5D4YA

A psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
331
structure length
314
Chain Sequence
QGLKDAYKDYFKIGVAVNNRNVADPDQIKVVLREFNSITAENAMKPQPTEPKKGEFNWEDADKIADFCRANGIKMRGHTLMWHSQIGSWMYQGNLLSKEEFYANMKHHIQAIVNRYKDVVYCWDVVNEAVADSPVYPGRPELRNSPMYQIAGEEFIYKAFEYAHEADPDALLFYNDYNDAEPAKSQRIYNLVKRMKDAGVPIDGIGMQAHYNVYGPTMKEVDDAIKLYSTVVDHIHLTELDIRINEVSDWERTLQQDQYVQLFKVLRKHKDVIDCVTFWNVSDKDSWLGVRNYPLLFDENYKPKQAYNAVKNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase
publication title Structural insight into potential cold adaptation mechanism through a psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase.
pubmed doi rcsb
source organism Environmental samples
molecule tags Hydrolase
total genus 120
structure length 314
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5d4yA00
4P8XA 3OZPA 4GINA 1QHOA 3U7BA 3CZ8A 3EDDA 3PN8A 4QLLA 4AMCA 1LWJA 3VILA 2XWEA 4W7UA 2C7FA 5EMYA 2ZICA 1XC6A 1E6SM 4PRWA 2VNCA 1BYAA 1M03A 4BQ2A 1B30A 2VZTA 5BYWA 3RM9A 3WD1A 3RILA 2WXDM 1JZ5A 1UD3A 4U33A 2E40A 2CPUA 1KR0A 2ZXQA 4JKLA 3VNZA 4HPHA 4PMQA 1XGZA 2VOTA 1BG9A 5FL1A 2GDUA 4FMVA 2F61A 2FHCA 1FOBA 1XCWA 1JFHA 3CZJA 3VIIA 1R7AA 3PZOA 3ZR5A 1BSIA 2G3MA 4AD5A 1CYGA 4FLOA 3FAXA 4J3VA 1BGGA 1CGWA 3NCOA 4Z2KA 1C7TA 3VVGA 1NQ6A 4PBGA 2WB5A 3AZRA 4GQRA 2QPSA 1WE5A 4LPCA 1B9ZA 4DWSC 1ECEA 5CJ5A 1BGAA 4OOZA 5LYRA 4W7WA 4CD5A 5HXMA 2YL8A 3SCOA 5CLWA 1GVIA 2BVTA 5A94A 1LF1A 2OSYA 1TCMA 1US3A 1UWIA 4RL3A 1JZ7A 2O9PA 2X1IA 1FHDA 4Z2LA 4WF7A 3CZGA 3AOFA 2EPOA 1V03A 4JFVA 1AQMA 1KCKA 3RCNA 3VIFA 1E6RA 1Q4NX 3M7SA 4X0VA 1KWKA 1L0PA 3BCFA 1ITCA 1CGVA 1JDCA 2YL5A 3NSXA 1CXIA 4OIFA 4D6EA 3U5YA 5CLTA 3UEQA 1W9XA 1RPKA 1LL4A 2GFTA 3VGDA 3O6AA 4Z2IA 2XTKA 3FNDA 3BSGA 4UQEA 3RMEA 4EKJA 1RD6A 2DSVA 5I78A 4IUGA 4UZUA 1TR1A 3T0AA 3G6LA 4ZFMA 3VINA 1OBAA 1MFVA 1BLIA 2XWDA 2QMKA 1CENA 7A3HA 3VNYA 3T0DA 2PF0A 1UKSA 4HU8A 2VQTA 2ZUVA 4MAVA 3ZIZA 1VFUA 2O9RA 2WMHA 1B31A 1BYBA 1Q6DA 4AZBA 4EE9A 1QI2A 3GXIA 1MQPA 1HX0A 1LL7A 5JIPA 3PZTA 1V3KA 4XV0A 4UQCA 3AHVA 3WIJA 4CN4A 2VZUA 4M56A 4YPJA 3BMWA 3WFLA 2J4GA 2A3CA 1WAWA 1ZJBA 1UKOA 1ODUA 2QPUA 3IANA 2WHMA 1BVNP 2CESA 4D6HA 1MYRA 3MUZ1 1MVYA 3A4AA 3I3BA 5A8NA 4TUFA 4U31A 4J27A 4U3CA 3WDIA 3EDJA 1NH6A 1U33A 1OM0A 1OWQA 6TAAA 3RM4A 1VBRA 2ZX5A 3N15A 1E72M 1W3JA 1LG1A 4ATLA 3WN6A 4PMUA 3KE0A 3WFZA 2DH3A 3ZJ7A 2BY1A 4W5ZA 7TAAA 1VBUA 2EPNA 3AJ7A 5M17A 1MW0A 2VRQA 3QOMA 1BF2A 3VX1A 1E73M 4M8UA 3SEPA 1NOWA 1J9YA 1UYQA 4AD4A 3VD9A 1CXEA 1ZJAA 3ARXA 3EMCA 3WUBA 3L2MA 3OLDA 4L4OA 5CG0A 4B15A 3WQ5A 1R7OA 3ZSTA 3KZSA 3SUSA 2VX7A 1OD8A 2OWWA 3WDJA 3THDA 3MSDA 4OBSA 1UR4A 1B3ZA 3SIMA 1QW9A 3WNOA 2X8RA 1I75A 2YDRA 1K6AA 2VVNA 4IPLA 1BHGA 3W28A 5A6BD 1GCYA 1UH4A 1WZKA 2BVDA 2GK1A 3SUWA 2ESCA 1KBKA 2WC7A 4KRUA 3WQWA 3OG2A 4XUYA 1JNDA 2DSWA 3VD4A 2JF7A 3ARZA 3TP4A 4TVCA 2XIBA 3UETA 1QI5A 2XJ7A 3CPUA 3BC9A 1EHAA 1Q6CA 1NP2A 3A3HA 4QCEA 5CQ1A 1CZ1A 4M24A 2OWXA 2AAAA 2YL9A 3G6MA 5ABGA 3AHTA 1V3JA 3CHEA 3M46A 3AS3A 1WB0A 4CU7A 4H8VA 2YJQA 2D0HA 5CPQA 1JGIA 2WHKA 3PBGA 3WNKA 4C7FA 1FHLA 1MW2A 3QGVA 1GW1A 1GPFA 1V6YA 5E70A 2A3EA 3WDRA 3PZ9A 1EOMA 4TVUA 1GHRA 3W0KA 3VIJA 2HVMA 4DWSA 2BHZA 3AS2A 5BRQA 3WQ6A 2D3LA 2CIPA 2WMKA 5CPTA 3UR7A 3VPLA 4MB1A 4AISA 4FLQA 4KMQA 1WDQA 1E1EA 2BY3A 1UWQA 2DH2A 3AS0A 3POHA 4PUEA 2ZIDA 4AWEA 1HT6A 5KEZA 4AXNA 3CH9A 3NDYA 3PTKA 1B0IA 1E15A 2WMIB 3PTQA 2XVNA 3ARUA 1CIUA 4GO8A 1US2A 1V0LA 1VEOA 2QMJA 4RE3A 3WH8A 1E4MM 2NT1A 1EQCA 4V28A 2OWCA 4AD2A 5D9PA 2X0YA 5DMYA 1JYWA 1UKTA 2G3NA 3D3AA 2J78A 2VJXA 2EJ1A 3ARSA 1BVZA 1WDRA 3FAWA 4A4AA 1V0MA 4W88A 4QAWA 1PIGA 4D6DA 4HZ7A 2J7FA 2QV4A 2VRKA 2XVKA 3BGAA 3OGSA 3VIKA 4W93A 1KQZA 1NWRA 1V02A 3KL5A 2WCSA 1E40A 4MB5A 3CO4A 4QLKA 2PI6A 1ODZA 1E4NA 4PTMA 4OJYA 4AY1A 3TTQA 4DWSB 3SURA 2RGLA 2XFYA 5A6AA 2XG9A 1OT1A 4J3XA 2XFRA 3BSHA 3VGBA 1UQYA 1WO2A 3T09A 2BXZA 5D9MA 1TVNA 2F8QA 2DDXA 3GXFA 4JAWA 2ZE0A 3WEOA 1UD8A 4HOWA 6A3HA 1QHZA 3AIVA 3LPGA 5I2UA 4OUEA 3W38A 2G4FA 3I3DA 2XYLA 1C8YA 5BXRA 3CZKA 3WD4A 1TG7A 3WF2A 2J7BA 4PMYA 2WMGA 4F9DA 2MANA 1H49A 1ISXA 2V3EA 1HNYA 2J7EA 4IISA 4PEEA 5JIWA 3N13A 4EANA 4Q7NA 1DHKA 2FHBA 5FIPA 1JF5A 5GNXA 1WZMA 4ZENA 3VIMA 2YA0A 3CUFA 3WNLA 1AQHA 1UD6A 1KGUA 1HVXA 4WLCA 3K8KA 3CUIA 3KL0A 3WH7A 4BQ5A 1V3LA 1E6ZA 1HJXA 3VMNA 1HJWA 3W24A 1J01A 3TA9A 4AIUA 4P8WA 4NI3A 1EDGA 2VX6A 5ABEA 3N9KA 2WZIA 1RP9A 2J79A 4P7QA 2GJRA 3UERA 2J7GA 5A2CA 9CGTA 2Y8KA 1S46A 4TOQA 3AISA 4IPNB 3SCWA 1J12A 2W63A 1EDTA 5HBFA 4QFUA 2VT0A 1OT2A 1W9DM 3OBAA 1LWHA 4UQDA 3AHYA 3CUHA 1VIWA 4WJXA 1J0YA 2XVLA 4MJ4A 1GQJA 3GTNA 1UR1A 2BXYA 3U7VA 1D7FA 1C93A 4N42A 1FFQA 3K4DA 4HA4A 3CUJA 2NW0A 1OGSA 4PTXA 2JEQA 3DECA 3TTYA 1H2JA 1O7AA 2ZX7A 4D6JA 4AZCB 5IFTA 1D3CA 2D2OA 1ZS2A 4W85A 2ZUSA 2XIIA 3BAYA 2PB1A 3NSNA 1V6WA 4M29A 2J8GA 1LQ0A 1FA2A 3ARPA 1KGWA 1PX4A 2VCAA 3VDBA 3VIGA 4K68A 1CWYA 2ZXAA 3I3EA 2OYKA 2XGBA 3VTRA 1UOKA 2YIHA 1C8XA 4H2CA 1J0HA 3AZTA 2YBTA 4GO9A 1W1VA 2CYGA 4JHOA 5CZKA 2WKLA 3S6TA 5I23A 2IUZA 3F4VA 5GNZA 1SFSA 1BG4A 4P8VA 2PWEA 3VGGA 3ZSSA 2WWDA 4MNJA 2BHYA 2YBUA 3W6LA 2RGMA 2D20A 2G3IA 2V3GA 4UFKA 2ZX6A 2QF8A 3LPFA 2WMJA 5E0CA 1D2KA 3EDEA 1HKIA 4XZBA 3CZLA 4U2ZA 2X05A 3ZO9A 4GQQA 3AIUA 3WNNA 3B9DA 4CD4A 1GOQA 1NWTA 1KXTA 3B9AA 1VB9A 3ZT6A 3UG3A 2WW5A 4Q22A 3WH5A 1TMQA 3MANA 5GQBA 3RO8A 2Q8XA 4HMEA 3WELA 2ZXBA 3WDHA 1J10A 2OYLA 1FH8A 1Q6FA 5E9AA 3VU2A 1H0GA 4PSRA 3AROA 4ZE4A 4UTFA 1E43A 1F4AA 1M01A 2HISA 3VIHA 1XD1A 5I3DA 1R8LA 3NUKA 3OGRA 2XM1A 2ZUMA 3WMSA 1EO7A 3AMLA 4CU6A 1C3FA 1PX8A 1TVPA 3WEMA 2X09A 5FOOA 1H41A 2VX4A 4JKMA 5A1AA 3NJ3A 3GM8A 4IM4A 3POCA 5D8ZA 2WHJA 8CGTA 5IFPA 1C90A 2EPMX 2VUYA 3EBVA 4CVWA 1C92A 3CZEA 3NYDA 2YDSA 4GPNA 4UFLA 1A47A 1CPUA 5DT5A 2FDMA 5A6LA 4AW7A 1XD0A 3EDFA 3AIBA 1R85A 1QVBA 2OSWA 1OB0A 4MADA 4WSJA 1GQLA 3F5KA 2CBUA 1W9VA 3RIKA 1GZJA 3W27A 1EOKA 2WZHA 2CETA 4B3KA 3FXYA 2PWHA 3OB8A 4QDMA 1XYFA 5C70A 3A6OA 4HPGA 1KR1A 5ABHA 2BVYA 1PZ3A 2Z1SA 2BFGA 4PMRA 1M53A 3L4YA 3UCQA 2E8ZA 3II1A 4BA0A 1XSKA 1J0KA 2ZXDA 2EEXA 5I6SA 2Z1KA 4TTGA 1ZBVA 2J7CA 5I24A 1DEDA 1GJUA 4ML4A 3SUTA 1UWUA 4UQ9A 1VAHA 4V27A 4ACZB 1GOWA 4W87A 3SCRA 2J62A 4PMDA 3TTOA 5GNYA 1QI0A 4R5EA 1LJYA 5BRPA 2AOSA 3GH4A 2YA1A 3MSGA 4AD3A 5IHSA 4HA3A 3WDQA 3QHNA 4JKKA 1H11A 4NSBA 3SCUA 3TTSA 1E0VA 2ZX8A 4FF5A 1B3VA 1U2YA 4ZXLA 1KQYA 1KXVA 2WVVB 2CHOA 5C71A 1LLOA 5AY7A 1CLXA 1CGXA 1UQZA 1HIZA 2WSPA 4W7VA 4CD6A 3CHCA 3W29A 1CBGA 1NOUA 2G41A 2EPLX 2BV9A 1W91A 3BH4A 4D1JA 3SUVA 1QOXA 1QI4A 2GUYA 4W5UA 1JI1A 2B31A 4UOJA 2BS9A 1HVQA 2A3HA 1M04A 1ESWA 1K9DA 2YL6A 1JZ8A 3PZNA 4J3SA 4U5IA 3WMCA 3OGVA 5E09A 4OKDA 1UKQA 8A3HA 4WK9A 1DP0A 4P7RA 1PJ9A 2J25A 4JFUA 1A3HA 1B90A 1TZ7A 1MQRA 1OGGA 4J7RA 2XGIA 4DUXA 4AZ5A 3BXWA 3CIVA 4BCEA 1OIMA 2D3NA 1UH2A 1WZLA 1XSJA 3O9NA 3IJ9A 1X6LA 2WVUA 1CXLA 3DC0A 3AYSA 2XHYA 3L4ZA 4AEEA 3GXDA 5D8WA 4DUWA 3HU7A 5BCAA 4X9YA 4BQ3A 3PZUA 1U30A 5CXPA 4BS0A 3ZMRA 3IJ8A 4AC1X 4TX6A 2Y5EA 1HKJA 3MV01 1QNRA 4JL1A 2WM0A 2JF6A 4LQ1A 2W67A 2WHLA 1EO5A 1WP6A 1VRXA 4LYPA 1I1WA 3DYOA 3N17A 1G01A 2WMIA 2EO7A 4UQAA 4P7OA 5JBFA 3BMVA 1W9PA 1SMAA 4JIEA 4TTUA 3WSUA 4D6GA 5JUVA 1EA9C 2J8FA 1V3MA 1GONA 2VZVA 2PWDA 1XYZA 4PMZA 1WDPA 5DF0A 2W5FA 4ZE5A 3SCNA 1SYTA 2PWGA 4MJ2A 1HKMA 3HN3A 4PN2A 4S3KA 4UFJA 3OIHA 5I79A 5AYIA 3K8LA 5DO8A 3NDZA 1WNOA 1C8QA 5A8MA 3VMOA 2CHNA 2BHUA 1J11A 1E1FA 3W26A 3AZSA 3W4RA 3BAXA 5AC5A 3OLGA 4JCLA 1E9LA 3S2CA 2BNJA 3ALGA 3WL1A 1IT0A 1QI3A 1KB3A 3A4WA 2VRJA 3B8SA 2J77A 1PEZA 1BPLB 4CUCA 2VZOA 3OLIA 5AC4A 3DYMA 2DGAA 5A2AA 2DSZA 4J3TA 3WBAA 3VUPA 1SR0A 4MNKA 1XV8A 3ARRA 1JD7A 4C7DA 1JF6A 2DSKA 4JL2A 1FH7A 3UG5A 3RM8A 4BZYA 2EPKX 1J0IA 2A3AA 2W4XA 1DWFM 1UUQA 4DM1A 5D9OA 2E3ZA 3B9EA 1ZL1A 4H41A 1HJQA 1ZB5A 3PZGA 5BWFA 3CBWA 3N04A 4ZEPA 3IK2A 2GJPA 3T2QA 3GBDA 3VDCA 3U57A 3EDKA 5HOSA 2VX5A 4LGXA 3N11A 5DT7A 3MS8A 1QW8A 2OSXA 3VGHA 3L4WA 1GOMA 4DWSD 2PWFA 4U2YA 1GOIA 4WKAA 5F7UA 7CGTA 4MDPA 1UR0A 1OINA 2XSAA 3IAQA 4JFTA 5HPOA 2X2YA 2ZUUA 2EBNA 4BF7A 4F9JA 2C0HA 4HMDA 4H04A 1TUXA 1JZ6A 1BYCA 4M80A 5A95A 4GIAA 4P8UA 2VZSA 1E4LA 1AQ0A 1H0IA 1V6VA 1GVYA 2DSUA 2J74A 4F66A 2YKKA 2WMFA 3ZT7A 2CCRA 2TAAA 2VCBA 3SCTA 2JIWA 3MUY1 2Y2WA 3AIEA 2WC3A 3RJXA 2Y4SA 1EHNA 2D22A 2W62A 4PUDA 5FCZA 3W81A 3AQUA 4JFWA 4D6CA 3W6MA 1TFVA 4HTYA 5A6MA 4L4PA 2ZWZA 5A6JA 4AZCA 1JZ2A 2E9MA 1BTCA 1G5AA 1UG6A 3A47A 2G3JA 2ZUWA 1KXHA 3WNMA 4F8XA 1WCGA 4LYRA 1BQCA 5I0DA 3WUGA 1XH2A 1B2YA 4ATDA 3UG4A 1G94A 1E5JA 1HJSA 4MTVA 2GDVA 2VURA 1E0WA 2FHFA 3N18A 1QNPA 4AYSA 4D72A 2C8NA 4P7LA 1QHPA 1IZKA 1RH9A 1OSEA 4M1RA 4N0RA 3DHPA 1EDQA 2VMFA 2XM2A 1J0ZA 2NSXA 2FGZA 1E0XA 4CKQA 1JZ3A 4W89A 1V6UA 1C91A 2WANA 3MMDA 1Y7VA 3FHAA 5BXTA 2FH6A 3SCPA 1UR2A 1QPKA 1CECA 3VDHA 5A2BA 4MPKA 1L8NA 3GNPA 2WCAA 2DT1A 3F5LA 5A8PA 1GUVA 1HKKA 2CBIA 5FKYA 1MQQA 3WF4A 2ZOXA 5AYBA 2CXGA 2X0HA 4A3YA 4DM2A 3WQ8A 4YN5A 1FFRA 5A69A 5FL0A 1PZ2A 3VO0A 1NWSA 3VD7A 2VVSA 3E1F1 1JDAA 2VCCA 5IXEA 4PSPA 1E5NA 3WH9A 4MB4A 3ALFA 2D0FA 5ABFA 2XUCA 1JNEA 1MXGA 5M03A 1CTNA 1IZJA 2AMGA 5DFAA 1E6XM 2G8ZA 1E6NA 4TX8A 3AI0A 3QHMA 2D0GA 3AIRA 1VFFA 3WF0A 1TE1A 4FLRA 1ISYA 1CGYA 4PYSA 4WKHA 2VL4A 2PBGA 1X6NA 1NARA 1J0JA 1TA3B 3L2LA 1MW3A 1ZBKA 4J3UA 2NT0A 5DEZA 2CKRA 2ZWYA 2JE8A 4E8CA 4NRRA 1B3WA 1I1XA 2WBGA 2DIEA 1H5VA 5A6SA 1NOFA 1HP5A 1PIFA 3K4AA 1SMDA 5M5DA 3PZMA 4S3JA 1MWOA 2VO5A 1DWGM 1JXKA 4W8LA 2GJXB 4CD8A 1JYVA 2IXUA 2WBKA 4D6IA 2OLHA 4LXFA 2V38A 3WY1A 3RPMA 1H4PA 4B16A 4W8AA 1E71M 3VKKA 1PX3A 1LL6A 1GHSA 4ACYA 3ZJKA 5ABFB 3J7HA 4CN1A 2XPKA 3WKZA 1GQIA 3W25A 1HP4A 3AS1A 2J75A 4YHGA 2E9BA 1CGUA 4XZWA 4WIWA 4KGJA 3ARQA 3AXXA 1BAGA 3K8MA 4A3HA 3ARYA 1UHVA 1R86A 4HU0A 1CNVA 3AXHA 1JFXA 3PZIA 4AIEA 1YQ2A 3VGEA 3AICA 2WVSA 1BFNA 2J7HA 1AVAA 1B3XA 1XH1A 3KWXA 4ACZA 1UR9A 1JYNA 1OIFA 2EQDA 4HZ8A 1H09A 2CERA 4CN6A 2WPGA 2XVGA 5D4YA 1W3HA 4PTVA 4UZSA 4HP5A 1W1YA 4W86A 1UKPA 3WUFA 1CDGA 3GNRA 1VFMA 4QP0A 3MKKA 1QNSA 3VD5A 4UFMA 4RE4A 3OZOA 1GNXA 4CCEA 1EQPA 2VI0A 3BCDA 2WVVA 4KWUA 1KXQA 2V3FA 3SUUA 2GSJA 2WVTA 2YA2A 1HJUA 4PMNA 4MDOA 5EB8A 2WLZA 5FD0A 3SCSA 3F5JA 1V3HA 2WCGA 3ZR6A 5M3WA 4GKLA 3CUGA 2W61A 1W2VA 3FN9A 2UY5A 4RE2A 2W91A 3WDPP 2ZX9A 2YLLA 1KWGA 3EMZA 3W82A 3QOKA 4OBRA 1MXDA 4FK9A 3T0BA 4LX4A 2V3DA 1E56A 1VJZA 4P7NA 1CEOA 4D1IA 4NF7A 1PAMA 1JYXA 3ZT5A 3AMGA 1W9UA 2A3BA 3VM7A 1JDDA 4GZEA 2IXVA 3AIQA 3MUIA 2JIEA 2E9LA 5EBAA 2VTFA 3ZJ6A 4PMXA 3VGFA 2Y24A 1JXJA 4HOXA 3CLWA 4AD0A 3VOCA 4HA1A 4KH2A 4J28A 1N82A 1MFUA 5JBDA 3L4TA 1P6WA 1O6IA 4J3WA 4C7GA 5CSYA 5TD4A 1XHGA 2WLYA 3MMUA 2CBVA 2O9OA 4GI8A 2V5CA 4UR9A 2DT3A 4EK7A 3JUGA 5E6ZA 4QLJA 4UOZA 1UD5A 3MUAA 3MV11 1E55A 4NRSA 1W9BM 1H1NA 3WEZA 4E4PA 2WAGA 2ZUTA 1W1PA 5E6YA 1DWAM 3NSMA 4TVDA 1W1TA 1GJWA 4JZ5A 3W37A 4JFSA 2CKSA 3ARVA 2DQXA 4PCTA 3O2LA 3BAJA 3IAPA 2WK2A 4GXPA 4R27A 1AMYA 4Z2GA 3WQ4A 4ATWA 1W3KA 4MB3A 4H7VA 2VR5A 3BLKA 5D9NA 3GXMA 4U5KA 5E0FA 5A6BA 4ZXOA 2WNWA 1V6XA 5A8QA 1UD4A 4HZ6A 1V02E 1QNOA 5CSUA 1VEMA 2GVYA 4GZIA 1W32A 1WKYA 1NM9A 4E8DA 1XRVA 1HL9A 3AXIA 1VF8A 3APGA 2DPEA 3L4VA 1Q6EA 5HPCA 1CXHA 1EGZA 4AZIA 2D1ZA 1JL8A 3CHDA 3QHOA 4UOQA 4AZ6A 1M7XA 1UA7A 1K9TA 4URIA 3PHAA 1UWSA 4Z2JA 4LYQA 3FHQA 1OD0A 1J18A 4OZOA 2O92A 1JI2A 3DYPA 4B9ZA 2OYMA 1EIBA 3TOPA 1IV8A 4CU8A 1UZ1A 1FH9A 1H3GA 2CITA 3ZQ9A 1C7SA 1E3ZA 4W8BA 1Q6GA 3M6DA 2W92A 5LA1A 3N12A 1JIBA 1KCLA 3UR8A 4EAMA 1ITXA 3GYCA 1HN1A 1JAEA 4WSKA 3GBEA 3PZVA 3EMQA 4KGLA 4PMVA 3MMWA 3L4XA 3WD3A 2Y8VA 3W53A 3GZAA 1CLVA 2DEPA 1HXJA 2YLAA 1BYDA 1JD9A 4CCDA 1V0KA 5BROA 4BQ4A 1KGXA 3WD0A 3IJ7A 2F2HA 1V3IA 3BAKA 1B3YA 1WZAA 4QCFA 3OA5A 2XFFA 1UA3A 2UY4A 4DUVA 5LA2A 4H8UA 3T2PA 1JG9A 3CGTA 3AHXA 4Y7EA 3LPPA 4M82A 2VQUA 1QBAA 5IHRA 1GOKA 1DWJM 1XH0A 3BLPX 2WKGA 3VD3A 2WWCA 4MNLA 3WF1A 3AMKA 4YHEA 4B9YA 4NZCA 4UQBA 3TONA 1G0CA 3WMBA 3ECQA 1UZ4A 5IDIA 1HF6A 3VX0A 1YHTA 1EXPA 1UWRA 3HMCA 3LPOA 4HMCA 4V2XA 3LMYA 2FH8A 3AMDA 4CVUA 4D71A 1VJSA 2GK1B 3FW6A 4AZGA 3T2OA 5A8OA 1FP9A 3SCVA 2FGLA 1UD2A 3ARWA 3MU7A 3NIYA 2W66A 3PTMA 1QBBA 1FP8A 5CGMA 4PCSA 1R87A 3GDBA 2UWFA 1E6QM 1QNQA 3RDKA 1OCQA 1K9EA 1CXKA 2WSKA 3AIWA 2PBOA 1OGBA 2E4TA 2WZEA 3AYRA 3CHFA 3AMCA 1HL8A 1ZU8A 4UFIA 4H8HA 4X0NA 4Z2HA 1NWUA 2JFEX 3T08A 1X1NA 2CBJA 3L4UA 3THCA 1CGTA 2JEPA 4B3LA 1B1YA 3DHUA 2VC9A 4E2OA 1DWIM 4HOZA 2DT2A 5CPSA 2CNCA 3VMPA 4PMOA 2WC4A 1WPCA 1ISVA 2E8YA 5HNNA 4CGTA 1WDSA 5A6KA 4FLSA 1KFWA 4M81A 3K46A 4MNMA 3QR3A 2UY2A 3VM5A 2XSBA 1GOOA 3GH5A 2YDQA 2D23A 4AZHA 5A3HA 1E3XA 3WQVA 4PTWA 2BY0A 5HDRA 1VENA 6CGTA 1G1YA 3OLEA 2EXOA 4TXEA 2V5DA 4AIOA 4AEFA 4XB3A 1JAKA 1E6PA 3HJEA 1DTUA 1DWHM 1UR8A 1VEPA 3KL3A 4JHZA 1E70M 3K1DA 1V08A 3WL0A 1TA3A 2PC8A 3RJYA 3A4XA 3GNOA 1ZBWA 3GH7A 2J47A 2WYSA 1W3LA 3PZQA 3EYPA 1GQKA 4UCFA 5KZ6A 4UNIA 5CGTA 1E4IA 3KEHA 3AFBA 2YOCA 1GORA 3MO4A 4JCMA 2UY3A 4GZJA 1MW1A 5GPRA 4GI6A 1ZBCA 2BY2A 2GJXA 2JALA 1RP8A 1VFOA 4AD1A 5ECUA 2ZUNA 5C8BB 1V0NA 3CTTA 2QLYA 3ARTA 5BXSA 1CXFA 1K9FA 3BAIA 3VIPA 3WENA 3CMGA 5I5RA 3ZJ8A 1Z32X 3UESA 3VDAA 1NP0A 5I77A 3U5UA 1G9HA 3WF3A 3ZOAA 3WH6A 4W84A 2XVPA 3ZM8A 1UH3A 5EFDA 1KBBA 1ISZA 1LG2A 3N1AA 3WD2A 3AHZA 2J7DA 3BAWA 4F79A 1PBGA 4D6FA 4AZ7A 2DIJA 2CEQA 2DT0A 1HJVA 3FY1A 5LA0A 4GI9A 2VR4A 3SCQA 2E0PA 4CCCA 4OOUA 5JBEA 4XX6A 4UFHA 1EH9A 1XCXA 1XSIA 2D24A 1W2PA 5BXPA 1ISWA 4KRTA 3WNPA 1F4HA 4WKFA 2O9TA 1UWTA 3M07A 3WUEA 3VIOA 1PPIA 2QHAA 3CMJA 4MAZA 4U3AA 3WBEA 1JZ4A 4CD7A 3D5HA 5EFFA
chains in the Genus database with same CATH superfamily
3R4IA 4XKYA 1X1OA 4UC5A 3H7RA 2XWEA 4W7UA 3NQAA 1E6SM 4PRWA 2EKGA 2VNCA 1YMYA 2QVNA 4BQ2A 4L5ZA 4R33A 4IJRA 1ZFJA 2WXDM 1JZ5A 3TFCA 3FJNA 1O1ZA 4M0XA 1FCUA 3U0HA 2E40A 3ITVA 1KR0A 4QNEA 1TX0A 3VNZA 4PMQA 1BG9A 1SW3A 2NVCA 5FL1A 2ZKMX 2GUUA 4ENLA 1FOBA 1TUFA 1O5RA 1R7AA 4AD5A 4IFKB 2G3MA 2PDUA 3PBUA 4KIEA 3DFPA 1C7TA 3NURA 1P1MA 1UMLA 4RDWA 4GQRA 1WE5A 3KOXA 4LPCA 4DVOA 5CJ5A 3A23A 1HL2A 3SCOA 1L6FA 2WJZA 2V6AA 1RK6A 5EGRA 1LF1A 1TCMA 3RO6A 1US3A 1UWIA 2XIJA 3E0FA 4S2BA 1XFCA 4CNNA 1FHDA 4WF7A 4AWTA 4ZQNA 3TQ0A 4FZIA 1YKWA 3E38A 3UXLA 3CB3A 3CL7A 3RCNA 5HULA 3M7SA 3MCNA 3NZRA 4PUUA 1KWKA 1JDCA 1CXIA 3G1YA 5CLTA 3GW0A 3STCA 5AHLA 2GFTA 5EMLA 3O6AA 4Z2IA 3FNDA 3BSGA 3DBNA 4A21A 3QYSA 2WKJA 3UXIA 4GGBA 3R7MA 1TR1A 3VINA 1OBAA 2QMKA 4JTEA 2V5JA 3T0DA 3SJNA 1LP6A 4HD5A 1SO3A 5AN7A 3ZIZA 1M6JA 4YWSA 1QTWA 2WMHA 1B31A 4EE9A 1QI2A 2WSYA 3DGRA 3GXIA 1MQPA 1HX0A 1LL7A 4UR7A 4WDWA 4UQCA 5FA5A 1Z7AA 3UPWA 1ZLPA 3CH0A 1ZJBA 3AALA 2C18A 3IANA 5HMFA 4JTUA 3EPNA 2OFJA 3QXBA 1EWDA 1BVNP 2GYIA 2H3DA 1MYRA 2NWSA 1MVYA 1JCXA 3I3BA 5A8NA 5KZDA 4TUFA 4U31A 4J27A 4U3CA 4IMEA 3WDIA 1U33A 4NVTA 2I14A 1OM0A 1FXPA 6TAAA 2PDHA 3SI9A 2HBVA 1VBRA 4XK2A 3N15A 3XINA 1LG1A 4JXCA 1RLCL 3VCRA 1Y0EA 4PMUA 5G1TA 1F3TA 2PLMA 1O66A 3W7RA 3LYEA 3G1SA 3FGCB 3AJ7A 3C86A 3N2MA 3QQWA 5M17A 5HNUA 2E67A 1HTIA 2OT0A 4ML9A 3KBSA 1BF2A 4Z08A 3MP4A 3VX1A 1EP3A 1E73M 3QR0A 4BI6A 4M8UA 3SEPA 1NOWA 2DJXA 1GKPA 2CLHA 1MDLA 1TPB1 2YCIX 1FXQA 1PTDA 4C65A 2FDSA 5CG0A 3CYJA 3W1LA 3W75A 3VZZA 2X0SA 2ZZ2A 4I5UA 1OD8A 1S2UA 4RPPA 1CX9A 3MSDA 1Y65A 3SIMA 3ZS4A 1K6AA 1BHGA 3W28A 4PUJA 1WZKA 3CTLA 4LWWA 3BG9A 4XUYA 3MDWA 2ISSA 3VD4A 4S38A 1XJBA 3TP4A 4TVCA 1IT8A 1IE7C 3UETA 2RDUA 4MWAD 2CC0A 2BZNA 3BC9A 3A3HA 5HUOA 4QCEA 3VUSA 2I9UA 1DTNA 2P5NA 3M0YA 1ZENA 1NF7A 1V3JA 3S1VA 4GX8A 3M46A 2NSOA 4YTRA 3KBMA 3EOOA 5FESA 2YJQA 3EZ4A 1Y5XA 3PBGA 3C2VA 3H53A 4L6DA 3UZWA 4BK9A 1GPFA 5D04C 2G4JA 4NG3A 3BLIA 3GVWA 4TVUA 3W0KA 1XICA 1EJVC 2C3ZA 2D3LA 2CIPA 2WMKA 2Y1HA 4O8AA 3AWNA 1F07A 3GWQA 3TH6A 4MB1A 4Y9OA 3BOXA 1WA3A 2OOGA 3DZ1A 5CBJA 3P93A 2QUNA 2VENA 4H9ZA 3PTQA 2R1LA 2XVNA 3MSYA 4B5NA 4GO8A 4UTJA 1VPXA 4GVIA 3QSRA 2DZVA 5BMXA 5D9PA 3GG1A 2IQTA 5C54A 4H4IA 1UKTA 1PWLA 4A29A 3D3AA 3CV7A 1AH4A 2EJ1A 1BVZA 1V0MA 5DBUA 3W1MA 1TELA 5BW6A 4QXIA 3BGAA 2XVKA 2YCEA 3VIKA 1LBLA 3TW7A 4W93A 1WXYA 2QXWA 3HIJA 2V30A 3N34A 4NAEB 3UGRA 1R9XA 4QLKA 4S3GA 1Z6KA 4DWSB 1LROA 3I68A 2NWRA 1VPYA 9XIMA 5A6AA 1L6SA 2WO5A 2PP3A 3GDMA 2JBMA 4I5RA 4LAZA 3B8TA 2XFRA 3BSHA 2BXZA 1TVNA 3GXFA 3WEOA 4HOWA 1QHZA 4B4HA 3W38A 1C8YA 1W1ZA 3AYTA 1A5SA 1TG7A 1KW1A 1M68A 4F9DA 1RQBA 1S5MA 4QNWA 4IISA 4O0KA 1ZJIA 2PWVA 3EOEA 2FHBA 3GUWA 5FIPA 4RNIA 1VLWA 3CUFA 4LYKA 3WNLA 1AQHA 3W7QA 1AUSL 5CZ0A 4H01A 1FWNA 4DLMA 3BLLA 1SR9A 3NVDA 4MG4A 1SZEA 3QPEA 3VMNA 1J01A 5I3JA 4NI3A 1EDGA 1MXSA 4P7QA 3P8IA 3UERA 1UROA 4GNJA 4R3UA 3AISA 2W63A 1EDTA 4JBRA 4N6FA 4QISA 4EF8A 3OODA 1XBZA 3AHYA 2CLOA 2CLLA 1GQJA 3GTNA 1IEXA 5AKQA 2BXYA 2ZA2A 3SGUA 1YNPA 2QIWA 2YB1A 2NW0A 2E7FA 2JEQA 3DECA 3MKCA 1H2JA 2QQ6A 2YZRA 3CV6A 1U22A 3FJ4A 1EGVA 3LGDA 1XXXA 4W85A 2I57A 4M29A 3DKLA 3GB6A 1KGWA 2VCAA 3BPWA 5HK4A 4K68A 4S3EA 4DBDA 3CT2A 1RY0A 2FZDA 2XGBA 2YIHA 1C8XA 5I3GA 2YBTA 4FNSA 4GO9A 5FEPA 3KRZA 4E3TA 1TWDA 4ZQOA 2IUZA 3MHFA 3UCCA 3LZ3A 3QZEA 1DJNA 1SFSA 3PB0A 3EWCA 4JYDA 3W00A 1WKFA 2X7VA 3GFZA 2BHYA 4IIGA 1DL3A 3W6LA 2NQJA 2MUCA 5FJIA 3T40A 4JPGA 4GH3A 3EDEA 3CZLA 4U2ZA 3S2JA 3B9DA 4CD4A 1NWTA 3B9AA 4YS1A 1VB9A 3ZT6A 7ODCA 3QTGA 4IG2B 4C6CA 3E96A 4ZL1A 5G2IA 2OR2A 1XI3A 2CLFA 3RO8A 4HMEA 4GXMA 3SW6A 4R9OA 5CG7A 3S4TA 2PGWA 3P2VA 5E9AA 2FMOA 3G8RA 1RBOB 1IEIA 2ZDRA 4IUOA 1M01A 1FDYA 1FHVA 3HGRA 5H8UA 3EPOA 3SRDA 1QOPA 4MFEA 5JXQA 3NOYA 3BARA 1XD1A 2ACQA 4YVVA 4DUOA 1PL9A 3DGBA 2QEZA 5IDZA 3WMSA 3AMLA 1PX8A 4ZO6A 4PR4A 3PUDA 3NL5A 1C8VA 3NJ3A 3GM8A 4IM4A 2Z00A 2AQOA 5D8ZA 4EXBA 1KM2A 5IFPA 2EPMX 4FHAA 2YZ5A 2YXXA 3SN1A 2YDSA 1TPC1 4S3FA 1A47A 5DT5A 2FDMA 3I6RA 4AW7A 2PZNA 1Z3NA 3UA4A 1OB0A 2Y6ZA 2IPGA 3BW2A 3PWAA 3W27A 1CT5A 2PCEA 2WZHA 1V51A 3CO8A 1O5QA 3FXYA 1Z41A 1OADA 3GXPA 3PNUA 4QDMA 1XYFA 3UP8A 5G4WA 5SWUA 2BVYA 2Z1SA 3UCQA 2E8ZA 3DCPA 3II1A 4NILA 2NV9A 1ADOA 3TKFA 1GTEA 5I6SA 2Z1KA 4TTGA 5I24A 1DEDA 2IS7A 4AVNA 3G5EA 3QQ0A 1RJPA 3FGCA 1QASA 1J6OA 1GOWA 4W87A 3T0CA 4ICNA 2AL1A 3NPWA 2TPSA 3TX9A 4HT3A 1VYRA 4C6DA 1AW1A 1L9WA 4LOCA 3IV8A 3HQOA 3KBWA 3M5VA 4HA3A 1BWVA 4CNUA 1JRCA 4JKKA 2E6AA 3TTSA 2ZX8A 1B3VA 1KKRA 1U2YA 1LLOA 4V1XA 4YCOA 3W1AA 4CD6A 3GR8A 3W29A 1NOUA 2ZZ7A 2G41A 2PRLA 4PZVA 2BV9A 4O54A 1DE5A 1F73A 2OMAA 3G1RA 2ZZ1A 1KNWA 1X8FA 4RR4A 4QAIA 4DJFC 4HU4A 4MKVA 5HA7A 4K7VA 1JI1A 2X1TA 4DJDA 3IVUA 3VFCA 1FWAC 1F6YA 3DIPA 3B0YA 1HVQA 2HVNA 5XIAA 1M04A 5DX7A 2A7PA 3R1ZA 5MKGB 2XFWA 3PZNA 1JZ8A 3BANA 3H55A 3UBPC 4HN8A 5HANA 1PSCA 1TZ7A 1XS2A 1OGGA 3V1HA 4BF9A 4QG9A 4Q7BA 4XD6A 1WZLA 3IJ9A 1X6LA 1Y5VA 4X9SA 3BGJA 3AYSA 2XHYA 2IPWA 4YVPA 3LDVA 1U30A 2HS6A 5CXPA 5F2GA 1SO4A 4AC1X 1OG6A 3RG6A 3UWWA 4FAMA 4TMCA 2WM0A 4GJ1A 2V9DA 4TO8A 1BWKA 5JBFA 5C0QA 3BQ5A 4L61A 3NEHA 1SMAA 2DU2A 4TTUA 3WSUA 1XDMA 5D33A 4W4QA 4DPQA 2J8FA 1GONA 2PWDA 5T91A 1WDPA 1A3WA 3G1AA 3DUGA 1HKMA 3HN3A 3EKZA 5TIMA 3RCYA 1TRIA 3SRFA 3GUGA 1AQFA 3NDZA 3W1RA 1YPFA 3EKLA 1ONXA 3F1QA 3GO2A 3LMZA 4H9TA 3AZSA 4NXSA 3W4RA 1R3VA 4V15A 3IJDA 3WFAA 4JTSA 4MWAB 4NAEA 3ABRA 3KFTA 1A0DA 2OELA 3A4WA 4ZA0A 4HVXA 1OG0A 3B8SA 1POKA 4YYFA 1PEZA 1IGWA 2R82A 4UUIA 2E68A 4U4MA 3W7LA 1CW2A 3UJRA 3M0IA 1TV4A 3KLKA 2DGAA 4J3TA 5I02A 3CHVA 3VUPA 4DBEA 5AHNA 2CFFA 3R0DA 3MKVA 2O4QA 3UFYA 4MNKA 1JD7A 1M7JA 1FH7A 3H26A 4H6QA 2FZBA 1XL9A 3KVKA 2INFA 2ODOA 4ZB2A 3BE7A 5D9OA 4NJJA 3B9EA 4H41A 3PZGA 5BWFA 4O57A 3WQFA 4A8RA 3GBDA 5HOSA 4LGXA 2R14A 1NDZA 3QN3A 3W7EA 2OSXA 3TROA 3R5EA 5F4SA 4KFPA 3M0KA 2PWFA 3UA3A 1GOIA 2NQHA 1DXEA 1UR0A 3IAQA 4JFTA 3TOYA 2ZUUA 4JR5A 3UZJA 3NL6A 1Z8AA 4G7EA 4N02A 1R5YA 4H04A 4RZ4A 5DMMA 2IQ0A 3PPCA 2OCZA 4ZO8A 4JTKA 4O8RA 3D6NA 3LERA 1MEIA 1N7KA 5CAHA 3GTXA 1BYCA 4L7ZA 3PF3A 2ZC1A 1A0EA 1H0IA 1S38A 4F66A 4HPJA 3NM3A 3MUY1 3W2LA 1B4KA 2WC3A 3UZZA 3RJXA 1NDYA 2W62A 4PUDA 3AQUA 4MUPA 3RRAA 1E0TA 1TFVA 5A6MA 5A6JA 4KCVA 1G5AA 2BOEX 3A47A 3W87A 1WCGA 1BQCA 4RV8A 1GVRA 1G94A 1E5JA 4YMZA 2GDVA 3EWDA 1SPQA 1QNPA 4AYSA 2J6VA 3B0XA 3EA3A 5HJXA 1OSEA 1Z89A 4YIWA 1EC7A 4PCNA 4W9TA 2Q3RA 3WBXA 4DJEA 3KAOA 1SJAA 5F2LA 4QGCA 1HKWA 3SCPA 3TYEA 1QPKA 3WLHA 2A7RA 1QR7A 2ZBTA 1HKKA 4FR1A 4K1WA 3BW3A 1RPXA 4DIAA 5I06A 3KDNA 2CXGA 2VGFA 1A3XA 1LT8A 4O19A 1PZ2A 1D7KA 1EEXA 4JQ1A 3VE7A 3ALFA 1W56A 4DZHA 3I7RA 5AZ0A 4DZAA 3WLJA 1JNEA 1MXGA 2AMGA 4GA8A 1E6NA 5CPNA 3BGGA 3FYYA 3QHMA 3WF0A 1VFTA 5FJPA 3BTNA 1TE1A 2C1IA 4JN6A 1H63A 1ISYA 4X60A 2PBGA 3L2LA 1MW3A 4YTQA 5IRPA 2Y88A 2JGYA 4BR1A 4O17A 4P5UA 1B3WA 2Q3OA 5CPOA 4ILSA 2XH2A 4H6RA 5FAJA 1UCWA 2X16A 3PZMA 4R7OA 3O06A 5B7YA 3OVGA 4S3JA 5ECVA 1OCJA 2GJXB 1JYVA 2F6XA 2QGYA 4D6IA 3LD5A 3WY1A 5G2WA 3QSTA 3H4XA 2GGEA 3ITCA 4AWUA 3D3FA 1EPXA 1PX3A 5AC7A 5I07A 5ABFB 4CN1A 1T5AA 3WKZA 3KM8A 1VFHA 3EX6A 1M9HA 3QV8A 4KGJA 2VEFA 3AXXA 1BAGA 3E12A 5KETA 1L2UA 3HFTA 3ARYA 3JRKA 1R86A 4QITA 3IJQA 1I45A 4ZVJA 3SQLA 1NQKA 3QC0A 1JFXA 3PZIA 1YDYA 4AVFA 3VGEA 4JD4A 3AICA 3W72A 1AL8A 1AVAA 1Q5MA 3RFAA 4M19A 3KWXA 1DKWA 1OIFA 3R79A 3UXAA 1OK6A 4HZ8A 1ZHAA 4CN6A 5AB3A 2HNEA 2WPGA 1W1YA 2SFPA 4PB3A 3IUDA 1TPWA 4M6PA 1EJRC 3KBNA 5EMJA 1EZ2A 3MKKA 4IMFA 3W3OA 4RE4A 1GNXA 2VYOA 5J5DA 2XH4A 2V3FA 2WVTA 2YA2A 3NAVA 2QF7A 3PSWA 3F5JA 1UP3A 1U5HA 2J9XA 1SQ7A 1A5OC 1QK0A 3CAWA 3CL6A 3WDPP 1W17A 3WLNA 3STPA 3W82A 3CQ0A 4CCZA 2OO6A 1A5UA 3LXAA 1MXDA 4JGDA 4FK9A 2X2GA 4NJIA 5DY2A 1E56A 1UW9A 5DELA 1K7EA 1CEOA 2BP1A 4NF7A 4GFSA 3W1QA 3THQA 3AMGA 2A3BA 1F3XA 1O94A 5G2HA 1JPMA 4GQGA 3MUIA 2CXEA 1LOQA 3R11A 3N4EA 1WDWA 4PMXA 3VGFA 1R9ZA 4AD0A 4B5XA 2E6DA 2BVWA 1MFUA 2VFDA 1Q6LA 3CQHA 2C15A 1SJBA 5I03A 5C2GA 4QRNA 4FP1A 1R3SA 3MMUA 3EX4A 4UR9A 4RPQA 5HQEA 2GVGA 3C61A 2VUNA 5F4WA 3W84A 3W7NA 3O3RA 1EZWA 3MV11 1E55A 3W85A 3WEZA 4E4PA 2WAGA 1KBLA 2AGTA 3QBUA 3H4WA 2R1KA 4H19A 3NL3A 4NNAA 1B3OA 4JZ5A 3S9YA 4JFSA 2CKSA 1WUFA 4R27A 1AMYA 1W1A1 3KBJA 4ATWA 4QEEA 4XSLA 4D9PA 4DRSA 4HNCA 2VR5A 3L68A 3LI0A 2XINA 3TC7A 3GXMA 2D2JA 1LQ2A 4U5KA 2WNWA 5A8QA 2WZTA 1KD0A 1G69A 2OJPA 4RNJA 1BSLA 1KTNA 2ZRVA 3M4HA 1KM6A 1G4SA 1XRVA 4MWAA 1MNSA 2E77A 3E0LA 3H22A 3AXIA 1IYXA 3APGA 2DPEA 1X98A 1JDFA 5J8LA 2X42A 4N9CA 3Q2DA 3CHDA 4BWLA 4AZ6A 4A2RA 3RXZA 4IIHA 4A3RA 3C0JA 1UWSA 1OD0A 1J18A 1EF2A 2FGBA 4R85A 3DYPA 3M5YA 3UWVA 4ROPA 1EIBA 4CU8A 1UZ1A 3Q67A 2E5BA 2OEJA 1C7SA 5B7ZA 3M6DA 4DXKA 2W92A 1RSCA 1JIBA 3EB4A 2E28A 3UZ5A 3K5XA 4RXGA 3QW3A 3MMWA 3L4XA 3GZAA 4WD0A 4FXRA 3F03K 1IWBA 1BYDA 4CCDA 1KGXA 2YFNA 4D2JA 3C2OA 1ZJHA 3NZ1A 1V3IA 5FACA 1XINA 3OA5A 4ICMA 2NQ9A 2EJAA 1UA3A 2XFFA 3PK7A 2WJDA 5D30A 4DUVA 5C9UA 1JG9A 2ZZ5A 4LC8A 4Y7EA 3ES7A 3LPPA 5T9BG 2GVLA 1QBAA 3H6OA 5IHRA 1GOKA 1XH0A 3BLPX 2WKGA 3WZ0E 2WWCA 4MNLA 3WF1A 3AMKA 4YHEA 3IIZA 1ME9A 2A1YA 2CLPA 3VKBA 1TWIA 1UZ4A 5IDIA 3PJWA 3GDTA 3TV8A 5BZAA 3HG3A 2IKGA 3NQCA 1UWRA 3HMCA 4G1NA 2H6RA 4HSOA 3LMYA 2GZXA 1A5NC 2NQ5A 1Q2SA 3MZNA 3P14A 2GK1B 1MUMA 3KTSA 3KHJA 4NAFB 1FP9A 3SCVA 4ERAA 3REQB 2VFGA 3ARWA 4ZQCA 1W1IE 5CGMA 4E4FA 3GDBA 1QT1A 1ONEA 3KOYA 3RDKA 3TW6A 4Q8OA 3O0FA 3LV5A 2HXUA 2B4GA 5AYYA 3QMTA 3QV7A 3AYRA 3LA4A 3AMCA 4H9XA 1YW1A 3ZLGA 3A12A 4I5XA 5M1TA 4X0NA 1NWUA 5LGXA 1REQB 4GOAA 3T08A 4CQ8A 4DO5A 3OVPA 1CGTA 4B3LA 3T42A 4U28A 3CQKA 5HQMA 1FCQA 4L1GA 4N4QA 4YYCA 2HNHA 4Q4QA 4HOZA 3A22A 1ADDA 1FWJC 3FVDA 2VHLA 2E8YA 5BOOA 4IIFA 4AU0A 4AYGA 3LHYA 2E6FA 4FLSA 6XIMA 4HU3A 1MO0A 1KFWA 2PTYA 3K46A 1D9EA 3VM5A 4Y9MA 4GKTA 3W76A 3IS4A 3LHWA 1G7UA 1GOOA 5EA9A 4D8LA 3IGSA 3IGUA 4XBKA 3QPYA 3WQVA 3CL8A 3QM3A 5HDRA 6CGTA 2CZVA 3N6JA 3FX4A 3JZUA 1JAKA 1E6PA 4HZMA 1DTUA 2RUSA 3KL3A 1OY0A 5C7HA 1EUNA 3RJYA 3VKJA 1DHPA 3GNOA 1ZBWA 3GH7A 2P0IA 4DXXA 2GQ8A 2YCJA 3EYPA 1GQKA 3EWUA 3LS9A 5F1UA 2C13A 1J96A 1TVLA 4DB7A 2VOMA 4H83A 1TWWA 2ZC8A 2X30A 4EWND 4JCMA 1KO0A 4HHPA 1MEHA 1LDCA 2GJXA 4K7YA 1TTIA 1VFOA 4AD1A 5EMMA 5ECUA 4C90A 2QLYA 1JR1A 4GWEA 3EWYA 4C6FA 2PDIA 4LUTA 3WENA 4OBTA 3C2EA 1XIIA 1A5LC 3OZYA 4IX0A 5I77A 3U5UA 1IIHA 1RZMA 3WH6A 4W84A 3ZM8A 1UH3A 3V16A 5EFDA 1KBBA 4FXJA 2TYSA 3N1AA 3QZ6A 2XZ7A 4MOZA 2J7DA 9RUBA 4F79A 4A8IA 2DT0A 1WKEA 1HJVA 3DAQA 2Y7FA 3TN5A 4A6GA 4C6JA 3SCQA 2R24A 4H3DA 5PTDA 3W2JA 4HNTA 2I5IA 5FF0A 1YTKA 4ONVA 1XSIA 2D24A 3LU2A 2V2HA 1OFAA 3Q37A 3P62A 1D8WA 1F4HA 2PSNA 3VIOA 4DF1A 3EB3A 5D02A 3RRXA 1X6UA 3D5HA 2ICSA 3TZFA 2CW6A 3NQFA 4HIBA 4P8XA 3OZPA 4GINA 3OBKA 1A53A 3PN8A 2CZEA 3OOQA 5BU6A 4QLLA 4AMCA 1TWZA 4ZGYA 2GUBA 1PYFA 2IKJA 2Y61A 3L12A 4S39A 3PG9A 1LWIA 2DFAA 4HTBA 5FJTA 3VNDA 3URNA 1DOSA 5DCBA 1WDDA 3MI3A 3OVQA 2F61A 1XCWA 1V8EA 4XD3A 1DIDA 4DZIA 3VIIA 3CT7A 2UBPC 1CYGA 2ZRZA 4J3VA 1BGGA 1CGWA 3NCOA 2DZWA 3IV3A 2XN0A 3GVGA 1H50A 2WB5A 3AZRA 2FVKA 2INEA 4XBSA 4G9PA 4DWSC 3FSUA 2J9ZA 2FIQA 4CD5A 2YL8A 2P53A 1EYEA 3R2GA 1V6TA 2QNEA 2PGEA 1X1ZA 2X1IA 4XBJA 1DJXA 4MF4A 2DZPA 4KCWA 1Q4NX 4X0VA 1LLWA 1L0PA 1CGVA 3NSXA 1K3UA 3O6CA 4D6EA 2W79A 5B80A 4IICA 1H7NA 3ITYA 4FNQA 4DYJA 2VFIA 3HPZA 3VGDA 3KUMA 1GYNA 1UZDA 2OZTA 2XTKA 4LY8A 4UQEA 3UJEA 1RD6A 3O6DA 2DSVA 3WJYA 4EVZA 3VNIA 5I78A 4UZUA 4UTLA 4MKSA 4I3GA 3PB2A 1NFGA 1MFVA 1R3TA 5HAOA 1CENA 1XX1A 3KDOA 7A3HA 1UKSA 4HU8A 3V75A 2VQTA 2ZUVA 4O13A 3SY1A 1VFUA 1DXIA 1BYBA 3LI1A 2PDBA 4LANA 3DENA 4WCJA 5CKSA 4JX6A 2YXOA 1R6WA 4XV0A 2FZNA 5ENLA 4MVAA 3ZLHA 5LNRA 4QJ3B 4M56A 3BMWA 4GISA 4EAYA 1UKOA 2J24A 2QPUA 3PVFA 2QJJA 3A4AA 1FUYA 4HNUA 4J4KA 4CNOA 4GQBA 2RH9A 3L5LA 3W7GA 1DQXA 2HSAA 2BTMA 3S5OA 1E72M 1BVWA 4Q4OA 4PTDA 1W6TA 1B54A 1HKVA 1YXYA 4GGHA 3CEUA 4EXQA 1Z69A 1S2WA 3G18A 1CB7B 1UB3A 4NZ4A 1VBUA 2EPNA 4LCRA 4KFNA 1P0BA 4LUIA 4DJEC 1EBHA 2F6KA 3SAZA 3VAVA 2QCEA 3QOMA 6REQB 4F2UA 4NP7A 2HTMA 5CEWA 1J9YA 1UYQA 4XUGA 3VD9A 1ZJAA 2RKXA 1KRCC 3ARXA 1PIIA 4FO4A 3W70A 3OLDA 1LM1A 1R7OA 3ZSTA 4FEZA 1KFBA 1THFD 5DRIA 4ORMA 4HK7A 3WDJA 3ZR4A 4LCQA 1I75A 3T05A 2VC6A 3DG6A 5A6BD 1CI1A 3GW3A 1YYAA 2GK1A 2BVDA 1UZHA 4KRUA 1OFQA 3WQWA 1A0CA 5CSSA 1JJKA 3REQA 1JNDA 5HMEA 3STFA 1T99A 2WZMA 2XIBA 1TTPA 3GNDA 1SJCA 3HG2A 1RHCA 3I4EA 3MC5A 5K9DA 3CPUA 1NP2A 4FNTA 1CZ1A 2PDJA 2OWXA 1QPNA 2YL9A 5ABGA 3AHTA 3CHEA 3C4UA 1WB0A 4B5VA 4ICCX 4H8VA 3A9BA 3VNJA 2G5WA 3U4AA 3G77A 2D0HA 1JGIA 5F2MA 5BWAA 3WNKA 1W3IA 3CU2A 4DN1A 4WY0B 2EAWA 4C7FA 1REQA 3QGVA 3OG3A 1YEYA 3UJSA 2A3EA 4AY7A 2I1OA 1VH7A 2NZLA 1VC4A 3AS2A 3WQ6A 1YLVA 1H7XA 2QR6A 5CPTA 5DMLA 1AG1O 3APTA 4AISA 1WDQA 2QAFA 1E1EA 1UWQA 2DH2A 2WM1A 3AS0A 2ZIDA 1XG4A 3TSMA 4AWEA 4NT0A 5KEZA 1QATA 3NDYA 3PTKA 4JN7A 4B5UA 3ARUA 1CIUA 3UJ2A 1V0LA 1VEOA 4RE3A 4H2HA 1Q85A 5DRCA 1A5MC 1E4MM 4MYXA 1EQCA 3TR9A 5M2FX 4V28A 2OWCA 4AD2A 5FF2A 5C2XA 5DMYA 1EBGA 1OHLA 3FAWA 3GVRA 1KC7A 4GY7A 4FNPA 1FX6A 3S1XA 4B2DA 2VRKA 2VELA 3OGSA 2Z7KA 3ZFHA 2OZ8A 1XRFA 3WYZA 4PA8A 1TPFA 5D38A 4JQ3A 3L9CA 1E4NA 2I5QA 4PTMA 2BSLA 1S3TC 2RJHA 1XM3A 2RGLA 1WUEA 3IJLA 2Q6ZA 4J3XA 4LC6A 4RCXA 3VGBA 2PFHA 1WO2A 5D9MA 1P7TB 2F8QA 2OZ3A 4YL2A 1UD8A 4I9MA 1PCKA 2P1FA 1RJRA 1PVNA 4IH3A 5I2UA 5EYWA 2BOFX 3VZXA 4RNFA 4F4RA 2XYLA 4PB5A 4QIUA 5BXRA 3MYPA 5C9RA 3WF2A 4PMYA 3U2CA 4FF7A 1OFRA 2WMGA 1GPWA 3BLFA 2V3EA 3GKFA 2QIIA 4RZ6A 1TREA 4K37A 5JIWA 2HBXA 4TMBA 2YA0A 3UPBA 3B0UX 4HJWA 1UD6A 4QJ1A 1KGUA 2I7GA 3UVAA 2CWXA 3KL0A 1TX2A 2DZUA 3DFOA 3MO7A 1E6ZA 1UUMA 1HJWA 3TA9A 3WLIA 3OW1A 4GUHA 1R3YA 2GQAA 3NQ6A 3LCLA 4PRRA 3KLLA 1K6WA 3N9KA 2WZIA 3W9ZA 1RP9A 2GJRA 2FKPA 3TEVA 9CGTA 4ZSTA 3PBWA 4GVGA 1PZ1A 4IPNB 5D37A 1VJIA 4AH7A 3SRKA 1W9DM 3OBAA 2C6QA 3R8GA 5CH9A 3CUHA 3QV9A 4WJXA 3F4NA 1XLEA 3TWBA 1UR1A 3U7VA 1D7FA 5AC8A 4HA4A 1W5NA 1V5XA 1RUSA 2Y62A 5LNSA 4PTXA 2WJEA 3PPHA 5LHEA 4H6KA 3BJSA 5FAGA 1M3UA 4D6JA 4HA0A 2QDDA 4IP4A 1PDZA 5IFTA 4LAUA 4ZFCA 4TR9A 2Z28A 1RV8A 2D2OA 4B5SA 4R34A 3ZVHB 3MJMA 1LQ0A 1FTXA 4Q4PA 3VDBA 4IOTA 3VIGA 3UXKA 1ME8A 2PGRA 3NQ8A 2OYKA 4JIRA 4OU1A 1LUCA 4H2CA 5D2XA 1J0HA 4MWAC 2Q02A 2WKLA 5XINA 4V1YA 2O55A 5GNZA 4N9BA 2YCLA 4PUKA 5AC6A 3ZSSA 1EWEA 1OFEA 3TXVA 3E3HA 4EX4A 4Y9PA 4UFKA 2ZX6A 3U8GA 3M64A 2QF8A 3OEXA 4XZNX 4QSFA 1N8IA 4QEHA 2P3ZA 1HKIA 4XZBA 4LNYA 1SVDA 4GQQA 2NLIA 3I7QA 4Z0SA 2WW5A 3VCNA 3HGOA 3WH5A 1JCNA 1RAKA 3Q4DA 1WOBA 2ZXBA 4D8AA 3WDHA 1J10A 3MW7A 2PDQA 3EPMA 1FH8A 5C9ZA 3VCCA 2VEPA 3VU2A 1H0GA 3W7KA 3AROA 4Q6JA 4UTFA 1HG3A 1F4AA 2PU1A 2HISA 1W3TA 2R9RA 3H7VA 4JTIA 1R8LA 1XKJA 3HPSA 4XTIA 4OWGA 4CU6A 2DQWA 1C3FA 2XH7A 1TVPA 4DBWA 1UC5A 3MJYA 5FOOA 1XFBA 2VX4A 1Q6OA 4MWAE 5A1AA 3IIVA 2OLAA 3LB0A 3FSTA 4LV9A 8CGTA 3AAMA 2VUYA 3SGGA 4REQB 4CVWA 1C92A 2R94A 3ELFA 3CZEA 3GU9A 4N9DA 3NYDA 2DP3A 4GPNA 4LTSA 2E09A 4UFLA 5TQLA 3TXZA 5JH2A 3MP3A 3QQ1A 4BFAA 1BRLB 1TJ0A 1Q45A 4GYJA 1R85A 2OSWA 4B91A 4MADA 3F5KA 1UWAA 4ZMGA 2CBUA 1EOKA 2D2HA 1Z48A 4B3KA 3RYSA 2ZE3A 2F7FA 2GSHA 4HPGA 1KR1A 5ABHA 1XSKA 1J0KA 5LIWX 2EEXA 4ML4A 3HQNA 1NTHA 4V27A 4PEKA 3M41A 2V0TA 1EP1A 8XIAA 4C1LA 2J62A 2QYGA 1KFCA 2I5GA 5GNYA 3ANYA 4R5EA 5BRPA 2H3BA 5HNRA 3RITA 3MBDA 3MSGA 1PKMA 3V5FA 2PDNA 4NSBA 1N2VA 1YRRA 3M9YA 3VK5A 1KQYA 1KXVA 3LTPA 2R1PA 2CHOA 5C71A 3E0IA 5KITA 2WV8A 2FZMA 1MMFA 2NV1A 2WSPA 4MHBA 3UNTA 1RBLA 2F38A 1R0MA 4JN8A 3BH4A 2VWTA 2OODA 4K8GA 3TVAA 2IKIA 4A3QA 4IQDA 1KCZA 5GJPA 4W5UA 4LEFA 4LF1A 4UOJA 4Q8MA 3WQGA 2W27A 2A3HA 2VFFA 3ZXWA 1ESWA 2VDGA 3DX5A 2OLSA 3WMCA 5AHIA 4CQ9A 2NUXA 1LT7A 4P7RA 1OF8A 3BLEA 4JFUA 3VDGA 1A3HA 2NXHA 1B90A 1ONWA 1GEHA 1MQRA 4J7RA 1XPGA 1FKWA 2XGIA 2GWNA 4AZ5A 1XBXA 2J27A 5LSMA 3LV6A 4A3UA 4BCEA 5CGQA 1OC5A 1V7AA 1UH2A 3MB9A 4WY0A 4TU1A 1AL7A 2GGGA 4AEEA 1GG0A 3TR2A 1I2NA 3M0JA 1GVQA 3G0XA 3H2NA 4FA3A 1I8JA 3GVQA 3KZPA 4I9TA 1HKJA 2YYTA 3MV01 1XIDA 1X7FA 1GW9A 5JMUA 3SN0A 4Q4KA 3VKDA 3KVJA 1I60A 4LYPA 3HZ3A 1G01A 4LBRA 1PTGA 3BMVA 3ENLA 2QKFA 2PDFA 4LVDA 2VZVA 4GZ7A 3AC0A 2W5FA 2PRHA 4QE1A 3SCNA 2PWGA 1RY8A 4JS3A 3B8VA 4AHOA 2VD8A 1MEWA 4P2VA 5I79A 4UWMA 3QV6A 3FA5A 3K8LA 5DO8A 3GK0A 2CHNA 3DFHA 2BHUA 3W7MA 5KTLA 3W22A 1MZRA 4DXVA 3OLGA 5I3FA 4JCLA 3M0MA 3T0TA 1E9LA 5LHFA 3HG5A 4JQAA 3P5ZA 1QI3A 1KB3A 2GLKA 2VRJA 1PTAA 1ZSXA 2Z6IA 1XGDA 1US0A 3NL2A 4LV4A 4E6MA 4CUCA 2VZOA 4K39A 4K1GA 5AC4A 3DYMA 4ZZ9A 2DSZA 3E0WA 3ZVIA 3FDKA 3CQJA 3RNDA 1P7TA 1SR0A 2X1RA 5MF5A 4C7DA 2QUUA 4B90A 2G96A 4JL2A 4P61A 1IF2A 1R47A 1J0IA 2QJMA 2W4XA 4DYEA 3HGJA 1ZL1A 1A4MA 1HJQA 1ZB5A 3FK4A 3O0KA 4AX6A 2TMDA 2DVTA 4LAOA 1XUZA 1K03A 2BX7A 3T2QA 3U57A 4OV4A 3MS8A 3LOTA 4WR3A 3B4UA 3WLMA 4JEJA 4JOMA 3L4WA 1GOMA 4DWSD 4S2CA 1O60A 3KP1A 1K02A 3WJSA 3EA2A 2XSAA 4WX2A 1YDOA 4IFRA 3G8EA 2EBNA 3S5ZA 3HG4A 2RFGA 4XTDA 1CB2A 2VWSA 3DERA 4O1AA 6ENLA 1T40A 4GRSA 2OQHA 2E1DA 1JZ6A 2D69A 5A95A 1ZY9A 4GIAA 2VZSA 1FWCC 2AL2B 2CCRA 2TAAA 3ME3A 3TIMA 3SCTA 4Z17A 3VYLA 5AOUA 3GHRA 3CYVA 4JFWA 3TLQA 1SSDA 4D6CA 4HTYA 2BASA 5TBOA 4J9JA 2ZWZA 4TX9A 4XZ9A 3UWQA 3HGSA 1UG6A 2G3JA 1KXHA 4F8XA 2POTA 5I0DA 3S1WA 1XH2A 3ZVHA 4ATDA 2HS8A 3UG4A 3CB8A 4I9AA 2VURA 3U6WA 2FHFA 2DZTA 1PHQA 4IXXA 2C8NA 4CNSA 4KBXA 1TV2A 1RH9A 3FVMA 2FFIA 1XYLA 1EDQA 4FOKA 4K3ZA 2NSXA 4CKQA 1JZ3A 1YXDA 4GD0A 5JQ9A 3N9SA 3GTIA 3FHAA 3ANVA 2FH6A 3TSDA 1A50A 1UR2A 1XLBA 5EMKA 3VDHA 5A2BA 2CLEA 3NWRA 1OX6A 1QPOA 4ZBCA 2DORA 3GNPA 2WCAA 3F5LA 1TV5A 5A8PA 2ZZ4A 3BK0A 4LB3A 1A5CA 1H7RA 4M3PA 1MQQA 4EPKA 2OGYA 2X0HA 4DM2A 3T8QA 4E8GA 1FFRA 1Q8AA 5I3IA 5FL0A 2F6UA 3VO0A 5AZ1A 3V4BA 1NWSA 4WOQA 3VD7A 2VVSA 3E1F1 2VCCA 5IXEA 3WH9A 3W1UA 3NQDA 1TIMA 5M03A 4EOUA 4LALA 3TJ4A 4LUSB 1RQHA 4ZQPA 3N4AA 2MNRA 1VFFA 3BG3A 3R25A 1U5JA 5E9XA 1ZAIA 1CGYA 4PYSA 1J0JA 3A3WA 1JEZA 4AHQA 3HJZA 1ZBKA 2HRWA 4J3UA 2NT0A 5DEZA 2ZWYA 5AFDA 3FKKA 3GNXA 4E8CA 3H21A 3ABOA 4AEOA 3GQYA 4DI9A 2DIEA 5EY5A 5DANA 4NY2A 3L66A 3SY8A 1HP5A 1PIFA 1TPUA 5M5DA 1H51A 1Q4WA 3BQ6A 3T78A 1KM1A 1JXKA 1VYSX 2Y5SA 1IWAA 2IXUA 1IXOA 4LXFA 2V38A 2ZRYA 1QAPA 1V93A 1HW6A 5CJNA 1OVDA 3RPMA 1RVGA 1BRLA 1BF6A 1H4PA 1E71M 3PC0A 3RLVA 3ABZA 2ISDA 4ERGA 3LCFA 3S42A 2QDHA 4LU0A 3J7HA 1S5VA 2XPKA 4GABA 1GQIA 4PC8A 3NR0A 4NI8A 4Z1AA 5AHMA 4XZWA 3OO2A 4IJBA 1IQ8A 1VP5A 2R1NA 4JX5A 3N29A 1CNVA 3AXHA 3LHVA 1YQ2A 1KCXA 2YPIA 3NNTA 3TNBA 1EX5A 3N4FA 1G7VA 2CU0A 3A64A 1OFOA 1UR9A 3SM0A 4KWSA 4KRZA 2EQDA 4US6A 2XVGA 5D4YA 1ICPA 1W3HA 1F7BA 1UKPA 3WUFA 1FY6A 1CDGA 3M5ZA 1TTJA 2ACRA 3EXSA 1PYMA 1VFMA 2ZDSA 1QNSA 1JPHA 2Z2BA 1YTDA 2D2GA 4DF0A 3BCDA 2HQAA 4E2BA 1QK2A 3R8RA 3UD6A 4E4UA 4JTFA 3SCSA 1V3HA 3ZR6A 3CUGA 3EWZA 5I3KA 2G37A 3FN9A 4N7QA 1JCMP 3B03A 4R53A 3EMZA 4O52A 3IIOA 1N55A 3NDOA 1VS1A 4OUIA 1WV2A 1ECQA 4LX4A 3WX7A 1TJPA 3O16A 4P7NA 1KFJA 3GG8A 5CC5A 2G95A 1PAMA 1AJ0A 5AYZA 4JTHA 5IOBA 2IPJA 1B57A 2NVAA 3N2OA 2JIEA 3PULA 2VTFA 3ZJ6A 3CPRA 4WDTA 3OU8A 4AAJA 2PTWA 5HWNA 5DN1A 3CLWA 2GQ9A 4PRTA 3EXRA 4J28A 1P1XA 1N82A 1P6WA 1EJTC 1XDJA 3ABSA 3MSRA 4DPPA 3SSZA 1IT7A 5CSYA 3HV8A 4IWWA 3H2MA 3FA3A 5JVLA 4GI8A 2WLYA 5XIMA 1ADSA 1YNYA 3M0XA 1P4CA 2EG6A 2DT3A 5E6ZA 4UOZA 3MUXA 1UD5A 1T0OA 1K1DA 3MUAA 1W9BM 2JKPA 7ENLA 3CIWA 1PO9A 4BEQA 3MY9A 1DWAM 4JYFA 3NSMA 3TCSA 1NELA 3GR4A 4YTSA 1JCTA 3W37A 4LJ3A 4PCTA 4IIBA 3O2LA 1GYMA 1M7PA 4GXPA 4JNZA 5LKYA 3PBYA 3RR1A 2XH0A 4MB3A 2FTWA 3CEPA 2YBVA 4H7VA 3BLKA 4L9ZA 4QR6A 3C2YA 5E0FA 5A6BA 4JIIX 3NPVA 1Z44A 2J8TA 4AY8A 1P6BA 1UD4A 3O07A 4YVXA 5CSUA 1VEMA 3KTXA 3N6HA 2DVUA 1W32A 1FQ0A 1WKYA 4E8DA 3ITTA 2XISA 4NZ1A 4E2DA 5LIUX 1VF8A 1ZP4A 3H8AA 1CXHA 4UBPC 3IUIA 1TTQA 4DNMA 4AZIA 2D1ZA 1IR1A 1XLJA 1K9TA 3V5OA 1RR2A 4GFIA 1W5OA 5A8GA 2OYMA 3LLFA 4MJZA 3IPWA 2EF9A 3QY8A 1FH9A 3THUA 2CITA 4W8BA 5LA1A 4IL2A 3GYCA 4WSKA 2IKHA 3PZVA 1TE6A 5FF7A 3CLMA 3I6EA 4KGLA 3UR2A 4XAGA 2A6NA 1GVFA 4MMWA 3AO0A 2V68A 1CLVA 3MQTA 1DVJA 2ASHA 3SN4A 5BROA 1WQ5A 4CQBA 3W7DA 3IJ7A 2F2HA 1RBAA 1S5TA 1VBJA 3BURA 4XIMA 2Y63A 5L9FA 1OYCA 4M82A 2VQUA 4YTUA 2FPYA 1J4EA 1EJ7L 4C6NA 2X41A 3LUTA 4JIQA 3E2VA 4RV3A 4XISA 3EX3A 3GYEA 1I9CB 4B9YA 2R1MA 4AQLA 4UQBA 3DHFA 4UMAA 3TONA 5CJMA 2OT1A 1PS9A 3VX0A 3DXIA 1YHTA 1IZCA 4BEUA 4YTTA 1ZP3A 3F2CA 1VBHA 3V0TA 2FH8A 3D0CA 1Z9AA 3AMDA 4CVUA 2A85A 3FV9A 4AZGA 4O1DA 4GCAA 1UD2A 1UBSA 3MU7A 3WO8A 2R91A 1QBBA 4PCSA 4GHRA 1O12A 3P82A 2UWFA 1QNQA 1OCQA 1K9EA 3G1DA 4LNCA 4K36A 1E0UA 1S39A 1OGBA 3DOPA 4Y2WA 4LAKA 2C14A 4UTWA 5TF0A 3TUUA 4QG8A 4V33A 1DORA 2NXGA 5CBBA 2Z2UA 1PB0A 3INPA 3THCA 3HURA 1PXGA 1UR3M 3DHUA 4KS0A 1FWRA 3R0UA 4M51A 3HMJG 2DT2A 5CPSA 4BHYA 4Q8UA 3E5PA 1UP2A 3GU2A 3VMPA 4PMOA 3TAOA 1ISVA 3CASA 1S2TA 4UR8A 5HNNA 3IVSA 4CGTA 4NUWA 1GTHA 3A24A 4DELA 5A6KA 4R9XA 5E1QA 2PTDA 1XKYA 4KWWA 2DZAA 3PM6A 3F7JA 4LAMA 1XUUA 3QR3A 2DUAA 1TO3A 3B04A 3USZA 2XSBA 1TQXA 2YDQA 4Q8PA 2QAPA 2XGZA 4LUSA 3WJXA 2BY0A 2WSRA 1VENA 3QLLA 2XIOA 1OCNA 3LCGA 4WJEA 3SY5A 4TXEA 2V5DA 4AIOA 1X38A 4XB3A 1DWHM 1VEPA 3K1DA 1V08A 1C9WA 3HB9A 1KRBC 5EU9A 2VGGA 3HPXA 2J47A 5K9CA 1J93A 1OFPA 3LN3A 4WDXA 4CQCA 2DW7A 3KEHA 4BY3A 1IEWA 3ZZ1A 4O4VA 2QJIA 4OV9A 1JRBA 1GORA 4N2YA 4G5DA 4GZJA 1MW1A 3TYAA 4IMGA 2ZCGA 2JALA 1RP8A 3M0LA 3CTTA 1TQJA 2FB2A 3U2EA 3NOEA 3ARTA 4XAYA 1KTCA 5BXSA 1IEQA 4IGNA 3BAIA 3VIPA 2VGIA 3CMGA 4I7WA 3BL3A 5HR7A 3LCHA 3P84A 3VDAA 2VR2A 3W23A 4ZOBA 4MSSA 5CC3A 4FX8A 4NU7A 3WQOA 3R13A 5CCZA 1ISZA 1H61A 3WD2A 3AHZA 2KZHA 1MZHA 4AZ7A 1JPDX 1XF0A 4O50A 2VR4A 4HNVA 5H2ZA 2OKTA 4XX6A 3OZMA 4XG1A 5REQB 1UIPA 4IFKA 5BXPA 3W83A 2PD5A 3MWCA 5DXXA 4WKFA 4IPPA 3NM1A 1UWTA 1PPIA 4JX4A 2VEGA 2QHAA 3BSMA 3CWNA 2F2KA 3R94A 4Z1BA 2D73A 5FEXA 2Q8LA 3RLGA 1QHOA 3U7BA 3CZ8A 1JCYA 1LWJA 3NA8A 2C7FA 5EMYA 2Z2AA 1XC6A 3V0SA 4O18A 1FWFC 1BYAA 1M03A 1YTEA 2VZTA 5BYWA 3IGXA 4TV5A 3UU0A 2V82A 4K6AA 3UNDA 1GK8A 1P5BA 3QR1A 2FVMA 3NTYA 2CPUA 1XGZA 4YWIA 1SJDA 5I3HA 3ATZA 3KHDA 3CZJA 4J1OA 1XYAA 4HNLA 4FLOA 4QE5A 4Z2KA 3TTEA 3VVGA 4PBGA 1YX1A 2QJGA 2QPSA 5DCEA 2GOKA 3BV7A 1ECEA 3MUCA 1BGAA 3UCDA 1LZOA 3EA1A 4WY0F 5LYRA 3N25A 4W7WA 3RLUA 4IIEA 5HXMA 2FFCA 4XKYB 5A94A 3B9OA 4CNPA 2OSYA 2V8ZA 1VR6A 1JZ7A 3ISIX 4JNYA 1CLKA 2O9PA 4Z2LA 3CZGA 3AOFA 3G2GA 2EPOA 1JDEA 4WRHA 1V03A 4XVDA 5BU9A 4L80A 1KCKA 1R3QA 4EPDC 3BCFA 1ITCA 2YL5A 3F4DA 2XIQA 3VABA 1FDZA 1W9XA 4S23A 1LL4A 2GGIA 2Q01A 2AKZA 3YPIA 4Q6XA 3G1HA 1I0DA 2A7NA 3CC1A 4IUGA 2C19A 1VZWA 3G6LA 1F2JA 3BDKA 1BLIA 2XWDA 1LBMA 2NXIA 2WQDA 1KFEA 1QPRA 3GC2A 3M0VA 1WKDA 2O9RA 2DIKA 1SZNA 4POCA 1XQLA 4AZBA 4UCGA 1XLAA 1QWGA 2B0MA 1MSSA 3CXOA 3P0WA 3PZTA 4LUYA 1V3KA 3NZQA 3P7YA 4PE8A 3PY2A 4KWVA 4CN4A 2VZUA 3PWIA 4YPJA 3P5YA 3VNMA 3GAYA 1ODUA 2XN2A 4FSAA 2FTYA 2ZTJA 3PPFA 4D6HA 2BWGA 4MY8A 1LCOA 1JULA 4RK8A 3EDJA 1OWQA 2G50A 3JZEA 2ZX5A 2A21A 1W3JA 3M44A 4ATLA 3UR5A 4GE8A 3M5XA 5D03A 4N9EA 4DLFA 2E1WA 3DC8A 4DBUA 3WFZA 2A6LA 4LW7A 1L6WA 3P6LA 4NZFA 4IZGA 3VOFA 3LHUA 4R7JA 4PFMA 3NVTA 4QS5A 3KRBA 2VRQA 3KS6A 1L6GA 3I7SA 1FKXA 2OEKA 1E51A 4BKNA 1V7YA 2CWNA 4DO4A 4RKAA 2ONEA 1XIFA 5AVNA 4C6KA 3G3DA 4AMAA 1YBQB 3OQEA 3WUBA 3QMSA 3L2MA 4NNBA 2Q71A 3OVRA 4JTDA 1OYBA 3G22A 3V35A 6XIAA 3P67A 4NZJA 3SUSA 3OPSA 1TJ1A 2VX7A 3URAA 3GS6A 5FI8A 3THDA 1B3ZA 3O8AA 2V5BA 5IBXA 1QW9A 3TAKA 3WNOA 1TPH1 2YDRA 3S2MA 4YNGA 1F9CA 3TDFA 2ESCA 1KBKA 1M41A 2WC7A 3OG2A 1G6CA 2Q8ZA 1XYMA 2JF7A 3ARZA 1EUAA 4C60A 2XJ7A 4X3ZA 5CQ1A 1EPVA 4OGZA 2AAAA 4HQVA 3G6MA 2G0WA 3AS3A 3I4KA 1XLCA 3WQEA 4C6BA 3MCMA 5CPQA 2WHKA 5DXYA 2HPIA 4Q33A 2WSQA 1MW2A 3S9IA 3A21A 3WDRA 3PZ9A 3BOLA 1EOMA 2J66A 1GHRA 3VIJA 1TJ2A 2HVMA 4DWSA 2BHZA 1SSGA 3QKZA 5LXEA 2BXVA 4XAPA 1N8WA 4NJGA 1W5QA 3MHGA 1K8CA 3PS7A 2VEIA 1ZUAX 4KMQA 2BY3A 1NVMA 3ICJA 4KEZA 2W3ZA 3MPGA 4JICA 1R30A 1E15A 3QW4B 4MKNA 3KOFA 4C6IA 2QMJA 2NT1A 5DCDA 1BQGA 4A2SA 4K8EA 3H12A 3GHSA 2X0YA 3CM4A 2V2DA 1JYWA 3CUXA 2J78A 3R58A 1OC6A 6PTDA 3ARSA 1WDRA 3KCJA 1WAUA 4A4AA 4W88A 3QRHA 1A5KC 3L5MA 3MHUA 4A8LA 2GJNA 3MP5A 1PIGA 2HE8A 1GEQA 4HZ7A 3HBLA 3NO5A 3B8UA 1S1RA 3MA8A 1V02A 2QCCA 2GL5A 1KLZA 2WCSA 1E40A 1TMLA 4MB5A 3UWEA 2QCDB 2HE5A 5K9XA 3CO4A 2QULA 2XDFA 1K7XA 3BG5A 1ODZA 4OJYA 2ZVIA 4AY1A 3SURA 2LLEA 1O68A 2XFYA 2EPHA 3WLOA 2C16A 3FEMA 3LQGA 1GVEA 4GX9A 1B4EA 1A5BA 2QDEA 5FF4A 3KTCA 4GVFA 1UQYA 4H00A 3T09A 1AH3A 2PZ0A 2ZE0A 1C9DA 4JY9A 3RF9A 4J2MA 2AQVA 3FYOA 3SR7A 3E9AA 3H4GA 3T4CA 2BGSA 2NVDA 4NQ1A 2FZ8A 4GUGA 3CZKA 3ITOA 3WD4A 4ADUA 2ZRWA 3S83A 2VGBA 3V36A 4PH6A 4PBFA 5T9CE 2MANA 4ZTXA 3PFMA 4O4WA 1ISXA 4B2DD 2PE4A 1HNYA 4PEEA 3N13A 3O15A 4PBEA 4I8DA 5GNXA 1WBJA 4ZENA 2UV8G 3LGEA 4S3AA 1TSIA 4ZB5A 2PDPA 2Z1BA 5REQA 3K8KA 3CUIA 1KFLA 2PC4A 4NIRA 4RZ5A 2YB4A 2ACUA 2AQWA 4WGHA 1FWBC 4Z1CA 1JPIA 4QQ3A 2PGFA 3N2XA 4AX7A 1S2AA 3FJ6A 3H70A 2VX6A 5ABEA 1G4PA 4LVAA 1HFBA 2Y8KA 2PLKA 5FEWA 1J12A 4QFUA 3W7OA 2VT0A 1P48A 5E0KA 4UQDA 2HJPA 4INFA 4RNHA 4MJ4A 2PDKA 3UGVA 1C93A 3GC4A 1L2QA 4N42A 3K4DA 2C91A 1J2WA 3T1GA 4X2PA 1CCWB 2YDAA 4IG2A 3TTYA 4LCSA 1O7AA 2ZX7A 4AZCB 4S3BA 1QO5A 1TMHA 1D3CA 3IJIA 4MZ8A 4LH8A 3QVQA 1QU4A 3E0VA 2VEKA 2PB1A 1QNVA 3NSNA 1E9YB 3DN5A 1IEVA 4I9JA 1W8GA 2J8GA 1PX4A 3ITXA 3C0QA 3LBMA 2ZXAA 4C6MA 2O4MA 3VTRA 1UOKA 3M0ZA 5BNKA 1DBTA 3AZTA 2JKEA 4KFOA 5I00A 1F61A 2ZA1A 3KX6A 3QMRA 5CZKA 3S6TA 4DO6A 3QFWA 4NASA 1XDLA 4P8VA 4WZHA 2WWDA 2GPTA 1UUOA 5G1MA 3QEZA 2G3IA 2V3GA 3RR4A 4KEVA 4XQ6A 5K4ZA 3P8JA 1D2KA 1H7PA 2Y7EA 1DJWA 1IXNA 3O63A 4KKXA 1WBHA 3RU6A 3ZO9A 3WNNA 1AH0A 4QS6A 3SQMA 3P3BA 1EP2A 3F2BA 3SSJA 3UG3A 4Q22A 3TJIA 4HYWA 1OYAA 1TMQA 2OU4A 3BLOA 5GQBA 1RA5A 2Q8XA 3GSMA 3JR2A 3QFEA 2A5HA 2EG7A 3LGGA 1OFDA 1QWKA 1UASA 3WLKX 2JK2A 5LZLA 2VDIA 1E9ZB 1Q6FA 4GBDA 1Q8JA 4ZE4A 1JQVA 1TV3A 2PTZA 3EKGA 1KKOA 3VIHA 3L0GA 2PODA 5I3DA 4JTTA 2XM1A 5C7VA 3FOKA 3SRHA 3UG8A 2X09A 1POJA 3PSVA 1IHIA 4JKMA 1Q6RA 3KRSA 1YNQA 2DY3A 5CZTA 4L64A 2I56A 3C6CA 3POCA 2WHJA 4DWDA 3OBEA 1C90A 3EBVA 3UPMA 3AU6A 4FNRA 3TFXA 2YR1A 4AUBA 3TWAA 4GH1A 4PTNA 1H7WA 1CPUA 1MRAA 4JTRA 2V63A 3EDFA 3VOIA 3AIBA 1ITQA 1X96A 1QVBA 4GQ0A 4WSJA 1GQLA 3RIKA 1GZJA 3K4WA 3TJLA 1J2BA 2PWHA 3NPUA 5T26A 4HHLA 5C70A 1I2RA 3EEGA 1EC9A 3Q94A 1F8IA 1PZ3A 2BFGA 4PMRA 3L4YA 5D2YA 3R10A 4K2SA 2ZXDA 4O0ZA 3N2CA 3ZYZA 5MKGA 3BW4A 2VKZG 4LS2A 5LIKX 3SUTA 1KFKA 1UWUA 1VAHA 3RPTA 4UTWC 1W1B1 2FQIA 4UMCA 3UYCA 4YXGA 1HQTA 3SCRA 2HMCA 4PMDA 2AOSA 2OX1A 2PRMA 4QBXA 2YA1A 4AD3A 5IHSA 5FSEC 4IXHA 1A49A 1XP3A 3SCUA 4UTKA 3W7CA 3TN4A 1YBQA 1YE4A 2WVVB 1FRBA 5AY7A 1UQZA 1HIZA 1CBGA 2EPLX 4MYAA 4ZSUA 1W91A 4E38A 3TC6A 4Q8QA 3IRDA 3KXQA 3OYXA 2BS9A 4O12A 2Y70A 3RPDA 2XSXA 4J3SA 4U5IA 5E09A 4OKDA 1UKQA 3UWYA 3GTHA 2Z4GA 4WK9A 1NFBA 3L23A 2RDTA 2J25A 3MI6A 3QF0A 1ML1A 4QG6A 4OECA 4ADTA 3DDMA 4DUXA 3W88A 3KCOA 4JQ4A 1MDRA 3BXWA 1XSJA 3MTWA 3O9NA 3DC0A 2ZTKA 3GXDA 5D8WA 1WYIA 2A2IA 4X9YA 2QT3A 4BQ3A 1TCDA 2YX0A 3PZUA 3STGA 3ZMRA 1E1CB 4GLEA 3DFYA 3OHIA 4TX6A 3URQA 3S8HA 3EEZA 1QNRA 4JL1A 4LQ1A 2W67A 3RX2A 1LOLA 5TNVA 3DYOA 3N17A 1VCVA 4UQAA 4R7WA 2G97A 1UC4A 1W9PA 1EA9C 4QHRA 2NQZA 3G24A 1D8CA 1V3MA 3WLPA 4L9YA 2E25A 1XYZA 4PMZA 5DF0A 2Y89A 3E02A 3ITLA 4ZOEA 4MJ2A 4MFDA 4Q4RA 4LY4A 4S3KA 4I7UA 4PN2A 4UFJA 3VNKA 5AYIA 1LLZA 4ZO7A 4EPEC 1RXOB 4GYPA 3VMOA 3UWUA 4IP7A 5DY3A 1HO4A 3ONBA 5J5RA 3CPGA 2NUYA 2KX9A 3NQMA 2OQYA 3ABQA 3S2CA 2QCDA 2BNJA 1FWGC 1PZ0A 3WL1A 1IT0A 3I6TA 2J77A 3RAOA 2PDMA 2E6YA 3LHZA 4QDWA 3OLIA 4KWOA 5A2AA 3WBAA 3NZGA 1Q13A 3TQPA 1AZ1A 1JF6A 2DSKA 2OG9A 1M7OA 3WLRA 2ZYFA 3UG5A 1EJSC 3RM8A 1TZ9A 2RJGA 3SIZA 3BV4A 1P0EA 4CEUC 4QE4A 1UUQA 4FXFA 3W2MA 3GRIA 4DM1A 2E3ZA 1XIJA 3R89A 1YIXA 2WQPA 3CBWA 1PWMA 3JW7A 3UY7A 3N04A 5F1VA 4ZEPA 4JDYA 4KCTA 1XLFA 2YSWA 2ISWA 3EDKA 2RDXA 2VX5A 1IXPA 3N11A 3FLUA 5AECA 1QW8A 4ZB0A 1EJWC 5CSRA 4C1KA 1Z42A 2V69A 4HSNA 4IIDA 4U2YA 2A0NA 7CGTA 4MDPA 1OINA 1ZZMA 2X2YA 3K2GA 4N4PA 3VE9A 4F9JA 2PD9A 1PKYA 4PUWA