5D4YA

A psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
331
structure length
314
Chain Sequence
b'QGLKDAYKDYFKIGVAVNNRNVADPDQIKVVLREFNSITAENAMKPQPTEPKKGEFNWEDADKIADFCRANGIKMRGHTLMWHSQIGSWMYQGNLLSKEEFYANMKHHIQAIVNRYKDVVYCWDVVNEAVADSPVYPGRPELRNSPMYQIAGEEFIYKAFEYAHEADPDALLFYNDYNDAEPAKSQRIYNLVKRMKDAGVPIDGIGMQAHYNVYGPTMKEVDDAIKLYSTVVDHIHLTELDIRINEVSDWERTLQQDQYVQLFKVLRKHKDVIDCVTFWNVSDKDSWLGVRNYPLLFDENYKPKQAYNAVKNFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase
publication title Structural insight into potential cold adaptation mechanism through a psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase.
pubmed doi rcsb
source organism Environmental samples
molecule tags Hydrolase
total genus 120
structure length 314
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5d4yA00
4UNIA 1JYXA 3NUKA 4DWSD 3MO4A 1PBGA 5LA1A 3CHCA 2O9RA 4PTXA 1UD2A 1X1NA 3TTOA 4PMQA 3S2CA 3VGFA 1CLVA 1KGXA 2XYLA 2VZVA 1DWIM 3VMNA 4CKQA 2E8ZA 3LPGA 4AIEA 2DIEA 2ESCA 1EDGA 1IT0A 4D1IA 1WPCA 4ZE4A 1F4AA 2VURA 2ZOXA 2WSPA 4WJXA 2DEPA 2PBGA 3VIFA 2XIBA 4GQQA 5I6SA 3CHFA 4EANA 1B3ZA 2XVLA 3CMGA 1EOKA 1UH4A 4PN2A 4JZ5A 2D2OA 2F61A 2FHFA 2OSXA 1C92A 2DT0A 2CESA 2YL5A 3EMCA 4IPLA 5TD4A 1GQIA 1HVXA 4AD4A 4UFJA 3UESA 1B9ZA 1GJWA 3IK2A 2DGAA 1R86A 2X09A 3L4XA 1CXKA 2OSYA 3GXFA 5E6ZA 3ZQ9A 3II1A 5JUVA 3VGDA 1AQ0A 4H8VA 4UTFA 3WF0A 5A6SA 1UG6A 3WQ8A 3EBVA 4D6DA 4JL2A 3QOKA 5D8ZA 3OZPA 1B2YA 4AEEA 2XSBA 2WMHA 3WNOA 5D4YA 1D2KA 2WHMA 2TAAA 1MW2A 3IAPA 3NDZA 4Z2HA 2WVUA 4JHOA 2PBOA 5M5DA 3CIVA 1ECEA 4J7RA 1HJWA 2ZXAA 2EBNA 1UA7A 1KXQA 5DT5A 4BQ3A 3VM5A 2WC7A 2WCAA 3BLKA 2XM2A 3NSMA 3AXHA 1RP8A 1OM0A 1WDSA 4J28A 1NP2A 5E6YA 3WFZA 1MQPA 1QBAA 2DDXA 4Z2GA 3DHUA 3ARWA 2J78A 3HU7A 3W38A 1EH9A 3WUBA 5BXTA 1E6QM 2ZE0A 2VT0A 3PZ9A 3QGVA 1MFVA 3MS8A 3AOFA 1J10A 4CVUA 2WKLA 1V3JA 1FOBA 1UD4A 1ZS2A 2YDQA 5A8MA 1O7AA 1UWQA 2D0GA 1JZ8A 3E1F1 2WZEA 1EHAA 3AIRA 2JF6A 4NSBA 1JYNA 3DYOA 4A3YA 4X0NA 5FL0A 3NSXA 3PZNA 5A95A 1DHKA 4W5UA 1WE5A 5D9PA 2EPMX 4IUGA 1OT1A 2W91A 4XUYA 3THCA 5ABHA 1NOFA 1QW9A 5FIPA 1V3MA 1JG9A 3ZT5A 1NOWA 2X8RA 3GZAA 3RDKA 2GDVA 1BSIA 3PTKA 4AY1A 2BHUA 2DPEA 3BMVA 1NWUA 4AMCA 4QLLA 1FP9A 4CN6A 5A6MA 4PMZA 1JIBA 1TUXA 3CUJA 2EPNA 1X6NA 4M29A 2WLZA 3SCQA 3VIGA 3CUHA 5HDRA 1C8XA 1B0IA 3ZM8A 1QHZA 3ZOAA 1BYBA 1WDPA 4BS0A 4B3KA 1TFVA 2XIIA 4QFUA 1OB0A 1G5AA 4PTMA 2QMJA 1E9LA 3W6LA 1R87A 2FHBA 1C93A 3BAYA 2XSAA 3WNNA 1KGWA 3VKKA 2CBIA 3ZJ8A 1N82A 2DH3A 3VM7A 4OIFA 3BCFA 3CMJA 5A8NA 2NSXA 4BQ5A 4PTWA 4H8UA 1JYVA 4XX6A 4AIOA 2G3JA 5HNNA 4MTVA 4GINA 1MW3A 3W0KA 4TUFA 3W6MA 3UETA 4OBRA 2VO5A 2CEQA 3MMUA 3N18A 4AW7A 4YPJA 3AZSA 2WBGA 1EA9C 2BV9A 4PMXA 4W86A 3DC0A 3MSDA 4JFSA 1JZ6A 1E71M 5I79A 3W29A 1J01A 2J74A 3VDCA 1V0KA 1JNDA 1TA3A 3BAJA 2AMGA 5BCAA 2FDMA 2VC9A 1I1XA 1UR4A 1G9HA 2ZIDA 3WF3A 2WAGA 3WD1A 4PBGA 3W28A 2YL9A 5I2UA 4CGTA 1OD8A 3AFBA 1LL7A 4UCFA 1E4IA 3VDHA 3VNYA 3TTQA 1V3KA 1G0CA 2WHJA 2WYSA 3PHAA 3SCTA 5HPCA 4UQDA 3BSGA 2G3IA 3CBWA 1OINA 3AHXA 1CDGA 1Q6EA 3WD2A 2NT1A 1KQZA 4HMEA 1BLIA 4V27A 3CLWA 1CIUA 3JUGA 3T2OA 1BYCA 1ISYA 1EOMA 1MWOA 4DUXA 3MUAA 5CJ5A 1JNEA 3KZSA 4MB3A 1WZKA 5GQBA 3OGRA 3RIKA 2Y4SA 2J7GA 4DM1A 4PUEA 2OWWA 1LJYA 2D0FA 1NWSA 2GJPA 3PBGA 4W8AA 2BHYA 1RH9A 3AISA 2CHOA 3VILA 1FP8A 4XB3A 1L8NA 4D6EA 1E4NA 3CGTA 5I77A 1CYGA 5A69A 2OYLA 2VQUA 4FLQA 5KZ6A 4Q7NA 4A3HA 2VRKA 1CBGA 3TONA 1E6PA 1E5JA 1V6YA 3VGHA 4TVUA 1E6RA 1LF1A 3AS2A 4D1JA 3BMWA 2X2YA 1QNPA 3TTSA 1E15A 3AI0A 1GOWA 2OLHA 3SUWA 2ZX9A 1BPLB 4MNKA 3WMSA 1XD0A 1NQ6A 4A4AA 3AHYA 2WCSA 1JDDA 1PZ2A 2YA0A 1VBRA 2QLYA 3AZRA 3GXIA 3WBEA 4U5KA 1H0GA 3T08A 1CXFA 1ITCA 1GHRA 2WW5A 3GTNA 1QVBA 1B3YA 2CETA 1DP0A 2CKRA 2A3BA 3W4RA 3ZT6A 1UZ1A 3UCQA 2HISA 3B8SA 6CGTA 2CKSA 1WZLA 3GBDA 2Q8XA 4PTVA 3SURA 1E1EA 3BAWA 1LWJA 3VVGA 4AD2A 1AQHA 4W8BA 1HNYA 1I75A 4W7VA 5CSUA 5A6BA 1WZAA 1ISXA 2A3EA 2WMIA 4UQEA 3A6OA 2X05A 1UWSA 3SCSA 3UG3A 1QNRA 3NJ3A 4D6HA 1CEOA 1JAEA 1PAMA 3AIQA 2E9LA 8A3HA 1VRXA 5I0DA 2J25A 2J8FA 1WKYA 1E6SM 3BXWA 3IJ7A 5CZKA 2BXZA 5BXRA 1B31A 4ZENA 2JFEX 4EKJA 1LG2A 2VCCA 5I5RA 2XVKA 1KR0A 1VFFA 2VVSA 2FGZA 3BSHA 1OIFA 4F66A 1J0KA 1EIBA 2DSKA 4PRWA 4KMQA 3AHVA 5JIPA 1UHVA 2D23A 4EK7A 3AZTA 3U7BA 4B9ZA 1HX0A 5E9AA 5DEZA 3CUIA 3CTTA 4YN5A 1XSKA 1PZ3A 3MU7A 1QNQA 4U3CA 4AD0A 1RD6A 2VL4A 2YL8A 3F5JA 3FXYA 3VPLA 1AMYA 3VD7A 4PCSA 2XVPA 5FKYA 1B3XA 3ARUA 2GSJA 1UWIA 3WN6A 3KE0A 1O6IA 5FD0A 4DM2A 1DTUA 2VTFA 4GO9A 3ARXA 1W1PA 1JZ2A 5D8WA 3PN8A 2AAAA 2WWDA 3S6TA 4FF5A 4GKLA 1VEMA 1MVYA 2V3GA 2XWDA 1GJUA 4U2YA 4WIWA 3AIWA 3CO4A 3CZGA 2OWXA 1JXKA 1BAGA 3VD9A 4HA3A 2WXDM 4P8XA 1GORA 2UY4A 1QI4A 4AC1X 3APGA 2FHCA 4IPNB 2VMFA 1BFNA 4UQAA 1IZJA 4P8VA 1K9EA 2XVGA 1Q6DA 2PC8A 1V6WA 4W8LA 1OIMA 2VX4A 2WKGA 2G3NA 1X6LA 2WHKA 2GJRA 2YOCA 3L2LA 3WF4A 3ZJ6A 1E3ZA 1UR2A 2J7CA 5I78A 4W7UA 5I3DA 3ZJKA 1HIZA 3VIPA 2Z1KA 1E5NA 5DFAA 5E70A 1CXIA 5D9NA 3VTRA 3G6MA 4PEEA 1R85A 1E56A 5GNZA 4Y7EA 4HA1A 4UZSA 3VX0A 1UKSA 4AD3A 2O9PA 2J75A 1HP5A 1FH9A 4GQRA 1VB9A 5EBAA 1GNXA 3QOMA 2CBVA 2CPUA 1UWRA 4F8XA 2J77A 1J18A 4JFTA 2OYKA 4KGLA 3WDRA 5EFDA 4LYRA 4S3KA 3WMBA 1QNSA 3BLPX 3G6LA 1CGYA 1KR1A 2W5FA 4D6FA 4ACZA 1E6XM 4PMUA 4WK9A 3A4XA 1E1FA 4HOXA 4J3WA 5IHSA 3ZSTA 1K6AA 1Q4NX 1UKQA 5A6LA 1M03A 1XV8A 3J7HA 4M8UA 4R5EA 3IAQA 4UFLA 5IDIA 4QP0A 2XWEA 2YKKA 3VU2A 4B9YA 1CXEA 5AYBA 1QPKA 4HA4A 4RE2A 2J7BA 3UEQA 4GIAA 4CN4A 2DT1A 4UFKA 1H41A 1C8YA 2W4XA 2O9TA 4UFIA 1PIGA 1J11A 1J0HA 3ZR5A 1D3CA 3ARRA 2V38A 4R27A 4BF7A 1TMQA 1AVAA 1B3WA 3O6AA 3ECQA 4DWSB 3AIBA 3B9AA 4KWUA 1GOIA 4UOZA 1BVZA 2PWGA 1NWRA 1XC6A 4C7FA 1JI1A 3TA9A 1WAWA 5A6BD 2WMJA 2J79A 3I3BA 2W66A 4F79A 1ZL1A 1W2VA 1J0JA 1JFXA 1JF6A 4PMDA 4L4OA 1Q6CA 4KRUA 2DIJA 4W85A 1G01A 1WB0A 4AZGA 4H41A 3W25A 1ZBCA 2RGLA 2BY1A 4RL3A 2E4TA 4JCLA 1BHGA 1JZ3A 1BG4A 1EO5A 3PZVA 4AXNA 2JEQA 3PZTA 4GPNA 3K8MA 1E43A 2VQTA 4MADA 1JF5A 1OWQA 1M7XA 4WKHA 2WPGA 5A3HA 2PWDA 3L4VA 3SUUA 4AEFA 2BY3A 4BZYA 3CZJA 2YJQA 1E4MM 2QMKA 4LPCA 4AZCB 1HL8A 2F2HA 2XVNA 3DECA 2GK1A 5A8OA 3AHTA 2WM0A 3AMDA 4OUEA 1S46A 3EDEA 4OZOA 1V03A 4FLSA 1E40A 1E4LA 1UR1A 4M24A 2J7HA 1MYRA 4CN1A 3GH7A 4J3XA 1P6WA 3WNMA 1HJSA 5FOOA 3B9DA 4AISA 3WQ5A 1EDTA 2E9MA 3BC9A 4TXEA 2YDRA 3RM8A 3NSNA 4AZ6A 2GUYA 2PB1A 4M1RA 3A47A 4QLKA 5A6AA 1GOKA 1H3GA 1VF8A 5CPTA 3VD4A 4D71A 2XTKA 2QV4A 1DWJM 4MJ4A 4GI9A 4UOJA 3GNRA 1G94A 4D6JA 2WVVB 2XFRA 5HBFA 2ZX6A 3N11A 4FLOA 1R8LA 4LGXA 3L4YA 3GM8A 2CCRA 3MV01 1E6ZA 2ZXQA 2V5CA 1LL6A 1K9DA 1KGUA 6A3HA 4TOQA 3CHEA 4RE3A 2ZX8A 5ABFB 1LL4A 2ZUUA 4WLCA 3ARYA 3AMLA 2WANA 4JAWA 3GXDA 3CZKA 1W3HA 1A47A 3ZR6A 3ZT7A 4HMDA 1EHNA 4D6GA 3WH7A 1V02E 3AHZA 5GNYA 4N42A 1HXJA 4GZJA 3MANA 3TOPA 4BA0A 1XRVA 2GJXA 1UR8A 4JFWA 1CXHA 4CU8A 1UD6A 2D0HA 1UKTA 1XH0A 1LQ0A 3FW6A 4J3VA 1YQ2A 1G1YA 2W61A 2CYGA 2D22A 2E9BA 1VAHA 1VFOA 4CD8A 1QHPA 4TTUA 3I3EA 2JIEA 1XCXA 3QHOA 3A3HA 3W82A 4TTGA 3AIVA 3MUZ1 1QI3A 3W81A 3WQWA 4CU6A 5CGTA 5M3WA 5CPQA 1CGUA 2A3CA 3ZO9A 3SCPA 5ABEA 1U2YA 2WLYA 1EQPA 1V08A 1CXLA 4MPKA 1RPKA 1V0NA 1W9XA 1CECA 1GQJA 3EDFA 1FHLA 3OGSA 4QLJA 3VD5A 4MNMA 3FHAA 2ZXBA 4ACYA 3I3DA 3W27A 4UFMA 2XHYA 1JZ4A 3T2PA 5D9MA 5A8QA 4D6IA 9CGTA 3RPMA 4CCCA 3BH4A 3L4ZA 2ZXDA 2XPKA 4V28A 5ABGA 3OGVA 2EXOA 1E55A 5GPRA 1I1WA 4MB5A 4CU7A 1HVQA 2WZIA 4EAMA 3WDPP 1FA2A 2Y8KA 3ALGA 5C71A 5FL1A 2D3NA 2VX5A 1XYZA 1ODZA 4U2ZA 3DYMA 2DT2A 3WH9A 1DWGM 3U57A 2V5DA 3WEMA 1DEDA 1HKJA 1SR0A 4UR9A 4ZEPA 2XG9A 3VMOA 5M03A 1NOUA 1JXJA 3SCVA 3VIIA 4UFHA 3OBAA 4ATLA 1E0XA 4CCDA 2EPLX 2VZTA 1W3LA 4MNLA 1E0VA 3SEPA 4CVWA 4J3UA 1KCLA 3NIYA 3GNPA 4TX8A 2OWCA 5A8PA 1VEOA 4AD5A 1BYAA 3AIUA 3VOCA 4HU0A 3QR3A 4W89A 4UOQA 3KEHA 2YBUA 4KGJA 3EMQA 3VIOA 5A6KA 4H8HA 3GH5A 5CPSA 3WIJA 3VD3A 2VX6A 3WNPA 4MNJA 2EJ1A 4RE4A 1QW8A 2V3FA 2E3ZA 4GZIA 4IM4A 3CZ8A 1L0PA 2YLAA 1J0YA 1OGSA 4LXFA 5E09A 5DMYA 4XZWA 4H04A 2UY3A 5A1AA 3LMYA 3AS0A 3KL3A 1IZKA 3SCOA 4W87A 1ZBVA 4Z2LA 4TVCA 3MMDA 1UD8A 5HPOA 3SUSA 1U33A 2WHLA 3VGEA 1JL8A 2X1IA 4JFUA 3MUIA 1C90A 1W9VA 1H49A 2OYMA 3BAIA 4IISA 2D24A 3WD3A 4JL1A 1E72M 3VX1A 4ATWA 1US3A 2GVYA 2DSVA 1UOKA 1W32A 1V6VA 4J3TA 1MW0A 3AMKA 1FFQA 3FAWA 3M6DA 3HN3A 3AJ7A 2DSWA 2ZUNA 3CZEA 1JDCA 2XGBA 2DQXA 2CERA 2WC4A 2XFYA 4ZXOA 5JBDA 1C7TA 1H0IA 3OLIA 4AZ7A 1V0LA 1KQYA 1WO2A 1K9FA 2BS9A 2FGLA 2QHAA 2Y2WA 1HKIA 4E8DA 1GOOA 1V02A 4DUVA 1HJQA 1JYWA 4E8CA 3T0AA 1R7OA 3K8KA 3SUTA 4UZUA 3AMCA 1PX8A 3EDKA 3ARZA 1QI2A 4P7QA 4S3JA 4X0VA 3PZOA 2BFGA 4P8WA 1UH2A 1BF2A 1ITXA 1W9PA 1DWHM 2C8NA 4PSRA 4P8UA 5E0FA 1LG1A 3MKKA 4MAZA 2JEPA 1W1YA 3T0BA 3LPOA 3FN9A 4AD1A 3W26A 1E3XA 5KEZA 1J0IA 4FLRA 2BVYA 1DWFM 2EQDA 3AYRA 2IXVA 3O9NA 5DO8A 3WD4A 5AC5A 1K9TA 1JDAA 3UERA 7TAAA 1SMAA 2Y8VA 1ZU8A 4AZIA 1H5VA 4Z2IA 4AWEA 1B3VA 2XJ7A 3RJYA 1W1TA 4PUDA 2X0YA 2NT0A 2VR4A 1WCGA 4B16A 1HKMA 4J27A 3AQUA 3UR8A 3RMEA 5EMYA 3SCUA 3WNLA 4HTYA 4K68A 1ISVA 3QHNA 1XH2A 1J9YA 4GI8A 1UKOA 1JD9A 1IV8A 3MUY1 5BYWA 3O2LA 1JFHA 2O92A 4F9DA 5I23A 1PX4A 1E0WA 3NCOA 3WQ6A 4P7OA 4Q22A 4M80A 3VGGA 2Y5EA 1TCMA 3K4DA 3T0DA 4HP5A 1GPFA 3WL0A 3ARPA 3PZQA 3AS3A 5D9OA 2ZUMA 1TA3B 5HXMA 4M82A 2QPUA 3CUFA 4M56A 4YHEA 2DH2A 4OOUA 5A6JA 1F4HA 1NARA 3ZMRA 3WEZA 1KBKA 1OCQA 4AZBA 1JGIA 4JKKA 3GNOA 4CCEA 2VZUA 2XFFA 1SYTA 2VCAA 1RP9A 4BQ4A 1CLXA 2WVTA 2JIWA 3ZSSA 3OIHA 4BQ2A 1WZMA 1CPUA 1BQCA 1CNVA 3BCDA 4QAWA 1GUVA 1UD5A 2VZSA 5BRPA 2PWFA 3D5HA 3WDQA 2D1ZA 2W67A 3ZJ7A 5EB8A 1B1YA 2G4FA 2IUZA 4F9JA 3MSGA 4QDMA 4H7VA 1EDQA 1GOQA 3ALFA 2J4GA 2RGMA 1E73M 4CD6A 1OGBA 2GDUA 1H1NA 1KXTA 1EGZA 1XSIA 1MQRA 1GQLA 3WH6A 4OBSA 1C3FA 3B9EA 2QPSA 3EDDA 4NI3A 4AZHA 1D7FA 2WMKA 4CUCA 1UQYA 1PEZA 5BRQA 3N12A 4P7RA 1ISZA 2WBKA 1NWTA 1QI0A 3VGBA 1HKKA 4UQBA 1JZ5A 2V3DA 2VUYA 3WF2A 3OG2A 1UWTA 1XHGA 3IANA 1PIFA 3WUGA 2EPOA 4PMNA 3GYCA 3VIJA 5ECUA 4LYQA 5E0CA 2WC3A 2G3MA 2EO7A 4ZXLA 3UG4A 1KWGA 5LA0A 2EEXA 3BAKA 3NDYA 2PF0A 5LYRA 3MMWA 2VVNA 2YDSA 2CIPA 1TVPA 1H2JA 3WL1A 5EFFA 1VBUA 5BWFA 4URIA 3U5UA 5F7UA 1EXPA 2CXGA 3WH8A 5A2AA 2J7EA 4MB1A 2ZX5A 2JF7A 2Z1SA 4AIUA 5JIWA 1SFSA 3VO0A 4W84A 3KL0A 4B3LA 3U5YA 4JIEA 1GHSA 4KRTA 3SCNA 4HZ6A 4DUWA 2D20A 2F8QA 1Q6GA 4U3AA 3VMPA 5BXPA 1FFRA 3SCWA 1NM9A 5FCZA 3AIEA 3WUFA 1XH1A 3BGAA 4BCEA 3RJXA 2WMIB 3IJ9A 1CTNA 2BXYA 4HU8A 4PSPA 1KWKA 5DT7A 5C70A 1J0ZA 2VCBA 2HVMA 2ZICA 4U31A 2BNJA 2D3LA 4P7NA 3F4VA 1UUQA 3GXMA 2EPKX 4XZBA 2DSZA 2E40A 4PMRA 3A4AA 2MANA 1ZBWA 1MQQA 4EE9A 1SMDA 1ISWA 1HN1A 2YLLA 3ZIZA 4CD7A 4GZEA 2FH6A 3WBAA 1QHOA 3K46A 1HL9A 1QNOA 4GI6A 4LYPA 2AOSA 1B30A 1GVYA 1KXVA 4NF7A 1E6NA 1ODUA 1GOMA 3VIMA 2UY5A 3ARTA 4OOZA 3N1AA 3VUPA 1ZJAA 2ZUWA 1Q6FA 2Y24A 5LA2A 1UKPA 3WQVA 4HPGA 4PCTA 2PI6A 1FHDA 2JALA 2QF8A 6TAAA 3RILA 2XUCA 5A2CA 2CHNA 3SCRA 4DWSC 3U7VA 5IFTA 2B31A 3UR7A 3GBEA 4PMYA 3WDJA 3TTYA 3CPUA 2J62A 2DSUA 5CGMA 2WSKA 4UQCA 5BXSA 3HMCA 3CH9A 4HMCA 4HOZA 1FH7A 1WP6A 3WQ4A 5I24A 2W92A 4QCFA 1C8QA 2J7FA 4Z2KA 2WZHA 3WF1A 1CGTA 1QBBA 2WB5A 1TZ7A 1HF6A 1UH3A 4JKMA 4D72A 3VDAA 2E0PA 4E4PA 1GONA 2J47A 4MDOA 4V2XA 3N04A 1UR0A 3WDIA 3VIHA 1GCYA 3T2QA 2YA2A 4CD4A 3THDA 1CGWA 2J8GA 1C7SA 3PZUA 3WEOA 2VJXA 3N9KA 2X0HA 3GDBA 4N0RA 4TVDA 1W9UA 4JFVA 1VEPA 3WH5A 1JAKA 1Y7VA 2UY2A 1AQMA 1GQKA 3CHDA 1BGAA 1BYDA 1V0MA 3M07A 1UQZA 2BY0A 3ARSA 4NRRA 1EQCA 2OSWA 1UD3A 3RM4A 3AMGA 1BVNP 5A94A 2VX7A 5CLWA 1W3KA 3PTQA 1W3JA 3K8LA 1W91A 4C7GA 5JBEA 1CGVA 4U33A 3VDBA 4C7DA 4TX6A 5M17A 2FH8A 1E70M 3W24A 2IXUA 2BVTA 2BY2A 2WCGA 2BVDA 1B90A 1C91A 1ZB5A 1PJ9A 7CGTA 1NH6A 2VI0A 1JZ7A 1UWUA 5C8BB 3RO8A 2ZUTA 4ML4A 3WFLA 5CXPA 4PMOA 5IXEA 2VOTA 1CENA 1OBAA 1VIWA 2ZX7A 3KL5A 3WY1A 1CGXA 4KH2A 3WENA 4YHGA 4W7WA 2WWCA 2PWEA 3EYPA 4GXPA 2YIHA 4CD5A 4W5ZA 5CQ1A 4ACZB 1V6UA 3W37A 2PWHA 1KCKA 3AXIA 4FMVA 1TVNA 4OKDA 2VNCA 3POHA 4PMVA 1JI2A 2C0HA 3FHQA 3IJ8A 3L4TA 1R7AA 4E2OA 1V6XA 2WNWA 5IFPA 5A2BA 2ZUSA 1UR9A 1KFWA 1HP4A 3AS1A 3POCA 1MW1A 1TG7A 5AYIA 4MB4A 4HOWA 1CWYA 5HOSA 2CBUA 1ESWA 4DWSA 3N15A 3N17A 3OLEA 3RM9A 4AZ5A 1UZ4A 2DT3A 1WDRA 3F5KA 3BAXA 4H2CA 1W9DM 4X9YA 3QHMA 2WMGA 3MV11 1US2A 3FY1A 3PTMA 3ARQA 3KWXA 3A4WA 4WKFA 4M81A 5DF0A 3VIKA 3SUVA 3PZGA 2YA1A 4MAVA 1BG9A 1OD0A 3W53A 5CLTA 1XSJA 1PX3A 3WSUA 1HT6A 4L4PA 1VFMA 3K4AA 4B15A 2A3AA 1KBBA 1MXGA 3OLGA 1GW1A 3F5LA 3D3AA 1M04A 1XD1A 3DYPA 4ATDA 4AZCA 5BROA 2C7FA 3VINA 3LPFA 4HZ7A 2W63A 2YL6A 2GK1B 1TE1A 1QI5A 3GH4A 2O9OA 2VRQA 4FK9A 1ZBKA 1J12A 1ZJBA 2CNCA 2YBTA 3ARVA 2WK2A 1M01A 4PYSA 1UYQA 3T09A 4Z2JA 1VJZA 2VR5A 1WNOA 1KXHA 1DWAM 1VFUA 3EMZA 4GO8A 3CZLA 1V3LA 4XV0A 4QCEA 3FNDA 4W88A 5AC4A 4UQ9A 1HJVA 1XGZA 3K1DA 1H11A 3M7SA 2W62A 4JKLA 5JBFA 4P7LA 4OJYA 1Z32X 2WVVA 5CG0A 1W9BM 1OT2A 2J7DA 2ZWYA 1HJXA 2VRJA 4NRSA 1TR1A 4WF7A 4WSJA 1V3IA 3TP4A 3OA5A 4JCMA 1VENA 2G41A 3NYDA 5ABFA 3AICA 2WMFA 3L2MA 3L4UA 4WKAA 1W2PA 2VZOA 4NZCA 3M46A 1EO7A 3VNZA 3DHPA 3OZOA 1WDQA 3AYSA 2GJXB 3WELA 4U5IA 3N13A 2UWFA 2JE8A 3WKZA 4HZ8A 1A3HA 3AXXA 3HJEA 3OLDA 2E8YA 2V3EA 4LX4A 1BGGA 4LQ1A 4ZFMA 4J3SA 3AROA 3PZMA 1MXDA 3FAXA 3L4WA 3WMCA 1MFUA 8CGTA 1HJUA 5IHRA 4ZE5A 3WD0A 1LWHA 5GNXA 4WSKA 1NP0A 1FH8A 2XGIA 4JHZA 4HPHA 1GVIA 1OGGA 3WDHA 1PPIA 1XCWA 5CSYA 2CBJA 1KB3A 1JD7A 3PZIA 1UA3A 3OB8A 3SIMA 1VJSA 1M53A 2CITA 1GZJA 2G8ZA 4D6CA 1OSEA 1QOXA 1YHTA 5AY7A 1W1VA 2BHZA 3LPPA 2ZUVA 1CZ1A 2GFTA 1U30A 3EDJA 1H09A 4MJ2A 3RCNA 2A3HA 3CUGA 3UG5A 3WNKA 2XM1A 7A3HA 1H4PA 3WUEA 1V3HA 1BTCA 2WVSA 2NW0A 1XYFA 2ZWZA 4MDPA 4W93A 1LLOA 4AYSA
chains in the Genus database with same CATH superfamily
1JYXA 4YNGA 3MO4A 3U48A 4QGCA 3CHCA 3BICA 4IFRA 2PDWA 3ELFA 1XIIA 1CB2A 4PMQA 5I3HA 4IH3A 1CLVA 2QJNA 1M7JA 4M1BA 1R9ZA 5DQPA 3GDMA 2R94A 1TPDA 3PSVA 3VC5A 1TO3A 3ZWTA 2DIEA 1H7RA 1RJPA 3NQBA 4D1IA 1WPCA 4ZE4A 5D33A 1F4AA 1EC9A 2ZOXA 3G1HA 4Q8NA 4Y8FA 4LF2A 2ZVIA 3A24A 3VABA 2DEPA 2KAUC 2PBGA 4GY0A 3VIFA 2FPVA 4LC6A 5I6SA 1Y5XA 1UH4A 3EOSA 3MT1A 4IUOA 1C92A 2UBPC 2A5HA 5CG7A 3TYZA 4MWAE 5D02A 4UFJA 1K8ZA 3TW7A 3BTNA 3IK2A 5HJLA 3L4XA 3BOFA 3W7QA 2Y7GA 3I6RA 4F2TA 3ZQ9A 3LMZA 2ZVRA 4H6KA 1TJ2A 4GBUA 2QUVA 1IQ8A 3E02A 2Q09A 3KTXA 3WF0A 5A6SA 3EPNA 1OFPA 1OJXA 1P6CA 3QOKA 3B8WA 3MZNA 3ORWA 3OZPA 4M5PA 4CNOA 2IKJA 2XSBA 2HV5A 3M64A 2RDXA 2WVUA 4GNJA 2PBOA 3NQDA 3CIVA 2D2HA 2YZRA 2EBNA 1ME8A 1UA7A 4O52A 3FLUA 3O7UA 3QFWA 3AUOA 3BLKA 4HYRA 2XM2A 3NSMA 3AXHA 1RP8A 4MWAC 4AVFA 4J28A 2QF7A 4HU3A 4DF0A 4L61A 3DHUA 3ARWA 5K9DA 3TN5A 2QVHA 3S9ZA 5BXTA 2ZE0A 4GCAA 3QGVA 1SZGA 1ELSA 3BLLA 4QJ3B 3S3GA 2ABAA 1GOXA 4XBKA 3B0PA 1UWQA 1RXOB 2UV8G 1EHAA 3ABXA 2DVUA 5LXXA 2JF6A 3VNLA 1JYNA 4A8NA 1PKYA 1DHKA 3C61A 2QCNA 3JVAA 5D9PA 4GYPC 1OT1A 2Y7EA 3K4WA 4NZ3A 3S1UA 4XUYA 2OZ3A 3WBYA 5DCDA 4RXGA 5GJNA 1NOWA 1BSIA 2CLLA 5D2WA 4AY1A 4AMCA 1GW9A 5H2ZA 1FP9A 4L6OA 3SGZA 4PMZA 3D3FA 5G4WA 1TUXA 3CUJA 2XH7A 4M29A 3RFAA 3CUHA 5CPMA 3UXKA 4F0HA 1C8XA 1B0IA 4EXAA 1WDPA 2RH9A 1VQTA 5AHEA 3UFYA 1OB0A 4PTMA 2PLKA 2FHBA 1VBGA 2XSAA 3WNNA 2QZRA 3TNBA 2CBIA 1N82A 2WZMA 4JR5A 4OIFA 1P0NA 3FVMA 3G3DA 5A8NA 4ZA0A 1UP3A 1FXQA 2NSXA 3REQB 3B8IA 3PANA 1T5AA 2PTDA 3WQGA 3NNTA 4L9ZA 4JEQA 3PM6A 4AIOA 3PF3A 3VZXA 1MW3A 3G1FA 4PB5A 4PA8A 3F4CA 4YPJA 4KS0A 1QWGA 3SQSA 2R24A 2WBGA 3QPEA 2ZA2A 2E5DA 3GDTA 3W6YA 4JFSA 2J8TA 1XG4A 3V36A 3QR0A 5I79A 3UWQA 1GZGA 2J74A 4U28A 3QZ6A 3A12A 1RPXA 1TA3A 3BAJA 4JICA 2GVLA 2VC9A 5ECVA 1I1XA 4JIHA 4QAIA 4KESA 4PC8A 2PD9A 4IPPA 3BW2A 4AVOA 3W02A 1EB3A 4CGTA 4KIEA 1OD8A 1XFBA 3LXBA 4JY9A 4LS0A 4UCFA 3LQLA 3L23A 2NQLA 3TTQA 1I60A 1V3KA 3DERA 2WHJA 3SCTA 1RALA 4MJMA 4UQDA 2BX7A 3BSGA 4A22A 5F4XA 1POJA 1OINA 3PPGA 3AHXA 1Q6EA 2DIKA 3R11A 2Y8UA 3MI2A 3K2GA 4ECLA 1BLIA 1I8JA 2P3EA 3T2OA 1EOMA 3S42A 4DUXA 3OQEA 4NAFB 1AD1A 5AKQA 1Z44A 3L5MA 4J9JA 4ZB0A 5GQBA 2CLOA 3IJQA 3IPWA 1EF2A 3GDRA 1LJYA 3PBGA 4WSHA 1NY1A 1RCOB 4PUKA 2CHOA 1FP8A 1L8NA 1D3HA 2OZ0A 1XLEA 3TONA 1E6PA 3IGXA 1WBJA 2J27A 1UIPA 2X2YA 3TTSA 4HK5A 1ONEA 2V5BA 2ZX9A 4MNKA 3LSBA 3CQKA 4NJHA 1WYIA 2YA0A 3B8DA 3BZGA 2JGQA 3H7RA 3T08A 1CXFA 5T9CE 3W76A 1ITCA 3GTNA 4S3FA 2C3ZA 3I4KA 1B3YA 2C18A 3CT2A 2A3BA 1A5NC 4TMBA 2CKSA 3NL5A 2Z1XA 2Q8XA 3SURA 1S5NA 2OG9A 5LIWX 2P5NA 4W7VA 2WMIA 4YWIA 3A6OA 1G69A 1UWSA 3UG3A 5A5WA 1T6MA 3ANUA 4H9MA 4D6HA 5FEWA 4ML9A 1CEOA 1MZRA 1I45A 1PAMA 2E9LA 4HHHA 5CBIA 4ONVA 1VFHA 1OCNA 4YTSA 1E6SM 5CZKA 4DXXA 2BXZA 4BKNA 3URBA 3ZYZA 3C2EA 1T0OA 4LV4A 4ZSUA 2I7GA 3QFEA 2XVKA 2FGZA 5RUBA 4O50A 4DN1A 1J0KA 3GHTA 4PRWA 2XIJA 2D23A 3U7BA 3BOXA 4B9ZA 1Q85A 3TQVA 3TLLA 2C91A 1HX0A 4ZOAA 1DJZA 1VHCA 3SY1A 2YB1A 2FVMA 4G7EB 4JTUA 1DYSA 1YXCA 4I5UA 4U3CA 3CYVA 2OPJA 1UBPC 3W75A 5FKYA 4GI4A 4XG1A 3HGSA 1R3VA 4UTWA 3WJSA 1Q7ZA 2DJLA 3HQNA 3WN6A 3KE0A 2BGNE 3NQ8A 4XQ6A 5SWUA 5EMLA 2VTFA 4GO9A 2QCFA 3N4AA 1KO0A 1ZSXA 3LHUA 1VEMA 4U10A 1KM6A 1ADDA 3F2BA 2HROA 4U2YA 3M1ZA 3CEUA 1OX6A 4W4QA 1L6SA 4MM1A 2PCQA 3HPAA 3HQ1A 5DMNA 1AJ2A 2RDUA 1RQHA 4LEQA 1MI3A 4IWWA 3KDOA 2E5CA 2PP1A 3APGA 1PCKA 2VMFA 4HT3A 3QR1A 4EF8A 4M19A 2JGYA 2J9XA 1V6WA 3JR2A 1OIMA 3TQ0A 2HS6A 2A3LA 4RDZA 2NQHA 2Y85A 4J1OA 1AH0A 3W1XA 2OR2A 4QE5A 5I78A 4ZQCA 4GACA 4W7UA 2A21A 3ZJKA 3VIPA 2XIQA 2Z1KA 3LBOA 1LLZA 4PEEA 3LI0A 4FNQA 3A64A 3IJIA 4UZSA 3VX0A 4KQNA 5LIYX 3T05A 3TA6A 4GQRA 4H83A 4CQAA 4S2CA 2FFIA 1R38A 4Z1CA 2CPUA 3MKVA 4MKVA 1UWRA 3H7VA 5CC5A 5I3FA 4XD4A 4OE7A 1A5CA 2PC4A 4JFTA 1FWWA 5EFDA 4S3KA 3UWYA 1T41A 2Y7FA 1ZY9A 4MMWA 4ACZA 3MA8A 5GJMA 1BWKA 4PMUA 4WK9A 3BLEA 1DJWA 1NU5A 3UWVA 1Q13A 4J3WA 2CZFA 3ZSTA 5LKYA 1K6AA 2E5BA 3ERPA 1Z41A 5IDIA 3B0YA 1CXEA 3M16A 1TPEA 4AH7A 4DZIA 2DT1A 1FWRA 4UFKA 1RR2A 2QGHA 1H41A 3VKAA 1C8YA 2Z24A 2O9TA 1X8CA 1F73A 3BG3A 4GQGA 2PDCA 1D3CA 3M0IA 3ECQA 2PDUA 5EKYA 4R33A 3AIBA 5FEXA 4UOZA 2PWGA 3CHVA 3H2NA 4HA0A 3TA9A 2WMJA 2ACRA 2W66A 1R6WA 4F79A 5AC7A 4PMDA 4H9TA 1Q6CA 2IW0A 4JTHA 3PNUA 1G01A 3E38A 4AZGA 4H41A 1YLVA 4BHYA 1SUXA 4X3ZA 3CV6A 5D38A 2P8BA 4JCLA 1CI1A 1JZ3A 2ZRWA 1BG4A 3TC3A 2V81A 3NPXA 2ZADA 4IQJA 3TMLA 2PTWA 3QW4B 5TBOA 3OP2A 1DJQA 4R3UA 4NXKA 2PTZA 3AO0A 3VOHA 3HO8A 4IG2B 3G1YA 5A8OA 2AQOA 3AHTA 3BGJA 3AMDA 3EDEA 1V03A 2ZC8A 4TR9A 1D9EA 4CN1A 1UC4A 4J3XA 3QLDA 4Z1DA 5LGZA 5FOOA 3BW4A 3B9DA 3GTIA 3TTEA 4AISA 1EDTA 2QCMA 4GIYA 4LT9A 1VP5A 4YTTA 4DAFA 2X16A 2PB1A 3VZYA 2R8WA 1PTAA 3CPRA 2FB2A 3VD4A 4D71A 2NVCA 3G1SA 1LOQA 4WZHA 3W2UA 4Z1YA 4B3ZA 4CEUC 2ZX6A 2JKAA 4NP7A 3TZFA 3L4YA 3ONBA 1E6ZA 4MKSA 4LUSB 4IFKA 1M3UA 1KGUA 3NO1A 1TYGA 4NAEB 3AMLA 1W3HA 3RITA 1KBIA 4WD0A 5LIUX 3ZR6A 3ZT7A 1QOPA 4BWLC 3EA1A 4R9XA 4I3GA 4K3ZA 3WH7A 2Q71A 9XIMA 4QNEA 1Z3NA 3V75A 2P0OA 4IP5A 1P43A 3MANA 3TOPA 3IGHX 3SR7A 2D0HA 2NLIA 1S3HA 4J3VA 3CJPA 4LS2A 4LANA 2E9BA 1NDZA 1DXFA 2NUWA 1FWNA 1VFOA 3LCIA 4CD8A 3V0SA 1GVOA 2CXEA 4TTUA 3I3EA 2H6RA 4FNPA 3USBA 4GUJA 2OODA 2I9UA 3LX9A 1QI3A 3W81A 4FAMA 4OWGA 4C6LA 3QV9A 2XU2A 4IP4A 2Y63A 3LQGA 3SGGA 1IR2A 2B81A 5M3WA 4M6QA 3DN5A 2GGHA 1FWJC 1EQPA 2GQ3A 1CXLA 1CECA 3B9OA 4AYGA 1GQJA 1FHLA 3OGSA 1B3OA 4QLJA 1RBOB 1TZZA 1P1MA 3RLUA 3AXKA 4UR8A 3W27A 3W7DA 3H22A 1UC5A 4QE1A 2RFGA 5A8QA 3BZJA 5DMMA 1OFQA 3H26A 3WQCA 5ABGA 3OGVA 3N6QA 4IMCA 4DXVA 2EXOA 3EB4A 5D2VA 5DANA 3R8HA 1TVLA 4JX4A 1VFLA 1XDLA 1J2BA 1I1WA 4MB5A 4CU7A 4I6KA 1HVQA 1TZ9A 2WZIA 5C9ZA 3WDPP 1FA2A 3KUMA 3ALGA 3TFXA 5FL1A 5T8GA 4E3VA 2ZCGA 1XYZA 1LM1A 1ODZA 4DX3A 3TJ4A 3LCXA 2QCDA 3R5EA 1DWGM 3XINA 4HKPA 4L56A 4ZEPA 2Z27A 3UCDA 2FDSA 4XVDA 4ERGA 3CS2A 4ES4A 4ATLA 4QSHA 4R7JA 1DL3A 4QIUA 3Q4DA 4IPIA 1E0VA 2Y0FA 2Y61A 3EZ4A 5A8PA 1VEOA 3G24A 1KCZA 3QPZA 4PUNA 1RLDA 2HJPA 4W89A 1J6OA 3VIOA 3GG0A 4HMNA 3IIVA 4YL2A 5CPSA 5ENLA 2NVAA 2VX6A 2JKPA 4MNJA 2E3ZA 1YTKA 4IM4A 1DXEA 3CZ8A 4EPDC 1UJQA 3MQTA 2IS7A 3NQ6A 4LXFA 3ITOA 2XIMA 4XZWA 4H04A 2C6QA 3NWRA 4KCUA 1K4GA 2UY3A 5A1AA 3AS0A 1ZBVA 2YCIX 5HPOA 1U33A 4X60A 3UYCA 1W9VA 3O16A 1ICSA 1R3WA 4H01A 2XH0A 2DSVA 1W32A 4REQA 2FVLA 3D0CA 5I03A 4ROPA 2WSYA 2PWUA 3GE7A 3OODA 2I56A 1IE7C 4FZIA 3XIMA 1JDCA 4LV9A 4XAYA 3VOIA 2ACSA 1EZ2A 3FYOA 2YFNA 1WO2A 3CTLA 2QHAA 2FGLA 1HKIA 3TCEA 4E8DA 1V02A 4DUVA 2GLKA 3TNOA 3IRSA 1QU4A 2BG5A 3V5OA 1U5JA 4UZUA 3AMCA 3EDKA 1POKA 1QI2A 4P7QA 4S3JA 4P8WA 1UH2A 4CQ9A 1BF2A 1ITXA 1W9PA 4P8UA 2PPGA 1OZMA 5E0FA 5TQLA 2PWVA 3FJNA 3N2XA 1W1YA 1P6BA 3FN9A 4QBXA 2PDIA 3E12A 3HGRA 1E3XA 1KA9F 5KEZA 2I17A 2IKGA 3GAYA 2ALRA 2VC7A 4G6CA 3WLLA 5AC5A 2V2CA 2A7NA 1REQA 1ZU8A 1WOAA 1H5VA 2BWGA 4AWEA 4UR7A 1F6YA 3H24A 4PUDA 2X0YA 1GVSA 4B16A 1ECQA 3LM3A 4RJEA 1R3RA 2DORA 3WNLA 2INFA 4K68A 3C2YA 2IPWA 5FF4A 3QHNA 1J9YA 4LRTA 5BYWA 3ES8A 2O4QA 2O92A 1OCBA 1PX4A 3WQ6A 4P7OA 3FA4A 3NR0A 3JW7A 3VGGA 1Y5WA 2OX4A 3FX4A 3K4DA 3PFMA 2YCEA 2E09A 4KCWA 3MHUA 2QJMA 4JTSA 3MJYA 4O8AA 3R94A 4M82A 4PE8A 3W7OA 2QPUA 1MNSA 3R58A 5AHIA 1J4EA 3R1ZA 3ZMRA 1KM5A 1W5OA 5CEWA 3PFRA 1U83A 2HE5A 1KBKA 1OCQA 4AZBA 5I09A 4F2BA 4JKKA 4PL1A 3WQOA 3M0VA 3FV9A 2VZUA 3UGRA 1F07A 2ADAA 2VCAA 4BQ4A 5FJRA 2JIWA 3OIHA 3QW3A 5C2GA 3Q45A 1UD5A 1HO4A 1OFOA 3WDQA 1IWPA 2J6XA 1GYMA 3N2CA 3K1GA 4C6DA 2IUZA 4AG0A 5FI8A 3TW6A 1EDQA 4AF0B 1XUUA 4LBRA 3FFSA 1EGZA 3WLNA 4GVGA 3MWCA 4D8AA 4PFHA 1FWIC 1JULA 4AZHA 1XLLA 4K1GA 5J5DA 1G4SA 5LHFA 4C6FA 1DIDA 4L5ZA 5AYXA 4IXHA 1Z9AA 1UWTA 4OU1A 5K3VA 3WUGA 3CV1A 3VIJA 4I7WA 2GGGA 5ECUA 3U2OA 4EPKA 2YSWA 2G3MA 1JCMP 2HNHA 1S2AA 3W7HA 1DXIA 1IXNA 3SAZA 1MEHA 2E7FA 1UJPA 1FWDC 7ODCA 3ZLHA 3WH8A 5AC8A 4MB1A 2BBFA 2Z1SA 4RLIA 1PO9A 3S2MA 3PP7A 4W84A 1QXLA 4KRTA 2X7WA 4WY0B 5G1YA 4U3AA 3VMPA 4FNSA 3WUFA 1MUMA 2PDYA 3THQA 3W88A 2E77A 1I2RA 4BCEA 3Q2DA 2BXYA 2C79A 4GKTA 4HU8A 1KWKA 5C70A 4Y96A 2VCBA 4K7VA 2ZDRA 4A3UA 3CM4A 4P7NA 3EOUA 1U5HA 2E40A 3TLQA 2YX0A 4TX9A 1MQQA 3R6IA 4IT1A 3ZIZA 4CD7A 2FH6A 3GR7A 4F4RA 2OT0A 5HQLA 1WXZA 1IF2A 2ZTJA 2QS8A 5MKGB 1IYXA 4NF7A 1E6NA 5MF5A 1GOMA 3B0XA 3ARTA 3N1AA 5E93A 5E9XA 4WDXA 3VUPA 1EX1A 1RCXB 4K38A 4HPGA 4WX2A 2XUCA 3NZ1A 1LZOA 3SCRA 4DWSC 3UR7A 2L5HA 1N8FA 4PMYA 3CQHA 4H6QA 3TTYA 4GWEA 2VEMA 5LZLA 4LY4A 1SVDA 5AFDA 5EBUA 5BXSA 4UCGA 4HOZA 1WP6A 4QCFA 1C8QA 1M68A 3TXZA 1RUSA 2PDXA 2OQLA 2A79A 3VFCA 3LLDA 2ODOA 4WDUA 1CGTA 1KFLA 2WB5A 4NJGA 5D2YA 4Z0JA 1VFTA 1WBHA 2WQPA 1SW7A 3N4EA 3O6CA 2CZDA 1GEHA 5F1UA 3FGCA 2E0PA 5DRCA 3T44A 2O7QA 2J47A 4MDOA 3N04A 3WDIA 3VIHA 1HKVA 4CD4A 5REQA 4C6PA 3LD5A 1GKPA 3U6WA 1Q6QA 4I7UA 3GC2A 3VNMA 2A85A 3T6CA 3CQIA 1W9UA 1KRBC 1VEPA 3R0DA 3TYUA 1JAKA 2FZDA 1AQMA 4GK8A 2Q8LA 3S2NA 4E2DA 4NRRA 5C2CA 1XQLA 4PTNA 3RM4A 5A94A 5CLWA 3P5ZA 3PTQA 3LTYA 1CGVA 4G1NA 3G22A 4U33A 5C2XA 2J13A 4RR4A 5M17A 3UXDA 1ICPA 1OABA 1B90A 1C91A 1K03A 2O56A 4H6RA 1JZ7A 1X38A 2TRSA 2I5QA 5LHEA 2G3FA 1UWUA 3RO8A 1UW9A 2ZUTA 1L6FA 4ML4A 4JX6A 1KFCA 3MVIA 3Q37A 3EXTA 1CENA 3WY1A 1CGXA 9XIAA 4W7WA 3M9YA 2PU1A 1V6UA 3W74A 4I8YA 3TQKA 2G50A 3OHIA 1ZENA 1XCFA 3OVGA 1Z89A 2PDQA 3BLFA 1AUSL 4E2OA 4UTWC 1YYAA 2HBVA 2OEKA 5IFPA 5A2BA 2ATSA 4P5UA 3QC0A 1KFWA 2J24A 2WNQA 2WZTA 3SZ8A 4TMCA 4HQVA 3S5NA 2CZ5A 4HOWA 5C54A 1CWYA 3GUWA 3KLLA 4KEUA 4E8GA 5HWMA 5F1VA 4AZ5A 2BODX 1UZ4A 3F5KA 1QAPA 3TROA 2ANUA 2WMGA 3VKDA 4E0CA 4GUFA 1NJJA 4WKFA 5DF0A 4UMAA 4KETA 2YA1A 2O55A 4LNYA 3E2SA 4BF9A 3OBEA 1HT6A 4L4PA 1VFMA 1UBSA 1KBBA 4ZOEA 1RQBA 1OFRA 1TX0A 4IQLA 3D3AA 1P7TB 1XISA 1IWAA 1XIFA 4F0LA 5HWNA 1SSDA 4LB3A 2F2KA 4LFYA 1KRAC 2Z29A 4HZ7A 2W63A 1SJBA 2GK1B 1TE1A 1QI5A 1ZP4A 4A05A 3DKJA 3R13A 2VRQA 3NVDA 1ZBKA 2CNCA 1LTDA 2YBTA 3SN4A 1D3GA 1O12A 3W7LA 4HYVA 1FQ0A 1S1RA 1UYQA 3VOFA 4Z2JA 4Q4MA 1VYPX 1DIEA 1WNOA 1VFUA 5KTLA 3EMZA 1V3LA 4XV0A 4W88A 4GG9A 4S39A 1TV8A 4UTTA 4UQ9A 1H11A 3M7SA 1GZ1A 2IQTA 2W62A 3WLRA 2V6AA 5CJMA 4OJYA 2DUXA 1KRCC 3ANYA 2WVVA 4GIRA 1W9BM 2VXNA 4GVFA 3WLOA 3WLHA 2ZWYA 3THUA 1R3SA 1PIIA 2VRJA 3QQ1A 1TR1A 2VHLA 4WSJA 4B5VA 3FOKA 4B91A 3IJ6A 3NL6A 4CNTA 2ISSA 4O1BA 5E0KA 3G1RA 1HW6A 3INPA 1CCWB 2Y70A 4N4PA 1PTGA 1EO7A 3ABSA 4NZ1A 3AWOA 4AHOA 4GGHA 1WDQA 4Q8PA 2EF9A 4G7FA 1JPKA 2GJXB 4O16A 2GZXA 4U5IA 1RVGA 1LOLA 3APTA 4L9YA 1DV7A 2QVNA 1G7VA 4IL2A 3WBXA 5MHBA 4C5YA 4EWND 5C9XA 2NX1A 3L4WA 3WMCA 1HJUA 5IHRA 3WD0A 1ZCOA 5GNXA 1NP0A 5I00A 4H00A 2NQ5A 2A4AA 1RCQA 2XGIA 1GVIA 1IWBA 3CNYA 3WDHA 1LUCB 1KB3A 4AAJA 3OEXA 1V51A 4LSBA 1UA3A 4LUJA 3OB8A 1VJSA 5AN7A 1XP3A 3W71A 4DJED 4D6CA 1XIMA 1YHTA 3MKCA 4XAZA 4L65A 4UTHA 1W1VA 2BHZA 2ZUVA 1CZ1A 2O7SA 2EKCA 3EWZA 2PEVA 1U30A 1IHIA 2BZNA 3UG5A 3WNKA 2XM1A 1MEWA 1KCXA 1V3HA 2NW0A 1XYFA 1H1ZA 5KETA 2ZWZA 4MDPA 4W93A 1LLOA 5H8MA 2ZRYA 4IMAA 4O15A 3W1UA 4HNTA 3N3TA 1PBGA 3OG3A 1MUCA 4IMGA 1UD2A 2GOKA 1SW3A 3G8EA 4X9SA 1X1NA 2FMNA 4LU0A 3L65A 4LC8A 3W7JA 3TTOA 1M7PA 4DO7A 3LGDA 3S2CA 3GIYA 3C52A 3H2AA 2REQB 2VZVA 1TTQA 4IQDA 2YW3A 3VMNA 4CKQA 3GLCA 3T8QA 2AMXA 3EWCA 3SADA 1TREA 2WSPA 2I16A 1UCWA 4AVNA 4JDYA 2XIBA 2Z2AA 1XBVA 3CHFA 1B3ZA 4K8GA 3CMGA 4IZGA 4AB4A 2F61A 2OSXA 4JTRA 3W2JA 3IACA 5KMYA 2YL5A 2Q3RA 4HSHA 3PNZA 4FHAA 4LF1A 1F6KA 3S9IA 4GBDA 4ZOCA 2PD5A 2QV5A 2PDFA 1KM2A 5G4EA 1SZRA 1FVPA 3UJRA 4DJFD 4KFNA 3PWIA 3WQ8A 1E1CB 5HAOA 3VK5A 3QLLA 1BWVA 4WY0F 1XPGA 3OZMA 2WMHA 1D2KA 1A80A 2TAAA 3QC3A 3IAPA 2QR6A 4LYKA 4IGSA 4HPNA 4HYWA 3LLFA 2ZXAA 1P7TA 3GU9A 2R6OA 3G5EA 4S3GA 5K2ZA 4ZQMA 4XK2A 4A3QA 1IR1A 4GA8A 3V1PA 2HK0A 1OM0A 1XF0A 3TCSA 5E6YA 1MQPA 2DDXA 4J2PA 4RX0A 5AHFA 3P2VA 1TV2A 4C6EA 1I4NA 3DESA 1EWEA 3C2FA 3HU7A 4Q8UA 2X1UA 1YKWA 2WM1A 3E5BA 3GHSA 1V3JA 1ZS2A 3RG6A 1JVNA 3UVIA 2D0GA 2Q02A 3E1F1 3TWAA 2Z6JA 3C8NA 4ERIA 4A3YA 3NSXA 1O94A 5A95A 4Q7BA 2EPMX 4IUGA 4L1WA 4RPQA 2W0UA 3THCA 1NOFA 5FIPA 1P0KA 3TUUA 4M3PA 3RDKA 2GDVA 1ZAJA 2DPEA 3BMVA 3LHVA 1EP1A 1P48A 5HR7A 3QF0A 1Y8BA 5BRBA 4CN6A 5A6MA 2EPNA 3BG5A 3VIGA 3AYVA 5HDRA 3M41A 4CCZA 2GVJA 1BYBA 4DIAA 4BS0A 2XIIA 1NDWA 4LAUA 4KERA 1KFJA 2VEKA 1WX0A 1G5AA 2WNZA 4G9PA 1PYFA 3W6LA 3H2OA 1R87A 3GD6A 1KGWA 4KW2A 3ATZA 3BCFA 3Q58A 3CLMA 3CMJA 4PTWA 3UU0A 4BJHA 3G77A 3PJUA 4PULA 4XX6A 2VEPA 2G3JA 4RK8A 3CWOX 1E9YB 2YXGA 4GINA 2EJAA 3UETA 4I5RA 4OBRA 2NXGA 1XIDA 4AW7A 4DXKA 4MF4A 1EA9C 2BV9A 4C6MA 5TF0A 1JZ6A 2PRMA 5G5IA 1J01A 1V0KA 3RR4A 2DU2A 3COTA 5BCAA 1KFBA 1UUMA 3PTDA 1A5BA 2YB4A 1UR4A 1G9HA 2VEIA 1V6TA 4GYJA 2YL9A 1J8VA 1X98A 3A4JA 2G5WA 1S5VA 4IX0A 1LL7A 3VDHA 4FB7A 1O68A 4WRHA 1ONRA 4MWAA 3OO2A 3B8VA 1TV5A 3HB9A 3NZPA 1WUFA 2G3IA 2OGJA 4X2PA 1WDWA 1S5WA 4QEHA 3N6HA 1CDGA 3N14A 1KQZA 2ZRVA 2G96A 3EEGA 3W87A 2HMCA 2ISWA 1ZLPA 3STFA 3JUGA 1BYCA 1MWOA 5J04A 2V63A 1JNEA 5PTDA 2VDIA 3VDGA 2Y4SA 4Q4KA 2HNEA 4GYPA 4R7OA 2X41A 4C1NA 1RH9A 2V2HA 4U4MA 1E4NA 3CGTA 5A69A 2VQUA 1XIBA 1UMLA 2VFIA 4LCQA 1E5JA 1V6YA 2GWGA 3VGHA 4BR1A 4TVUA 5HQMA 3O15A 1ENUA 3LDVA 3PBMA 1QNPA 3TFCA 4DHGA 4QISA 2QT3A 4YVPA 1BPLB 1XRSA 2D69A 3KCJA 3HBLA 3AHYA 2WCSA 3OQ8A 1JDDA 5I02A 2WJEA 3QXBA 1PZ2A 4B4FA 3JZUA 4Y9NA 1VBRA 3P6LA 3E49A 3O3RA 2QW5A 4N7QA 3MVTA 1DPMA 1SJCA 3RU6A 1GHRA 2PCEA 3UNTA 3V7PA 1XBXA 4ZTXA 1DP0A 1W5QA 4ZGYA 2CKRA 1UZ1A 3EWBX 3B8SA 3N25A 3GBDA 2PU0A 4LAZA 1E1EA 3DFYA 3VVGA 4AD2A 4DYEA 4W8BA 4HBKA 1HNYA 2Z1VA 3GIQA 3RPTA 2A3EA 4UQEA 1PCWA 3WFAA 3TDFA 3WQPA 3AIQA 5FSDC 4RPPA 3BARA 4GX8A 2QJHA 2J25A 1JPIA 3BXWA 3HG3A 1B31A 4ZENA 1IXQA 4EKJA 3RYSA 3E0FA 2VVSA 1OIFA 4F66A 4GY7A 3TSMA 2W27A 3AHVA 5JIPA 2AL1A 4UNLA 3LV6A 2GVEA 1FHUA 4XVEA 5DEZA 4N02A 3VKJA 2INZA 3OVRA 3H4GA 1Q4WA 1IIGA 1XSKA 1IZCA 1Q6OA 4Y9PA 3WCZA 3MU7A 1QNQA 4AD0A 1WDDA 1RD6A 3F5JA 3R8GA 3VD7A 1M5WA 2XVPA 3PUDA 3ARUA 3TJXA 1WV2A 2V30A 5BOFA 4BI7A 4Y9OA 3H2FA 3G0XA 2B7PA 6REQA 5FD0A 1E9ZB 1OYBA 3TJIA 3WMLA 3ARXA 4DJDC 4I9AA 3V0UA 2CHRA 2GPTA 2ATMA 2J6VA 3PN8A 4OQVA 3S6TA 3IGSA 4GKLA 4YVXA 4LBUA 1GJUA 2YW4A 5D30A 4WIWA 4G1KA 4WQ6A 4F0SA 1AD4A 4GFSA 1BAGA 1F3XA 4ZTYA 3VD9A 2WXDM 1GORA 3UJSA 1PWMA 1EA0A 1NF7A 3MZ2A 1QI4A 2Y5SA 4CLMA 1M41A 1IZJA 1Q6DA 3CC1A 1X6LA 2WHKA 1XYLA 1PVNA 3RX2A 3L2LA 3WF4A 1E3ZA 5I3DA 3A23A 5D9NA 1R85A 2WV8A 4Y7EA 4IJBA 3W2MA 3EA2A 5D37A 1MDRA 3QOMA 1VZWA 1KM1A 2CBVA 2NX9A 2QCCA 3GTXA 3MUXA 4FOUA 4YS1A 1J18A 4YXGA 4LYRA 3WMBA 3A22A 1BD0A 3BLPX 3G6LA 4YJ5A 5AB3A 2GQAA 1V93A 3BCJA 1I0BA 2D73A 4DYJA 2GVGA 2H8ZA 3OA3A 4A2RA 5IHSA 2PURA 4ZL1A 3R0UA 3TKFA 1BF6A 5A6LA 3J7HA 4M8UA 4R5EA 2Y6ZA 3FEQA 2XWEA 4QP0A 1PSCA 3SIZA 2C13A 1FUYA 4QDPA 2P8CA 1W5PA 2C0AA 2W4XA 1WXYA 1PIGA 4AXKA 2V5LA 2PLJA 3ZR5A 4V1XA 3FVDA 2V38A 3GVRA 4BF7A 1TMQA 1YDNA 1H50A 1XDJA 1AVAA 3U0HA 3NPVA 3O6AA 4DB7A 2PLMA 1GOIA 1YRRA 4EPEC 1NWRA 3U2ZA 1XC6A 4HSOA 1IXOA 1HTIA 1JI1A 5K9CA 5FF2A 3R0KA 1S38A 4ZODA 3U8GA 1JFXA 3LXCA 3PBUA 3GXPA 2PRHA 4F0KA 4W85A 1J5SA 2EKGA 1WB0A 3E3HA 2E4TA 3VOJA 4R53A 3PZVA 4FEZA 5CSRA 2JEQA 3M5YA 2B7NA 2OOFA 2OOGA 3PZTA 3TN3A 1E43A 2VQTA 4MADA 1JF5A 4H9ZA 1X39A 3HV8A 4P2VA 5A3HA 3L4VA 5FEZA 1QTWA 4AIBA 3CZJA 1AW5A 5CGQA 4F48A 2H9AA 4LPCA 4AZCB 1HL8A 5FAGA 1EWDA 4LOCA 4XKYA 4PB4A 4JQ2A 2WM0A 3Q65A 4Q8VA 4PUMA 3UZXA 1S46A 3QQWA 1UR1A 3KRSA 2J7HA 2QDEA 3WK3A 1P6WA 3B8UA 4JQ4A 1HJSA 3ICJA 1KM4A 3WQ5A 2E9MA 3NEVA 1MXSA 2EHHA 3I7QA 4XBJA 3IIOA 3LS9A 4N6EA 4AZ6A 4O0QA 3FDKA 3G1AA 3SJNA 3A47A 4QLKA 3EX2A 1GOKA 1B9BA 1TJRA 1CW2A 2HRWA 4LH8A 5CPTA 4IJRA 1DWJM 4MJ4A 3GNRA 5M1TA 3TJLA 1G94A 3NQVA 3NO3A 4HCDA 4C6IA 4A8RA 2XFRA 1O1HA 4F0MA 3N11A 4FLOA 4F40A 1X1OA 1R8LA 5JH2A 3I10A 1L6YA 1QK2A 2ZXQA 1B4KA 1JCXA 4K39A 3CUZA 1LL6A 1K9DA 3P84A 3DIPA 2HE8A 2HWGA 3CHEA 1GJPA 5ABFB 2ZUUA 3ARYA 2VYOA 2WANA 1XPYA 1A47A 1KNWA 4H7CA 1X7IA 2NUYA 4HMDA 4EOUA 3U2EA 3N9SA 2HEJA 5KZDA 1OX5A 3KTSA 1VRDA 3V0TA 3AHZA 2J66A 5FAJA 4GZJA 1FXPA 1TMLA 1AH3A 2F84A 1UD6A 4BFAA 4H6EA 1UKTA 1YBQB 1LQ0A 1OCJA 3QYSA 1G1YA 2CYGA 2GUUA 4OBTA 4E2BA 1VAHA 1PUDA 1MUWA 3EX3A 4AWSA 1JCTA 5FACA 2R1NA 1XXXA 1X97A 1XWYA 3OBKA 3QTGA 2JIEA 1XCXA 3W82A 2Z0IA 4GXWA 3WQWA 5TIMA 3H2EA 3GR8A 4MYXA 3D47A 5CPQA 3K13A 2A3CA 2PDPA 5I3JA 3MYPA 2PGEA 3W70A 5HUOA 1RPKA 1V0NA 3ONCA 2Z1BA 4YCPA 2OZ8A 1NDYA 3VD5A 2A1YA 3L5AA 2XN0A 2R1PA 4MNMA 7ENLA 4QDWA 4WXYA 1KKOA 3I3DA 3UNDA 2PFHA 4D6IA 1NELA 3S1WA 1BXNA 1BRLB 1EBGA 1D7KA 4HPXA 3UQNA 3BH4A 2E6FA 4A3RA 3PWAA 1UROA 3PUEA 3TSBA 4EWJA 3L9CA 1E55A 1EEXA 3N19B 5CCZA 4DY1A 2QCHA 1Q65A 4EAMA 1IEXA 1YX1A 1KTNA 3M5ZA 1A0CA 1S2UA 2POZA 3DYMA 3WH9A 3GDKA 4LVBA 1SR0A 4UR9A 4B90A 4J5NA 1NOUA 2NXIA 1R2RA 3OBAA 3G0UA 4MUPA 1W3LA 2PMQA 1TUFA 3LY0A 3SEPA 4CVWA 3G1VA 4J3UA 4FS9A 1OX4A 2P1FA 5AHNA 1FWAC 4TX8A 3E2RA 3LGEA 3V16A 4AD5A 1BYAA 4HU0A 5EGRA 4NY2A 4KGJA 5EU9A 2Y1HA 3R12A 1ZQ5A 4H8HA 4Q6XA 3GH5A 2NZLA 4GUGA 4JN6A 4AY8A 1QW8A 4OVXA 2ONEA 3IK4A 1LLWA 5ABTA 2RDWA 2FZNA 1OYCA 1J0YA 1QASA 3EAUA 3KBSA 5DLCA 3W73A 5IRPA 2YDAA 4W87A 1KBLA 2BTMA 4TVCA 3N2TA 1ZFJA 3MMDA 1UD8A 3PUGA 5D05A 2WHLA 4MZYA 1JL8A 1H7NA 3MUIA 3GW0A 1C90A 1QWKA 1H49A 2OYMA 2DZUA 4IISA 4ZBCA 4JL1A 3NQFA 3B06A 4C6KA 4QQ3A 2GVYA 1AK5A 4X63A 4J3TA 4XAFA 2XSXA 3AMKA 5JXQA 1A4MA 3TVAA 1FFQA 1EUNA 1BWLA 1HG3A 1XRFA 1JJKA 4S3EA 3H8AA 3S5OA 1H7PA 2DQXA 4QM1A 2WC4A 3W1PA 4ZXOA 2CC0A 1AFSA 1K3UA 4MZ1A 2G0WA 3UR5A 3HIJA 5DXYA 1JYWA 4Q7IA 1R7OA 4JTQA 3ARZA 4RW3A 4A6GA 3PZOA 4J3ZA 1XIEA 5EMUA 4PGLA 4WHBA 1DWHM 3V35A 4PSRA 4KPLA 3A9BA 4IIGA 4ICCX 5DX7A 1LG1A 4B4HA 3SRFA 4E4UA 2PDJA 1VIZA 4FXFA 1K70A 5M2FX 4ROQA 2VELA 1FCQA 2I5IA 3P82A 4S3AA 3H6OA 2RJGA 3LPOA 2ZQ0A 3LB0A 5C55A 2EQDA 5DO8A 3O9NA 1JDAA 3NQMA 1EJUC 3RNDA 3GWQA 1SMAA 2Y8VA 4YYCA 4AZIA 1VR6A 2AAMA 2GQ9A 4C1KA 4QR6A 3QBUA 4HNVA 3UYIA 4WDTA 4DVOA 3RMEA 2PODA 1UPPA 1PKNA 2Q3OA 1ISVA 3BK0A 3KS6A 1XH2A 3LOTA 2OEMA 3AWNA 3HPZA 4I5XA 1JD9A 1IV8A 3MUY1 4EPBC 1JFHA 3C3NA 2R1MA 3S2JA 2PGWA 1UP2A 1E0WA 4PUWA 3N2BA 5D09A 3KM8A 1IGSA 3DI0A 1VPQA 1T7LA 3GDLA 2Y5EA 4A2SA 4O57A 4MIMA 2GGIA 4HP5A 2IQ0A 3T78A 4XO7A 4EVZA 2ZUMA 1TA3B 4R9OA 4UWMA 3E9AA 4RDVA 4M56A 4YHEA 4JN8A 1TIMA 1SO6A 3OYXA 5A6JA 3PJWA 4AC7C 1NARA 1TJPA 1AZ1A 4Y9MA 1JPDX 1PZ1A 4ZO7A 1X7FA 3ZVIA 1XBZA 1HGWA 1JGIA 1IEVA 4O28A 3GNOA 3WJYA 2XFFA 1SYTA 4DI8A 1RP9A 3SM0A 1U1UA 3NGJA 1L2QA 1VPXA 2QIIA 3GQYA 4BQ2A 1YPIA 5AHMA 3BCDA 1FWTA 4QAWA 3UWUA 3DOPA 1QPNA 1PHQA 2PWFA 2W67A 1KV5A 4O17A 5CAHA 1B1YA 4NNAA 3VZZA 2OZTA 5CZJA 1E51A 3G18A 4H7VA 3ITYA 2J4GA 5F2LA 4V1YA 4CD6A 2GDUA 1H1NA 3GFYA 1NFPA 4OBSA 1PB0A 3I7RA 4NI3A 2QPSA 3C6CA 4LS1A 4FR1A 4UTLA 4CUCA 1PEZA 5BRQA 3GIPA 2WBKA 1NWTA 1A5SA 1TKKA 1HKKA 2V3DA 1Q8AA 3JU2A 4NIRA 3H23A 1V79A 3GYCA 3AXMA 3GVGA 4L4LA 5E0CA 3QV8A 3QY8A 5JMUA 2EO7A 1W3TA 3TAOA 3O63A 1KWGA 5LA0A 1XI3A 1I2PA 3BAKA 5LYRA 2OT1A 2D2JA 2CIPA 1ZPTA 4Z08A 4PUJA 1JR1A 1VBUA 2CZVA 2WKJA 2YYTA 1EXPA 2CXGA 5A2AA 3BO9A 4XISA 4LVDA 1EX5A 2OVLA 4B3LA 1SFJA 4JIEA 3RF9A 4NZ4A 3BGGA 1O4UA 4QITA 4Z1AA 4DUWA 2D20A 2F8QA 3W1TA 3HGJA 3ATYA 2CLFA 4PBEA 3SCWA 3AIEA 5D32A 3BGAA 2WMIB 4PSPA 1J0ZA 3GC5A 1TJ1A 2D3LA 1LQ2A 2JKEA 3LXAA 2DSZA 4PMRA 3MBFA 1TV7A 1E0UA 3A4AA 4ZR8A 3DEQA 3DGRA 1VCGA 4HSNA 4AU0A 3MUCA 3WBAA 1BTMA 1QHOA 4LYPA 5JH1A 2AOSA 3F2CA 1UZHA 3QN3A 2H8XA 4JBRA 4R85A 4WR3A 1YNPA 4OOZA 1ZJAA 2ZUWA 1IT7A 3UP8A 1NF0A 1QUMA 3SY8A 5A2CA 2CHNA 2B31A 3SFWA 1EC8A 2Z26A 1EJRC 3NM3A 2P10A 2IKIA 5HNRA 4O11A 5CGMA 1UUOA 5I3GA 3QSTA 2WSKA 4UQCA 3GG1A 3GVQA 2W92A 2VGIA 3KX6A 3CB3A 3KBNA 2NX3A 2J7FA 4Z2KA 2WZHA 1SZFA 3WF1A 4NJKA 4HJFA 1G4PA 1TZ7A 5XINA 1HF6A 1XYMA 4JIRA 5G1MA 1A50A 4JOMA 5CZSA 4E4PA 2WPBA 4HNUA 1A3XA 1ZJIA 4V2XA 3MCMA 3LGGA 2NVDA 1GCYA 3WEOA 4DO4A 4LVAA 3WQEA 4A35A 1XLCA 4TVDA 4OUIA 3GNDA 4ZVJA 3DU0A 1GQKA 3CHDA 3ARSA 4IOTA 3GTFA 3GVVA 3VXGA 4B5TA 4KFPA 2DUAA 3K8LA 3LRMA 2V0TA 4PB3A 1WQ5A 2FH8A 1B5TA 1P1XA 1E70M 1TJ0A 2TODA 4JTTA 4PRRA 3ZXWA 3OVQA 3MCOA 2YPIA 1R3QA 4H9UA 1TX2A 2X1SA 4EP8C 5BU9A 1K7XA 1U5VA 1ZB5A 2QDGA 2YCKX 1NH6A 2QEZA 2ZZ5A 1RVKA 3KRZA 4ADTA 2V82A 1DJGA 3RUBL 3IARA 2ZX7A 4H9VA 2RJHA 1FCBA 2WJFA 2BB0A 2PWEA 3EYPA 4GXPA 1K8XA 5CQ1A 4ACZB 3FKKA 1KCKA 3AXIA 1TVNA 4OKDA 3I6EA 1VJIA 2QDHA 4PMVA 2QAPA 3UJEA 3TN4A 4WGXA 3E0LA 2Y89A 4AX7A 4FOKA 3RLVA 1V6XA 1ADOA 2ZUSA 3LYEA 3VKBA 2V8ZA 1UASA 5BNKA 4Q4OA 4TU1A 3POCA 5AYIA 2CBUA 1ESWA 2PAJA 4DWSA 2E6YA 3RM9A 3NQ7A 2OGYA 1WDRA 4Z17A 4YTRA 4FIRA 3BAXA 3G8RA 1OC6A 3TV8A 4X9YA 3QHMA 3SRHA 3MV11 5DBUA 3BLOA 3KWXA 1UR3M 2X2GA 3VIKA 1JQVA 2C1IA 4POCA 3T4WA 1GTEA 1P0EA 3PZGA 4GYFA 1OY0A 4IPJA 1XSJA 1PX3A 4MUZA 2A3AA 1I2NA 2ZZ6A 3ZVHA 1FCVA 4HIBA 3OLGA 5AOUA 2C71A 3QY7A 3ID7A 4HU4A 4NL1A 1OFDA 1YE6A 2IKHA 2HK1A 4ATDA 2C7FA 2G95A 4NU7A 4NX0A 3IV3A 2GSEA 1FWHC 1V8EA 2YL6A 1XYCA 1B57A 4CQ8A 1ZJBA 2O4MA 2DZVA 2BGQA 1M01A 3DBNA 3SRKA 3T09A 1W0MA 4S38A 5LNVA 4PBFA 3H12A 2VR5A 3RLHA 4JTCA 4M7SA 4QCEA 3P0XA 2OFJA 2VEFA 1XGZA 3K1DA 2J9YA 4LWWA 2PDNA 3LCFA 3BDKA 5JBFA 3LCGA 2GGEA 3UCCA 1Z32X 3VCRA 1RA0A 1OT2A 3UBPC 2J7DA 3ZWSA 4HTBA 2FJUB 2QNEA 5CSSA 3TP4A 3UPMA 3U9IA 3OA5A 5CC7A 4IFKB 3UY7A 5E1QA 1EJSC 3NYDA 3NZQA 3OYZA 4BI5A 2CLKA 2EG7A 2VZOA 3M46A 2OJPA 1C9DA 1NVMA 3UXAA 3BQ6A 3DHPA 4XAGA 2GOUA 5XIMA 3AYSA 1GKQA 2VOMA 3CQJA 1KFKA 3T81A 1XC4A 3WELA 1YPXA 1F7BA 4LRSA 3KCOA 3LERA 3KBMA 7REQA 2UWFA 2JE8A 4YYFA 2DW7A 3HJEA 2OO6A 3H2CA 4RDWA 1BGGA 3HURA 2QKFA 3C0QA 4KCTA 4ZE5A 3BURA 3SQMA 1SGJA 1XCWA 1UP0A 2CBJA 1VYSX 3QTPA 5AYZA 1JD7A 4LUTA 4MPQA 2AKZA 1DJXA 1YIXA 2CITA 2G8ZA 2R91A 4GGBA 1QOXA 5AY7A 4D8LA 3LPPA 4O13A 3B4YA 2V68A 1H09A 3CUXA 4MJ2A 4XZLX 1AL7A 1TPFA 2DUZA 1T8QA 1W56A 3FS2A 4GJ1A 1UOZA 1KBJA 3WUEA 1BTCA 2WVSA 1EGMA 1QCWA 1SFLA 3T9PA 4HD5A 1VC4A 2QYGA 4TV5A 4AYSA 4MKNA 4UNIA 3OPSA 1XW8A 3EKLA 3HTWA 1YNQA 1H51A 5LA1A 3MDUA 2CZEA 3M0MA 1XLDA 4YCOA 1XLHA 1Z8AA 1XIHA 3VGFA 2ZTKA 3AC0A 2XH2A 4O19A 2DP3A 3DHFA 2XYLA 2GJNA 1DJNA 3MP3A 4QSFA 1DWIM 1TTIA 2ZZ2A 2QCDB 3BJFA 3LCLA 3LPGA 3ME3A 3AAMA 1SO4A 2ESCA 1EDGA 1EJXC 2VURA 1R47A 3WLTA 1EJTC 4PZVA 3GFZA 3STEA 4WJXA 4Q4SA 3VE9A 2OX1A 2HBXA 3LV5A 1ML1A 1F8MA 1EOKA 4JZ5A 3EOEA 2D2OA 5DN1A 3MSYA 1KFEA 2CESA 1S2TA 3EMCA 4IPLA 5TD4A 3GXTA 3UESA 1MEIA 1B9ZA 1GJWA 3BG9A 4S23A 1IXPA 2X09A 4Y8EA 1CXKA 3GXFA 5E6ZA 1SU5A 4GZ7A 2CW6A 5JUVA 4LBSA 1XFCA 4DI9A 3VGDA 1AQ0A 1TMHA 4UTFA 2ABBA 4IHCA 1W3NA 5C9UA 1XYBA 3IS4A 3CAQA 2B4GA 3CL6A 4PR4A 5D8ZA 5CAKA 1B2YA 3TEVA 3T8LA 3WNOA 5D4YA 3S6OA 2QCLA 1MW2A 3NDZA 4K36A 5M5DA 1E0TA 1SW0A 4K7YA 3GC4A 4REQB 3LBCA 1ECEA 4J7RA 4IIHA 1TCDA 1YADA 1EJ7L 4BQ3A 3VM5A 2WC7A 4X61A 4GUHA 3TZNA 1K8YA 2WCAA 1XL9A 1BQGA 1X8FA 4XZNX 1WDSA 4XWUA 6XIAA 4N9DA 3T40A 1NP2A 4Z1BA 1QBAA 2QCEA 3BOLA 3W38A 1H7OA 1EH9A 3ITXA 3S0CA 1E6QM 2VT0A 3W86A 1MFVA 4CVUA 2WKLA 1HGYA 4YU1A 2YDQA 1O7AA 3EEZA 2WZEA 4UTJA 1EGVA 1Q7QA 1YNYA 3KOFA 3DYOA 3M0LA 5FL0A 1YMYA 1WE5A 1N7KA 2ZFAA 3NGFA 3W01A 1GGOA 1TWSA 1KLYA 2W91A 4JEJA 3TYAA 3M0KA 5ABHA 1QW9A 1AW1A 3WLIA 1T40A 4MY8A 2FZ8A 4D8ZA 2X8RA 4IP7A 4DZAA 3PTKA 3TWBA 4QJ1A 1LOSA 1X6NA 4MVAA 1REQB 4AWUA 2PGRA 4L80A 3ZM8A 3PBVA 3ZOAA 3LK6A 2R1LA 4QX4A 4B3KA 4K1WA 4D2JA 1RV8A 4BI6A 1KV8A 3DI1A 3LCWA 1C93A 3BAYA 2FZBA 3VKKA 4W9TA 1QPOA 2DH3A 3S9YA 2WSRA 3SB0A 4ZQOA 4BY3A 1U1HA 4IGHA 4H9XA 1JYVA 1J79A 3SW6A 4PCNA 5HNNA 4MTVA 4TUFA 2YCLA 2PDHA 4LY8A 3MMUA 4QEEA 4W86A 3DC0A 4QTGA 2ZZ1A 2OU4A 2W79A 3BVJA 3W29A 1LBLA 1JNDA 4GABA 1Q63A 4MLJA 2AMGA 2PDKA 1MDLA 3KP1A 2FDMA 4XD3A 4Q8OA 2WAGA 3WD1A 2WJDA 2ZZ4A 3W1AA 4NUWA 1RK5A 1W8GA 2VDGA 3AFBA 1S1PA 3VNYA 3UF9A 3W84A 4C6QA 1P5BA 1G0CA 1PDYA 3O0FA 3PG8A 5HPCA 1XIGA 1EZWA 3CBWA 3EWXA 3AU2A 3WD2A 4FXSA 1X96A 3CLWA 1CIUA 1ME9A 1ISYA 4JTGA 5F4SA 4GYKA 3KZSA 2KX9A 4MB3A 4NYYA 2ZZ7A 3MCNA 3SRDA 3GX9A 4DM1A 3MO7A 1EPVA 2RAGA 1NWSA 2GJPA 4W8AA 1W6TA 2BHYA 2BOFX 3GXNA 3VILA 2HXTA 5I77A 1CYGA 2OYLA 4FLQA 5KZ6A 4Q7NA 4A3HA 3P62A 2VRKA 2OLAA 2ZRZA 4GNKB 3DENA 1FWCC 3N4FA 1F2JA 3BMWA 1E15A 5HMEA 3SUWA 3WMSA 2VDHA 3E74A 4RNJA 2QGYA 4IGMA 4O1DA 3L68A 4IQEA 3W7CA 2HZGA 5CBBA 3AZRA 4IIEA 2VFDA 1HQTA 3WBEA 2DV0A 3MHFA 3NURA 4U5KA 4O12A 2PDLA 2WW5A 3APYA 3KCLA 2BOGX 1QVBA 5HA7A 4CQBA 2CETA 3B04A 3PAOA 1A5OC 1PWLA 4J40A 3D46A 1BXBA 2FPTA 1H7XA 2HISA 3GW3A 6CGTA 5FESA 4PTVA 3BAWA 1LWJA 1AQHA 1LQAA 4DELA 4IX2A 3UWZA 5A6BA 4LNCA 1ISXA 2YCJA 3NDOA 2CWNA 4GIEA 4DZ5A 4DJFA 3RU8X 4M51A 4KEMA 1JDEA 3SCSA 2OLSA 1GVEA 3NJ3A 3QRHA 2OEJA 1JAEA 4ZO6A 1S5TA 8A3HA 3CO8A 4QE4A 1RZMA 1VYRA 3G0SA 4O4VA 5BXRA 2C15A 1R3YA 3KRUA 1LG2A 5I5RA 1KR0A 3F03K 3NYZA 1HKWA 3BSHA 4MJZA 1EIBA 3U4FA 2DSKA 1UHVA 5LXEA 4EK7A 4MG4A 3AZTA 1K6WA 3KBJA 1FWGC 1E9IA 3CPGA 5E9AA 2XGZA 3HPSA 3PC0A 3CTTA 4DO5A 4H3DA 3KHDA 1GEQA 4HK7A 2AQVA 4E4FA 2VL4A 3FXYA 2PZNA 3VPLA 5C0QA 3RGTA 3L21A 4PCSA 3CAVA 1LBFA 2GSJA 4O54A 1HFBA 1UWIA 4DM2A 2I14A 4J35A 2QXWA 4IICA 4C60A 1A5LC 9RUBA 2V3GA 2XWDA 4C65A 1TV3A 1SO3A 3CO4A 3M6YA 3FGCB 2E68A 3W7KA 1JXKA 1EC7A 4NG3A 3BUVA 2AGTA 4MWAD 3L12A 2C16A 3KFTA 4AC1X 5REQB 4IPNB 1JUBA 3AUJA 3VNIA 1BFNA 1EYEA 4UQAA 3FCPA 2I9EA 1K9EA 5I06A 2PC8A 5BOEA 3PB2A 4W8LA 2VX4A 2WKGA 4H9YA 2ZRXA 1F8IA 4AY7A 4XUGA 3ZJ6A 2VKZG 2J7CA 2J88A 8XIMA 3GZ3A 1HIZA 1E5NA 2HTMA 3DFPA 5DFAA 3W2KA 3ITCA 4RV8A 1ZZMA 1JCNA 3G6MA 3VTRA 1E56A 3ITLA 5GNZA 1OG0A 2WOQA 4XBSA 3LNPA 1UKSA 4XAPA 3GR4A 5HATA 3W22A 1LRTA 4AD3A 2O9PA 2J75A 3QYQA 2VFGA 4HNNA 4O14A 3S1GA 1GNXA 4HVXA 3VCCA 1K02A 5CPOA 3S6DA 3BV7A 1XKYA 3NL2A 2NQ9A 4XZ9A 1UIOA 4F8XA 3P61A 3T1GA 3WDRA 4GC4A 4QQUA 3V18A 3H21A 4B2DA 4GUIA 1CGYA 4UMBA 4QJ4B 1KR1A 1MMFA 1K8CA 4D6FA 3F4WA 1E6XM 3ABQA 1EBHA 3M4HA 4KBXA 1E1FA 4HOXA 2BASA 3HPFA 3NZRA 1XX1A 1UKQA 1M03A 3E2QA 3IAQA 4ZOBA 3PPFA 2YKKA 3VU2A 3W7NA 1O1ZA 5AYBA 1QPKA 3C0SA 1EYWA 4CN4A 1KM3A 2YZ5A 1XLFA 4JYEA 2HXUA 4UFIA 3IIXA 3QM3A 5C9RA 4WCJA 1J11A 5TNVA 2AL2A 1IEQA 4R27A 1B3WA 4GMEA 1NFBA 2ZA1A 2ZKMX 4I9MA 3FSUA 1BVZA 2BXVA 3EWDA 4B5WA 3TYEA 3I3BA 4DJDA 1Q5MA 4EX4A 1K4HA 1Q3NA 4L7ZA 1W2VA 1J0JA 1JF6A 5L6UA 4FX6M 3OHMB 4IMDA 3C2VA 3BANA 3DG3A 4JTLA 4EXQA 1ZBCA 4P61A 2RGLA 2BY1A 1Y5VA 4DO6A 1BHGA 1Q7MA 3PR2A 3LHYA 3M47A 4DUOA 5DBTA 4AXNA 3GY1A 3TIMA 1W1A1 4EACA 4GPNA 5L9FA 4L6DA 4WKHA 3THAA 1TE6A 2PWDA 4HZMA 1MO0A 3SUUA 4AEFA 2BY3A 4BZYA 2YJQA 1E4MM 3N34A 5JVLA 3HFTA 3UY8A 5C6MA 3DECA 2ON3A 5U4NA 3PBYA 1JEZA 1OG6A 3RXZA 1LRQA 4OZOA 4FLSA 1E40A 5J8LA 4M24A 3GH7A 4CNPA 5H91A 1K7EA 3BC9A 1A4LA 2R9RA 4DF2A 1N55A 3DKLA 2GUYA 4M1RA 3M5XA 5A6AA 3QPYA 4ZO9A 2QV4A 4JQ1A 4JY8A 3GS6A 2NXHA 3AJXA 4GI9A 4UOJA 2PE4A 1S2VA 4HCHA 3M0JA 4D6JA 2WVVB 2Z6IA 4DF1A 4LGXA 3DBPA 5I07A 3GM8A 2CCRA 3MV01 5FA5A 3UZJA 2XN1A 3LLXA 3AYTA 4C6CA 6A3HA 3HQOA 1O5XA 3U2CA 5H1WA 1J6PA 4JAWA 3GXDA 3CZKA 3SN0A 4O1FA 3MB9A 4D6GA 1LRNA 3RK8A 4JYDA 1G4EA 4HK6A 1ZGDA 3WLSA 5IOBA 1XRVA 2QJGA 1UR8A 4JFWA 1CXHA 4HPJA 4CU8A 1XDMA 2NSOA 3F7JA 2FB3A 3FW6A 3W83A 1TSIA 4RCXA 4M7TA 2W61A 4JTEA 4O0ZA 2D22A 3T42A 1NFGA 5DXXA 3CEPA 5AZ0A 1QHPA 3S4TA 3QHOA 4TTGA 4I9TA 1Q6LA 1AA1B 3AIVA 3CH0A 3MUZ1 4AWTA 3OU8A 1JQXA 3QZEA 2ZC1A 4US6A 3ZO9A 3SCPA 5ABEA 3RX3A 1U2YA 4OTKA 1V08A 4MPKA 1W9XA 3W7EA 3EDFA 4L1GA 3H55A 2I1OA 2GL5A 4ACYA 2XHYA 3GTHA 1JZ4A 3C2OA 3OZYA 4XZMX 3ES7A 3RPMA 2BMBA 4CCCA 4KWWA 2FZ9A 5C7VA 1Z69A 2TSYA 2IQDA 1F3EA 1WUEA 2BVWA 2ZE3A 1TB3A 2ACUA 4US5A 2Q01A 2CLMA 2PS2A 1PV8A 3O06A 3BV4A 2W9MA 1OADA 3L66A 2FPYA 4JPGA 3MDWA 1DBTA 2QCGA 4F0RA 3RMJA 4NKCA 3U57A 2V5DA 4E3TA 3WEMA 3NXFA 3VMOA 5M03A 2B0MA 1SZEA 1XM3A 1FCUA 1ALDA 1NAL1 4HN8A 2A6NA 1E0XA 3V4BA 4CCDA 4QHRA 4MNLA 3W07A 4JQAA 5U7SA 3VAVA 1QW7A 3GNPA 3MSRA 1ZTVA 2OXNA 2D2GA 3LEPA 3PY2A 3LNMA 3EOOA 4LUYA 3VOCA 3QR3A 1GT8A 1VKFA 3U4AA 3GSMA 1H62A 5A6KA 1F76A 4KEZA 3WIJA 3WNPA 4RE4A 2V3FA 4GZIA 1L0PA 2VEGA 1FWEC 2QQ6A 4GQBA 4ICNA 3V3WA 1R9XA 2TPSA 5DMYA 4RZ4A 3NQEA 4TIMA 4HN4A 3LMYA 3DZ1A 3KL3A 3SCOA 2DFAA 4Z2LA 4YTUA 5G2HA 4ENLA 6ALDA 2X1IA 4JFUA