYPA 4XBKA 4ZQPA 1SM9A 4CKQA 3RU6A 1OK6A 3L4TA 3KCJA 4IP4A 4DYJA 1XIBA 1LLOA 3QHNA 3NJ3A 4HU4A 3TK7A 1H1NA 3NDYA 3P81A 3TWAA 3EDFA 4RPQA 3WLTA 4DZIA 4DJEC 5C54A 5GNYA 2I14A 1NU5A 5HDRA 5FACA 4JQ4A 1MW3A 2XDFA 5DT7A 1DE6A 4U2YA 4O28A 1S2VA 1H1YA 2QR6A 1P7TA 1SO3A 3VGDA 1QWGA 1Q4WA 3VD5A 4X3ZA 3OG2A 1PX4A 3A21A 3AUOA 1TV2A 3VOCA 1NWUA 1R47A 3G1XA 1WPCA 3ZJ8A 4GUIA 3BTNA 3M46A 1EBGA 1O5QA 1Q6CA 4F0SA 3QM3A 4PEEA 2VCCA 1KXQA 2C18A 1GG1A 1KFKA 4B3KA 1BRLB 1CB7B 3CPGA 1FDJA 3BK0A 3ZQ9A 4R7WA 2INFA 1RUSA 2ZUNA 5IM51 4O12A 3RLGA 5CSYA 1PX3A 3W27A 5JH1A 5LXXA 4Z1YA 1BHGA 4RDWA 2D0HA 1V0NA 4GIRA 2Y5JA 4JX5A 4J3XA 3COTA 3EXTA 4J7RA 4IIBA 1ZBVA 3BANA 1UZ4A 4I7WA 4V28A 7TAAA 2WW5A 3GTXA 1Q5MA 3TYCA 4AF0A 1TO3A 3AIVA 1BYDA 3A3WA 4DNHA 1JZ2A 4XG1A 2JF7A 3WK2A 2OFJA 5E0KA 2ESCA 4JTCA 4Q4OA 2JKAA 1ITXA 1VEMA 3WDJA 2YZRA 1WZMA 3LSBA 5FEXA 2Y5SA 5DFAA 1W37A 4FXFA 4YTUA 2E09A 4QQ3A 1EJ7L 5F2MA 1YNQA 4X2PA 5JIWA 3WLMA 3IPWA 3LRLA 1A0EA 4YCPA 1DP0A 4LEFA 2ISFA 3J7HA 1QNSA 4IMGA 4AYGA 4PTWA 2DUXA 3SCPA 3KRSA 1XIJA 2EKCA 2L5HA 3ALFA 4GO8A 3W2UA 3WQPA 1J5TA 1KA9F 1XV8A 2UY4A 1KTBA 5A2BA 4QCFA 2V3EA 5DANA 3MSGA 1AQMA 3QQWA 1R87A 4PA8A 1B54A 1ONXA 4H9TA 1V8EA 3OB8A 3B0UX 3L4WA 1P0NA 2PLCA 4FF5A 1FHDA 4GO9A 1TWWA 3HG2A 4JDYA 3LU2A 3R2GA 3CUJA 3OHIA 4I9JA 3E0WA 4J28A 4Z2IA 1F6YA 1ELSA 3CO8A 3CZKA 1F07A 4IL2A 5D38A 1UP2A 3GVQA 3H7UA 5I5RA 2AMXA 1Z3NA 3ITYA 4H8UA 3QBUA 1ZRQA 1QFEA 1H51A 1JUBA 1J18A 2V6AA 1UJPA 1JUEA 2WC3A 2E5CA 3V5CA 1LL6A 4IIGA 4ZSUA 1VLIA 4PYSA 1E6PA 2ZTKA 5K2ZA 3W7JA 1VCVA 1UWRA 1IGSA 4A2RA 3R43A 2YCIX 3ORWA 2WV8A 4HJFA 2VGBA 2VFHA 7A3HA 2BASA 2NXGA 1IEIA 1VFHA 4YNGA 5BXTA 4XKMA 3TIMA 4UWMA 1W8SA 1UKPA 4XV0A 1EA9C 3UZ5A 1QATA 3TYUA 4B2DA 4JTLA 5JQ9A 4O1BA 2J9ZA 2FYMA 4IMAA 1FBAA 3S46A 1G4SA 3LXBA 5A8NA 3CL8A 1F3WA 1H4PA 4M3PA 5G1YA 3AHYA 3B8UA 1JXKA 4HHLA 1UKSA 2YL6A 6A3HA 4EPEC 4RNJA 1A49A 3GYCA 1K77A 2CCRA 2BSLA 4DUOA 4HZMA 1R9XA 4KEUA 2J7GA 3I68A 2Z27A 1XH0A 3ZLFA 5I3FA 1O94A 1ZJAA 4Y9PA 1XCFA 3M16A 4F48A 4O17A 3KOFA 1QAPA 3RPMA 2GZXA 2OOGA 2ABAA 4E4PA 2Z2AA 2PURA 1OC5A 4HNNA 5AYBA 4C7FA 3XISA 1FH8A 5KMYA 1E51A 3NQ7A 3FJNA 3PP7A 4DO5A 1YPXA 2WJFA 5A6KA 5F7UA 3F2BA 2WHKA 4KWWA 2VYOA 3VGHA 2PWUA 2V2DA 1XHGA 3YPIA 1R85A 4AWSA 2HNEA 3GXFA 4J2PA 2V63A 1EC7A 1OG6A 3REQB 3DUGA 1RCXB 4GQBA 4QX4A 3W0KA 4FXJA 3GW3A 2IW0A 2PDKA 2E5DA 1OX6A 3SJNA 4NZ5A 2YPIA 3AOFA 4D8ZA 3M0XA 4IIHA 3LYEA 4AD0A 2GUBA 3RHGA 1IWPA 3C8NA 2PLJA 4QBXA 3U2CA 2GQ8A 1VPYA 4P7OA 3WQGA 5F1VA 4A3YA 3BZGA 3EKLA 5BOEA 4DYKA 4HA4A 1HNYA 1RSCA 1KQYA 3UFYA 2B0MA 4I8YA 1KKOA 1BRLA 2I7GA 5F4WA 2HPIA 1Z9AA 2TYSA 3WH6A 4IJCA 1ODUA 2XH4A 4BHYA 4MB3A 3WQCA 8CGTA 2V5CA 1MI3A 4UTUA 2GGHA 4AVNA 3V5OA 4D6GA 3T9PA 4YN5A 3VMPA 3M5YA 5A8GA 1JF6A 1QPQA 1J2BA 2OZ0A 1CW2A 1V77A 1NQKA 4C5ZA 3FYPA 1VFFA 4HHPA 1TPDA 1AD1A 4C6QA 2RGLA 2OWWA 3O05A 1K4GA 4BR1A 2WMFA 1H1ZA 3AMLA 3WD3A 2HXUA 4M56A 2XVNA 1HIZA 2I5GA 3FKRA 3GVGA 3W2MA 5F1UA 1YLVA 2A0NA 3P8JA 2QIWA 5I06A 1KFEA 5LIUX 4GXPA 3HJZA 1B1YA 3GO2A 1EDTA 4JZ5A 5HJYA 4CD4A 1OM0A 3M0ZA 1NDZA 3MI6A 1V02E 1R2RA 1V03A 2YIHA 4ZO8A 4LBRA 2PLKA 2Y70A 4S1FA 3BGGA 1KTCA 4IFOA 2PDLA 4JR5A 2HVOA 1HJVA 3CUGA 4GINA 1KXVA 3MV11 1XIIA 1H5VA 2OCZA 2ANUA 2FZMA 3WF2A 1QNVA 2OG9A 4CUCA 3MUAA 1T8XA 1CBGA 3N6JA 1O1ZA 4IPNB 3UZXA 4J27A 1C29A 2G4FA 1VBHA 2X1IA 4AY8A 4XD5A 3K4AA 4DJFC 3VKKA 2A3BA 4J35A 3BOXA 3IVUA 1A5OC 2PDFA 1MW0A 1DKWA 4IPIA 5HJXA 4KW2A 4X0NA 3E0FA 1G5AA 5FAGA 3O6YX 4JOMA 2I9UA 3E2QA 4H9YA 4DZ5A 1B2YA 4GUJA 5CJNA 3CUXA 3PWAA 4PSRA 2OYKA 3W85A 1POKA 4F0HA 4B92A 1FWWA 2X05A 2Q8LA 5EMKA 5IFPA 4LANA 1VEOA 3PNZA 2P3EA 3ONBA 1HW6A 3VKAA 3KDNA 5LNUA 4S3JA 4E38A 2XU2A 3QZAA 3L4VA 2GUYA 4MYAA 4N9DA 2ZA1A 4BQ3A 1XC4A 3BV4A 4QSHA 3UA3A 1GHRA 3TFCA 3AS2A 3R0DA 3KTSA 5G2WA 4L4LA 1HVXA 5BXPA 4Z0SA 3F4NA 4D8AA 1QI5A 4ZB5A 1RQEA 3F1QA 4BFAA 3F5KA 3T0BA 3VIPA 1U22A 3M64A 4O15A 1W5OA 4PODA 3V4BA 3HA1A 3W76A 3UVIA 3MW7A 4H04A 8XIAA 1EHAA 3CC1A 3RM4A 1I2RA 1W32A 4C6FA 5BMWA 3NQ8A 3QHMA 5FJPA 3BCDA 1UMYA 1WX0A 2E28A 4HMEA 3N3TA 4NAEB 2PF8A 1W56A 2DQWA 3P2VA 4I9MA 1FWNA 3NR0A 2OWXA 3WMBA 5B7ZA 3KX6A 1BSLA 1S38A 4WLCA 1R9YA 3KBJA 5AHEA 4Z42C 1OT1A 4DO7A 4HNUA 1V3IA 1TUXA 2CEQA 4D1IA 4JHZA 1JYNA 1E56A 2WJZA 3JRKA 3RDKA 4ASTA 1V93A 1LBFA 1MUWA 3O6CA 3KOYA 3OODA 1J0IA 2I17A 3VIFA 2VVNA 1UH2A 1QU4A 3WQDA 5G1MA 3EZ4A 1WDPA 2J7CA 3PJXA 4WXZA 3REQA 3SB0A 3SUVA 3VIIA 3WMCA 2ZX8A 3BSHA 3MKVA 1LOSA 1THFD 2G41A 2EPKX 1TPH1 2QMKA 1KFBA 1KCZA 2OZTA 4B2DD 1R2TA 3W7LA 1Q2RA 1O60A 4ZVJA 4NIRA 4UOZA 1ZBWA 4JIPA 5LA2A 3BURA 3FXYA 5IXEA 3OGRA 3OZPA 1PCKA 2PWEA 4F2UA 1JCJA 3L9CA 3IEBA 4ZXOA 2QS8A 2WSPA 3S1WA 4PUMA 3B97A 3BGJA 3C52A 3R94A 1RJQA 3USBA 2NLIA 1PIIA 1TCDA 2JBMA 3W1PA 2O7QA 4JHOA 2XM2A 1C9WA 1GVIA 2VX6A 2NXIA 4FLSA 3U5YA 8TIMA 4QXIA 3NDOA 1LRQA 1BVWA 1Q7MA 5AC6A 4B9ZA 1SR0A 3Q67A 3N15A 4AEOA 4KWSA 1F61A 4I9AA 5IBXC 5DO8A 5JMUA 1W0MA 1W3TA 4GI8A 1KWKA 3NL5A 3UXKA 5DY3A 2ZX5A 3PZMA 4EPKA 2PBOA 5TIMA 3C2FA 3WUFA 2BX7A 1Q6FA 1IGWA 5BRPA 3ARZA 3VDAA 1LQ2A 2XVKA 3I6RA 5T9BG 4AUBA 4B3LA 1C3FA 1M5WA 3QPYA 4PUNA 3ABOA 2PC4A 3UXAA 2OEJA 3WDPP 3DX5A 4GQGA 3QRHA 1TMLA 4W8LA 2PAJA 2INEA 1I2QA 3MP4A 2Z1BA 4LB4A 2V3GA 2WQDA 2V2CA 4AEFA 4IFKB 1RJRA 1W31A 2CLIA 1GPWA 1EOKA 3W81A 1IEXA 4XTDA 5HUPA 4LC8A 3SUWA 2Z7KA 3T0DA 2OXNA 3E3HA 2HXTA 2B81A 1AJZA 1GNXA 2CETA 4EAMA 2PE4A 3TWBA 2H8XA 3GQYA 2WVSA 3QH2A 2FFCA 5LNWA 3AISA 4KKXA 4YTTA 2WC4A 2NXHA 3W1XA 1BYBA 4JN6A 2WLZA 1UD8A 3EOLA 1K70A 1VHNA 2AL2B 3HM7A 1US3A 1BD0A 3LHTA 3WMLA 1PKYA 2IPFA 3WLJA 4WJ8A 5DRIA 1CYGA 3N2MA 4E2VA 3W7NA 4WOQA 1X7IA 5HJLA 4MY1A 3W07A 2G95A 1TPVA 2WSRA 1Q6DA 1XPGA 3PBGA 1WXJA 2QT3A 4JNYA 5HATA 1QRQA 3WQ8A 2XH0A 1FH9A 3KP0A 1QHPA 1UWUA 3LQLA 1IT8A 4DBEA 1EX5A 3VOFA 3HBLA 3MCMA 4OOZA 3AICA 1UD3A 1GVQA 4DNMA 3NURA 3VKDA 4Y6GA 3ES7A 3QFEA 4QJ3B 4IQJA 1DEDA 2Y7DA 3QV7A 3U5UA 3WLOA 4LAMA 5I00A 1WAUA 4AIBA 1NDVA 3W1UA 1NARA 4FNSA 4KCUA 4RPPA 2VHLA 1VH7A 5EL1A 4ZSTA 3TJ4A 2PP0A 4M5PA 3NNTA 4MNJA 2WHLA 3BLEA 4JNMA 3B8WA 3VGFA 4GKLA 1I8JA 2OMAA 2FTYA 1F8IA 3W9ZA 4FB7A 1X1NA 1MEWA 3BW4A 3DECA 3FGCA 4DM2A 1G94A 3UY8A 1NJJA 2QPUA 3TW9A 2VT0A 4AWTA 5EY5A 4DF1A 2PS2A 4QG9A 1I60A 3A64A 1KFCA 5H6HA 3IARA 1A3WA 2ZE0A 3GDLA 3K8KA 2QPSA 2JF6A 5RUBA 2ZRWA 2QQ6A 4WJXA 4KPLA 4GH3A 3ZXWA 5M1TA 3H7RA 3GHSA 3A23A 2XIMA 1JCNA 5A5WA 1MNSA 2PRMA 4GYPC 4PR4A 1M01A 3OU8A 5JXQA 4KQNA 3NZ1A 4ZODA 4WSKA 4MZYA 3TSMA 3TAOA 3U2ZA 4J4KA 4LUSB 4Z0JA 4JFWA 4Z17A 3APTA 2DPEA 5AFDA 3LV6A 4GRSA 4MADA 4B5NA 2Y85A 3R89A 4MNLA 4XO6A 5CC3A 3VNJA 2ZRUA 3GFXA 4ICCX 4ZOCA 1HQTA 3AIQA 3GK0A 4LY4A 4EXBA 1O95A 3ZT5A 1OFQA 2FPYA 2DZUA 4ORMA 4LVAA 1H41A 3MUCA 1XLHA 3RMEA 3MYOA 1YYAA 5C8BB 1CLVA 3HPFA 2Z25A 2VKZG 3Q58A 1Q6LA 1FWIC 5I3IA 3EWDA 3W28A 3MYPA 2BMBA 3G1SA 3NL3A 1BWKA 4L4OA 4CU8A 1OT2A 1GJWA 1Q45A 3N2BA 3LNPA 3RN6A 2YR1A 4JTJA 3PG8A 4H8HA 1KCLA 1PDZA 3MHGA 4B5XA 3IK2A 3GXMA 1RCOB 2F7FA 2ZXAA 1LWJA 1PTGA 3PZOA 1A5AA 3OIHA 4WKFA 3WQ4A 1HO4A 1A5NC 1KV8A 4IGSA 3WFZA 1E9YB 3L68A 1D8WA 2AQOA 1M04A 4FR1A 2HS8A 4ES4A 3W88A 3E0LA 1JCTA 1M7JA 5B80A 4FNUA 3CIXA 3DFQA 2B4GA 4C1NA 4ATWA 3TXZA 3NL6A 1GUVA 3PB0A 5EYWA 3RNDA 3LHVA 4ZOAA 1UWTA 1EX1A 3THQA