5D5ME

Structure of human mr1-5-op-ru in complex with human mait m33.64 tcr
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
200
structure length
200
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVMDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 46
structure length 200
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d5mE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d5mE02
1T2JA 1UYWL 3KHQA 3VI4F 2FECI 1FNSL 5KVFL 5E7FA 3ELAT 5DFTA 4AQ1B 3L3HB 3B6SB 4Y88A 3ULUH 4ERSH 3SE3A 2JIXA 1YN7A 3NAAL 5L6YH 4X4YA 1MLBB 4KK9D 5HYSG 4XVUC 1CICB 1KEMH 3WDHA 2CIIA 2QQNL 5DFVC 3UPCA 4AH2A 4NO3B 3NH7H 1OGAA 3CIQA 4HEME 3BP6A 3U79A 2IADB 5D1ZC 3MRLA 1GOGA 5T1KD 2W9EH 5EUKB 3RIAK 1A2YA 1IEAA 5HI4D 3LS4H 1QPPA 3Q48A 3SDAB 8FABA 4HC1H 5EU6E 1S7QA 4L5FH 2XN9E 4HMDA 1QSFE 3BPCA 1A47A 3QZWA 3QQ3B 4L8BB 1IQDB 3MBEC 1CE1H 2DQTL 2ARWA 2W0KA 5DVNA 5C0AE 1K6QL 4EXKA 2I9TB 3OR6B 3MBEA 3O4LD 3P2TA 4OQTH 3ES6A 1FV1A 1MVUB 4M9OA 1OP9A 3C9NA 3UTPD 1YYLH 3CD4A 4WTXA 5D93B 5LGKA 3S37L 3OKDA 3PABB 4RZCA 3OF6D 3LZFH 1B0RB 4Y4HC 4Z7UF 3RX8A 3GSXB 2IPKB 1CLOL 3A6CL 4BZYA 5EIQA 3X3FH 1AKJB 5JW4Q 4M4RA 5J6GA 4KVCL 2P7TB 3S34L 1WBZA 1WTLA 4PREA 4QOKB 5ISZB 1S9XA 3VFOA 1K8IA 5C1MB 2JELL 4XX1G 1EBAA 1UM5H 5H2BA 5L2JB 2XZZA 5TH2A 2FATL 5K59E 1QEWA 2BVOA 3WUWB 3ULUD 1MH5B 3TBSB 4LSRL 2F53E 1P4BH 4NJ9L 3HE7C 3KYMB 2YSSB 5L2KB 2EXYD 2GY7B 1YEKL 5C2BL 3HE7A 4XPGH 3H2WA 2ICES 2YXMA 2Z4QA 4RQQA 5CINL 5DUMH 5IK3B 4APQA 3DX8B 4WW1B 3PNWA 4UOW1 2A6DA 3ARFA 3QUMA 4RFOH 1G7LA 1CFSA 1M71B 3N85L 1CN4A 1QPXA 4K9EH 3QRGL 3MJ8B 4AH2B 1YY9C 1ZMYA 3GMQA 1GPOH 1GZQB 3E2HC 3NCFB 4S2SB 3BP6B 2DWDB 3O8XD 3MRLB 3QCUH 5CP3H 1P6FA 4HWBH 1Y0LA 4OD2A 4DWHA 5JR1H 3S35X 5C0JB 1JZ8A 5ELIA 5CWSA 3S8WA 1S7QB 1N0XH 4DKFH 5MI0C 2FX8L 3BPCB 3QQ3A 1FSKB 3QZWB 2Z35B 1HHHB 5DHYB 4GRMB 3NFSL 1ZLVH 3GEWB 4HUMB 4XAKE 3WUZA 4ZSOA 4Y19D 5CHNB 5FGBA 1LDPL 3ES6B 2FYYB 4M8QA 3QIUD 3KPQA 3L3OB 3DYPA 3OKMA 4HGWB 1A6PA 2AJUH 1NAKL 4HC1L 2NY0D 1DP0A 2DYPA 2H2SD 2AK1L 3MR9A 3NACH 3T0VA 4BFEA 5ILTL 1WWWX 5EORH 3UTQB 1NAMB 4KTEL 1TCRA 2EYSB 5I1GL 1FPTH 2BVYA 5TH2B 3Q1SL 4JFPB 2YKLH 5D1QD 4DTGL 4LSSH 2BVOB 1MH5A 1ZTXH 4S1QH 1A64A 1BZ7B 3MUHL 2HG5B 1WAAA 4ZTOL 4U6YA 3HG1B 2MPAL 4X4MA 4UQ2B 2IQ9H 4U4BA 4LEXH 3M8OH 1YEFH 4ERSL 4OGYH 1R3LA 1AD9B 5DVLA 5T1LD 4XCNB 2MHAA 4PRPD 2FHBA 3VWKD 5EU6A 1CDGA 1JPTH 3QUMB 4ZD3H 2VABA 5EOQL 5C0AA 3JSSA 1NLBL 1CVSC 1CXEA 4J3TA 3MV7B 1CD0A 3KG5A 2DWDA 3HB3D 5E99L 2JCCB 2EEDA 5EBLA 3BPLC 4X6EA 5CWSB 2ESVD 1VPOL 4XP4H 1HOCB 2Y36L 2CIKB 2NY7H 3B9VA 3KPPB 3S36H 3U46B 3F6IA 3QEGL 3D9AH 5SWSA 4J6RL 4NPYB 5JXEA 1LP9F 5D8JL 4C57C 3NPSC 4WFFE 4WTZG 1LE5B 5FYLD 3P73A 3D0VA 4JRWA 1RIHL 2C1PB 4LCUB 3BQUA 4H88L 4AL8H 5KG9A 4KDTC 3CXDH 4EDWL 5D2NC 3BAEL 2Q3AA 3UTQA 2VISA 2EYSA 4QY8A 1HILA 2XQYK 2XQYG 1QFUL 3S34H 3CU1A 3CLEL 2E7BA 3GI8L 2ORBL 4R96A 4XWOC 1R24A 1A1NB 4H20L 3SKMB 4G8GE 2D7TH 3A6BL 1YPZE 1FZOA 5E4EB 2XT1B 1PLGL 1MPAH 1I85C 2J2ZA 2B4CL 4PJGF 3ZTJH 5DEFA 5EO0B 3MACL 3MLWH 3VXSE 4PG2C 2F53D 2ZUQC 3VFTB 5ESVA 5FKPB 1MFAL 4Y5VB 4DFIA 4M6NL 5AD0B 3QIBC 1EH9A 1KT2A 3OKEB 3ARBC 1CS6A 5L88H 1UZ8B 4U1GB 3MFGB 4MDIB 1KEGL 2P8MB 5HDQH 1DBJL 3CGTA 3CFEA 3GBMH 3I6LD 1F42A 1HQ4B 4Y5XC 5KVGL 1FRGH 1EFXB 2B1AH 2VXTL 1P7HL 2CLVB 4Z7VB 1S8DB 1CGVA 4Z7WE 3HAEH 5EBLB 3HR6A 4D9RD 1TVBB 5EC2A 4GUPB 4JPIA 2HN7A 4NRXB 4UV7H 3X14B 1J5OL 1ND0B 4PB0H 4ONGH 3KPTA 3U46A 4PR5B 2H8PA 1JJUA 1DQTA 4NPYA 5JW3L 5KS9A 1HI6A 1QR1B 1LE5A 3VXTA 3KLAB 3UZQA 1S7SB 4YUEL 4N9OB 2UYLB 4C83B 1D5BB 3P4LA 2R4RH 3EZ8A 5T3ZH 1KEGH 2EIEA 5DRWA 2I60L 3FKUS 5DMGC 4U1JB 3T0BA 3O4OB 3TT3H 5KG9B 4I4WA 3S4SA 1JCKA 5TF0A 1MRDL 3BZFB 2EDHA 4CDHA 2WWKT 1N6QH 1OW0C 5F7LB 4XVTL 4UDUA 4LCWA 4QY8B 2APVA 2VAAA 2VSDA 1QYGL 4YHOL 1P5UA 1XGPA 1LK3L 5D7LD 5M95B 5FM5M 5I1KH 5IFHL 2X1WL 4XHQA 3W0WA 2D4DA 4KJWC 4WEUD 4XNUH 2NY2C 1RJZB 1BQHG 1Z5LB 1T3FB 3TO4C 4RWYL 1DN0B 1PG7X 3BJLA 1ZLUH 2BVUA 2YWYA 1YPZF 3FN0L 3NPSB 3FQXA 4P5MA 3BAEH 4XTRD 5E6ZA 5FXCH 2GIYA 5SWZD 2AERT 4MQ7A 4FTVA 4Z76A 1NEUA 1DBAH 4HV8A 4PRIE 4PV9A 2XWTA 4XMLH 2DN7A 4BSWB 3EFFA 3M8OL 5FKAB 3QNYA 4NBXB 4J12A 2OL3A 2DDQL 4HBQA 1OAQL 5HBBA 1GGIL 5F88A 2V2WA 2DJSA 4FN0A 1T04B 2JJTA 4PGEA 3EW3B 5I1DA 3RZCB 3HNTL 1DL7L 5HVHC 1BVKB 1ND0A 5HYJD 4DAGL 2FBJH 4QXGH 1RK1A 2COQA 3FB5B 4EUPG 1SJXA 5D6CA 5KS9B 1EGJA 2AEQH 3MV7E 3HCVB 3WJJA 3LQAH 3M17B 4LFHD 1VSCA 1NC4D 4RAUB 1EVUA 4W68A 5SWQA 5A3IC 5HTSA 5KN5A 5GGSA 3WNMA 2J4WL 2DQCH 3PIQB 4P4RB 2DLIA 2XWBA 4I4WB 1NGZA 1OP5K 1MEXL 3LKNB 4PJBF 4AJ0A 4BQBA 4O4YH 2GITA 4QWWD 5DJYB 4CNIB 5DXWA 4JG0L 2IQ9L 5DJDB 5JZ7D 1HYRC 5EU7C 1P4LA 4GFTB 4S1RH 4G9FA 1WT5C 4QGTA 3KXFD 2QHRL 3GI9L 3RRQA 1OGTB 1RJZA 1MCPH 2FECL 3NZ8B 1U8PB 3VA6A 4PTTB 3HS0B 3S96A 4DAGH 5IHZA 3RIAF 1BLNA 3M1BA 5I1JH 1JI1A 3FN3A 4OCNC 5BMFL 3NIGE 2XZCH 5HGAA 3O9WB 1OT2A 3KS0H 4V2CB 4OCSL 4UT7H 5JOPE 3O11B 1E0OB 3PL6A 1PW3A 1WC7B 2Y6SD 4X5XB 4UOW0 3VRIA 4JFOB 4IS6A 3BKML 2V2WB 3I6GB 3RBSA 1T04A 3QXUA 4L4JA 4PJCB 1MY5A 1GH7A 4PJ8B 3RZCA 4KK8D 4UZGA 3MNVB 4RDQG 5F3HA 2NY2B 1J8HA 4N5ED 2ILLA 3ZHDA 4GW1B 3K8KA 2X1OA 2DL9A 5EWIL 4LPYA 3FB5A 2QSQA 1WCBA 4I2XA 4ODXB 3V5HA 3WIFA 5ADPH 3MV9E 1AD0A 4G80A 1XCQB 2NZIA 3MUGB 4WV1B 5TPWH 3V6FA 5GS0L 1IGML 2ATPB 2F9BT 1WIPA 4GAGL 2EKSA 3CNKA 4JHWL 5KN5B 3O4OC 2BRRH 3L3IB 5CJ5A 1N6QL 5FEBA 4FQ2L 3ECBA 2GITB 4DZBA 3ESUF 3VXPB 3ILPA 1VACB 2BCKB 2MTPA 1C08B 4FTVE 2NW3B 3LS4L 1NMBH 4HKZA 5ACMA 4PRDB 4Y5YA 1TZIA 5H35A 4OD3L 2VLRB 4TULH 3P4NA 1HCFX 1I8KA 1A6ZA 2I5YL 4TNVK 2UV3A 3O9WD 1NGWA 4BFBD 1E4WH 3NZ8A 2XZQL 2N7BA 1BIIA 1Q0YL 1LDSA 5DWUL 4G6AD 1X5KA 1YUHA 4OZFG 1A9EA 1RURL 3NAAH 5L6YL 4RGMB 1NCAH 2GFBB 3QO0A 1MAMH 3UZVB 4MZ2A 4ZO9A 2YUWA 4JRYA 4N5EC 4E42B 4H1LH 2R4SH 3GKWH 5F21B 5T1DH 4KK8C 2IH3B 1DLFL 4GRWE 4RSVA 2YD9A 3N1GC 2IADA 4Y19B 3DO3A 2CLRA 2IGFH 4GAYA 1FZKB 4RMQA 1S5IL 2YBRA 2DBLL 5FUZH 3F65A 1LD9B 1BFSA 4JN2A 4LASL 5T3ZD 3VFUA 1HNFA 1RZFH 8FABB 2VTFA 1LO5A 3EO9H 1K5NA 2PW1A 1CZ8L 2BC4A 4OV5A 4D94A 3DMMD 5GS1B 2MSPA 3OR6A 4YHNB 4YDKL 2PYFB 5JUEH 1OSZA 1I8MA 4P2QB 1AD0B 4FXGB 4NZDA 2BVPB 3ZYJA 1QO3B 3TIDA 5JOFA 4YE4L 4WFEE 3LY6A 5DD5L 3AC0A 2CKNA 4PJXB 1AC0A 3OKDB 3PABA 3U6RB 4MAYD 4KWUA 1CR9L 1VEOA 2Z91A 3ARVA 2OK0L 3RZWA 5TE4L 3ECBB 1MFCL 4RMRA 2MCG1 4QOKA 5ISZA 1GC1H 1VACA 5A2FA 4WJ5A 2GSGB 1KN2H 4ELMB 4PRDA 5H35B 1PZUB 4JVWA 2OJZL 3TA3A 2D31A 3CUPA 3DGCR 2H26A 3BXNA 4WGWB 1T0PB 4KJYB 4ORZC 5TQ0H 4YHMH 4F9LA 1BIIB 1IGYB 3GSNH 4WNQA 2OCFD 3TT1H 3V52L 1TZGH 4M5YH 1YUHB 1AQKH 1CGUA 5DQDL 1AE6H 4AEIH 5EZOL 1KYOK 4ZOCA 3DECA 2FJFB 1RMFH 2LTQC 4HKBB 2FWOA 4JRYB 4EN3B 3B3IA 2UY6A 2OI9B 4OF5A 3ILQD 3LEVH 1A21A 3FTGA 3MJ8A 5CD3A 4JM2C 3B9EA 3GJEA 5I74C 2BNQE 4QHNB 1MLCA 4P4KA 5ICYA 5GXBB 3V6OE 4GAYB 4M48L 5I19H 1Y0LB 3N1PC 4OD2B 4LGRB 5KSBE 3QYCA 2RAMA 2JB5L 4IDJH 3GNML 1IAIM 1RZKC 2MWCA 1FYTE 4HCRA 3RWFB 1Y6MR 4JQIL 1EHXA 3FO1A 3L3DA 2FO4A 5BS0A 4P2QA 1G9ML 1FVEA 1VGEL 2UZXB 5GRUL 4R97C 5C08B 4KVNH 3K1DA 5IF0A 5GZOC 5FUOH 3TNMB 3C5JA 3U6RA 5CP7A 3QXVA 1F3RB 3BDBA 1IILE 1QHPA 5E6ID 2DYPB 1Q9WA 2P47B 2AK1H 4XVSH 4OCWL 3RBGA 2WBWB 4BFIB 3BSZH 1MCLA 3V0WH 2A83A 4Y5XA 4ELMA 3U2SA 3S5LG 3MCKB 1WSST 4P48A 5DSCB 1CD1A 5J12C 1ZA3B 5EBGA 3L9RB 2D31B 4GAGH 1KPVB 2CKBH 2Q8AH 2FEDC 5HYQA 1CGYA 5F1OB 4MMZC 4U6YB 4UQ2A 3GO1H 4D3CL 3MX0A 4NQUA 1NH6A 2DTML 4WV1C 5CGMA 1DTUA 1F2XK 4I3SL 2MHAB 2OZ4H 4FFYH 8CGTA 3SHSA 4GBXD 5C0EA 3KJ6L 1X3DA 3O4LA 4HKBA 4U6XA 2XZAL 1DANU 4ZTPL 5IW3A 1CU4H 1U8KA 5DK2A 3BEWB 3GO1L 2VZTA 3GSQB 4FXLA 4HK3N 3W11C 1MUJB 4GXUN 1MRCL 1NGPH 4BZ2H 2KUTA 4XCFH 3KPLB 4NZTH 2DQUH 2ZUQB 1FNGA 3QJHA 4YK4C 1T1XA 2EC9T 5D7JC 3MGOB 1FP5A 4TOYL 4QNPF 3QI9D 4UAOB 3S35L 1HOCA 5D71L 5KVEH 3KPPA 4K71C 4LLVA 1YMMB 3O6LH 2W9DH 2CJUL 2DQUL 5SWSB 1MCSA 2AGJL 3CH8A 4NJ9H 4RA0C 2B2XL 3FO1B 2YPKB 2X42A 1QUNA 4ETQB 2DLGA 4MJ5B 4I5BA 4GW4A 3T4AA 1UM4L 4Y0GA 4HX1B 3D0VB 3IFPA 1F4AA 4LCUA 3TNMA 1VGEH 3LRSB 1FIGL 4KJPD 3W9EA 3V6BR 1WZ1H 3V4UL 3ULSA 1BVZA 3QXDA 1EJOL 4IRSD 2I25N 1U3HA 3U2SB 3UBXB 1WFOA 4GRWH 4RAVA 3LPGA 4JFZL 1ZLVK 2FX9H 1T5WA 3M07A 3W2DL 2FHFA 1CGWA 5D1XD 1I7UA 5DEFB 1U91B 4WVRA 3KR3H 4AQOA 2ZSWA 3QEUB 3SQBA 3CH1B 3WUWG 4U49A 5J56B 5AD0A 4UU9A 3TBWB 5HJ3B 3OB0H 5IWLC 3MRBB 2VC2L 3WMSA 3K81A 5FGCB 3RVWC 3CSGA 3VI4E 2P8LA 2FD6H 5HI5C 2AEWA 4LCWD 3GM8A 1II4E 2X4UB 1F00I 4L3CB 4YHML 5GGUA 5FOJA 2XPGB 3REWA 1HQ4A 5SV3A 1JMZA 3MLXH 1ZLUK 3IAGC 3V7AE 5C7XH 2F8XC 3IJYA 4J3SA 4AT6B 1GRWA 5E8NB 1MWAL 2MQ0A 3SDDD 2HN7B 1RFDL 3X14A 1GC1L 3U4BH 3V0VB 4XXDB 3LRGA 2G75B 4PR5A 3T77A 4O2CA 2IBBA 1HHIA 4B7LA 1FNFA 2UWEA 3TH3T 3D3VE 4D2NA 1S7SA 1T1WA 1R3HB 2CKBB 5C6PB 1TJGH 1LNUA 5LXGH 1UA6H 3QDAA 4FNLL 3IXTB 2ICWI 5DRWB 2PYED 3W9EB 5CILL 3NGBC 1JPST 2IPUG 2D9QB 4C55A 1MCBA 3V52H 5JTWA 2P8PB 5FOBA 1S9WA 1PG7W 2JCCF 1EA9C 4X7DC 5BV7H 4FNLH 3UBXA 4XNYL 4RAVB 2DKSA 1FLRL 9CGTA 4CN4A 3NIFE 4Y16C 5T3ZL 3W0WB 4YIQA 2A6IB 1FE8H 3QUKB 1DLFH 4ZUVA 5HHPA 3QIUC 4P5MB 4PPTA 3SKUD 3T0DA 4UU9B 1MCWW 1IM3B 5C0BA 4YGVA 2C7UA 2GK0A 1IKNC 1D7FA 2P8LB 3JZ7A 5EO1B 2XWTB 5DJ2B 1MFEL 2XI9A 4Z7VF 2VQ1B 1KBGL 5C0DB 2FSEB 4K94H 3BZ4B 3HMXA 5CBAB 4P23B 2RCSH 1PX4A 5KANG 3VJ6A 1MCRA 3X3GH 1LO4L 5E8NA 3OHXB 4K2UH 1IARB 1YJDC 4HPOL 2IFFL 3G9VA 1F4YH 2VJXA 4WHYG 2YMXL 3QI9B 1G7MB 5D1QB 4XXDA 5GGRY 3DVNA 4O2CB 1HHIB 1SM3L 2DS4A 5E2VL 5IVXF 3O3UN 3MRHA 3HI1A 3MACH 3MLWL 3WDIA 1WJ3A 3LRHA 3MZGB 3CFJB 4NZUH 3GJFB 4K94L 5I6XB 1KCKA 1UACL 4KKLC 4WUKH 2X9WA 4D9QD 1QBLH 2VLLB 2J8UF 2GT9B 4FFVC 3SY0A 1KF9B 3MRPA 2NXZB 4HXAL 1FNLA 5FOBB 3O3BA 2FEEI 2PN5A 3B9DA 1O7SA 3VRLE 4OB5L 4YDLC 3VXRE 4OKDA 3FT2B 1MCIA 5ETUB 2HRPL 3G6JB 2CR3A 3QUZB 5KW9H 1F6FB 4ODHL 4TSAH 5IHZB 2G2RB 4P59H 5HHPB 1R0AL 2XA3A 5HYSA 1T5XB 4YXLL 3WFEH 1DQML 1JHLH 3RNKB 1OQOA 1HSAA 3O9WA 1I8LA 2W59A 3ZKSD 1UXWB 5DHVA 4O58L 1MFNA 2HJKA 3D3VA 1WC7A 4HKXA 3PQYE 5TFSH 1GHFH 4OZFH 3MUY1 5JHDE 2HKHH 3RTQC 4PJCA 5EOQH 1MCWM 2ZCKL 1MREH 5I1LB 2BSSB 3OHXA 3DJ9A 1BQHA 4NCDA 5EZJB 5IB3A 4LKCB 4MAYB 4LCCC 3RL1A 3EDJA 2GJZB 4LDEB 5B4MC 4WDIB 1DQJA 1HXYA 2YN3A 4I2XB 2J4WH 1AXIB 2CKBL 2BY2A 4L4VD 4ODXA 5F6HJ 2Q8AL 1HHGA 1RD6A 2E8YA 3MRHB 4G80B 1HINH 4PGZA 3IKCA 1LEGB 2F53B 5FYJL 2YRPA 3AUVA 3BI9X 4Q9BA 5HI3D 2X1PA 1BJ1H 4Y4FC 4HIJA 3L3IA 4QRPE 4NO0D 3C6LC 4KDWA 1K85A 4H8WH 5IGXH 1OSPL 1YYML 1D6VH 2LU3A 2EH8L 4HUUB 4EOWH 1PKQA 5E2WL 3QEQE 3O3BB 1XGRA 2GJJA 2P44B 3HHRB 3L6FB 4YFDB 5KS9E 1YEJH 2F5BH 2X7LB 4LPUA 4XMPH 1DANT 3B2VL 5IMLB 1NAKH 4FQLL 5IROC 4IHOA 1Y6KR 1JK8B 2X10A 2PXYC 3L1OL 4OZHF 1OAQH 1A8JH 3IGAA 1A4JA 1Q72H 2IQAA 4C54A 4FQQA 3BP5A 5GGTH 3QIUA 4Z18A 2XTJB 3RGVA 1EEYA 2EYRB 4LLQA 3ILQC 3LEYH 1FC2D 2JJSC 25C8H 3T0EB 3QHZH 4ZPVA 3V5KA 3K2MC 4LCWE 1R3IL 3EUUA 1P4IL 2GFBA 3PWLB 3QO0B 1XGTA 4JN1H 1TTFA 5GGTL 5IB4B 5DHVB 3MO1B 3W0WE 1OAKL 4WRLA 2NPLX 5D7IF 4D8PA 3D3VB 1VA9A 1NCUA 1A4KB 4L4VB 2APBA 2I24N 1JWUB 4FQCH 4AEIL 4M4PA 5KSUA 1TZGL 4R4ND 5F7NC 2GTZA 3E3QE 2ICWB 3MRRA 2PW1B 4OV5B 1E4XI 3CCHB 5E6IB 4YHNA 3MRJA 4WHCA 4X0KB 3CZFB 1F3DJ 3DSFL 4G5ZH 3N1QC 2BY0A 4W4NA 4FXGA 2P5EE 4OQ1A 1QO3A 3TIDB 4DN3H 5JOFB 1UXSA 3IKCB 3GB7A 4PJXA 4GKOA 1LMKA 1KN2L 4YNYA 3BT2L 4MD5B 4EDXA 3IU4H 12E8L 3L3KA 2BK8A 1RUAH 4N1HB 1UM5L 4F3FA 3PXJA 4P4KC 1PKQB 1XR8A 2CUMA 4P49A 4UV7L 4WJ5B 2O5YL 3TPKA 3BGFB 4KPHH 1CF8L 3RL2B 3IVKA 2ZOKA 3MLZL 4MXQC 4DFHA 5KSAB 4Z8FH 3KNBB 4ZXBD 3U1SL 1MIEL 3TA3B 4YWGH 3CUPB 1T1ZA 3DVGB 1N4XH 4UILH 4HUWA 3BP5B 2WBKA 1JF1B 5GSRB 1A14L 4P57B 5BQ7A 1ERNA 3P9MA 4XAWL 3VI3E 1J88A 4LLQB 3HE6D 3V6ZA 3T0EA 1A7QL 4XP5H 4L5FL 4EQ2A 5I76B 1JGUL 1S3KL 3WEXB 2FJFA 1JN6A 4JREB 4LAQL 3RY5A 3CFIC 3HAEA 2K1MA 4F80A 3X3GL 4CMMB 1U92A 3PWVA 5F96H 3O45B 4OCLC 4ZSOE 4YHLL 1RJYB 3NCMA 3GJEB 1A4KA 4MJ6B 4LSPH 2AV7B 3GSWB 4QHNA 4DW2L 2EYTA 1MI5B 1U8MA 2ESVE 1QQDB 3H9SE 4K7FA 1Q1JH 1CT8B 5C0GB 1G9NH 4GMSL 4HMEA 1JGVH 1PD6A 1G7PB 3EGSA 2E7MA 2GTZB 1MWAA 2NZ9D 1QVOB 1F4XL 4R3SA 2AEIT 4KK6C 4N0FA 1FRGL 2E9WA 2VXTH 4HIHA 4LSPL 1X6LA 1NMCC 3PQYB 1JYNA 4PP2B 1MCDA 1UC6A 4YEEA 5IF0B 5K93A 5E7BA 1X44A 5GRJH 4ZUWB 5ICXB 2AJZB 4ELKB 1CFTA 1R3JB 1FLRH 4OLUH 3VXSB 1Q9WB 2ZSVA 4F9PA 3Q5OA 1J0YA 3JV6A 4X6DF 4YHPA 3VXMA 4O00A 3RTQB 2D0HA 2PYEE 4P99A 4JY5H 1W0VB 2RJMA 2QTEA 5JOEA 5DSCA 3KNBA 4E9LA 1LO2L 3OWEA 5JW5B 5CBEB 4G3YL 1KPVA 1UCBH 1R6VA 4XNMB 2EXWD 2AXFB 1NQBA 3CLEH 2BNUB 3O8XB 1CF8H 1JF1A 5GSRA 4GLRH 3RKDC 3U7WH 5BQ7B 5FYJU 4LLUA 3S36X 2C5DC 1QP1A 1TPXB 4KJPC 3B6SA 1XGQA 3P0GB 1MI5D 4M8VA 4JY4A 4OSUH 5CMAA 2XYCA 2NY6B 3BIAX 1YN7B 1AGFB 3T08A 2J12B 5F89A 3O6ML 3HAEB 4TUOB 4XGZA 3GGWA 3O2DA 4DKDC 1U92B 5DC0A 3BD5A 4W81A 5DK2B 4PJGE 1T89C 2IANA 4MJ6A 4U7KA 4AG4L 2EYTB 5HGHA 5GRVL 3WNLA 3GMRA 1HH9A 4K7FB 5HYJB 1GOHA 4O5LL 1A2YB 5C0GA 2CR6A 2Y36H 1IEAB 4J4PD 3SDXE 4M93C 5JZ7C 5EORL 2VUYA 1KGCD 1OPGH 3C6SB 4MJIE 1OP3H 1QVOA 5JXAL 3P9LA 1KULA 1BECA 5IB2A 3UPAA 3G5XA 4KUCF 4KJWD 1ZVSA 4HXBH 1MFBH 3T0XA 2YPKA 2VZUA 5FAAA 3KLSA 4ETQA 4DGYL 4OCYL 4I5BB 1LILA 2Y07H 3SGEI 2V2XA 3C9NB 4PP2A 5F7KC 3GBLA 5IQ9B 5D7LA 3LRSA 3GSXA 2AJZA 1Q9KB 4F58H 2RR3A 3U4BL 3ULSB 2ZSVB 3S3SA 5T1LB 3ULVE 2HJFA 3QHZL 3INUH 4H25B 1CFNB 1K8IB 4BA8A 5DT1H 4HT1H 4N8PA 4NHCH 4D9LL 4OGAD 4F7PB 2VH5H 4QT5A 3WUWA 3TN0B 1KB5A 4FTVD 1T5WB 3C8HA 3DHMA 2AEQL 3EDEA 4QHUA 3Q6GH 2YSSA 3RA7H 2FLBT 2A9NH 1U8HB 4FQXB 1GXEA 3G04A 3FZUD 1ZT7B 3O3DA 1XGQB 3PP3H 3QP3A 4D0DA 3FQUB 4APQB 3T04D 5C0IA 1AGFA 1YQVL 3PNWB 4XCEB 1B4RA 1D3CA 4QTIL 5FYJD 2ERJC 2AJUL 3STLA 5MHSE 5FYJH 1J1OH 2DJ4A 3ZE2F 2X4UA 4L3CA 2F5AH 3REWB 1GZQA 1RUML 1UH2A 1YC7A 4L8CB 1VKXB 2B4CC 1XF5B 3UTPE 3BKJH 2IBZX 1GGTA 2A1WL 2IAMA 4H0HB 4NWTH 3G5YB 4OD1L 1IGIH 3G5XB 4JM2D 1HHHA 3G9AB 3TM6A 4X6FB 4MHHI 1NC4A 1OCWH 4ZNEA 4ZSOB 1GPOL 4AIXA 5EZIH 4EI5C 2FYYA 3KYKL 5HXMA 1FVDB 1R3HA 2CKBA 5C07E 3BPNC 4NC0B 2NNAB 3QCTH 4XMKH 3OXSA 1BHGA 2DQFA 4HGWA 3WNPA 1H3GA 4QXUH 4JZOA 32C2B 2EKJA 4NSKA 1S7XA 4TN9A 1QLEH 1S9WB 4U1SA 4R9HA 2VDLH 3LV3B 3CX2A 5E2UL 1KYOJ 3QWOB 2ZOLA 3HMXH 1YPZA 1FYHB 4YIQB 5KJRL 2IH1B 3RWHA 4BSJA 4I0CC 4ZTPH 2D2OA 1RZ7H 2GCYA 4RNRA 3O3AB 2FH8A 1WK0A 1J5OH 1ZT7A 5I1CH 4ELMF 4ZO7A 4I3SH 1R5WA 1IM9B 1KPUB 1IM3A 1T22A 3X11A 4AENB 2DM3A 4XCEA 2J6EA 3QR2A 2N4IA 4EQ3A 2F58L 4ONOA 3EDKA 3NABH 5DJ2A 3TJEH 5CZVH 3GK8L 5C0AB 5C08D 2XG5A 2FSEA 3RGHA 4FFZH 1U42A 3UTTA 1SJVA 3RI5K 4EUPB 4YXHH 1JRHI 1B9ZA 2DQGH 5L2KD 2CUHA 5MEPA 2IAMB 3KPMB 3BP7A 5CIPA 5EZOH 2ADFL 2CIKA 5FGCE 3QH3A 1G0YR 4NT6A 1ZVHA 4JG1L 1U95B 1FNAA 1I9EA 2ARJQ 3HKFA 3LAFA 2EE9A 3VMNA 5JHDD 1AXSA 3P73B 3HZYB 3EAKA 3GJFA 3ARDD 5TGBB 1NGQH 3OXSB 5FUCE 5D70H 2YZ8A 3W39B 1PAMA 3BGAA 4OFKA 5AG9A 1UWXH 1A1OA 3L5XL 3FFDA 4PJ9B 2C9AA 3SY0B 2HT4D 3VFGH 3MRQA 1KCLA 5F3BB 2BVTA 1D9KD 5FYKD 2NY1C 4LARL 4DCQA 1EEZA 3C8KA 3LV3A 3I84A 1ZVYA 2WLYA 2A74A 2UVFA 1G7QB 3X13A 4OZFB 2HTKC 3LDBB 3NCEB 2H32B 5CZXC 1A1NA 3SKMA 5JIIA 3RWHB 1YNKH 5EU3B 1JGDB 4YE4H 3G6JA 2GCYB 4LVOB 1UCBL 4JFFA 5EO0A 3H3BC 4P3DA 3WO4B 2BNRE 4JFXA 3VFTA 3FB8A 1TENA 3IETA 3O0RL 5J1AB 2VDRL 4AENA 1NMCB 1YNLL 1KT2B 2HFGL 3OKEA 3IDMB 4CN6A 2VDNL 4PTUA 5C09E 1HSAB 4OGXL 3T2PA 4QHKJ 2P48B 3DNKA 4ODWB 1TJGL 5CFHA 2CRMA 4PRHB 2BSTB 2XA8L 1QBBA 2HJLB 3EYOA 5E2TL 5C07A 3DX7A 4R4BB 3MRMB 1S8DA 2PO6A 1OP5H 3NGBB 5I1LA 2N7AA 4L8DB 1M4KA 3FMGL 1F5WA 1TVBA 2PO6C 5EC2B 3WXVL 3IXAB 2MCPL 2QHLA 4GUPA 2IFGA 1YA5A 3CK0L 2GYSA 1K9TA 4MAYA 2EXYC 5IW6B 1WWCA 4PJCF 1DQDH 1LEIA 4XVJH 2PO6D 1IT9L 5EUOE 4KI5E 2UYLA 2Z93B 1NDMB 5D72H 5DFWH 3W39A 3RX7A 4TULL 5HGDA 5ILTH 5E2UH 3PF2A 3OAZH 3NACL 5I66A 4CVXA 5CIPH 1AGDA 3MV8A 4E41D 2IG2L 2AQ1A 5FHAL 5JORB 1A7PH 4LCWB 5DRNB 3C8KB 3VGDA 1IZJA 4RMUA 4BQCA 4OZFA 2AP2A 5EU3A 3WLWD 3IGAB 3C08L 4GH7B 5IFAH 3QIBA 4NYLA 4Z7OE 5GGQL 4LGPB 5HHXL 3CFKA 3CC5B 3RGVB 5DD1L 1CFQA 1MAML 3CVHB 3F12A 2Y5EA 4P2OD 1FC1A 1MCFA 5C8JA 3HAEG 2F8OA 2J6EH 2PTTB 5HI4C 5A3ID 5LJYH 2O5XL 4ZPVB 3V5KB 1NFIA 4PJ7E 3VXUA 5LGHH 1I85A 3FCTB 3GRWL 4OD1H 2HTKD 4Z76B 5F1NB 5F8QC 1BFVH 4PJAA 3B8SA 2NY1D 4OZIF 5HHQA 2HVJA 2VDKL 4HS6B 4JHZA 2HT4C 3DETD 3RWDA 4A2MA 5FYLH 2OL3B 4LSTH 4ZFGH 3EYOB 3BIKB 3BWUC 2F5AL 3L5WA 3L7FB 2PO6B 3EOTL 3UO1L 1BJ8A 1CG9B 4L8DA 1L7IL 2J88L 4YHIB 3HFML 1WGOA 1P53A 1J8HE 4PGCB 3G6JF 4UOJA 4HZAA 1LVEA 3D39E 2WAHA 3MRJB 4X0KA 1Q9LB 4XNZB 1LEIB 3EFDH 1RJCA 3LOWA 3FFCD 4FQIL 4GRLD 1G7IB 1YEDB 5CUSL 1IC5L 3BW9A 4IOIB 5HHMD 3V5DB 5EZIL 1SHMA 2QHRH 3GI9H 5JQHC 3CJJA 2V2TB 5SWQB 4ONFL 3MRKB 3WFZA 3L3KB 2OTPA 1J8HD 4JPVL 1VFAA 2VH5L 1JYXA 4P3CL 5D7JB 1NGZB 4ZD3L 5AWNH 3S9DB 1A9BB 3L95B 1TETL 2YD4A 5BW7A 5J13C 4P2RD 1OTUC 5SWZE 3ROLB 4EBQL 1AHWC 2VDOH 2OLDA 3IVKB 5DJDA 4U33A 5ACLA 1NBZB 2EE6A 3EKCA 3WKNA 3UCRA 2ZKHL 4JGMA 4ACPA 1OTSC 3I3EA 3UPRA 4U2YA 1DBMH 1KN4L 1J1OL 4HUWB 4PTTA 1N6VA 1NLDL 4OLYL 5GJSH 3LPWA 1BLNB 1KCUL 2X70A 3B2VH 1PQZB 4OLEA 3V6ZB 3KPNB 3IDXH 4JLRB 4ZS7L 3MLVL 3BE1L 1FO0A 3T4YA 4F7EB 2CK0L 3IDYC 4PJAB 1G0DA 1MLBA 2DMCA 4CMMA 1MCPL 3O45A 4HS6A 1VDGA 3DGGA 3IDJB 2IBGA 4PRPE 3IDNB 2ZUYA 5F71A 1MHEB 2JLLA 4X5XA 2EDXA 5F9WC 1KB5H 3VRIB 4F7TA 1H15A 4MX7B 1OAXL 5EUKA 4NUGL 5JW4M 1MCEA 4JKLA 4NRYB 4M7LL 2M2DA 4YDIL 4BUHA 3MBXL 3M45A 3CDYA 1RV6X 5I1AB 4HF5L 2P4AB 1IQDA 1LQSR 4M43H 1X7QA 3MBEB 2B0SH 3BHBB 3BOVA 2W0PA 3PQYA 1G7IA 2APWA 3SDAC 4KROC 2K7PA 4M3KB 1ETZA 3QUYC 1MCKA 1GAFH 4NFBA 7FABL 2ZUXA 5IT2L 3D48R 1UG9A 4RZCB 1T0MB 3B4NA 3N85H 1LO2H 1A3RH 5IMKA 1F97A 4FHBD 3TA3C 2C3XA 4CDGC 3C60D 4C56E 5D1XA 3QEHA 4XVTH 2E7HA 4JY5L 3ARED 2EDTA 1CFBA 2BCKA 3NA9H 1YY8B 3ROLA 1W0VA 5L2JA 4L9LA 1JZ7A 2E7LA 1VFBB 4NN7C 2EDKA 5F6HI 1OLLA 5JW5A 3P4NB 3QQ9C 4QRRA 1A6ZB 3MLUH 5L7XH 2XNAA 2YD5A 2OQJA 4J3XA 3F58H 4H1LA 1JNHA 4FQ1H 4LSRH 5MEND 2WV3A 1EERB 1OARL 4YX2L 4X7SL 1SYVB 3RVVD 4WENB 4MNQE 2FGWH 1A9EB 5AYQA 4G7VH 4TTGA 2A6DB 3ARFB 5E9DE 1L6ZA 3DMMA 4TUOA 4XGZB 4EI5B 1G7LB 4P23D 4E42A 2WBJC 4KHTH 1C5DA 4X7FC 5BVPH 2IH3A 2A0LD 5JUEL 1QACA 5HHXH 5MENE 4GMTH 1N8ZB 1LK3H 5JHLH 5FYLE 1H15B 4KGJA 3VFRA 1T7YA 4Y19A 3H7BB 5KSBA 2CLRB 4MJID 3QSKB 1FZKA 4I77H 4KKCD 3U4EB 2ADGB 1LD9A 3O41B 2YOCA 3JV4B 3VFUB 5I1AA 1FIEA 3P9LB 4XPBH 1K5NB 5D5MF 2R0LH 2BC4B 4JFED 1KJMA 4GRMA 3ZSSA 1PBYA 4OT1L 5GS1A 4HFUL 3FRUA 1OSZB 1SEQL 1WZLA 2QQKH 3UJJL 3FO2B 2RCSL 3GK8H 3SCMA 1RZKH 3R1GH 4IJ3B 1T0MA 2VLMD 4PJFB 5BVPL 2HT3C 4D0CB 3QDGE 1FNEB 2XACC 2PXYB 1E4KA 4RIRA 1BJMA 5T1LA 1JZ2A 2R2CA 4CGTA 4H25A 3QEHB 4KI5C 5E56A 5DJXA 3TFKD 2YRLA 2Q86A 5AAWA 2GSGA 3LDBC 4L9LB 3BN3B 1VFBA 2OTWA 4NHUB 3K74B 3TN0A 1KB5B 3ARXA 4MVBC 2MQ3A 4Z0XB 1FNSH 5KVFH 4BSVA 1ZT4A 3BXNB 4ETYA 1AO7D 3BKYH 5F96L 4GQ9L 2OQJB 4DN4H 4XI5C 3DOSA 1JNHB 5C0BD 2BY3A 1U8HA 4FQXA 1DBJH 2ZUVA 3QIWA 4KY1H 4NCC1 5C70A 2H2SC 3G04B 4F9LC 4WNQB 1DQQA 4LSUL 2DQIH 5IR1B 2ZUSA 4XB7A 4XCNA 3VGAB 5I18L 2FX7H 1KNOA 5CJQL 5EU6B 1QA9A 2FWOB 3UTOA 2B4CH 4P0DA 1ZANL 3B3IB 2H3NA 2Z8RA 5AZ2L 5DUPH 4Z95L 4NQDB 2ORBH 2HWZH 1EGJL 2WK2A 4QTHA 3DRTB 5A2KH 4Z8FL 3VFRB 5ICYB 1LO3H 4POYA 3VGEA 5DD0L 1W2KT 5D96B 4JFEE 2VXVL 3O8XC 1I7TB 5GS0C 3JV4A 3G5YA 2A1WH 1SBSH 2OR7A 5L0QB 4YX2H 4X6FA 1JTOA 4M7LH 1T1YB 1RUMH 2HLFD 3DVIA 4NUGH 3GSNA 2HA1A 5BS0B 3VW3L 1UT9A 3JWNC 1WZMA 4K55A 1FVDA 1AGCA 2DIAA 5FCUH 2X4OB 4HS8L 3K1KC 5C08A 4PG2A 1E6OH 5I1EL 3D9AL 3J7HA 3BQUB 5L2KE 2P5ED 2YD7A 1FNEA 2A38A 3SDXB 1BAFL 4RIRB 4UINL 3STZB 5EBWA 2VLJE 4LPVA 3BFOA 4PG9B 2VDQL 3MXVH 4KTEH 4R7NA 4FQCL 3HUJF 2Q86B 2ADFH 4NBZB 4Y5XB 3ULVD 1TCMA 4QF1B 4OIBA 4YBQD 3QWOA 2ZOLB 4G8GB 1ZA3A 4JQXA 4ZMAT 3L9RA 3PHOA 2OL3H 4U3HA 5IKCB 3HE6C 5I73C 1I7ZB 1ULVA 3O3AA 4MGXA 3QIWB 5E5MA 3OJVC 4HT1L 4QKXB 3H3PL 3SJVD 2V7HA 4G6KH 4Y5VA 5SX5H 4H26B 1EV2E 1R5WB 4TSCH 5BO1L 1J1XL 1KPUA 1T22B 2FJGB 1RZJL 4HD9A 3X11B 5HDBE 3LB6D 2ZPKL 4UTBH 4NGHH 4HQQH 3ARFD 1QA9B 3SPVB 2H3NB 4UDTB 1XEDA 4U1HA 4JREC 4WFGD 3BEWA 3L1OH 1MUJA 2YS4A 1RZ7L 4WI8A 3P0YH 5MEOA 1TMCB 3UTTB 4ZFOL 4G8FB 1FNGB 1ZT1B 1T1XB 5E8DL 4OLVH 5JXAH 4OIIL 3WIIL 5MEPB 5MP6L 1XZ0B 4MS8C 3ZO0A 4J4PA 1B2WL 4F2MB 3KPMA 4WEBH 2Y4SA 1JHLL 5CIPB 1DQLL 1KCRH 3MNZB 1J10A 1QFWI 4M00A 3QH3B 1UADC 4JFYB 1JYWA 4Y2DD 1T1YA 3CU7A 4OLYH 5DA4A 4YO0B 1C1EH 5EOCL 4I3GA 3GSNB 1RZ8A 1QR1A 5LBSL 1SYSA 3VXTB 3EJZD 3EO0B 4C83A 4HX1A 1MRCH 5TGBA 4OCMC 3RWGB 2BERA 3SDXA 2UZYB 1A1OB 4KXZI 43CAB 1A02N 4PJ9A 4GAFB 2IPUK 2WMPA 3MJ9L 2DRUA 1ZSDB 3MRQB 3AM8C 5F3BA 1NSNL 4FP8H 5J12B 3QDGD 1RUQH 4HWBL 3GMOB 3IJHB 3P77B 1OOAA 1U9KA 4QF1A 2F8VA 4PB9H 3HUJE 1IC5H 3PHOB 2IMNA 3O6FB 5CSBA 1JGDA 5D7LE 1I7ZA 1SQ2N 3UX9B 1I7UB 4L1DA 3VGGA 2VWEE 1RHFA 1KG0B 4P3DB 3ZDYF 3QEUA 3CH1A 4H26A 3Q3GA 3IETB 5C0BE 4JHAL 2FJGA 3TBWA 3V0WL 4JFEA 4PY7B 4R90L 5FHAH 4JAMA 1V05A 2IG2H 1KC5H 1NGXA 1BGXL 2OR9L 4ODWA 4BSWA 4YFLF 4HK0A 1AI1H 3U48A 3CXHJ 1L0XA 1OGAE 1KLGB 5CEXA 3ALWA 1UJTA 2HJLA 2YR3A 2H6PB 3T0WA 3DX7B 1YJDH 4PJIF 3MRMA 4G8FA 5C08E 5DMJB 1KEML 3DIFA 2X1XR 5DD6A 2NY3C 4CW1B 1XZ0A 3GRWH 3QHFH 4I13B 3C5SA 4RFNB 4YDVB 2AJYL 4UUJA 4K7PY 3V0VA 1Q1JL 3VWJB 1OHQA 2HT2C 1UACH 1ZWIB 5IW6A 2V17H 2B1AL 4NOFA 4HMCA 5J3HC 3ZKMC 4N8VG 2YD6A 1GYAA 5FDYA 3KXFA 1SMOA 4OAWB 4O9HL 1NDMA 4XC1H 3RZCD 1LNUB 1FZMB 3RTQD 3RPIA 4X4ME 3RAJH 3BQUD 1OT1A 2WW8A 43CAA 4RWHA 2IF7A 2I26N 4FS0A 5F9OH 5I0DA 4OCXH 2H2PC 4QO1A 2DI9A 1OD7A 4QRPD 3RDTD 5DJZA 1OF2B 5HYIA 2CLZB 3WN5B 4KRMB 1HQRA 3TT1L 4CVZB 2K3TA 3MLTB 1IT9H 1PG7L 1VFMA 3SGJA 3ARFC 2CPCA 3U1SH 3FFCA 2FDBP 3QUKA 3K0WA 1HHJB 1B88A 3QIBB 1U8PA 4DGIL 4X7CC 3BKCL 2NY6D 3HS0A 4ZUVB 1REIA 1F90L 1NL0H 1VENA 1IMHC 3SJVB 5FO9B 5C8JB 3PL6D 4XP6L 2B5IB 1V7NL 3FCTA 4PY7A 2ATKB 3TCXA 1BQSA 4I48A 1OGAD 5DURD 4YPJA 4K8RH 1QTYT 5DC9B 4L1HA 1FE8L 5AYUL 2QL1A 2EDBA 5BW7C 4M62H 4FFVD 1BWMA 2Q20A 4MXWH 3RFZC 5DD5H 3ZE0E 4JFOA 4XNYH 2EECA 3HC4L 4LVOC 4N8VB 3GUTA 3R8QA 3LKRA 4WCYH 3SN6N 1IJ9A 1A6WH 4CW1A 2GW5A 2VR9A 5ERWA 2ZUWA 3C5SB 1LO0L 1Z9SA 1WZKA 4OGAC 5F3HB 4DGVL 3MGAA 3BRDA 2VLJB 3HRZA 4P2YA 3VWJA 4GW1A 3DVNB 4DK3A 5GGSY 3OXRA 1FFNB 1Q9LA 3CPLA 5ABDE 1T21B 4OLZH 1KUMA 2ZG1A 4MA7L 2IGFL 3ALXA 3LN4A 3EYSH 5GRJL 1MNUH 3U82B 1QLFB 3UTZA 4WV1A 3CFJA 3V6FB 1KJ2B 3PDGA 2NXZC 1UQSB 3WL9A 4FFWD 5T1DL 5D2LB 2CO6B 3GKWL 3F6LA 4OZIE 3NABL 3BJ91 3QEQA 1A6UH 3ILPB 4JDVB 4LVNC 2UY7A 4DEPB 1L7TL 2CLZA 3UYRL 5L9DH 4Q9QH 4N0UA 2VLRA 4J4PC 5ETUA 3FQTA 4RFNC 3QDMD 5T3XL 4LVEA 1NGWB 1NBVH 3RU8H 1OTTC 1U3JA 4L4TD 4CMHB 2NY3B 4HLZG 5CCKL 1CGSH 4N8CL 2NY0B 1CLCA 2HAZA 1T5XA 1BF2A 1PQZA 2YN5A 4EOWL 1RPQA 1TNNA 3IDXL 4YHYB 1NMBL 3KPNA 4JLRA 5I6XC 1RU9L 1NUFA 4XI5D 1FZJB 1F02I 2CXGA 1K2DB 1DBML 1UXWA 4OI8A 3IDJA 1E6JH 1MCQA 3HG1D 1WIOA 4JM2F 1S9KC 1OAZH 1JF6A 4MX7A 2ICEA 1C5CH 5EFIB 3I50L 4KI5D 3PJSB 4WW2C 3LKRB 4XBEL 3ZE0F 3QQ9D 2DIJA 5ERWB 3ZHKA 5JIKA 4EZMA 3WS3A 3WV0A 5EZJA 1N2RA 1I3RA 2ZCKH 2O5YH 1LO5B 1QBAA 2LU7A 3IYLW 4XZUA 1ROWA 2OJEB 1X7QB 3C2SA 2HKHL 3KHOA 3ZT5A 1FFNA 1HZHH 3MRCB 3CPLB 4TUKL 1HXYB 3QAZB 1RUAL 1SMAA 3QFJD 1HHGB 2CUIA 4Z7UE 3KLHD 1QOKA 1C5CL 1ETZB 2BVPA 5B3JF 3UTZB 1U8QB 4IIQC 1KJ2A 1S9YA 4JO1L 5DQJA 4N0RA 2EDDA 3QBTB 3U30B 2Z91B 2J5LB 1IAMA 3GZKA 4WHDA 4KKCC 2AXGB 2KH2B 3QEQB 4HUUA 2DBJA 3WKMH 4B7IA 4JDVA 4OCWH 2QQLL 4ZNCD 3RVWD 1XIWC 5FK9A 2X7LA 3U9UB 1MF2L 4X9BA 4HWZA 3QQ4A 5J9PA 5LWYL 1FL3B 1U8LB 4QRRB 4IHOB 3FQTB 1SY6L 3MNWB 1FLTX 1TDQA 3U9PH 3W82A 2R8SL 2IQAB 5E03A 1BBJB 2APXA 1UWXK 2FB4L 3LVEA 2Q76B 3FB6B 3T0EE 2M26A 1J0HA 2RQ8A 4G42A 1B90A 2AJXH 4R0LB 5DT1L 5M94B 5L8KB 1XGTB 1FZJA 4LVHC 4JGUA 5SX4H 5AG8A 1MEXH 1U6AH 1BOGB 3MO1A 2X2YA 4APQC 1AO7E 5KANI 1C12A 3D6GA 4XAKD 5CD3B 1G9NC 4D8PB 1FAIH 3KPRE 2ESVA 5J57B 3LQAL 3SE4C 2OL3L 5EFIA 3H7BA 5KSBB 3KPSA 4FQLH 1OTSD 3U7YL 3U4EA 3P9WB 5IJVA 1H3VA 2ICWA 4U1NA 3QXAB 4NWUH 4PJAE 3S3PA 2D9CA 3CCHA 3MA9H 3MRCA 1F11B 1JNJA 5GGTA 4MXVF 1NJ9B 3L3DB 1IAKB 1CDUA 1FVEB 3IFLH 1G9MH 5F9AC 1UXSB 4JQIH 3EYQC 4PIRF 4YQXL 1S9YB 4Y4KD 4Y4HA 4YNYB 5GIRB 3C5JB 4MD5A 2LAAA 4EDXB 1MHHA 5CP7B 4U31A 2RIKA 5FA4A 2IMMA 1A6UL 5HY9A 3VXME 3D69B 3O6MH 3DI3B 3WXVH 5CSGA 3ULUL 1XR8B 1WF5A 4OFYA 2J8HA 4XT1C 3QIWD 5HI3C 4BFIA 1ZHKA 1ZOXA 5GGVL 4OSUL 3RL2A 3MCKA 1QSFA 5IEHA 4NHUA 3QQ4B 1KTKE 4U1MA 1FL3A 1P2CB 4Z0XA 5TE6H 3C5ZC 2VZVA 3E8UL 5GISH 5SV4A 2FRGP 1S78D 5EH1A 2BZDA 3FB6A 1UCTA 2HLAB 4LGSB 2NY5C 3QPQC 5AEAA 5JO5A 2FEDD 4YPGA 2GJ6E 3NTCL 4TVSa 4M5YL 5I18H 5I76A 3DO7A 1DQMH 1KNOB 4PRIA 4WCYL 5C0EB 1YMHB 2JIXD 1BOGA 5CD5D 1AHWB 3JXAA 1O0VA 4MXWL 5I8EB 4I2XE 4TNVF 4URTB 2C4FT 5IVZA 3GSWA 4JPWH 5J6HA 4X6CB 2BHZA 1MI5A 1U8MB 4G8EA 5KBNC 5F8RC 4XBPA 3QJHB 1CVRA 4PGBB 4M9PA 2Y06H 2JJWA 4F37F 4YR6A 4ZDHB 5DGQA 3WFDL 4OZIB 3EJYC 1I7TA 1UZ6F 1G7PA 1I1CA 4PB0L 1MWAB 4LLVB 4HXAH 3ZMRA 5ITBL 3ARDA 2HFEA 3A6OA 5FV1L 3IRPX 3C6LD 1FHGA 1TLKA 3GIVB 1AGCB 2XZQH 4FABL 4U3XA 2X4OA 1RZKL 1SJEB 4K23H 5LGJA 3MA9L 3H7LA 4HK3J 1VEPA 2P46B 1LWRA 2R56L 2VZ3A 3GIZH 1S7WB 3MLPA 1AQDB 4HFUH 3STZA 5EBWB 3CFCH 4K9EC 4LRIA 4PG9A 2O93L 5TDPA 3QXDB 4OLUL 4Z77B 3TYGH 2X09A 5CP3A 3RIFF 1PKOA 1QSFB 5IEHB 4U1MB 4U1LB 4DQOH 3MRDB 2NQCA 5CBEA 3W2DH 5HSFA 1GJIA 2FH6A 5D5ME 2AXFA 1UWEL 4LP5A 5JOPD 3TBVB 1YNTA 3A6BH 5ID0A 3O8XA 3F62A 5IBTL 4OTXL 2HLAA 4KHTL 2V7HB 2X44D 1VCAA 2AJXL 1EEQA 2ZG3A 1ZGLM 5CMAB 4UB0H 4KPHL 1UWGL 5CJOH 5IMMA 3O2VH 4Z5RA 4K94C 5JMOC 1M7DA 2OI9C 6FABL 4UDTA 5DDHB 4H88H 5DA0B 1S7VA 3MCLL 5I8EA 4NKIL 2IANB 1WBYB 4XCCH 3BPLB 5IVZB 5J6HB 3GSUB 5F97E 3OJMB 5HGHB 2WM0A 3LS5H 4Q9CA 1X4ZA 1HH9B 1WAAE 5HYJA 2R15A 1KC5L 3K4ZA 4P5TC 5IFJB 3IJYB 3RPKA 5CZXD 3PDDA 4M3JA 5CEYA 4F2MA 4POZC 3ZE1F 4IMKA 5BMFH 2BDNH 3MNZA 3S88H 1IEHA 1D9KC 1E4JA 5CGTA 5B21A 3ULVL 5I1IL 4JO1H 3ZKXC 2EH7H 1UENA 1RZ8B 1PZ5B 1SYSB 4YWGL 1T1WB 3D18A 2V2XB 1JNNL 5ADOL 1ZLSH 5HDBF 1IFHH 3IXTA 1I9JL 4QHLA 5D7LB 4KI1A 5IEKA 4JFFE 3D87B 1AQDA 5FCSH 1JPTL 3BO8B 3MJ9H 1D5MA 4NRZB 5GGVH 5GZND 2DTMH 2DD8L 3GMOA 5GRXG 1PJ9A 1AP2A 3P77A 3VDAA 3DPBA 1EK3A 4QT5B 1NKOA 5ENWA 3MQIA 1BJ1J 3TH4T 4QHUB 1DSFH 2APFA 1A0QH 1DUYB 4UNTA 2XRAL 2DKMA 4ZAKB 3RUGA 3EO1B 5A40E 3V4PH 4D0DB 3GMLB 1AFVH 1EVTC 3P11H 3LIZL 4JFEB 5D6DC 3CXHK 4YGVB 2KBGA 5IMMB 2KQMA 2VC2H 2GK0B 3VFSB 3STLB 3SDXF 1D6VL 1KIQB 4JRXE 2OMNA 2ENYA 4FG6C 1GGBH 1HCVA 2D03L 2LABA 2HTLD 4H8WL 5GRVK 3SO3B 4AIZA 5T3XH 3ZYZA 4Z7OF 1KLGA 2XRAH 3FRPG 5CEXB 1NLDH 3MUJA 3GSUA 4PJ9C 1VKXA 1FAIL 3DIFB 4W70A 5KOVC 5DO2D 2P43B 4HGKC 4HC1A 2YPVH 2RFXB 1UH3A 2DQDL 1I8IA 3QI9A 1G7MA 3MV8E 3AVEA 1ZGLB 3ARDC 4G9DA 3HE6A 3TZVB 3VG9C 4Z7NF 4FZ8H 1ZWIA 5HVWA 5F9JB 4ORGA 4LLAA 4CUCA 1Q72L 2SEBB 3RHWK 1PZ5A 2NR6D 1ZAGA 3HI1B 4Y5VC 3WLBA 3C6LB 3D18B 4X7TB 1KSRA 4OAWA 3O2WH 1W0YT 4X8XA 2D03H 1TIUA 5CUSH 1YEIL 1JF5A 4Z95H 2CRIA 1KCSH 2GSIA 3EFDL 5FV2A 1ZANH 2JTDA 3KWWA 3WJJC 2GT9A 5ISZE 5J06A 1A1MA 5IVNA 1YYMH 4PJIA 4WY7L 4TQEL 2CSPA 2W38A 2ED8A 4U1SB 4R8WH 1OF2A 3FHQA 1IC4L 4RISL 1OAYL 1AP2B 4M7JH 4I9WD 1B3JA 3STBA 3BN9C 1HINL 2E7LC 4L9DA 2CDEB 2IH1A 4NZTL 5JIPA 3FFCB 4MCZA 3ARUA 3MV01 1DBAL 5FO9A 3SJVA 5BCAA 5HDLA 1A7NH 3RVTD 2VUOA 2X4TB 3S5LA 2W0LA 4HW6A 1Z6JT 4XBGB 3IDGB 1NL0L 2MOVA 1T7WA 3KJ4C 4AMKH 3QISA 3L5IA 1U3HC 4YFLI 3SGKC 4QWWC 1ADQA 3MC0A 2NYYC 1EHNA 1I1FA 2FIRT 4LRIC 2HJKB 5EOCJ 3S37H 3FAWA 1KFAH 1FBIL 3FO0H 5B39B 2QJDA 3VD9A 1EBPA 5BV7B 4PYHA 5IV2B 4ZFOB 2BSSA 3WFBL 1K6QH 2VXUH 1HDMB 2R0LL 4LKCA 1ZGLA 1RU9H 1F4YL 4JRYD 2XKSA 3RL1B 4NT6B 1U8NA 3THMH 4JO4L 4J2XA 3GIZL 3SO5A 1I9IL 3CMOH 3LN4B 1FFPA 1AXSB 1XR9B 1XFPA 2OXHA 3AS2A 5DVOA 1NCWH 1XT5A 3FQWA 4P9MH 3WL9B 1N7ML 2WZPD 5D2LA 1AY1L 4ODUB 5CSZB 2JJSA 2D7QA 1TVDA 3HC3H 2EC9U 1A1MB 3LKPB 1U0QA 4XH2B 1XGRB 4ELME 4DCQB 2VAJA 2UZIL 1N7MH 2RHEA 1WV7T 3WFDH 3R1GL 3FMGH 3SKJH 4NC2B 1JK8A 4H5SA 1SEQH 3UJJH 1RIHH 3OKOB 4RFEA 5H8DA 1A4JB 4JO4H 4FQQB 4Y4FA 4BUGA 3D2UA 4LAQH 5B8CC 5ALCL 3EJJX 4GJTB 4KC3B 4JFXB 4LSVL 3UTSE 5B8CA 1Z0NA 1D6EB 1KXQE 1OL0A 3IDIB 5D7KD 1IAII 1MFAH 3NA9L 4NQXA 4ZO8A 5HGBA 3PWLA 3IDGA 2OTUA 3O0RH 2J8UA 1Q9OA 1AQKL 2EDYA 4K23L 3UYOD 1K2DA 3GHEL 5GS0H 5JHLL 2CRZA 5TF1L 1I1FB 3H9HA 5ADPL 4RGNB 3DROA 2BSTA 3HC4H 5HHMB 3NCBB 2DL2A 1T83C 3R8BB 4G9FE 1GAFL 5C07B 3MLZH 1MHPH 2DM2A 3CX5K 5B39A 1HYSD 3PJSA 5ITBH 4WFED 1NCCH 5GRZA 4X5LA 3RZCC 2VWEC 2W65B 3QNZA 4P46C 3LSOA 2FGWL 1I3RB 3O81A 4P2RB 5BS0D 4IRJD 1NCBH 2UUDK 3D39A 2OJEA 5E6IA 4I18A 4N1EA 3V2AR 1U8NB 4GXVL 3E3QC 2P5EB 1CR9H 5E6IC 2XICA 4G9FD 2D0FA 2NYYD 1XR9A 3T65B 3DSFH 3JWDC 4KMTL 2Z93A 5GZOD 5IHUL 5F9DC 2E3VA 3GB7B 5DQJB 1FDLL 1PG7H 4NZJA 2WINA 4M7JL 3K2UH 4POUB 5CSZA 5CLTA 3QFDB 3DI2B 4CVXB 3RVTC 3SJVE 4F3FB 1YMMD 4OIIH 2WIIA 1H8OA 1DDHB 2NCMA 3EYUL 3MROB 3QG6B 4BZ1L 5C6WH 3NZHL 4OZGE 5I71C 4RX4D 5FO7B 5KSAA 5J8OA 3H42H 1F58L 4K3JH 4KQ4L 4J8RB 2CXKA 3MNWA 2W60A 4OLXH 2X4QB 1JRHL 4JCLA 3OKLB 3ARTA 4JG0H 3CC5A 2WP3T 3O2DH 2FLRT 2Q76A 1CFQB 4OZ4B 5D7KE 5I8OL 4HHAB 3P9MB 5IESL 5KZCB 2JE8A 3MBXH 2FNBA 4XWOD 1D6EA 5MERB 3IDIA 4JHBA 5CEZE 1GGYA 2X4PA 2OTUB 5J11B 3VE0B 3WEXA 2J8UB 1KGCE 4QHKI 1T6VN 2ED9A 5JR1L 2HVJB 1KB5L 4JPVH 3H9HB 3VG0H 1H8NA 4S0TD 1AIFB 4GAJL 1MQ8A 3TWCH 4LRNH 1I3VA 1MSPA 2ESVB 1U41A 3L7FA 1QQDA 5J13B 2ZWLT 3KPSB 3HMXL 1CXLA 2Y5TA 1CG9A 5D2LE 4JJ5B 3LSOB 3ZLQC 1NUGA 1I1AD 4W6XB 4ZXBC 2W9DL 4PGCA 1P7QD 4MXQD 4P2RA 3QXAA 2Z8WC 3REVB 3D39B 5EULV 1OY3B 5BRZA 3TEUA 3O9WC 4HIHB 1IAKA 1BWWA 1YEDA 2HTLC 4MAYC 1MFDL 3V5DA 1NGPL 1T7VA 4BZ2L 1JWMB 2V2TA 4KKNA 3DUUA 4NC1E 3MRKA 3QWRD 4ELKA 1CFTB 5FA4B 1FL6A 4TRPH 4TUKH 4NO0A 2BNRB 2VXVH 2NTSP 3UTSA 3JV6B 1A7OL 3ABZA 4PLOB 2LE9A 3V4UH 5DD3H 4IRZL 1QD0A 1T7ZA 3BH9B 3VWKC 4R4NC 1CD9B 1NBZA 4Z7UB 2D4FA 3N1MC 4DUWA 5ALBH 5EA0H 1SY6H 3UPRB 3AXLB 1J0IA 1NCNA 2KZ1B 2WQ8A 2BNUA 2H9GA 3HMWH 1Q38A 3AREA 2DMKA 3OGOE 2BMKA 2BFVH 4YPGB 2JKXA 4ZYKA 4NNPL 5MERA 5F89B 4PRIB 1DZBA 1D5ZB 3HPLA 2AJSH 2P45B 4TNWK 3GGWB 4JR9L 5I1JL 3VDBA 1Y18A 3IS0X 4XCFL 5J11C 3WIIH 4WU7B 3DGGB 3RUGF 4KZDH 4NQCB 3IDNA 2FR4A 1S7UB 4RGND 1MHEA 1QFPA 5HVHB 1GC1C 1ES0A 4XPAH 5C07D 3TF7C 4ONGL 1IRAY 1DVFD 4YR6B 4QXTA 1UWGH 4QOKD 5F6IC 4HWEL 4L29A 1V3KA 2AEPH 3C6SA 4NGHL 3REVA 4XB8A 4PJBE 5IB2B 4NQSA 1Q94B 4IRJB 1CLOH 3A6CH 4X9GA 1X5HA 5GHWH 1XGYH 5FA3B 4CN1A 4MQSB 1ZVSB 4G7YL 4MA8L 4PFEA 4IBLT 1XMWA 4RGNE 3BHBA 1N5YH 4ONHA 3TBYB 3KPRB 4AEFA 3GIVA 4Y4FD 4J23A 5BVJA 5D6DA 3TVMC 4BQ8A 2JJTC 5LGJB 3QDGA 2LVEA 5C0ND 3MFFA 1F6LL 1Q9KA 4NJAH 1S7WA 3G5ZA 2KPNA 2IFFH 4NO0B 2EDOA 3VGFA 5D1XB 2VDNH 1JGEB 3RWIB 5B4MD 1XF2A 4PD4K 3GMPA 3HC0A 1TFHA 1PX3A 3VD7A 1BEYL 4F7PA 4Z7UA 5GJTH 4X9HA 3MRDA 1EUUA 2AJVH 2XNAB 1UZ6E 4P2QE 3TBVA 2EDEA 1XAUA 4H1LB 2H9GB 1FQ9C 1GVIA 2VDMH 1CDHA 5FM5O 2BMKB 2P1YA 1AR2A 4IJ3C 3CK0H 4LF3B 2YXFA 5FHBL 5JW4R 4Z5RB 3TN0D 1RY7B 1UGNA 3FL7A 2VRAA 2OBGA 5DMKA 1UB5A 4EI5A 3B9KB 4X6CF 5DDHA 3SGKA 3QB7C 1C5DB 3UYPA 2FR4B 5E2JA 1WBYA 3BKCH 5HHVH 1N59B 1MJUH 1N8ZA 2EO1A 4L8CA 1ES0B 4KTDH 3PGFH 5E70A 4PJCE 3EBAA 3PP3K 3EYQD 3WE6B 5GJTL 4M1DL 4QXTB 5CEYB 3W81A 4Q9RL 1AE6L 5I9QB 4NCC2 2FZ3B 4PJHE 2R0KL 5LAXB 1R5IB 1A6WL 5FA3A 1NC4B 5FUZL 4HG4J 3MLYL 2DQIL 3TT3L 1BM3L 2VQTA 2B1HH 3KPRA 4X83A 5SWSD 1UJ3A 3FO2A 4M62L 1YEHL 2NNAA 1HEZB 1CDJA 3BKYL 3ME0A 3PWPE 2DQFB 4G6FB 4HCRH 3MFFB 4M43L 4PJFA 5IEKB 1ACYH 1IVLA 5I1HH 2IAMC 2PXYA 3C2AL 5DMIL 3BO8A 3I9GL 32C2A 5E4EC 1D5MB 4M7KL 5DJXB 4CL7A 1F6AB 1K3ZA 1KELH 3T2OA 5DQ9B 2UVEA 4NN7B 4DGIH 2LAGB 5E5RB 3PGCB 1YPZB 2CD0A 4BSVB 1ZT4B 3A0OA 2W07A 5KVGH 2J1KA 1DEDA 4JG1H 3VH8B 1M05B 5I1GH 3QIWC 1AJ7H 4YHLH 4ZQKA 3MLVH 4OD3H 3L3JA 2F54A 4ZS7H 1U8OA 5IR1A 3GMLA 2VDLL 4LASH 1DLHA 1KCUH 4XXCA 4Y5YC 2ZCLH 3IJSA 1IGFL 3KJ4B 4JM4L 1UB5B 1RHHB 4JZJC 3B9KA 2V5SA 4AIZB 4NQDA 1YDPB 3I6KA 1N59A 2R4SL 1QKZH 4QTHB 4WI7A 4H20H 1MIEH 5GHWL 2VXQH 5IG7A 3PGDA 4PB9L 1CXKA 3WE6A 2PKDA 2RFXA 4UT6H 2DIBA 1MRFL 3EOBB 5E8EB 2QBWA 5CLWA 4PJ5D 2DI8A 3GMNA 3FRPA 5SWSE 4OKVA 5TJWK 4XPAL 4I18C 4TRPL 1A6AB 1IAIH 2SEBA 3IDYB 1A7BA 4X80H 5J4MA 3WLBB 5LG1A 1U8JA 4PJXE 5TQ2H 1H3WM 4OFVA 5LCVL 4DN3L 4C56D 3FFCE 1FGNH 2GAZB 5IVXA 2ZJSH 3BDXA 1LE9B 3DUSB 5BJTB 2VLRD 4PJIB 4R8WL 1YQVH 5JMRA 1F6AA 4RRPA 3AMKA 1CGXA 1SBBA 2G5BB 3ZDZE 1J11A 3EOTH 1HSBA 1FGNL 2A74B 3SDDC 2VLJD 1G7QA 3X13B 1CGTA 3LH2H 4XPTL 4Y16A 4ZG1A 4G8GA 1U3HD 3PGCA 1EXUA 5FYLL 1OB1A 4X80L 1HH6A 4MCZB 4PJ9D 4LPWA 4JFFB 3V95A 5E5MB 1O7VA 1IGIL 3FB8B 1V5JA 1K3IA 2MKWA 5FYKH 1U8OB 4F8TA 5J1AA 4UT6L 2V9RA 5HI5D 4FQXC 5I0ZA 3IDMA 3T8XA 5E94B 1BZ9B 3MRGB 25C8L 3GJFK 3BN9D 1YEFL 3MV7D 4F58L 1RUKH 3U4AA 1NEZA 4OQTL 1OW0A 5LBSH 4M7ZC 3SDCC 5MEOB 3FOLB 5D1XC 4R4BA 3VXUD 4P2CG 1WTGT 1A7PL 5IG7B 4LNRA 3QG7H 2NY4B 4PJFE 4ZFOA 5C9JA 5A2JH 3IXAA 4PLJC 4KQ3H 3LD8B 1H0DB 3I85A 1CK0L 1J9CT 4IRSC 5E2WH 2A9NL 5HVGB 4YO0A 2AK4E 4XWGL 1JVKA 4HG4K 1IQWH 4LRNL 3VFNB 5I1EH 1RK0B 3EO0A 1KN4H 3FQWB 4HAGA 4Q9QL 3RWGA 2GAZA 4XPHL 2YZ1A 1T20A 5HGDB 2PUQT 1LE9A 4X8JA 3EYVA 4PJHB 5I66B 3DETC 3LKPA 1AGDB 3MV8B 4YAQB 4CRPA 1H8SA 4XH2A 1HIML 2EIDA 2ICCA 2XQBH 2G5BA 3MOQA 1GGCH 3IJHA 5D2LF 1QSEE 5K9OA 2XN9A 2VZOA 3O6FC 4GSDH 5BZDA 2EE2A 5C2UB 1QFWH 1OB1B 2WSKA 1BVLB 3O6FA 4RFEB 4WFGE 4NYLB 2EIBA 4Q58C 3D2UB 4KKAD 2VXSL 3CFKB 4S0SD 2A9MH 2NY6C 3EYUH 4FQHB 1NFKA 3OG4B 1TJHH 1QFOA 5KSVB 4UMGA 2EDJA 3VXUB 4HH8A 3U0PB 2FX7L 5F1IA 5HGBB 4GBXC 4JAMB 3KPSD 1JNLH 4JZJA 4WIQA 4HWBA 5GPRA 5HHQB 4WU5B 4PV8B 4R2GB 4HK0B 4ZNEE 5C2BH 1RZIA 3DROB 1G7HB 3FT4B 4MDJB 2YD2A 4QGYA 4QYOA 5CS7A 2H6PA 4LHUA 3BIKA 3FOLA 1P4BL 3OJDB 5DD6B 2GTWA 2VLKE 1SBSL 5C9JB 1ODAA 4OB5H 1IE5A 2R1YB 4YDVA 4CU8A 2PR4H 3ZKMD 1LP9B 5HHNA 3T2NH 3VXRD 1NCCL 3DHJA 2O5XH 2KKQA 1SJHB 1RIVL 4Y7MA 5I30H 2HMIC 3ULUC 3CSPA 4OTXH 5TE7L 3KXFB 3LZFL 3BW9B 4IOIA 1WITA 1AGEB 2NY3D 4IOFD 2EDQA 2DQHL 4FZEL 4OFYD 2FEEL 3QDME 3RPIB 1MJ8L 2HKFL 1CZ8H 1AGBA 3ARRA 2A6KA 3F7RA 2LQRA 4I0PC 1QSFD 1LEKA 1KACB 1CE1L 3AS0A 2DBLH 1DE4B 3D0LB 4MSWB 1T66D 1DDHA 4YXHL 5DJZB 2V9TA 1KXTB 3W11D 5KSBF 5IQ7L 5K9OB 3WN5A 3MOBL 5FO7A 4TNWF 3V0AC 2X5PA 2D3VA 1CXHA 4XC1L 5FM8A 2FO1A 1A14H 1HQRB 2R56H 1CE6B 3MLTA 1AJ7L 4PP1C 3RWEA 1LK2A 4K71B 3WN5C 1MJ8H 3B5HA 4MLIA 2DQHH 2X4QA 4GMTL 3WSQH 4RRPG 4AYFA 1XGYL 2DLFL 3OKLA 4PY8J 4HBCL 4EKXA 4JPKH 4XX1E 1YY9D 4HHAA 4NO2B 2H2PD 5F7HA 5ITFA 4ZPTB 2YEZB 2X70B 4GQPH 4PJIE 5CD5C 4MJ2A 2ATKA 3BQUC 1FO0B 3T4YB 4F7EA 3VE0A 5FGRA 5LQBH 2MCPH 1MIMH 2EO9A 2X4NB 3I9GH 4WU5A 1NCWL 1JV5A 3QFJB 5I1HL 4G43A 3C87A 3F58L 5IW1B 3BGFC 4F7TB 1YEHH 3HTLX 4N8VA 5HDQL 3BEVB 2B1HL 4OZGF 3D1MC 4JJ5A 1V3MA 3LKOB 1BM3H 4NRYA 1NAMH 4I3RH 4IIQA 4NNPH 4M6NH 1OAYH 3EDDA 5DRXA 1DFBL 3VXQB 5E08H 4YBLC 2VL5B 4JQXC 4WY7H 1RAMA 4O02L 1J18A 2A6JB 4Y2DC 5HHNB 3OXRB 1YN6B 3SE9L 1FJ1B 5JXEC 1T21A 4EEEA 3LMJH 2GK2A 4CU7A 3OAUH 4XNXL 4QRSA 2NX5E 1MCJA 1AGEA 5JPNB 2ARJB 4PJDF 5HHVL 3EJYD 3CSYA 3QPXH 5IMKB 4PLNC 3PXHA 4GKSB 2BNRA 3UTSB 2PR4L 4JKWA 1CXFA 1INEL 1DE4A 1VFOA 3D0LA 5IROA 4ZFZA 5DZNA 1YY8A 5K33A 4ZUTB 3BH9A 4CVWA 4M5ZH 4N0UB 4NM4H 4EI6A 1FORL 4LDLB 2ITDB 3QCVL 3HNVH 2V7NB 2MFNA 1KTLB 4LEOB 3J8F7 4OJFH 5D8JH 3AB0C 3SDYH 5IM7B 2XZCL 4S1QL 3D2UD 3AREB 5ITFB 1JHKL 1SYVA 5F72S 4ZPTA 3T0EC 1F45A 4ZYKB 3WNOA 2VLKA 3DRQA 5MP6H 1GIGH 3UMTA 3DV4B 5I17A 1FYTD 1R5VB 4OZGB 2B39A 4OLVL 3DMMB 1KCSL 3HPLB 1QRKA 3RWCA 2GJ6D 5E5UB 5FYKU 3AAZB 3P0YL 1AO7A 1ZE3C 1JV5B 3DYOA 3LEXB 1G6RL 4P2QD 5INCA 4NQCA 2AK4B 1P5VA 1S7UA 3IAQA 1OWWA 3CVIH 1V3JA 4XPFH 5IW1A 5SX5K 4UIKH 4X4XB 3X12A 1FGVL 3CFDB 2OYPA 3I02A 1KENH 2AW2A 2ADGA 3VFVB 4O4YL 4KRPD 2VDOL 3O41A 4L29B 1N2RB 4YDIH 5DRXB 2FX8H 3VXQA 2J8UE 2VL5A 4L3EA 4G6FD 1Q94A 4IRJA 4XZUB 3QA3B 1KJMB 1TQBB 4HWEH 3N1FC 4DOHE 2WBJA 3FRUB 4YJZL 4KH2A 2WWMC 1UB6B 3SGDI 5HHOA 2PW2B 4KUZL 4EVNA 5DURB 3SCMB 4KDTA 5BVJB 1F58H 4J7RA 3IT8D 4DTGH 2BHUA 4D0CA 4L8SB 4F15B 3CSYB 4L4TE 1I3GL 2R23A 1I1AC 3CAFA 1H5BC 4XPTH 4AY0A 4GKSA 4LP4A 1YECL 3U83A 2AGJH 4Y2OA 4Z7WA 1ACZA 5E6YA 4N9GB 2YD1A 3VH8G 4MA3A 5E00A 1MJJB 3VFWA 5EB9A 1ZS8B 3CDFA 4KGLA 4ZUTA 1T4KA 5EDXA 5FK9B 5GJSL 2OTWB 4E41E 4TOYH 4HWZB 5C09D 3F5WA 2DDQH 4JRXB 4F7CB 3ULUF 4Y8AA 4UAOC 3UO1H 1YEKH 2V7NA 3OMZA 3ZZ1A 4ZXBA 5F7DA 2B8OT 3QCTL 3NIDF 4JVPA 2EDNA 3WO4C 3DUHA 3TLRA 3RVUC 4P46A 2Y6SC 1DQQB 2H1PH 4RMTA 3T1FA 1INEH 3NCYP 4KAQL 5EBMB 4WTZA 1KIRA 3KYOA 3DV4A 5I17B 5C09A 4OZGA 2OSLA 4IMLB 2M8XA 2NXYC 1JZ6A 5DMKB 1CL7I 4V1DE 3AAZA 2NW2B 1IFHL 1AO7B 2XG4A 4RA3A 1NGYA 4WUKL 1NKRA 4JO2L 4U2ZA 4D3CH 1OP3K 1YYLL 4O58H 4AIOA 3DRTA 3X12B 3BRGC 3I02B 4JDTH 3QDMB 3VFPB 2X9YA 2BDNL 3C5ZB 2AXHA 3MSPA 2FZ3A 3PV6B 5I75B 1KPRA 1R5IA 4TYUA 5FB8A 4HPOH 2ZJSL 1J0ZA 3G6AA 4PRHD 3KLHC 1F11A 1NCDH 1NJ9A 1QZ1A 3SKOA 1UB6A 1UJ3B 2PW2A 3O3EB 4EVNB 5DUBA 5JIHA 4GT7A 1HEZA 3RA7L 4Y4HB 2EIZB 2ADJB 4YZFF 4WWKA 5GIRA 2C3VB 3FJTA 1U2HA 4RAHA 2VR4A 1PGRB 2R23B 2EZ0D 3JV5A 5M7QA 3OF6A 4Z7NE 5L9DL 4UB0L 3UTSD 4HIEA 4R7NB 4M6AA 4N9GA 5EUOF 3TJHC 4MA3B 1MOEA 1G9NL 4GMSH 4JFFD 5E00B 4P23C 1ZS8A 4RGOH 3T1WA 1T4KB 2J7LA 4PJFF 5DQ9A 5JA9A 2VMFA 1RI8A 1FO0L 3WSQL 5C0RH 3IFOA 2Y06L 4JRXA 1P2CA 1KV3A 1CBVL 4HCRL 3EHBD 3PWNA 2VDPH 5IKCA 4DVBA 1QFHA 1VADA 4HDIB 1XIWA 2F74A 4FMKA 4PD4J 4PJHF 1RUPH 3SOBL 4WHYH 1NDGA 2YC1A 1M05A 1MJ7H 2DQTH 4N68A 4P46B 3NIGF 3TFKC 5JO5B 2EXWC 3NIDE 5EZLB 4PJ7A 4PJAF 5L2KA 2EZ0C 5EBMA 1DLHB 3VXOB 2AKRB 3DO7B 2HT3D 4IMLA 4ODTH 3IJSB 4J1UA 4OCRH 1DUZA 4EUPH 3SPVA 2DB8A 3FO0L 4QHMA 2E6JA 4U1HB 1G6RA 3ARYA 2RB8A 3MCG1 2YK1L 4BFGA 3I6KB 4L4VE 5LXGL 4X7EC 4OM1L 1A3QA 4X6CA 4DUVA 4E5XB 4K07A 1ZT1A 3N9GH 4PGBA 1TJIH 4X6DA 4M61A 4NNXA 4ZDHA 3IS1X 4L4TA 3UBXG 4NKOB 3EOBA 3TGXA 3U0WL 3PV6A 43C9A 1KPRB 1L9NA 5DJ0B 2E6QA 2C3GA 4LQ1A 3RDTC 3V7AG 1GCFA 4JFYA 2YWZA 3ET9F 3BT2H 3G6AB 4MLSA 3VA2C 2HFEB 2R2HB 2EDLA 1A6AA 2L7UA 3MJ7A 3MV8D 4E41A 5L7XL 2Z8SA 2NY5L 5DUBB 1NGQL 4G5ZL 2DWEA 3DX9A 2L0DA 2NXYD 3SGDH 4WWKB 1SJEA 1BP3B 1IC4H 2WLZA 1U93A 3DUSA 4D0BA 4JB9L 3WFCL 1ZSDA 3B9KC 1JUFA 5SWZA 4LCYA 2BHYA 4AEHH 1NBYA 4WO4A 4PJDA 1Y6NR 3VWJC 4U1LA 5EOTB 3SGEH 2DOCA 3EOAB 5TE6L 4M1GH 5IVOA 3T0ED 4HDIA 5GS2H 2IEPA 1YNTB 4YBHA 3MMEA 2JJVA 3DX6B 1KG0A 1GGCL 3OQ3B 1HIMH 4G7YH 1F8TL 4MA8H 3C60C 3HZVA 3TNNA 5IBLC 2R39A 3Q3GB 3E6FB 3UP1A 3VXOA 4RGOL 4JVUA 1TZHB 5E94A 4HULB 5T5FL 1NGXB 2C26A 1M7DB 2UUDH 3A67L 4ODVL 1DCLA 1S7VB 1NEZB 5A1AA 1KJVA 1YEGL 4R7DA 4PS4H 3CX5J 3GFUA 3T09A 3WHE0 3ZKQD 1FPTL 4X6DB 5IFJA 1I9IH 3CMOL 4GRLA 3NFPB 4WFHE 4NWUL 5ANME 3THML 2EH8H 4NKOA 4ZUSB 2CJUH 4NC1C 4GRLC 4OBSA 5DJ0A 3GMMB 4UUJB 5IIEA 5JXED 3WKML 4NJAL 5HDOA 2R2HA 3MOAL 5E8PA 2BFVL 3MJ7B 4E41B 3MV9B 4TVPD 4MNHA 4HAFA 4GBXA 4LCIL 1JP5A 1QNZH 2QV2A 2J8OA 1FZMA 1S5HA 4QHLB 1ZHLA 1T20B 1U93B 3Q5YA 5DS8B 4PJHA 4D0BB 5AWNL 5EWIH 4YAQA 4IRZH 4NRZA 1JUFB 1I1YB 4LCYB 4FP8L 3ROOB 1NBYB 2XKNA 4ONFH 1NUDA 4MZ3A 3T3PF 3AGVA 4JKPL 4PJDB 1GHFL 5IHLB 5BZDB 2IBZY 3P3YA 4V1DB 5EOTA 4CVZA 4FG6D 1BVLA 3MODL 1CWVA 3F7YB 4X9IA 4EIGB 1HHJA 2AABH 3ARBD 3D85A 1MFDH 4W4OC 1DUYA 4ZAKA 3RUGB 4UNVA 3BZDA 3DX6A 5IWLA 4FQHA 4OCSH 4UT7L 3WIHH 2V5YA 4OF6A 3QO1B 3TNNB 5D71H 3E6FA 4PJXF 3WFEL 3CLFL 4LAJH 4RISH 4QOKE 1J87A 3WHE1 1MAJA 2DKUA 4I48B 4WGVB 4TSAL 3ZE1E 4XVSL 1LP9E 3HMWL 1XGUA 5LCVH 2B5IC 3QDJD 3KGRA 1P84J 1UM6H 1G7HA 3FT4A 3MCLH 1WICA 4MDJA 5EA0L 3UBXI 4HUVB 5C92A 4QYOB 2X41A 2X40A 3KLDA 3MV9D 1NBVL 4MQXC 1P1ZB 3PE9A 1BPVA 3GUTB 2ZCHH 3DXAE 4H0GA 2F54E 4GRLB 3DBXB 3BYYA 2GTWB 4ODVH 1O5DT 4YHKH 2YHGA 3SCMC 4BH8B 1I9RH 3OTTA 5T5FH 2VLJA 3HRZB 1QRNA 3QWRA 3BKJL 4LIQL 1Q0XH 1RVFH 5FGBC 5F9JA 4TSCL 5BO1H 1T2XA 3S4SG 4M48H 5I19L 1MHCB 4GBXB 4X7TA 1QLFA 1E6JL 2WIMA 3DXAD 4ZFFB 4KUCD 1UQSA 1X5XA 3GHBL 1IGFH 4JM4H 2GSIB 1EDQA 1AGBB 1G6RH 4HXBL 5D1ZB 3KWWB 4ALAH 1HK6A 3QWQB 1PSKL 3NZHH 5DZLA 4P2OC 3HB3C 4U7MA 3FB7A 4X98B 5KSAC 1W0WB 4OBRA 3U36B 2BJMH 3W0WD 4LLWB 3Q6GL 1Z3GL 4O5LH 1A6TB 1CE6A 4EN3D 5B3NA 1LK2B 3QRFM 2CDEA 4EN3C 1XCTA 1ZLWH 4Y2DA 3JVGA 1GGIH 1H3PH 4BH7A 4M7LT 2OJZH 1ZA6B 4NO2A 1INQA 1BD2D 3ISWA 1CTNA 4NM4L 4ENEC 2EDRA 4MMXC 5CZKA 2ZP0T 4XBGA 4I0KA 5T3ZE 5C6TL 4N0CC 1OM3L 5AUMA 1G0XA 1Q8MA 3ARGA 5BRZE 2F19H 4MJ4A 1AXTL 2Y07L 5D1QC 3LQZA 5FO8B 1VGKA 3ARGC 4HUVA 3P4OA 3OZ9H 4I0PA 2HP4A 4XNUL 3BMVA 1JPSL 2ICEB 5I9QC 2NY4C 1IL1B 3BEVA 1SEBB 4DGVH 1FFRA 3SCMD 3WS3B 2DYPD 1MELA 3ULVH 3EOYG 5DC4B 5CILH 2VERN 2R9HD 3ZYIA 1I4FB 4O2FB 3K2UL 1YN6A 3MYJB 2QKIA 1S5IH 3ORJA 1WUNT 2WWKO 1DJSA 2HLFC 1MHCA 5I8CA 1QSED 1FFPB 4PRHE 4N0YL 5K9JH 2WUCL 4U1KA 1OQXA 3FONB 1U8QA 5JPMA 4P9HL 4TVPL 4WW2A 2ARJA 1J0KA 4MQTB 3VFMB 4ODUA 1CLYL 1C5BH 3LN5B 5JW3H 3SDCD 2AS5M 2MJWA 3QUMH 4LIQE 2AXGA 3NOIA 4WTWA 5B22A 1V7NH 4H1LG 2FGZA 3OR7A 4ZFZB 2OK0H 1X5IA 1CICD 1B6DA 4GLRI 4ISVB 3U36A 1F90H 2VB5A 5I15L 3QHFL 1L0YA 1RJLB 2FJHB 5D70L 1I75A 3U9UA 4FQXD 4PYGA 5DWUH 5J9PB 2ITDA 1U8LA 1CI5A 7CGTA 4H5SB 3UJIH 4HBCH 1KJ2H 3OKOA 2YK1H 3O6FD 4DW2H 4UTAH 1J05A 1BBJA 4Y4FB 1BEYH 1CCZA 2BJML 1P69B 4OCRL 1BMGA 4GG8B 4HH9A 5BXFA 2Z9TA 3SE8H 3HZKA 3QPQD 1JPFA 1VEMA 1P7QB 4Q0XH 4RX4A 4G42B 3KS0J 3S7GA 4S1DC 4R0LA 1NC2D 5F7MC 3GSOB 2K7QA 3RWCB 2K9UA 1A7QH 1Q9OB 2JK5B 4XAWH 3TCLB 2H45A 5INCB 1C12B 3RVVC 3KYNB 4X6BB