5D5MA

Structure of human mr1-5-op-ru in complex with human mait m33.64 tcr
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
270
structure length
264
Chain Sequence
RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELLYSCHVEHSGVHMVLQVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 264
sequence length 270
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d5mA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5d5mA01
5KBNC 1UCTA 2VLLA 3C6SA 1LHZA 1NAMH 3HC4L 1SMAA 2KBGA 5SWZA 1OQXA 1UKSA 4M6AA 5DMIH 3RAJL 1A14L 2BOBB 1YEFL 5IT2L 1OVZA 4R4BA 3C8KB 1LGVA 4C83A 5GGRB 4GW4A 4DKEL 2B4CL 5C9JA 4JFZH 1IRAY 2QSCH 2PXYA 3DURB 3X11A 2VAAA 3STZB 3CVIL 4KHTH 2O93L 3L95A 3LIZL 4WWID 2EH8H 1MF2H 2APXA 4R7DB 4NO2A 2DLFH 5GJTL 1UM6H 4GOSA 1EHXA 4HIEB 4PBXA 2V7NA 5H2BA 4AEHL 5HYSG 3TN0B 2IPKB 4JVPA 1I75A 1NGWB 2AEPL 3QXAA 5F3BB 5F7UA 2FECI 4GW1A 1S9WB 2EDJA 2X41A 3T2NL 3BPOB 4PJXF 4AENB 2G9HA 4K8RL 4WI3A 1XR8B 1XIWA 5I8OL 4PV8A 1YEIL 4EUPA 4U1JB 1RQ5A 3QDME 1LQSR 5DXWA 4PJGB 2CRYA 5E2UL 4XP1H 2MNUA 2X1XR 3BI9X 3PV7A 3WJLA 4NCC1 2CDFA 1SVCP 1ITCA 2XKNA 1DBAL 3MJGX 5L0QC 4OFKA 3VMNA 2D4FA 2ITCA 1A3LH 3MLZH 4NKMB 3WL9B 3U9PL 2CMRH 3UMTA 4LF3B 3QNXA 3QDMD 5DFVD 3OGCB 2Z31A 4JY4B 4CW1B 2QR0B 2V5TA 3RKDD 1E4XL 1VGEL 3JTTA 3OKOA 1IBGH 4UIKH 4HUWA 3MODL 2DWDB 2H2SD 4NBYB 1D5MA 1DBKH 3LKSA 1BF2A 4ODVL 3WD5H 4P5TB 1I7TB 3PGCA 1T89C 3ARFA 3QB7C 4KK6D 4N1CA 5C2BH 3VI4F 4Y88A 2HKFL 3JTCA 2B8OT 4PJEB 4F2MA 4EDXA 1NMCC 3QEQB 4JLRA 5DHVA 2NYYD 2ZNXA 4XVJL 1DSFL 1QG3A 2VKWA 5T1LA 3RWHA 3L3DA 5KSVA 4Z7VE 3D2UD 4WDIB 2WINA 4M8QA 4PJDF 3SGDI 4J2XA 5DYOA 4KDWA 4XPHH 4NKIH 1T5XA 4I13B 3WXWL 3D85A 5HTSA 4F7PA 5ADOH 1I8KB 3MRIB 3MGTB 1FNEB 4PB0H 5D7LB 3LS5H 3RVXC 3PDDA 4FQIL 3FT4B 4APQB 3RP1A 4YX2L 3UTOA 2DQDL 4LSVH 3UTPE 1H3WM 4KI1A 1DBJL 3A6CL 4NQSB 1QPXA 4KROC 4F7TB 2F54B 4K71B 5F7YC 1OM3L 4OD2A 4BSWB 5JR1L 4JAMA 1IZKA 3AS3A 5JOFA 3S9DB 3IU3A 3REWA 4U33A 3MACL 3ULUL 4A6YL 4XPGL 1BQHG 4IRSA 1DN0A 4RFEA 4X6FB 4ONHB 1ZSDA 1SBSH 4HWBL 4KDVA 5DK3A 3H9HA 4GXUN 1Z5LB 1A6WH 4RGNB 4X4MA 5HYQB 4XH2A 1E4KC 4OQTH 4WO4B 4EOWH 3IFOA 4NHCH 4KQ3L 3LSOA 2EZ0D 3E2HC 2YA0A 1P7KA 2G60H 1EFXB 3FOLB 4WHTA 3TO2A 3TA3D 3LS4H 1FLRH 4ZD3H 3HI1A 4PLKD 1JGEA 2AK1H 4P5KA 2D2OA 5B22A 2YXMA 5I1HL 4KKAD 2DQGH 1EJ6A 2YA2A 1T66D 4WI7A 4GXUM 2HLAA 1CD0A 4JPVH 1OB1A 3HR5A 4XB7A 3DO7A 2A6JB 3B4NA 1KF9B 5DURB 4DOHB 4BSJA 4WIQA 4H0GA 1XH3B 2Y72A 3OKDA 4Z9KB 4NBZB 1M7DA 3KXFB 2FNBA 1F3RB 5DRWB 3ZKMD 3KYNA 1RMFL 2R0WL 1TENA 5I15L 3CMGA 3GO1H 3OAZK 1HNGA 3VXUB 3SHSA 2VYRE 3JWDL 3ZHLA 5JOEA 4ZFFA 2VDMH 4ONGL 3EFDH 5DZNA 2UUDH 1R5WA 3HRZA 2EIBA 3MRDB 2IFGA 3IFNH 3K4ZA 3MLUL 3L3IB 3MA9H 1GC1C 2VDQH 5AD0A 3QWRA 1LE9B 3WNMA 1DLHB 4F33B 3OR6B 3O4LD 3FMGL 3WFCH 2FSEA 3MLXL 4YK4C 3IFLH 1MJ7H 3TIEB 1KLUA 1U92B 2DMKA 2C4FT 4C56E 2Q8AH 4XVSH 5EZJA 4QHUB 4OD1L 4JVWA 2VLRE 1OARL 4H8WC 4N0CC 1KJMB 5L2KA 2UYLA 1LD9A 3VFGH 2DLHA 4I18A 3EAKA 3VI3F 4CJ0A 2DJ4A 4FQPA 1MFBL 2VSDA 5DRNB 2EXWC 3GMNA 3GMQB 2DL9A 3BP7A 4C56D 1H3PH 5CILH 5B39B 2CIIA 4KJYA 5HGDB 4KZEL 4ZTOH 3MGOA 2C9AA 4HWNA 4Z7WA 1GZPA 2WLYA 3HAEA 3MOBH 1H0DB 1BREA 1BZ7A 2VC2L 1FZJA 1FZMB 2AEWA 2ATKA 2UWEB 4NRXB 3TBYA 4JFXA 2ITDA 2IG2L 3D87B 1C5DB 3OAYK 1RPQA 1MAJA 5FB8A 1UFUA 2DQIL 4ZO8A 1FNFA 3L5JA 4NM4H 5GS0H 1NC4A 5HHOA 1OAYL 1JGUH 1U2HA 5EU5A 4AH2B 3MRKA 3EUUA 3KYMB 3ULVH 1KJ3L 5B3JF 2Y4SA 3SCMB 3RTQB 2LQRA 4NWTL 4Y16B 2OCFD 3UO1L 2Y5TA 3U7AA 4MX7A 4GBXB 1NFDA 4Q97A 3TH2T 4LLUB 2XZAL 2HTLC 1ACYL 5I1JL 3A67H 1LO4H 3MV8A 3WV0A 5E2JA 2I9TB 3PWNA 4MXWL 3IDJA 4L8CB 4LEOB 4R9HA 5CFHA 5C0ND 4LCCA 5FO8B 1YQ2A 1XF3A 1IC4H 2N56A 3O6ML 5T1KD 4LPXA 4G8EB 5I0ZA 5E94B 2YOCA 2IPTL 3T0EB 5HY9A 4CU6A 4LHQB 1ZVYA 2IANB 3GJEB 4P2OD 4NFCA 5DFTA 3LN4B 1G7PB 3UZVB 2HRLA 2ZCKH 1AP2B 5ISZA 1H8OA 5CSBA 4Q7DA 3WS6C 3PL6A 3D39E 3QFJB 5E8NB 4NWUH 2Z92A 1KOAA 5LKNA 1Y18A 5TPWH 1A4JA 5C86A 1N6VA 2CO7B 1Q0YH 1TJGL 1WISA 5DA4A 5C0GB 5GQBA 3BX7C 4Y4KA 4OSUL 3WXVL 4EQ3A 1J88A 1UCBL 4Y5YA 2CRZA 4ZS6D 3UJJL 2VLJB 2FBJH 4YBLB 3WEXB 5IG7A 3HMXH 4RDQF 1CU4H 4IRJA 3QXVA 4XC3L 4JKKA 1UXSA 3D39D 1MIMH 1BFVL 4MDIB 1I3VA 3F7VA 3QUXA 3IDGA 5I9QC 4JFFE 4WCYH 1BVZA 4PG9A 1BBDL 3UTTB 3FQTB 1QHOA 3VFSA 3OB0H 5FOBB 2ZKHL 4JKPH 1T1WA 1EMTH 5DD5L 5K9JL 3O3AB 1IFHH 2EYTA 5F7EL 5HHNB 2HYMA 2R4SH 1AKJD 5DUPH 1MCOL 2XXCB 1G6RH 2LV4A 2BNQA 2C1PB 3OXRB 3WE6A 4ZPTA 1KCVH 3RIFK 3BH8B 4BZ1L 5IV2A 3FJTA 4PJ9C 2HFFB 4L9LA 2DQFB 4JPKH 1UXWB 1ZVSB 2GT9A 4UV4H 5CGYD 2AW2A 4AL8H 1A7RL 1QLRA 3QIWA 2PTVA 3D0LB 1KEML 5HI5D 3RWEA 4DW2H 3EYUL 4DGVH 1Q9KB 5EOCH 1I7ZB 5BS0B 4OIIH 4G6FD 4ZQKA 2JKXA 2M8XA 1QP1A 1HIML 1Q94B 2DWEA 3SDDC 3OKKA 4MAUL 4P4KD 3U7WH 5C1MB 3UTSE 2FATL 5T33L 5KSAC 1YEDB 5EOQH 4UTBH 3VFRA 1J0IA 5GPRA 3VWKA 4CMHB 3QIUC 4GKNB 4GKOA 3CFEB 4JGJA 3BZFB 1BQLH 1HZHL 1AO7E 4UT6H 1KT2B 3SGKA 2HJLA 1K5NB 1OGAD 5A2JH 1A9BB 3X14A 1AI1L 3JBG7 1E4JA 1CL7L 2MTPA 4MNGB 5GRUH 3U0TB 1DVFC 4OLVL 1A6AA 1MVFA 5ICYB 1U8JA 4BKLA 5DEGB 3V52H 4JANA 4LBEA 2E7HA 5D2LF 5EIIB 5L88H 1S9KC 3PWPD 3SGJA 1MHEB 4TTDD 3SQOL 1K8DA 5CP7A 1WWWX 4NM8H 3ARXA 4O5LH 1WTGT 1PZ5B 4X5XA 1O7SA 4H26B 1FNSL 1FRGL 4MYWB 5E8PB 1TZIA 3G6AA 3BQUD 5I1LB 1FAIH 4JPIA 4LHUB 1QRND 2V7HA 3I6LE 3RFZC 4MQXC 4JJ5A 1DUZA 3BP4A 4KXZH 4LCIH 3UTQA 4UIMB 1B2WL 3BSZH 3VXSE 5IHBA 4ODWA 3T04D 2P24A 2QKIA 1PKOA 3RPIB 1CFVH 4NQXA 3KPRE 1HDMB 4NO0A 3IJSA 1B0RB 3BIBX 2ZUYA 2H41A 3P4NB 1PD6A 4PUBL 1U8KB 2NY2C 3I6LD 1XCTB 3EYOB 1M4KA 3PE9A 4TUKH 3JWNC 3MJ7B 4RISL 2XZQH 1SEQH 3T8XA 3VXSD 3QO0A 2X42A 4RX4A 2QHRL 4JZNA 4CRPA 2VZTA 3KPRD 1WCQA 2AK4E 4GKZA 1HI6A 4XMPL 1XIWC 2R39A 4KWUA 1HWGB 4HIXH 3VH8B 3BUTA 1QUNA 1NLDH 3S96A 1HSBA 3LRHA 4K8RD 4HBQA 4MA8H 2F58L 3ZKXC 3WJLC 4JZJA 4OLYH 4X83A 3MRFB 4YQXH 4YHZH 3VXTA 5I8KL 2OJEA 3O8XA 1K4DA 2AK4D 3QCVL 5HHXH 2X6MA 2D31B 5CINL 1T2QH 2XOTA 1RSFA 2OXGA 1UZ8B 2Z31C 4LCUA 1MVUA 5TE7H 4CKVX 3DBXB 4N5EA 1QOKA 1ZHNB 2ENSA 5EUKB 4F57H 1MFCL 4H0HB 1I1FA 1KLFA 2CR6A 1JFQH 2FIKB 3VFVA 3G5XA 3QDGE 3IJYB 2X4RA 5E7BA 5K9KB 2HVJB 3ARFC 1WFTA 1T1YA 4YDIH 4IDLA 3GM0A 4U1MB 4FXGA 1L6XA 2IAMA 2J1KA 1WITA 3DUUB 4X6CB 4DKFL 4KC3B 1C12A 2QSQA 3GSVA 4HUUB 2C4XA 4U1NA 1QFPA 2NY3C 3K2UL 4MNQB 4UNUA 1CF8H 1NEZA 2V2XB 4NOBA 2I9LB 2CK2A 5L7XL 4L8DA 4JJHA 4M7KH 4RAVA 1BX2A 1KN2L 1NGYB 4R4ND 3WS3A 5GGSY 1MRFL 1N2RB 3VXRD 4LPTA 2X4UA 3VXME 3TBVA 4J4PA 5F1NB 3CFDA 2FGWL 4U6XB 1ZT4A 2DJSA 3N0PB 4D9LH 4R7NA 1T2JA 2LVEA 3CCHA 3MNVA 4KKNA 2QV2A 1A5FL 1EXUA 4I0PB 4YZFE 3UCRA 4BQ6A 4QXTA 3VFPA 2DM2A 1A02N 2YS4A 5DWUH 4IRSC 4E42B 3BUYB 3F5WA 4I48B 2A6KB 2GQHA 4JFDB 4LLMA 3FFCD 1INQA 4R97C 4NBXB 1M1SA 4KI5F 2GCYB 3ULUD 1XF5B 1I1YA 1X6LA 2W38A 3MBED 3LKNB 3GHEL 4GW5A 5HDBF 5F7WC 4PJBF 1ZT7B 3LRSB 5DD3H 1DQJB 4G6AC 1KCSL 1UGNA 1OF2B 1E28A 2EIZB 3U9UA 3F58L 3PWJA 3H8NA 1HXYA 2ADFH 2VR4A 4OCXH 4JFOA 4K94L 1IGJA 1E0OB 1WWCA 4OCYH 5DJ6A 2DYPB 4BZYA 1JWUA 1L4IA 4LQ1A 3QO1A 5AZEH 1G9ML 4YDLB 4UV7L 3NPSC 5CJBA 5FYKH 1OAXH 2ERJB 4HF5H 1A7QH 3QDMA 5D2LB 5CP3H 1F4WL 4MA3B 4XT1C 5ETUB 3S34L 4NC0B 1MCHA 1TTFA 5LQBL 4QF1A 4E0RA 2XWBA 1L0QA 3ARGB 4NZRH 4JQIL 2E27L 5IVZA 2L7UA 3O45B 1T04A 5T1MB 2YD9A 1I7RB 2BXYA 2FHFA 1RJZB 1UEMA 3TBWB 4LCWD 3GIVB 3GUTB 2OSLA 1GH7A 1L0XA 2ZG3A 4JFPB 1N5YL 1AFVL 3ZKND 3ARSA 1MHHB 4PLNC 1TVHA 3QCUL 1PY4A 4ELMF 5I8EB 1SBBA 3IDMA 3P11L 1AHWA 3DGGA 5IESL 3HE7B 5GGRY 5F7FA 3D2UA 1B4JL 1BD2B 15C8H 5GRYA 2NY4D 1GJIA 2JJSA 2EDXA 1EV2E 4I18C 4JDVA 4MVBD 1IM9A 1SEBB 5FKAA 1EGJL 4OIBA 1AGDB 1MWAL 3X17A 1S7WB 1DN2A 3ARBA 4ODUA 5I1GH 4IIQB 1RUKH 3NIDF 3WUZA 2AXHA 2DTSA 4Z7VA 1EO7A 4O9HL 3SDYH 3T3PE 5FK9A 3DV6B 4YJZL 3DRTA 1FLTX 2KUTA 3QUKB 1KV3A 1LNUB 5F1OB 4MJ4A 1WCBB 5L6YL 1MOEA 3RL2A 5IIEA 2AJZB 4POZC 3TZVB 4HZLA 3FQWB 4HWZA 4ZUVB 3E8UL 2QLVB 4EDWH 4N0RA 2CXGA 3ZTJG 2ZUQB 4XCFL 5DK2A 5KSUB 4XNZC 5DQ9B 4QHLA 4OLZL 2FH8A 2JIXA 1KJVB 4QRPE 1J5OL 2VXUH 1IGIL 4PRNA 4Z95H 3UPCA 3C60D 4OI9A 5DS8A 5GRJL 4WFGE 5J3HC 5EZLB 5F93C 1I1AD 2NTSP 1F42A 3B9AA 3TA3A 1PZUB 2G60L 1BPVA 3DRQB 4QRPD 5ERWA 5F72S 1IC7H 3V2AR 1KCRH 1JRHH 1NEUA 5JORA 6FABH 4WFGD 1ZGLB 1S7SA 1R3IH 5ACLA 1LO3H 3C08H 2R56L 1NJ9B 3WIHH 3IETB 2NZ9D 3MROA 3T09A 1X5YA 2QQNL 4ONFL 3RGVB 4NKQB 5E2VL 4F7MB 4LCCC 3VXNB 5INDB 2VXSL 2JJVA 1IT9H 4OAWB 4PREB 2IEPA 2OK0H 2HJKB 4MZ2A 4KUCF 5B38B 1YEKL 1Q38A 2K1MA 4ZS7H 3VXPA 1R6VA 2MCPH 2V17L 5ANME 3MV7E 2DM3A 4H8WH 4OM0L 1YMMB 1X5GA 4LCYB 1P7QA 4HXBH 5CAYB 2Y25A 1YEGH 2QL1A 3KPQA 4Y5VB 2GTWB 3PL6C 2PTUA 1D5ZA 1NGQH 3BKMH 4DN4H 2DQTH 2OMNA 1CS6A 1J05B 1H3XA 3UJTH 3MV7D 4TSAL 2ESVD 2IGFH 3U6RA 5K59F 1KB9J 5FUCC 5CJXA 5IQ9B 4R2GC 3ES6B 2FR4A 5C6PB 2LU4A 4NUJB 4Y4KC 3QRGH 4DVBA 4Y5YC 3LN5A 3G08A 3K74B 2RR3A 1INEH 3ROLA 1R3HB 4IRJC 3VFGL 2D7OA 4M1CC 3N50A 2VZOA 3P4OB 1NFIA 3B43A 3MCLL 3QUXC 4V3DB 3C5SA 4C56A 2ARJQ 3OAZH 2VLRA 4MA1C 4PJBB 4BQ8A 1X4XA 1YJDC 3W0WB 2A74A 4KZDL 5KVFH 2NY1D 5CJOL 4R26L 3FOMA 1T0NA 3MBXH 1MJ8L 1S5IH 3F12B 4JREC 4QEGA 4WY7L 2Q87A 5JW4Q 2O26U 1FFPA 2BRRH 1YQVH 5SWSB 4L9LC 4HX1A 4R90L 1KTLA 5C9KA 1C16B 1MUJA 3KYOA 1AGFA 3QIWC 5EU4B 5ILTL 4Z6AT 3HFML 5D2NE 3C6LB 5LGJB 2YZ8A 1UH4A 4M93C 1K6QH 2BNRE 2G2RB 1N64H 4WRLA 4OGAC 2GW5A 4TPRL 4YHKH 4OCLC 1SYSA 2MKLC 3EYQD 3LD8B 3WHXB 1OP3K 1J0JA 2JJTA 2GTZA 3VWKC 2DM4A 1RJYB 2XRAH 1A1MA 1QYGH 4MDJB 4ELMB 2VABB 4X7TA 1FC1A 1W0WA 3MJ9A 4N0YH 4EJ1C 1I3GH 2VDOL 3B5GA 3GRWL 3MV9E 3EHBC 2Q6WB 3SGKC 2FB4H 2PYFB 3FCTB 1FVEB 5KAQF 3OAYH 1TCRB 5I73B 4YDVA 1QLEH 4QXUH 5D70H 2XT1B 3LKPA 2LTQB 5IWLA 1FNGA 4XBGB 2JELL 4M4RA 5DGRA 2CK0L 3QULB 5IMKB 3QZWG 3MV9D 4OCSL 4PY7A 5TDNA 2A83B 2YR3A 4ODHL 4WJ5A 4XBEH 3SGJC 3QHTC 1OAZL 2AGJL 2FX9L 1JIBA 3ZE2F 3ILQC 3K7UA 3TGXA 2OJZH 5F9JB 3IRPX 2NW2A 1FDLL 3SJVB 3AU1B 1MI5B 3K80A 2J88L 2VQ1A 5C07D 3KYKH 3AUVA 3QHFH 2FLRT 2E6PA 4RIRA 5LBSL 4DVRL 5HHMB 4V1DB 3D39A 4HC1H 3U46B 5DT1H 4NC1E 4KK9C 5EOCJ 3Q3GA 4S11A 4X8JA 1CXIA 4GRWH 1ADQL 3HE6B 3AS0A 1A3RL 2DQCH 2IMMA 5GS1B 1AKJA 3RNKA 2HLFC 2X40A 5SV4A 1V7NL 4U2YA 4RWHA 1ZHKB 2VR5A 4JFFA 2QSVA 3PGDB 3IDXL 4LAJH 5IVOA 1NCWL 1PLGH 4IHOA 4TVSa 2X05A 1I9RL 1Q9LA 3JTSA 2FDBP 3QQ9D 3BO8A 5KANI 4Z7OE 3I2CL 1CXHA 3TWCH 4PJ7F 4GAJL 4HUXA 3EOAB 3U83A 4DGVL 4EI5D 2F5AH 3N85L 4JZJC 5IQ7H 1JF1A 4P4KA 2YD6A 2R9HC 3PJSB 3KPNB 3O8XC 5IM7B 1M6OA 4PRPE 2J4WH 5GS3A 2W0FB 2DI9A 1CT8B 1ZTXH 1FN4A 3I50L 1CICB 2BSTA 4U2ZA 3HUJF 1ZLUK 1L7IH 1UWEL 3FQNB 4DAGH 2Y7QB 4N5EC 1MCNA 3I6KA 4N8CH 4DWHA 1U8IA 4PRPD 1VPOH 3UTSA 1JZ7A 5CUSH 3C5ZB 2Y23A 2KZ1B 4O2FB 2R29H 4GAYB 1FZKB 4KUZH 1BBJA 2PETA 1FPTH 4JHZA 4YBQD 1HQ4B 5JQ6L 2D7PA 4MSWA 2HT2D 3MV01 3PWLB 2IAMC 5D6DC 1GL4B 2HTKD 1AO7A 4GG6F 4DCQA 4S1RH 5DK0B 3FO9B 3KPLA 2QADB 2H8PA 1E6JH 5E6IB 3O81A 1NCDH 4FXKB 4RAUB 1IAIH 2ENYA 2YWYA 4PGEA 1WK0A 1JPFB 4OCRH 4HQQH 3NCJH 3T77A 5GGTL 4ETQB 1DEEB 4OJFL 1REIA 4J4PC 2R2BA 3BQUA 2IH1A 3ZSSA 4KHXH 3WFDL 1I8IA 3PQYB 1JRHI 1MFEL 3HNSH 1XR9B 3LKRB 1U36A 2X4PB 3U0WL 4OUUA 4IOIB 1OOAA 4KDTA 3UJIH 5C0BD 2AJVL 4LSQH 4Z0BL 5HYJB 4ELKA 1CE1L 3CPLB 35C8L 1ZLWH 1MREL 3T1WA 3BD3A 1RJLB 5EZOH 4UILH 2Q7YB 1H8SA 5C2UB 5J13C 5EBWB 1C8PA 2J7LA 4CNIA 2AXGA 1V7ML 3BT2L 3ZT5A 1KLGA 4S0SD 1JP5A 2PTTB 3VXSA 4J3OC 1DE4B 1NBYA 4PJHB 3TNMB 3KPRA 2P8MB 3S8WA 2A38A 1UWXH 4KY1L 5HPMA 4PV9A 1KJ2B 3P40A 1RZFL 4XVTH 4O2EB 1YEEL 4Y1AB 4MJ5A 2OL3B 3SDXE 2AAVA 5EO1A 2CDEA 5F7DA 1V3KA 5IROC 4R0LA 1OSPL 1WBZB 2AK4A 2R2HA 4OLYL 1VFBB 3MOAL 1FYTE 2QEJA 2BSSA 4UNTA 4QRUB 4HDIA 5DFVC 2BNUA 2X89A 3FO0H 1FQ9C 2FIRT 4X99B 3T65B 1CXFA 1AE6L 4XHQA 4LVOC 2A0LC 5IHUL 5DHVH 4AQ1B 5F6HI 3AXLA 3PP3H 4LP5A 4KRLB 2W9EL 1JPTH 4HS6B 4G59A 3HMWL 1LILA 1FYTD 43CAA 3GIZH 4M7JL 1GAFL 3QG6B 5BXFB 5IB1B 1EERB 1A8JH 3JXAA 5CBEA 3I75A 3NH7H 5FDWA 4MJIE 4HG4K 3TNNA 5LGHH 2NYYC 5T3XH 1AHWC 3ALWA 3CXDH 1NLBH 3PXJA 3QDGA 1ZXQA 2JJSC 3P0VL 4MB5A 3REVA 3BGFC 4BFBD 1BGXL 3ARBC 3TLRA 4ZTPL 2H6PA 5HHVH 5DJ0A 5F3HA 2D03H 1P84K 3VXQA 4AEIH 4AY0A 1SY6A 4FMKA 3UPRA 4HCRA 2WP3T 1S7VA 4ODTL 3GDBA 4OLUL 1ZKAA 4U1IA 5CMAA 3WN5B 1L7TL 1WSST 1OGTA 2BVPB 4RMQA 1IE5A 3V6ZB 1UZ6F 4U6HB 4OV5B 3WNNA 5F8QC 2ZOKB 3T4YA 3VXMA 2E7LE 4TRPL 3VFNA 4OZFB 4Z0XB 2J12B 3UYRH 1RZJC 1FBIH 1ZEAH 4AM0A 4QGYA 4FQHB 5TQ0H 1OP9A 4FMFA 4XX1E 4WU7B 2WWMC 1DL7H 4A6YA 3OKMB 5HHPB 2DQHH 3HUJB 3MBEA 4XPAH 1TQCC 4S1QH 1ZA6A 2EZ0C 1K8IA 3OHXB 3S98A 5CCKL 2Z8VC 1UYWH 3A6BH 3TA3C 1MHCB 4PLKC 2YPVH 4IM8A 4XI5D 4KKAC 4LARL 5GGUA 4X8XA 32C2A 3OKNA 1ND0B 1T66C 4PB9L 4U1KB 4HBCL 5E4EB 1INDL 3RWDB 3PABA 5EORL 4CVWA 5JPNA 5DJCB 3L5XL 4FP8L 5MERA 3P4LA 4ZG1A 2GJZA 4M62H 4NQVA 1IJ9A 3RX7A 3ZKMC 3BDXA 4GG6B 5DC9B 3K8LA 1EJOL 3EJJX 3QAZC 3RWIB 4CBPA 1VKXA 5FHBL 2A1WL 3T3ME 1PGRB 3X12A 2MWCA 3CFCL 2BFVL 5CZVL 3TCXA 2FHCA 3CSYB 4XMKL 2XWJB 3BMWA 4RFOL 5MEPA 4OZIE 2P8LB 2AS5M 1X5FA 3HB3D 3IGAB 2FJGB 2VDKL 3TYFA 4QNPF 1WEJL 3QUYB 3F6LA 2AXJA 2OP4L 5GGVH 1WC7A 3LKOA 4NRYB 5DGQA 4W6YB 3GSXA 2QQKH 3MUGA 4GUPB 2ORBL 4PJCF 3BWAB 5KANG 5JIPA 5CJXC 4O4YL 1HXMA 5EU3A 4N5UA 3DX9A 3VGDA 5EBGA 3BRDA 1SYVB 1CFNB 2BOCB 4E41D 3MFFA 1FL5A 4B7LA 2VIRB 5L8JB 4J3TA 4LSPL 5C92A 1LK2B 5MEOA 4L3CA 3WNPA 2W0PA 1FGNL 2HN7A 3U4BH 4MD0B 5DSCB 2FEEL 3RVUD 1CR9H 2CD0A 5IMLB 3E3QE 4K3GA 3H0TB 4KMTH 5B8CA 4PJEE 3M1BA 1BIHA 5TH2B 4JO4H 2I07A 5I18L 5DQDL 5INCB 1AD9A 4P5TD 1MCWW 3H9SB 5FA3B 5KW9H 4WI9A 1X5LA 1KEGL 5I1KL 3QIBB 1BZ9A 3C60A 2BY0A 3PDGA 5D7LE 1RY7B 5H35B 3QEQD 2GFBA 3P9LB 3MO1A 3LQMA 1I1AA 3LPFA 4RGOH 1L9NA 5I1CL 1RURH 1JNHA 3RZCA 4QRPA 4K3DL 1UB5B 4ORGA 5FOJA 2F54E 2BY3A 5DMGD 1M05A 2BY1A 5D7LD 4HKJB 3SOBH 1N6UA 4YHMH 2JJTC 5KJRL 3VFOA 3HZKA 3F65A 3QQ4A 4RRPA 1IAII 4APQD 4U3XA 2AJ3B 4FA8A 2QTEA 1BFTA 5HHQA 4Y4FA 4LLAA 1LMKA 5DI8B 3U1SL 4G43A 4RGNE 1I8MA 4FNLL 2ICEB 1T7VA 3BOVA 3GMOA 4XC1H 2F54D 5DHYB 1F11A 5CHNA 2Q20A 1M71A 1CFQB 4O00A 4RQQB 1GVIA 3BRGC 1P5UA 2HH0L 4XAKD 4P2OC 2B1HL 5TQ2L 4CVXB 5IWLC 4YHNB 5F6HJ 1X5IA 4JVUA 3VJ6B 2Q1EA 5FYKU 3QPQD 1V3MA 4RGND 5H94B 4NKOA 3JWOL 1S5HA 3LDBB 5E9DB 1G9NL 3G6DH 2EYRB 4MCYA 2ZCHH 1A7OH 4WFEE 1J18A 1DQDL 1TPXC 5AG8A 1N4XL 1EFXD 2EYSB 5ANMA 3MV7A 1QVOA 3KXFE 4H1LA 1RHHB 2JTDA 5EFIB 5FGCE 1YJDH 4B41A 2WBJB 2Z91B 4YHPA 1QFWH 3NGBC 1R3JA 3VXUE 3O6FB 5DURD 2WUBH 5IFJB 1IMHC 4FTVB 2XN9E 3WYRA 5A2LH 2K7QA 1I9JL 1RI8A 1A7NH 1CXKA 3KXFD 3GB7A 1N8ZA 4I0KA 3GMPB 1GGYA 4EXKA 1OWRM 2HVKA 4PLOB 5EBMB 5BJTA 1IGFL 2QQLL 5IB3B 4FZ8L 1CFBA 3ARDA 4BH8A 3VXUD 5KVDH 3AFLA 3RNQB 4QRRB 1YUHA 2XY1A 1Q72L 4KGLA 5ID0B 1AGEA 1KTDA 1P1ZB 2FBOJ 1KIRA 2IADB 3T0BA 1S7XA 3DNKA 4KMQA 4MS8D 5IK3B 5E5UB 1O5DT 5CGYC 4LFHG 2R4RL 2MMXA 3HZYA 5HI5C 3LVEA 3VDCA 3L7EA 1J1XH 4ZSOB 5F9WB 4DGIH 4NQCB 5LCVH 4PJXE 1JE6A 1AQKH 4P4KC 4QY8B 4HWEL 1QACA 2VH5L 4G7YH 3L5IA 3F7RA 3VD5A 1PG7W 1UQSB 2IF7A 2VITA 3BDYL 4LMQI 1NGXB 1OLLA 4IRZL 2ADJB 5D2NA 1KG0B 4I2XB 1D5XA 5T5FL 2BNRA 3T0XA 2AV7A 1RVFL 3VGEA 1CVSC 1UB6A 4JQVA 1EEYB 3QISA 4HPYL 1HHKA 4OF7A 1NFKA 1RULH 5FCUH 1YY9D 4PJCB 1CG9A 2WUCL 4CADB 2HMIC 1IQWH 1L0YA 3HI5L 2B5IB 1S78D 4XRCA 4YXKL 3KS0H 3NABL 4UDUB 2IQ9H 1NAKL 4NO3A 5CZKA 2VDRH 4XXCA 1Q1JH 4X7SH 5ALCH 5CEYA 1X5ZA 1VENA 7FABL 5ITFB 3DVNB 2QBWA 3MV9A 2VE6A 3QDJB 4NQDB 3MCKA 5BCAA 2YA1A 3D9AH 1G7IB 3VI4E 3W9DB 1FNHA 1MFAH 3SCMD 5AG9A 1A64A 4FQXB 5F7LB 3RTQD 4F37K 4Y16D 1URLA 5E5MA 1OP3H 5CEXB 3PP4L 3RY6A 1YPZF 3MLRH 4GBXD 1B0WA 3QI9B 4PJDE 4YHOH 3BQUC 3CFBA 3S36H 1AQDB 3AS1A 3T0EE 5BVPL 4AG4L 4EN3A 4NNPL 2IANE 1DUYB 2AABH 4JHWL 4JR9H 1KFAH 3FT2A 1II4E 2IWGA 5IJVA 4KDTC 1YA5A 4TULL 1HE7A 1T1XB 1WF5A 3P9WB 4U31A 3QFJE 2YUXA 3EYFB 1YN6A 5AWNH 3T0ED 5BRZB 2ZUXA 3NVQA 3VD4A 3GMMA 2IAND 5D93C 4HEPG 5C0DA 25C8L 5ALBL 3ARPA 4WNQB 6CGTA 3RQ3A 1BFOB 5DJ2A 4Q9RH 4M43H 5D72L 5IFAH 1QBML 3IF1B 4NRZA 2VLJE 5DRZB 5HD8C 1NL0L 5CLWA 3L3KB 4YR6A 5DDHB 2GSIA 2A77H 2R1XB 1A0QL 1LDPL 5EB9A 1OAQL 3QFJD 4Q0XH 4M6ML 4MQ7A 2N4IA 1VDGA 4PJIF 3V5DA 4PGBB 1S9XA 3UTTE 4B0MM 4K8RC 4EI5A 4MJ6A 5I6XC 1SHMA 1P7HL 1G7MB 2VLJD 5GSRB 2DIAA 3HZVA 3QXDB 3HC0B 3IAPA 3LQAH 5J57B 4OM1H 1GSMA 1QLFA 2NY5C 3RDTB 2XA8H 4YC2B 4PP1D 5IOPA 1ZWIA 1NDMB 5K93A 2XTLA 1JN6A 1ZHBB 4WEUD 1TVDA 3UTTD 3ZDZF 4HS8H 4KROB 1HH9B 5A2IH 5D96C 2Z93B 4JG1L 2EH7L 5HGBA 4NT6B 1A9EA 1XF4A 2CGRH 1FV1A 4GAFB 2KQMA 5HDLA 4PRPA 1N59A 4YXHH 1MLBA 5IB5A 4JM2A 4MA7L 3S35H 1KB5B 5BZWA 3EJZC 5BS0E 5ABDE 1A1NA 2OQJA 3C09B 3U4EA 1S8DA 4U1HB 4D3CH 3AM8A 4XZUA 3F6IA 4NUGH 3HCVA 4PD4K 3HC3L 2EEBA 4HZAA 1UM4H 4RMUA 5LWYH 4X6BB 4XCCH 3V6FB 5GRWA 4OCWL 4H5SA 3AB0C 1HNFA 4X80H 4NPYA 4XPFH 2HT4D 4PPTA 4WW2A 3CX5K 1JGDB 3I6GB 1G0DA 5J11B 3BH9A 5BS0D 3S4SB 2GY7B 3MRRA 1IQDA 1U91A 5IBTH 4K9EC 4HHAA 4KQ4L 4RCAA 4WEMB 1WZLA 3VMPA 4WFFE 3QFDA 2VLKB 5JW3H 1IARB 1KENH 3VI3E 1MQKH 5TFSH 2PCPA 3EDEA 4UAOB 4MNGE 4CUCA 1ONQA 2F74B 1BIIB 1ZMYA 4G9FA 4LU5L 1FIGL 2BDNH 3T4AB 2Y36L 5MP6H 3TM6A 3CZFA 4Q6YA 1XGUB 3QUMB 1HHGB 5L2JA 1T20A 3LN9A 3M17A 1U58A 1F3JA 3ULUC 2CIKA 4UNVA 1U8OB 3LQZA 3MBEC 5GZOD 3D18A 2HP4A 4KVNH 4TUJB 4J6RH 2NW3B 3HG1B 1DCLA 3D0VA 4EUPG 5EZIH 4LPVA 3G6JF 2R2EB 4NFDA 1OSZA 4YFLF 3N1FC 4NOFA 2AI0L 3KPSB 2IALB 5TDOB 1CGSH 5B3JE 4QTIL 1A6TB 3KWWB 1ZT1B 2QSTA 5E8DL 5DQJB 1WFNA 4QHNA 5TE4H 4E9LA 1OCWH 1MFDH 1WUNT 5FYKE 4LHUD 4YDKL 4XAWH 3BEWB 4CGTA 4QRSA 5GGSA 2APFA 1KN4L 1CD9B 1CDGA 1QFWI 4YIQA 3SDXA 2ARWA 1S9VB 3NCEB 4JDTL 1XGYL 2Y6SD 3WKMH 4N0UE 3TYGH 5IGXH 1FYTA 1QKZH 3CVHB 3S5LA 1U3HA 3NCCB 5H37H 1ERNA 1NMAL 1RFDL 1S7QA 1YEHL 3JWDC 4KU1A 4X9BA 4HEME 1C5CL 2DDQL 1KIQA 5D1XB 3SN6N 1JZ5A 3SO5A 1NBQA 4KK5C 4LLWA 4MCZB 1HHHB 4DN3H 1A6VL 4B50A 2NY4C 1SM3H 3CLFL 3QYCA 1MIEH 4DZBA 4PTTB 3C5JA 1AR1D 1IKFL 3LEVL 4MVBC 1UA6L 3CDYA 3PUCA 3QEGH 3VE0A 4MJIA 4NJAH 4Z8FL 3DIFA 1J1OH 3VFUA 3U0PB 3INUL 3CDCA 3AMLA 2NX5E 3IDNA 3NFPA 3HS0A 5JXEA 4RAHA 2PR4H 1MCEA 1MWAA 1CXLA 2FO4A 4GAGH 4K3JH 4S1SL 3DROA 1KB5H 3BAEH 5T1KB 5B8CC 5K9OA 1FZOA 4GS7C 2DBLL 4GG8A 4PJIB 2DTMH 5ITBH 4QTHA 4MXVF 4XGZA 5D4QA 4MNQE 1DQTA 1U8HA 4P3DB 3MNZB 3BZEA 4X6EA 5FF6B 5TF1H 4R3SA 3KLAA 3G5ZB 4BFIA 5AZ2L 2PO6A 4CVUA 1MAKA 5HDQL 4HFWB 4NN5B 3T1FB 4OF6A 1BQUA 1TTGA 4WV1B 3BGMB 3C60C 1JK8B 4XCYA 4UTAL 4PRHE 3IXTB 4WUUB 1I1AC 2E7LA 4MNQD 4DGYL 5JHLH 4ZMAT 2CDGB 4PJ8B 1TETH 3MRJB 3PGFH 3RZCC 4UT9L 1M7XA 4DK3A 3MRNA 2B2XL 1CBVL 3C8KA 1F4HA 5GGRA 1R3KA 1P53A 3DURA 3STZA 3EGSB 2HFGL 4G6JL 4G6ML 4XCEA 2DL2A 3L3HA 3PDOB 1MY7A 2DQJH 3HNTH 3U82B 5FA4B 4RBPK 4R7DA 4KJQC 3TT3L 5E6ZA 4G8GD 3OMZA 4Y4HB 1RU9H 2CUMA 5DD1L 1IEAB 1EFQA 4HIEA 3R8QA 4HLZG 1HILA 5J9PB 5DJDA 3TN0A 2IPKA 3VA2C 1Q8MA 1NGWA 2E9BA 4P3CH 1ETZB 4Y19E 4JFDD 5F3BA 5C08B 4I3SH 3IXAB 1S9WA 1KJ2L 2ADIB 1OTSD 4GH7B 4IMKA 5EDXA 3TO4D 4Z7UA 2OL3L 2R0ZL 4AENA 1PY9A 3EKCA 3R8BB 2XNAB 4LSUH 5C7XL 1JWSB 3CC5A 1XR8A 4L8SA 3V0WH 4U1JA 5KN5A 5HYEA 5D2LE 3W9EB 1T22B 4Z18A 3JV0A 4OZIA 3PHQB 4JZOA 3ULUF 1EHLH 3OBAA 4XP4H 1VEPA 2DYPD 5E8OB 3RVWD 3EOYG 3C87A 1QD0A 3QIUB 4CN1A 1NKOA 3IKCA 4DK6A 4OIAA 4M00A 2C3VB 1MCPH 5C0CB 3WL9A 3QQ3A 4LF3A 1W72B 4P49A 3SKOB 3OGCA 3CXHK 3NACH 1JNNL 4JY4A 4CW1A 2QR0A 3G6JB 3FAWA 1ZLVH 3ARDC 3VCLB 1CYGA 3ARGD 2DWDA 5E4IA 1CQKA 4GQ9L 3BD4A 3MXWH 4GXVH 2E5EA 2YPLB 3LB6D 3C2AL 1I7TA 3MRGB 1BZQK 1DVFB 1X7QB 3WSQH 5A16A 3SKJL 3L9RB 1XGTB 2YBRB 3BPLC 3E3QA 2VDLH 4PJEA 1QBLL 3MX0A 1IGYB 3HE7D 4LQFL 3THMH 4WDIA 1T7XA 1TJHH 1BD2D 4R8WH 2P5WB 1FJ1B 1OHQA 3IDUA 3QWOA 3EYQC 3X3FL 2Q7NA 2PNDA 1A6ZB 2PXYB 5L9DL 1QRNB 1N7ML 4RMWA 5EG6C 1I8KA 3MRIA 2APTA 1FNEA 3MGTA 4ODBD 1S3KL 4WUKH 5D7LA 4YXLL 1FSKC 3QP3A 1QSEB 3W2DH 3FT4A 4APQA 3V6BR 4XPBH 2COQA 4URTB 3VRJB 1F4XH 3TJHA 4LKCB 4QLRA 4JQVC 2M26A 4NQSA 3T0DA 1TZHA 3KLHD 2F54A 5H2BB 4BSWA 1F02I 2WWKT 1RUAH 4DQOH 1AD0B 5DUBB 4X6FA 3GRWA 4ONHA 3ZE1F 5CGMA 1MQ8A 4PJ5E 2N7BA 3ARUA 1J8HD 1OTUD 1DR9A 4XXCC 1Z5LA 3FZUD 2G9HB 1OP5H 2OX5A 4WO4A 1SJHA 4KJWD 2RGSA 4PV8B 1NMBH 5EA0L 5HI3D 4EUPB 3GI8L 3MQIA 4OD3H 3ARQA 3PNWB 1FE8H 2FWOA 1GOGA 3FL7A 1TNMA 2HG5A 1JVKA 3RHWK 5E2WH 2X70A 3IAQA 2A6JA 2OTUB 3GM8A 4L8BB 4ZOEA 1XH3A 4D0BA 3F7YB 1NGPL 1YMME 2NPLX 4N1EA 4GRLB 4OT1L 2Q76A 3KXFA 5DRWA 1YNLL 3JTTB 1LO0H 3RGVD 4YHLH 3HMXA 3NCMA 4IDJH 3RA7L 3VXUA 1CVRA 3OJVC 3Q1SL 2DQUH 2XN9A 3Q6GH 4NC1C 1A6PA 1YMMD 1CGTA 4U1SA 1BMGA 3MRDA 3QR2A 5JW4R 3DMMD 4MS8A 4KPHH 3L3IA 1JYXA 4UINL 3CUPB 3QQ9C 5E99L 3S35X 5KSVB 4O58L 1G6RA 5LXGH 2NY3B 4F33A 3OR6A 2AJSH 3KJ6L 5GISL 4FZEH 4KI5E 4WFHD 3X13A 1TZGH 4M1DH 5B21A 1U92A 1CGVA 4QXGH 4QHUA 3V4PL 4EI5C 1KJMA 5HDBE 3VXRB 4AEFA 2EE6A 4PJBE 2VXVL 2FZ3A 4M5ZL 3U4AA 4LRNH 3RIAF 1AQKL 4PTUB 1WZMA 1FG2B 3FAXA 5KS9F 4KVCL 4HIIA 2VL4A 3GMQA 2GAZA 4J8RA 3O9WA 1A47A 5SWSE 4ZFOA 5EU6D 2B7DT 4PJXA 4AMKH 5B39A 3GK8H 1KELH 4MXQD 1HCFX 4HH9A 5I1DB 3DECA 5JOFB 5HGDA 3KVQA 3W0WD 1JWMA 3O2DL 2E8ZA 1NH6A 4ZXBB 1JUFB 3HC4H 1ZSDB 4JM2C 3DX7B 1H0DA 4XTRD 1FZMA 3MRCB 4KFZC 3AM8C 5SWSD 3O6LL 2HT2C 3RAJH 1A14H 3EZJB 3IFOB 3GBNL 1YEFH 3CFKB 5IT2H 1EZVX 2HTKC 4TQEL 4WW2C 3TO2B 4AH2A 3SGEH 4DKEH 3C6LD 3HI1B 1JGEB 1BEYL 2B4CH 4RGMC 3SCMA 1XF2B 3RTQA 3CVIH 1CDIA 2HLAB 4ELME 3ARTA 3PXHA 3LIZH 4BQ9A 2HRPL 4XCNA 4GBXA 5F8RC 3KG5A 3WCYA 1Y6NR 1DBBL 3PF2A 4N8VA 1U3JA 3NAAL 4O51B 3IS0X 4HPOL 1ES0B 4MAYB 4TSBL 3OKDB 4XP6L 1QSZA 5GJTH 3NPSB 3RVVC 1WWBX 5GGTA 4AEHH 4L8CA 1T7WA 4LEOA 1EUTA 2AEPH 2AABL 2GHWB 3NIDE 3P2TA 2VSCA 3Q6FB 4OFPA 5FO8A 3OJMB 4PJDA 5E1AA 4G8EA 3NCYS 3T2NH 5E94A 3T0EA 4IJ3C 1I1RA 4K8RH 2IANA 3ROOB 1MI5E 3GJEA 2ZOLB 5DZLA 4JO2L 4LLQB 3BE1L 4N90D 5I8OH 5J12B 4YEFA 5IBUB 1YEIH 1G7PA 5AD0B 5JW4M 1BAFL 2YC1B 1AP2A 5E2UH 5HHME 3FQRA 4HSQA 3QFJA 5E8NA 2OZ4L 2SEBB 3C8DA 1NCCL 2G75A 4ZO9A 2UYLB 1T03L 1DBAH 3SJVD 1GCFA 4PJFF 4AZ8A 5C0GA 2CUIA 3U9PH 1HOCB 3IDIA 3WNLA 4HGWA 4M4PA 3WEXA 4NP4L 5HHMD 4V1DD 1E4XH 1VGEH 3H3PL 4Y0GA 3NCBB 3RWGB 4K94C 1JMXA 4FG6D 4JO3L 4I1NB 3MODH 5J1SC 1VADA 5T5NF 2DLGA 4P2QA 4U7MA 2CIIB 4ODVH 3UTTA 1KSRA 3FQTA 1G9MC 4NQEE 1G1CA 2VXTL 4IEFB 5FOBA 1F97A 3HE6D 1GGTA 1GZPB 3O3AA 3HAEB 2HKFH 5HHNA 3MREB 4WTXA 1EPFA 3U2SB 3TBYB 2EDDA 2C1PA 3OXRA 5K33A 4S0UC 2YN3A 4XVJH 1U3HC 1DSFH 1JGVL 1HKLL 1AY1L 1EZVY 1NUGA 2J5LC 1GGBL 2FHBA 1MJJB 3ME0A 5D8JL 2HFFA 2DQFA 4UB0L 5T3XE 1UXWA 1ZVSA 3MRKB 4OKDA 2FJHB 3WXWH 1NEZG 1WAAF 3RL1B 4OF0A 1I7ZA 4X5WB 5BS0A 3IU4H 4KUCD 4FQIH 4G5ZH 1HINL 4YX2H 5EU7E 2IJ0C 2DQDH 3S7GA 1J7VR 5K59E 1DBJH 3A6CH 1YEDA 1VSCA 2F19L 5JR1H 1OM3H 2XZCH 3IDJB 3L6FB 4OLWL 4GKNA 1T1ZB 3MACH 3ULUH 4A6YH 4XPGH 3CFEA 1XF3B 3BZFA 3LMJL 3UBXB 3W5MA 4HWBH 2E9JA 4MD4A 5JO5B 1JHLL 5ESQB 2WV3A 3B2UD 1FYHB 2BDNL 1A9BA 1U6AL 2F15A 4AT6B 4PGJA 4KQ3H 3DPBA 2PO6C 1U8NB 2UUDK 4MNGA 3U0TA 3SDAD 1TQBC 1JYWA 1RZIB 4S10A 4JHBA 3LEYL 5ICYA 3FN0L 5I1HH 2ESVB 1IC5L 5EIIA 4ZUWB 2E7LC 1A4JB 1S9YB 2QADD 3T0VA 4R2GB 5E6ID 4ACPA 3DVIA 1ROWA 4H26A 1UEYA 4ZOCA 5E8PA 3AGVA 4IRJB 2MCG1 4ZUSB 1RMFH 2R0WH 5I15H 3CFIC 4M48L 3QUXB 5I74B 4LHUA 2UV3A 1D7FA 3PQYD 3JWDH 2VJXA 4UIMA 1D5IL 1EX0A 1GIGL 4ONGH 4FXLA 1HDMA 5HYJD 3MLUH 1B0RA 5HJ3B 4ZPTB 1T89A 2GITB 3P4NA 3TN0C 1U8KA 2P7TB 3ZTNL 3EYOA 3FMGH 4Y1AE 5CP3A 3MLXH 4NN7B 5B4MC 3MJ7A 3SE8L 2GT9B 4OD1H 4RZCB 1OARH 4IMKC 1KGCE 1QLRB 3BPOC 3ZKSD 4N0UA 4W70A 3KAAA 2JJWA 4QRTB 4YBHA 4CL7A 3EBAA 1N0XL 2DWEB 1VESA 1MFBH 4Y1AD 3VH8A 5H37G 5CSZB 3E6FA 3ZE2E 1QSFE 3O0RL 2H2PD 2WM0A 4HG4J 1B6UA 3HLAB 3MRFA 1KGCD 1XFPA 3B83A 5FDYA 1G7LA 2AQ1A 3RWFB 4KZEH 2P46B 4U1LA 1QFHA 4M61B 2EDEA 2DN7A 4LLYA 1UZ8A 4B7IA 5ESVB 3RVUC 2BC4B 2ADGA 4JB9L 4F7EB 5DJZB 2VC2H 1YC8A 4HS3B 3KYAA 3DBXA 2IG2H 1ZHNA 2BJML 5EUKA 1D9KD 4OTXL 3FTGB 2DQIH 3QEHB 4PJFB 2H9GB 1P84J 2FIKA 5J1AB 2VR9A 1OAYH 2NX5A 4FHBD 4V2CB 3IJYA 5K9KA 2HVJA 5DO2D 1CD1B 4M3JA 4UBDD 1A6AB 4MLIA 4BKLB 2APVA 1KJ3H 3E3QC 4U1MA 4NWTH 1OT2A 3RI5K 3UO1H 3KPMA 3TPUB 3DUUA 1CK0L 3B3IB 3GSNB 5KSBF 2OMBA 5CP7B 4MNQA 2XZAH 1RIVL 1ACYH 2I9LA 5I1JH 2D7QA 5GS0C 1TZIB 4O02L 3U30B 3SGEI 3G6AB 2P5EE 4MXWH 4ZOAA 3OV6A 1N2RA 1PJ9A 4LDEB 4ONOA 5IFHH 4KJPD 3W39B 4PRHA 4JJ5B 1DUZB 5EWIL 5F1NA 3B2VL 4M7LL 4APQC 3O6MH 2CR3A 4U6XA 4X6DF 3TJHC 2QKIB 2IPTH 4IBLT 3QUML 3OB0K 2NY6B 1QFOA 4NO0B 1MNUL 3HUJE 2X4TA 4K71C 5C6WH 4N9GB 3UZQA 5C6TL 4I0PA 2RAMA 1GC1L 4H1LH 4E42A 3BUYA 2YD2A 2RJMA 4I48A 2A6KA 1AJ7L 2OTWB 1AGCB 3QO0B 1UC6A 4RGNC 4OGXL 2GCYA 3J7HA 2FYYB 2IC2A 1XF5A 1TJGH 2UZIH 4WO4C 1CI5A 4N1HB 4OSUH 3WXVH 1UCBH 3UJJH 1ZT7A 1P2CB 3LRSA 4N0CA 4R4FL 1DQJA 1HSBB 3WDHA 4XC3H 3T2PA 1OF2A 1BHGA 4PBVC 2EIZA 4Y19A 4GG6E 3QQNA 5SX4H 4UT7L 1BFVH 3MXVL 3ARYA 5FYLL 1VFAB 1BBDH 1SQ2N 3QJFA 2ZKHH 4OI8A 1D6EA 5K9JH 4LGRB 5F7EH 1EAPA 1H5BA 1MCOH 1KIPA 4C55A 5D2LA 5ETUA 1RUML 2V5MA 3CVHL 1I1FB 5FUZL 4BZ1H 2O61A 4PRBB 4L3EE 3VFVB 3D5OF 3O45A 3RPKA 1WLHA 4TSCL 1I7RA 1A7RH 1MAML 3FKUS 1RJZA 1V3LA 1KEMH 4G6KL 3TBWA 1E27A 3EYUH 3GIVA 3NOIA 4FXGB 3GUTA 4MS8C 1E4WL 4F3FB 4JFPA 4HWUA 1VHPA 3QUYD 1HIMH 3F62A 1MHHA 5F1SA 3F7QA 4MAUH 5D5MF 5I8EA 2BRQA 1QZ1A 2NTFB 1NEZB 4PY8I 4L1DA 3P9MA 4FN0A 3BKCL 2FATH 2VZUA 5T33H 4RAVB 1EAJA 1F4AA 2ZSWB 1SEBA 3ERYA 1AGDA 4IMLB 2XA3A 1S7WA 3CFDB 4BSVB 5JDJA 1HZHH 4IIQA 4ZYKA 4PGCB 3DX8B 5MEQB 1DTUA 2PKDA 2LVCA 3CCHB 1EEUA 5TDPB 2YHGA 1LK3L 1FO0L 3MNVB 3QUKA 1LNUA 4PJGF 4OF8A 1AI1H 1WCBA 1YY9C 1CL7H 3TZVA 4OLVH 1G7HA 1CN4A 3FQWA 2L7JA 3F5WB 3RX8A 3MLTB 1INQB 4FFVC 2EIDA 3H9SD 3LV3B 5J56B 5KSUA 3SQOH 5AUMB 1N26A 1EVUA 1KJVA 1LP9F 3QIBD 1LEGB 3BHBB 1FNSH 3OL2A 1FRGH 1NPUA 4OF5A 4HV8A 1E28B 1WBYB 4MWFA 3SCMC 3RTQC 1HXYB 3D69B 1NMBL 3MRMA 4PJ5A 5I30L 2X9XA 1IGJB 4GBXC 2D7TL 2NLJB 1B2WH 1JWUB 3QH3B 2Y5EA 4RFNB 5ICZB 3EYVB 3EJYD 4LASL 1ZGLA 1B90A 3DSFL 4EBQL 5D1QB 3IETA 2F8OA 4PUBH 1CFTA 5KSBB 3GGWA 5HGAB 3RGVA 4F7MA 3VXNA 4PRDB 4QF1B 2XWBB 4RISH 5E9DE 4ZNCD 4PREA 1T04B 2HJKA 3EDFA 5B38A 4HC1A 3TFKA 2E6QA 5C09B 2QHRH 4AYFA 2VERN 4OZGF 3T0EC 2MKWA 4XMPH 2KDGA 1UZ6E 1YMMA 2BHUA 2VO5A 3FONA 3NFNA 4LCYA 4AIXA 2F53B 2EDOA 1KPUB 3IDMB 5E9DD 3NIGF 2F58H 5FEBA 4X6DB 5C0AD 4FTVE 4Q9CA 5I8KH 3QCVH 1J05A 3SDDA 5CINH 8FABA 5IKCB 3ES6A 2YSSB 2XTJB 2LAGB 4J3UA 3T0AA 4NUJA 4J7RA 5E1HB 1B3JA 3VGFA 5DJ8B 2DB8A 4YBLC 4ODSL 2WBJD 4BELD 1R3HA 1W72L 3O6FD 4QRRE 4FTVD 3P4OA 4G8IA 1GHFL 1MFCH 1SJXA 2GK0B 4KV5F 4HW6A 4KRMB 5IIEB 3O3DB 1RK1B 2K7PA 3CLEL 4PJBA 4BK4A 4HZLB 5ESAA 4MXQA 4K07A 4C54A 3VU2A 2NXYB 3QA3A 4YHIB 4LDLB 1UH2A 3P0YL 2W59A 4DKFH 4WWKB 2HT3D 2ED9A 3F12A 2JIXB 3BESR 2VL5B 3K2UH 5SWSA 2RCSL 1EEZB 3HI6L 5L7XH 1CGXA 2AXFB 1TQCB 1KN2H 2HT4C 2X9YA 5EU4A 3TIDA 3ZZ1A 5CZXC 1MRFH 3C6LA 5LGJA 4I2XE 9CGTA 1PX3A 4D8PA 4ZUUA 4QNPE 4NQCD 3TBTB 2FGWH 3R1GL 3MRLA 3UXFA 1ZAGA 4PJCE 2OI9B 1UKTA 3WHXA 3P30L 3MTRA 2BK8A 3K1KC 4P99A 3QUZB 4RMRA 4DKDC 1OAUL 1U8PA 3WUWB 1BF8A 3OKLB 5I1AB 1M7IB 1A5FH 5F9DC 3V4UL 3O6KL 4CMHC 5J8OA 1RJYA 1IAKB 2V5RA 4MDJA 3MLSH 4ELMA 2VABA 5D5MB 3ULSA 4L29A 3V7AE 3HPJA 2V2TB 4I3RL 2Q6WA 3MLYL 5GGQL 3RJDA 1RUPL 1ZOXA 3N1GC 3NCYP 4PLJD 1FVEA 2CKBB 3GHEH 5GSVA 3ZT6A 2E8YA 1BQSA 1KCSH 4XBGA 4DKAA 1PAMA 1FGVL 3F58H 3QULA 3FT3B 2A83A 3QDJD 4NQDD 3BFOA 4ZFZA 4K94H 3MRPA 3IT8D 5FECB 5E2TH 5F9JA 4E41B 4ZPVB 4FQXD 4DVBB 1CIDA 1G9MH 1MI5A 2UWEF 1VFOA 2X4OB 5DEZA 4UV7H 3G08B 4Y7MA 4PDCE 1ZK9A 1S7RA 3NMEA 3KLDA 4PY8J 4CDGC 1R5VA 3QI9D 1F4WH 2VZSA 5DVNA 3S34H 3JUZA 5HHMA 3BJ91 3C5SB 4JRWA 1XEDA 4P23B 5LQBH 2OS7A 5BRZE 1WZ1L 4JQIH 2E27H 1LP9B 3ILPA 2UVFA 3VRLF 5CIPB 1U8LA 4ZFGL 2Y6SC 4ISVA 3TV3L 4TVPL 2IBGA 3FOMB 3GJFB 3GHBL 4FQJL 3QSKB 4K3HA 1WGOA 1AFVH 1N5YH 3QCUH 5BRZD 1FFPB 2BZDA 1ZHKA 3P11H 4HX1B 5IESH 3RRQA 1W2KT 3Q5TA 4L5FL 1B4JH 1MCDA 5ADPL 4NQEA 5HBBA 2PW2B 1DQML 1PW3A 4JO1L 3IFPB 4PRID 5IW6A 1EGJH 2OBGA 1MWAH 5FAAA 2X4QB 5CJ5A 1U93B 2AJUL 5DR5L 3I85A 4F15C 1SYSB 2Z4QA 1IEBB 4PD4J 2HWZL 4QHKI 5HI4D 1YYML 1AH1A 4O9HH 4FQQB 4EVNB 4NSKB 4JRYD 4OZGB 3IU4L 5J1TC 5FKPB 3PJSA 4G5ZL 5IM7A 3CX5J 2EC9U 2W0FA 5L6YH 4E5XB 4HT1L 4ZDHB 1CT8A 1FNLA 3RDTD 5I17B 1CICA 4HIJA 5BVJB 2MPAL 1A7PL 1W0WB 2VNCA 3E8UH 3FQNA 4OLXL 2XZCL 1UVQB 4XCFH 1T83C 4KROD 1Z0MA 4G3YL 1F6AB 4OLZH 1TXKA 3DUSB 1RK0B 4NNYB 2X7LA 1J5OH 1IGIH 2BVYA 3OPZL 2ICWI 3BPNB 3FB7B 5D7KE 4NDMB 3HZMB 3C5ZA 5GRJH 3TT1L 3FFDB 4BQCA 4O2FA 3RZWA 4GAYA 1FZKA 1CL7I 1FG9C 3PV6A 1U8QB 1HQ4A 3L1OL 5E0QA 5JMOC 3PWLA 3VFMB 3CK0L 4WJ5B 2FEDD 1AR2A 5DK0A 3FO9A 2NW2B 5D7KD 3DTXB 5JPMB 5DMKB 1MY5A 3OAUL 4MD5B 4HJGB 5E6IA 4BFEA 3BRFA 1OPGL 4RIRB 4FXKA 2R56H 5IEHB 1JPFA 2QQNH 4ONFH 4ETQA 1DEEA 5E2VH 1JHTA 2VLKD 3GSUB 3B8YA 3ZL4L 2VXSH 1LE5A 3RUGF 5LJYH 1YEKH 3Q3GB 1JZ2A 4HUMB 4LPYA 2F8XC 1MEXL 4X8JB 2V17H 3ABZA 1XR9A 5EPMA 3LKRA 4GQPH 3O4LE 4OM0H 2X4NB 2GUOA 2X4PA 1F6FB 2XQYK 5DC0A 4EIZC 5I2IB 4IOIA 3RNKB 5E08L 5T3ZL 3HG1E 1UACL 4I0PC 5I19L 3CPLA 4PGDB 4WHYH 1A1OB 2R0LL 3GSWA 3O41B 3FB5B 1CZ8L 4WI6A 1RJLA 2Q7YA 5EBWA 3QJHA 5FO9A 4YDJA 4M5YL 4LIQL 4TSAH 3BO8B 1DE4A 3HG1D 2P8MA 3K2MC 4HMEA 3JWOC 1F58L 2YEZB 4ERSL 3D25B 4Y1AA 2OL3A 4JCLA 4XP5L 3KPSD 3BEVA 3MCLH 5I71B 3UAJC 4X7EC 4Z5RA 4IS6B 3FB6A 4P57B 4MHHI 1TLKA 3RVWC 4GRMB 1VFBA 3BIKB 3LZFL 4OI7A 4YDLC 1YPZE 3EFFB 5FYLD 5F6IB 4KZDH 3K8KA 1H5BC 5CJOH 4R26H 5D6CB 2ERJC 4OZ4B 2G5RA 1MJ8H 4X99A 4WY7H 3T65A 1QSFA 4LOUC 3ARGC 4HS6A 4LLVB 1RIHL 4R90H 4ZODA 4ZAKA 2RQ8A 2Z0BA 3LB6C 4NZUL 4XWOC 5ILTH 3QG6A 3HFMH 1X5JA 3ZHDA 3ZDXF 5IB1A 3VMOA 5BXFA 5C0JB 4V3EB 2PN5A 1FC2D 3OKEB 1AO7B 2AKRB 1JYNA 4DCQB 4TPRH 3KPLB 3TH3T 5EC1B 5D1XD 3SEPA 4PP2A 5BV7B 3HE7C 4PIRF 5GS2D 4G80A 1HQRB 4HULB 1EVTC 1NUFA 1YYLL 4XHJD 5AYUL 2Q3AA 1DVFA 3W82A 4PJIE 3GNML 1MLCA 3MV11 3GBML 4RRPG 2H32B 4IIQC 1FORL 3T0WA 2VDOH 3GRWH 4HK3N 4G9DB 5IFHL 1YZZA 5GHWL 4Y2DB 4MMZC 4HD9A 3TJEL 4O2CA 1C08B 1ZLSL 3WN5A 5IF0B 4PJ7A 2ZUSA 2P5EA 2BVPA 4RA0C 3TZVC 5HYSB 3V6ZA 2AERT 2BVQB 2JELH 1I7UB 3OR7A 1G7JB 4U6HA 4OV5A 4WUUE 4KKLD 2P8PA 1F90L 2K9UA 2CK0H 3ZDZE 4PJAF 4OCSH 4CNIB 3ECBB 4Z0XA 1KNOB 4ODHH 1JPSL 1KLGB 4JY5L 1W0YT 1OAZH 2AGJH 2E3VA 2FX9H 3QDHA 4PYHA 3RX5A 2D3VA 3I3BA 4FQHA 1NBZB 3CZJA 1RZGB 1NBYB 3CDFA 4JFYB 4WU7A 3FZUC 1FDLH 2GJ6D 1C7SA 5HHPA 2J88H 3HUJA 4KJWC 1F3DH 1QFUL 2R23A 3MRBA 4NGHL 4WUUD 1ED3B 5HI3C 2UZIL 3OHXA 4H1LG 1T0MB 4JPWL 4MJ5B 5TJWK 1JYVA 5LBSH 4DVRH 4PJ8D 1U95A 5JUEL 1TVBA 1GPOL 2AVGA 4R0LB 4U1KA 4DUVA 1H3VA 1NUDA 1QR1B 4LSDA 4PFEA 3S37X 2XG5A 4X6CF 5DJCA 5FUOL 3AY4A 4X7FC 3WJJA 4LEXL 1ADQH 3MMEB 4I9WE 4QHKJ 4YEEA 1A3RH 1CDJA 2X9WA 3LHPL 4XNXL 3RBGA 4YPGB 4XMLL 4GG6A 1T3FA 1V7NH 3RGVC 1DDHA 2NY0B 4Y4HD 3RWIA 4ZO7A 4JY6A 1OW0A 3TFKC 2FX7L 4U49A 3VW3L 4C4KT 2NY7L 3IDXH 1NCWH 3CSYA 4I9WD 1I9RH 3BISA 1IVLA 2XWJA 3I2CH 3CXHJ 3HPLB 1ORSB 5C08D 1WIOA 4GAJH 1HHJB 2P8LA 1QSVA 3IGAA 2FJGA 3RUGB 2AEQH 3QUYA 5C0IB 4H25B 3N85H 4OGYL 4L3EA 4NRYA 4RWYL 4UMGA 1QTYT 3SDCB 2CO6B 3VD9A 5C0CE 3QEUB 4TNWF 5I1EL 3EOBA 1U3YA 3I50H 5EIQA 2ICES 2GEEA 5E03A 1OGAE 3G6JE 1SYVA 5BMFL 1GGIL 1UWEH 2F8VA 5CJQL 4Q6IB 5BW7A 2D9CA 2VIRA 2R1WB 3MNWA 4LLDA 2ED7A 5EUOF 2N7AA 4KI5C 2YPLE 3QIUD 1PYWB 1S7VB 2I60L 5FGBA 2FX8L 5C0CD 4MD0A 1JZ3A 5DSCA 3O3BB 5IMLA 3PWPE 3H6JA 3H0TA 4MXQC 1K4CB 4I77L 3WFHB 4WGWB 5JQ6H 3UTZB 1BQHB 5TH2A 4I5BA 2JK5B 1ZLWK 4AM0B 2YPLD 4POUB 4XTRC 2P5WE 1DVFD 4P46B 3GSNL 3D3VB 1ODAA 1PSKL 5FA3A 1MRCL 1I9EA 3ZO0A 4OQ1A 1QRNE 3QIBA 5SWZD 5H35A 3NZHL 5FYJL 1UWXK 3C6LC 3P9LA 4QHMB 1DQQB 5GGTH 4OJFH 1QSEE 3M8OL 4M1GL 1Q0XL 5HGGS 1BLNB 2P5WD 3PABB 3WFDH 3IDYB 5DLML 2Q8BL 3LD8C 1UB5A 1MFEH 2PXYD 4XNMA 5MERB 5A2KH 5F88B 3QWQB 3U0WH 5KVGL 2FD6L 4L3AA 4MQXD 4X0KB 2AJVH 4CMMB 4Z0BH 1CE1H 1QSED 35C8H 3CFJB 2AJ3A 4RNRB 1MREH 1JTTA 4JFHE 4WVRA 5DI8A 3D1MC 3DVGB 2I25N 2ARJB 2P48B 2ICEA 5FCSH 1V7MH 3BT2H 1WZKA 3PP3K 4WHCA 4FFYL 1S7TA 3QXTA 2NY2D 1CFQA 1MH5A 4RQQA 4TNVF 4KY1H 4YWGL 2LTQC 4CVXA 5GXBB 4JFHD 3TYFB 1RZFH 4MXVE 5H94A 1YEEH 4HIHB 4ENEC 2P47B 3GSXB 5JDSA 5E9DA 2QHLA 1FFNB 2EYRA 1XZ0B 4FQ1L 3VWJB 2NCMA 1OSPH 2EYSA 1GZQA 3DX9B 3MOAH 5F9OL 1RHHA 2VDPL 3S37L 5DRXA 4KTYA 1FL5B 4PJAB 4D9RD 1Q9OB 2WBJA 2Z91A 3FRUB 4U1GC 1AE6H 4L3CB 5IHUH 5SWQB 1C5BL 2GKIA 2HN7B 4FTVA 4NHUA 1I9IL 2W9EH 4FG6C 4MHHG 3HMWH 2HA1A 4TVPE 5IB2B 4GRLD 4XP9L 5TGBB 3BP5B 5LGKA 4M7JH 3M1BB 1KCUL 1PFCA 1GAFH 3KDMB 5EBMA 3RY4A 4X4YB 5IB3A 3WO3B 1FL6B 4HGKC 4UI2A 3VXOB 1F2QA 3RNQA 4QRRA 5CD5D 1DANT 5ID0A 4TVPD 1P1ZA 1MHPL 3TVMB 5CEZL 4KMLB 4Y5XB 5D6DA 3VXRE 4P9ML 5KVEL 3WFBL 1VGKB 3P0VH 5IK3A 2VZ1A 4K55A 1MRDL 1NCUA 2ATPB 2NY3D 1JCKA 1BGXH 1A22B 4ZTPH 3LEXB 1KULA 3D85D 3R06B 4WI8A 3SPVA 3DSNA 5IHZA 4ODTH 3FQXB 4OLUH 1UQSA 4RMTA 1L7TH 1B0GA 3HZKB 4P59L 1NGXA 1CICC 3FFCE 2ADJA 2O5ZL 4FFZL 1I4FB 4I2XA 1ZANL 4YO0A 3ULUE 4Y4FB 4G8GB 4TRPH 3GSOB 2MSPA 3EYSL 4UQ3B 3FHAA 1AIFB 2AJXL 3GMOB 5EU7C 1EEYA 5CHNB 4LSTL 4PJCA 3MLSL 5JZ7D 2R0KL 3UDWA 2H26B 4ZXBD 4HJJL 4NKDA 3C5ZC 5F97E 5EO9A 3UPAA 3RKPA 1UH3A 4K7PY 4UDUA 3TO4B 5I75B 2VQTA 5LAXB 4NKOB 5CCKH 3RHWF 5EUOB 4LARH 1UJ3B 5ITFA 4PB9H 3DVNA 4I3GA 4HBCH 1INDH 3ELAT 4G6AD 3BN3B 5EORH 1JHKL 2QADC 4G8FA 1G7IA 3W9DA 1BVKB 3L5XH 4FP8H 3MGAA 1CTOA 5E6IC 1T6VN 4HKXA 5IROA 3BGAA 5E2TL 1UENA 1R3JB 3AROA 1J8KA 5BOPA 3VDBA 1EJOH 3QI9A 3R0NA 4JDZB 4LCWE 4MAYD 1AQDA 5FHBH 3GMRB 2A1WH 2N1KA 1FVCB 3GB7B 1OLZA 3WIIL 3CFCH 4HMCA 2BFVH 5T3ZE 5CZVH 3NZ8B 4YNYB 4XMKH 3SO3B 3VG0L 4RFOH 4EI6B 3EIFA 3ZKQD 4BH8B 2YXFA 4DEPC 2VDKH 1T1XA 1KPVB 2VN7A 1WEJH 5AAWA 3S5LG 1LEKA 2FO1A 2OP4H 3KR3L 1ZE3C 4BJLA 5BRZA 1T80A 1J0KA 5T3ZD 2ORBH 4K7PL 4WNQA 4OLEA 1C1EL 2J3SA 3IF1A 4O4YH 2JCCF 5DRZA 3ZE1E 1HYRC 3L3KA 3L7EB 5DDHA 2R1XA 2VAJA 4HKBB 4LSPH 2YUWA 2OYPA 4XPTL 1FGNH 2H2PC 1JGLL 5GSRA 3QXDA 2Y06L 5D2NB 5KZCB 2IBZY 3BZ4B 3MLWH 4C57C 2BNRB 2FRGP 2AV7B 2ED8A 3RDTA 3FN3A 2YMXL 1NDMA 2GSGB 5FFLA 5I18H 5DQDH 1HHKB 2KQNA 4KTDL 1NCAL 1CG9B 1IC1A 1RZJL 1L9MA 1HH9A 5CS7A 2Z93A 3WLBB 2NR6C 2OXHA 4NT6A 1A7BA 1FL3B 4C4KO 2R69L 1KEGH 4ZAKC 5I1KH 1J8HB 5D7JB 1F8TL 3KJ4C 1KB5A 4NO3B 5DO2C 3NFSL 4QOKB 3H7BA 4U1HA 1LEIB 2R1YB 5CEYB 3IAGC 3B9KB 1IGML 1KC5L 1QQDB 1YY8B 3UEZA 5I1CH 3MCKB 1U41A 4X6BA 2JB6B 5J3HD 5EO0B 4TUOA 4K3DH 2BP3A 1RHFA 3LCYA 1JGDA 3TC9A 4XX1G 4LNRB 1JPGA 5KJRH 4EEEA 4HGMA 3QNZB 1N3NB 4Z78B 1YDPB 4Z7NF 1MCQA 1MCRA 3U1SH 1TJIL 2P44B 2XV6B 4FNLH 4EN3B 1ZGLM 1A2YB 5E8EB 5FXCH 3FT2B 3QG7L 4U0QB 3WN5C 5KS9E 2F74A 4KXZI 2HH0H 2B1HH 5JOPE 2CKBL 5TQ2H 1PEWA 3FQUB 2ESVE 4NYLB 4KAQL 3JWOH 1XGUA 3QUMA 1G9NH 4Z77B 3DMMB 5MHSD 1DQDH 4LKXB 1CDHA 1N4XH 1DFBL 4YHYB 5GIRB 3SKNB 2WAHA 1QO3A 3O4LA 5JOPD 2GSIB 3PL6D 1U8OA 1R0AL 2OR8A 1I1CA 1I3RB 2VXQL 4MQ7B 4XBPB 2NW3A 3HG1A 4WHYG 5HGHA 5GJSH 2VLMD 3NPZB 5DD0L 2DI7A 1IM3B 1UKQA 1T2XA 5H8DA 4R2GD 5JW5B 3BIAX 4MJ6B 4I4WA 1OWWA 2I5YL 1I9JH 3ALXA 2HFTA 5E4EC 2IALA 3DXAB 5TDOA 4IRJD 1A6TA 2A2QT 1ZT1A 3AY4C 3MFGB 4UZGA 3WJJC 1ZWIB 1IGFH 3QUXD 5EU6B 2QQLH 3ZYJA 1MCLA 4FZ8H 3BEWA 1X4YA 1VEMA 3MOQA 1Q72H 1IAOB 5HGBB 1FV1B 4F8QA 1OW0C 1S9VA 5CBAA 3U36B 5IB5B 1JL8A 3SKMB 4R96B 5A40E 5I8CB 2OQJB 3CVHA 1YPZA 2E7MA 3DOSA 2R4RH 1JV5B 2DKMA 4FQ2L 4ALAL 5BZDA 3VG9B 1YN7B 4ODXB 4D0CB 2J6EL 5JXAL 1X5AA 3L7FB 3QUYC 4KRPB 5ACZB 2EKSB 1JMZA 5D1XA 4M6OL 4V2BA 3CNKA 3V4VL 4HWEH 5F1KC 5F7NC 2VH5H 3BH9B 3NTCL 4P2RB 3BDYH 1U91B 5GRZA 4MCZA 1HHHA 3O4OB 5BO1L 4IRZH 3SBWA 1NAMB 1A4KB 1X5XA 2ZJSL 5CGTA 5T5FH 3DGCR 5JMRA 3ZE0F 3CH1B 1WFOA 1RVFH 5BW7C 4GMSL 4HKZB 4PJHF 2YPKB 5DTFB 4HPYH 2RFXA 3MJ9L 4PJFE 3VWKD 3U0PA 4OZHF 2WUCH 2EE9A 5JIHA 1F3DJ 5D1ZB 5FGBC 1EK3A 4HAGA 4G9FB 1IAIM 3HI5H 2JCCB 2X1WL 3W81A 4LVNB 5T1KA 1CE6B 4YXKH 3L3GA 3NABH 2BERA 3CZFB 3DHJA 3TPUE 3BPCA 1NAKH 3VGAB 4PJIA 5L2JB 1T20B 5IW1B 4P2OA 7FABH 1QEWA 5C07E 1U58B 4P3DA 5T1DL 5FF6A 1OTTC 4KKCD 3T1FA 2WIIB 4FFEX 4OGZA 3QIBC 2XPGA 3D0VB 4WV1A 1JK8A 5EBLB 3PP4H 3WFEL 3ILQD 3IXTA 4WUUA 4D9QD 1ZV5A 3OX8B 4B5EA 3I3DA 3U7YL 4PJ8A 3MRJA 5FYJD 3O11B 5BVPH 4MNHA 4AG4H 4NNPH 2H1PL 2NZIA 4ZOBA 3ZT7A 1WAAE 3K3QA 4QHNB 1G1YA 2A9NL 4JHWH 4TN9A 4NIKB 2ZPKL 3GKWL 3SE3C 4TULH 3EGSA 3ZSTA 4K3EL 3QT2A 5AAMA 3PDOA 1H15B 2CPCA 3SDXB 2W9DL 2NY6D 5HVFB 25C8H 5ALBH 3MJ8B 4NO0D 4U6TA 4Y4HA 1CLZL 5D72H 1IEAA 1QBMH 3WLWD 5E00A 1P4LB 1NL0H 3VFTB 2XFXA 3ULVF 1A0QH 4Q58C 1LDPH 3LKQB 1ETZA 1OAQH 4M6MH 2R8SL 1Z3GL 1HHIB 1BP3B 3IXAA 5DUML 2ADIA 2D9QB 3LDBC 4A2MA 4DTGL 5K9QI 3N9GL 4LSSL 3K4DA 1OQOA 3MUZ1 3GSRB 1X5HA 1DBML 2V2WA 2AEQL 2XNAA 1A6UL 2LAAA 4DZBB 3C5JB 4A2LA 1EH9A 3W9EA 1T22A 3BYTA 1FCGA 5ID1B 3GMLA 4XNYL 3PHQA 1BWMA 3DIFB 1RZ7L 2WBJC 1GOFA 4OFYD 4J3XA 1RD6A 3O6FC 3NFPB 3HS0B 3MUJA 1NGZB 4JG1H 2EH7H 3GBLA 5F71A 1V05A 5IMMA 3DROB 5B39G 2FEEI 5C0CA 1HSAB 1ULVA 4XNUL 1FZOB 3V8OA 1W72A 3SKOA 4MA7H 4N5ED 2BSRB 4GG8B 1OGAA 1RUQL 3G6JA 3LQAC 2P43B 4QTHB 5CEZE 3HC3H 1U8HB 4UQ2B 5ACMA 2W07A 4OCWH 3SDAB 4BFIB 3ESUF 4HK3J 4BZ2L 1WT5A 2IAMD 3L9RA 5BV7L 1XGTA 2YBRA 3PWPA 4XCYB 5IVXA 3WBDA 1D3CA 2OR9L 5CEZD 4PG2A 4JN1L 3L3OB 4KQ4H 1GGCH 1XCQB 1IGYA 4DUXA 4HFUL 4MB3A 2ZG2A 5F9WC 2HKHL 2YKLL 2OTPA 3MRNB 4YFDB 2P5WA 1FJ1A 5C0BE 2NMSA 2Z35B 4N8VG 3ETBF 4NQUA 1NQBA 2IPUK 1KPRB 3JZ7A 1A6ZA 1R3KB 5ECJE 4LU5H 1QRNA 2BVOB 4J4PD 4JFEB 2DIBA 3W11D 1FIGH 2Y36H 2IQAB 4XCEB 3L3HB 2DD8L 1QSEA 5DD6A 5GZND 2B1AL 2D0HA 3GI9L 3EDDA 3VRJA 4LKCA 3I9GL 3UDWC 1HILB 1NC2B 5DJDB 3OXSA 3RWJB 4M7ZB 4PLJC 2B5IC 1R3LA 2BMKA 4D0DB 1AD0A 5DUBA 3SY0B 2AQ2A 5CKGA 12E8L 1SJEB 4NNXA 4Z7UB 1B4RA 4OZHB 2AI0H 1A3QA 3QPXL 3CC5B 3ESVF 3MR9A 1O0VA 3O2WH 4L8SB 4NO5B 4QTIH 5KN5B 4QCIA 5E8DH 7CGTA 2G5BB 4FQXC 3PNWA 3VD3A 1K2DB 4OZIB 4YDKH 1PKQB 2NY5L 4JZOB 5KSBE 1P69B 1A21A 1AXSB 1QNZL 3G9VA 1KN4H 4X9FA 3KHOA 4M6NL 3QI9C 3P4MB 43C9B 5E7FA 2OTUA 5C09E 5LVEA 3IKCB 2ZG1A 4JDTH 4L8BA 1XGYH 3QQ3B 3F7YA 3RKDC 5CD3A 5D1QD 1VCAA 4GRLA 2BX5A 2F53E 1G84A 1D9KB 5A3ID 2H2SC 2A0LD 1CFSB 3IVKB 1OAKL 1NMAH 1RFDH 3JV6B 1YEHH 4KTEL 4X6DE 1QPPA 5F96L 3IKKA 3NIFF 5C09D 4KK6C 2R2CA 5F7MC 1C5CH 1CGYA 2DDQH 5A16B 1J0HA 4NQTA 2XTJE 2AJYL 2F53D 4P9HL 3H7LA 1A6VH 3CLFH 4F58L 1FAKT 2UZYB 3WO4B 3CUPA 4K9EL 3LEVH 1IKFH 4KGJA 1UA6H 5IEKA 1PQZB 4MMXC 4Z8FH 2NXZB 1U8MB 3AC0A 4J3VA 3UC0L 4YGVB 3QWOB 3INUH 1IM9D 2XTJD 3GZKA 3KPOA 5HI4C 3VXRA 1SY6L 4HCRL 4S1SH 2EC9T 3ARBD 4NCC2 4G7VL 4CN6A 4PTUA 3ARVA 1FG2A 1AC0A 3B9EA 5DEFB 2DBLH 2MOVA 5IB4B 3JV4B 2FJFB 4YC2C 3RDTC 3ZTJH 4U6VH 3CDGA 3V9FA 4C59B 1TZHB 3MYJB 1U0QA 1TTUA 3KPPB 5I1DA 1E6OL 2NXYD 5AZ2H 5HDQH 4MQSB 2X09A 5MI0C 1F4YH 5C3LD 1DZBA 4ZXBA 4DFIA 1P6AB 5IP4A 1JUFA 3FFCA 4QRQA 3DX7A 4WWKD 4UTAH 2HJFB 4WEBL 1MFNA 1NSNL 2JIXD 3C09C 2XQBL 3UTPD 3MRQB 2WWMD 3MRCA 4DGYH 3QZWB 4ZUTB 1UWGL 4H20L 4HWBA 1SJHB 3CSBA 4UT9H 3CFKA 1QR4A 1CBVH 2B2XH 2FEDC 5C8JA 5HVHC 4DZ8B 3SE9L 2FWOB 4BH7A 5J11C 1XF2A 2HG5B 2JB5L 4UOW1 3E6HB 2HFGH 4G6JH 5D5ME 4G6MH 5E24E 2X70B 5J6HB 3RU8L 2CKNA 2J8UF 4LHUG 3TT3H 4O51A 3CX2A 3QUZD 4D0BB 2O5XL 1ES0A 4MAYA 1OD9A 2Q76B 3HRPA 3TBSA 5DD1H 1CXEA 2Y07L 2FL5B 3EOTL 4UAOC 3ZDYF 5ICXB 5FGCB 3P73B 1QFWM 5BQ7A 4WENB 1T5WA 1O7VA 3Q6FA 1ZLVK 3MLPA 1KJ2H 2XN9B 4LGSB 4LCWA 4PJGE 5IMOB 2OL3H 2R0ZH 4U1SB 4E41E 1FNAA 1P7QD 3T2OA 4BUGA 3ROOA 5C7XH 2ZOLA 4LLQA 2XYCA 1Q9WB 4P5MB 4Y89A 1G6RB 4J1UB 1J1PL 2YC1A 1PG7X 3M07A 1KTKE 1HH6B 3X13B 5K9QG 3VH8G 2LABA 2SEBA 3BP6B 3MUY1 1LP9E 4MVBA 3CGTA 2FZ3B 2EDYA 2FH6A 2IFFL 4DFHA 3BKJL 4LPUA 1HOCA 3T2QA 1KCKA 1Z6JT 3PHOA 4XNQB 3MSPA 1JNNH 4CVZB 4HIIB 1KXVC 4JRXB 4LSRL 4U7SA 3NA9L 4TOYL 3VFWB 4JEGB 1NCBL 2GAZB 4J8RB 3O9WB 4P23D 3RWGA 4ZFOB 2VLRD 4PJXB 3MLWL 2C26A 4GQ9H 2WIMA 2X5PA 3QEQE 4HH9B 1K85A 3C2AH 4G42B 4NN6C 1JWMB 2Q3ZA 3SKJH 3VGGA 3N1MC 3MREA 1QBLH 4RDQG 3U2SA 2PW1B 3DV4B 1YEJL 3BKYL 3RWCB 4LQFH 1OD7A 1MJJA 4OZGE 2A6IB 3TCLB 5D7SL 3CD4A 1OP5K 3AREB 1P6FA 2VDNL 5D1XC 2FJHA 3X3FH 3BVNB 2A6DB 5L9DH 1LO5A 5I76B 1N7MH 3RL1A 1S3KH 4YXLH 3SBWC 1MCCA 1CGWA 5F1IB 3NIGE 4X5WA 4XCNB 2L0DA 4XHJC 4N8VB 3EO1A 1AGBB 1ZHLB 4JFQB 3ARWA 4MGXA 1BM3L 4CU7A 4XAKE 1HN1A 5GRVK 4OZFH 5C0NC 1U42A 4M02A 3L6FA 4M3KB 2B39A 5DJAA 1T1ZA 1DQLL 1RZ8A 3G5YB 4LRIA 4QT5B 3UBXA 4PJDB 5EOTB 2EECA 3S3SA 5E1AB 4KV5E 5B3NA 3UP1A 2FECL 2YD8A 4KKLC 5JO5A 5ESQA 3V7MA 1JNLL 4D2NA 2W0LA 4JGMA 3LH2L 4AT6A 1RZKL 3QCTL 4U0RB 4YAQA 5EA0H 3GI8H 1U8NA 3STLB 4XXDB 3O3EB 4NN5C 3LY6A 5KS9A 1RZIA 3QHZL 4DOHE 5C0AB 2LU3A 4WV1C 3FQRB 4JG0L 4PS4L 4UU9A 3K4AA 2ESVA 2G75B 4L4TB 4ZUWA 1S9YA 1D6VL 2GK2A 4ZS6C 5CWSB 4PJ8C 5GJSL 3IDIB 4HGWB 1NGPH 4OT1H 3CU1A 4Q2ZB 4ZUSA 1NBVL 1YNLH 5D7IF 2CLZA 2DJUA 3X3GL 5LG1A 3RA7H 1VADB 4P2QB 4FQLH 4WU5B 1BVLB 1CLOL 3ORJA 5TE6L 2V9RA 3Q1SH 4XB8A 1SJVA 1EO8L 5KTEL 2DQEL 2C7UB 4Y4HC 4AIZB 5I66B 2D7NA 1IGCL 5HJ3A 4UINH 4JM4L 4J3SA 3S88L 2GITA 3O3UN 5E99H 2ZCLL 2P7TA 2XQYG 2O5YL 2A9ML 4JFFD 4O58H 4FABL 4Q9QL 1FH5L 3KJ6H 2X4SB 5GISH 2J8UB 2XZZA 1PG7L 4HK0B 3OJ2C 3V4PH 4RZCA 3MRHB 5D9SB 2VXVH 4M5ZH 2NQCA 1UM5L 4QRTA 5IR1B 2F5BL 5E5RB 1KBGL 4K23L 4KVCH 4Y2OA 1AC6A 3OZ9L 3WFZA 5CSZA 4UUJB 4GSDL 4QYOB 3BW9A 3HLAA 3S3PA 2Q86A 4XWGL 2EDRA 2UWEE 1HEZB 2WSKA 3I02B 3RWFA 3K8MA 3O2DH 1IKNC 2OLDA 2V9QA 5DJXB 4M61A 5ESVA 2BC4A 4F7EA 4LVHC 5ENWB 5DJZA 4UDTA 4MD4B 5KG9A 2CJUL 4HS3A 1KYOK 4UOJA 3UTSD 2HMID 3O6LH 2CRMA 2VB5A 3FTGA 3QEHA 3GBNH 3BXNB 1EHNA 3AS2A 1XGPB 4PJFA