5D5ME

Structure of human mr1-5-op-ru in complex with human mait m33.64 tcr
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
200
structure length
200
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVMDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 200
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d5mE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d5mE02
5C09E 1MF2L 5HVHC 3P4MA 1XF4A 4FFVC 3NOIA 4CADB 4FQ1L 3RVTD 3KYKL 3QJFA 1DN0A 5IMLA 3MLSL 1A21A 2CLZA 4XHJC 1TNNA 2I9LA 4O4YL 5CMAA 3PHOB 4X6BB 1XZ0B 1CXEA 4ENED 1RVFL 4HG4J 2DDQL 4K7PL 2VLJE 4D0CB 2C4FU 1FBIL 3HC4L 1PEWA 2I5YL 1YEIL 3W82A 3MRBB 3DX7B 1XGPB 1JNJA 3PWPB 4M8QB 4LLWA 4NRXB 1KNOA 4PJCF 1FVCA 2IPTH 5GRWA 1ROWA 1NKOA 5K93A 1YYML 4HUVA 5E1HB 4P5TB 1Z2KA 5A2IH 4PY8I 5I30H 4YXHH 1B4RA 4OZIA 3G9AB 4Y1AD 1NGWA 1UYWL 4OF7A 3MR9A 1T1XB 2ZOLA 3N1FC 3ZMRA 2CXKA 2EDBA 2OMBA 4ZUSB 5GS1C 2NY3C 1W72B 3DVGA 1VEMA 1WAAF 3CAFA 4JRYD 1G84A 3T0VA 2YD5A 2Y6SC 5I1AB 1PLGL 3TBYA 4NO0D 4MJIA 1KB9K 2DQUH 2BVQB 2SEBA 3JVGA 3V7MA 2C1PB 3QNXB 4X4ZA 3UTPD 4YDVB 2HFTA 5F71A 5K59E 3P4OA 1Q9KB 2OJZH 1FLRL 5BCAA 4RMTA 3G5ZA 1R24A 3PGDB 4R26L 4P3DB 3MRIA 1K4DA 1ZVHA 4KK9C 4ZUVB 1MCDA 4FQ2H 5TFSL 3VFSB 2D7OA 1DQLH 2GJ6A 4NYLA 1Q94A 2RCSL 4GS7B 1R5WB 4F8TA 1YEHH 4NZTH 4ONGL 1LO0L 2FX9H 3P11H 1QFWL 4FQCL 4NGHL 2PO6D 2V9RA 4LF3B 1UEYA 1KG0A 4OLUL 1A6VL 3MRHA 1MJ7H 3EYFA 2PF6A 4MD5A 4P99A 4QHMA 4RNRB 1UM4H 6FABL 1NEZG 1AD0B 2FWOB 1BAFL 5HHQA 4OGAD 2W0FA 3S36X 2XZQH 1A14H 5I15H 1VSCA 5CLTA 1UJ3B 1N7MH 1AY1H 2EDYA 1HE7A 3RA7H 3CU7A 4DKDC 2ICEB 4G8IB 3OF6D 2A6KA 2I25N 3RWFA 3LKRB 1OLLA 5MP6H 1EXUB 2N56A 4NQDD 5FDYA 4Q6IB 3QHFL 4K55A 3QG6B 3VFVA 4PLKD 2PW1A 2O5XL 4P57B 3OL2A 4WW1B 3P9LB 1NEUA 1FG2A 3SOBH 5IR1A 4OV5A 3IDIA 4EN3B 2AGJL 5HJ3B 3FQNB 4I9WE 4U1NA 2YPLA 3OKKA 3Q0HA 4DKAA 3ETBF 3PG2A 3OB8A 4HEME 3VFOA 4UI2A 1U41A 1IGMH 2IBZY 4NKOB 3L3HA 4JFFD 3EJZD 4FXGA 5CKGA 2AABH 2QHLA 4LLVA 4NKDB 5J13C 4WY7H 1GOHA 5HBBA 4U2ZA 3PL6C 4UTBH 1V7MH 2VR5A 5I1HH 3KPLA 1T1YB 3X14B 3U9UB 5INDB 1MHHB 3G5VB 1PVHA 1YJDH 5FGRA 3H2WA 1N4XL 3WNLA 4UDTA 4YEFA 3F7RA 4KK5D 2CR3A 2JK5B 5BJTA 2BNQA 4P3WA 3WSQL 4Q7DA 2IG2L 4WTWA 3GJEB 1OAQL 3N1GC 1GC1L 4XNQA 1IGJA 3C8DA 3DMMB 3VD4A 1I1AC 5BZDB 4JAMA 1KFAL 2AK4B 1SBSH 5L2KB 3DROA 1WBXB 1J1PL 4OD3L 1CDJA 3AREA 5EC2B 3GSQA 3TT3L 1I8LC 3OHXA 4L5FH 3CIQA 4O51A 2NZIA 4K2UL 1ZLWK 5DWUL 1BZ9B 3DRTB 3ZDXF 1NCBL 1FYTB 5SWZB 5E9DA 3TF7C 2DKMA 5F8QC 3VFTA 1QRNA 3VXSB 1D5IH 1P5UA 4E9LA 4WEBL 5B38A 1UWEH 1Z9SA 4OT1H 4YHIB 2Z31B 3QXAA 4XCFH 2R0ZH 5BOZG 1ZT7B 1E27A 4ZO6A 1FL6B 3OGCB 3EO1B 3UJTH 1ZHLB 1QTYT 4FQXB 2IC2A 1LQSR 2XG4A 4CDHA 4EOWL 3KYNB 4RX4D 3SE4A 4PJIB 4D9QE 1KCUH 2Q87A 1ZV5A 2YEZB 4HZLA 1J8HD 2J6EH 5ISZD 1YNKH 1H3XA 1K8DB 1Z3GL 4M7ZC 4P4KC 2PTTA 1CK0L 1XF4B 3FAXA 3CU1A 3UDWA 3QJFB 1DN0B 2WBKA 4S2SA 2CLZB 4NNPH 2DL2A 2I9LB 4JG0H 4JJ5A 1RZ8A 3O4LE 5CMAB 3HUJA 1ZT1A 2QSVA 3RVVC 2WINB 3IRPX 3R1GH 3O8XA 2WMPA 4PJFE 5B8CC 2QTEA 4HBCH 1ZT4A 5AAWA 2YKLL 3LY6A 1KNOB 1FVCB 1AKJA 2N1KA 5E5RB 3BSZL 2JIXA 3OSKA 5JNYB 3DVIA 3X3FH 1U92A 2VDLH 5KANG 4OZIB 3V6OA 2NXYB 1MJ8L 2XWJB 3AS0A 3QUML 3ALWA 1OTUC 4WTZG 1NGWB 3AUVA 2B4CH 3MR9B 1OTSC 1RAMA 4LQ1A 4XWOC 5I30L 3DVGB 3ARWA 5GGUB 1UH3A 2DQIL 3BDYL 3TBYB 5FYKE 4NNYB 4MJIB 3L7EB 4MQ7A 5IB4A 5D96C 3GI9H 1S7VB 2NPLX 2IANE 4J4PD 2EDXA 1MAKA 3P4OB 4JM2D 2E7BA 3U0TA 3G5ZB 4XVSL 3MPCA 4BK4A 1JCKA 3BYTA 4GLRH 3VXQA 1R24B 2IQ9H 5ETUB 3MRIB 1JTPA 2XQBH 3V52H 3HNTH 4TNWF 2OJZL 1CLOH 3PE9A 3BPNB 3Q6GH 4U1HA 2GJ6B 1ZMYA 1Q94B 2AXGB 4LU5H 3VI4E 3SE9H 1X5AA 4EKXA 4FQ2L 1QEWB 1FL5A 1SQ2N 1HINH 4KJPD 5GS2H 1A7RH 1G7IA 1KG0B 4UAOC 1T1ZA 2FR4A 2UY7A 4EZMA 4LNRA 3EYFB 4NZTL 3SGEH 3P11L 4H1LG 4QHMB 5CZXD 1Q38A 2AXFA 4JDVA 2YD8A 3CSGA 4XP5L 5FO8A 5JW5B 2AQ1A 4MDJA 1MJUH 2G5BA 4E0RB 4GLRI 1CLCA 1G7QA 5EU7E 1MJ7L 3K7UA 2HLFC 3J8F7 3M8OH 4K8RD 3VFRA 4U1GB 5HHQB 2W0FB 5LAXA 3KPRE 1UM4L 4P2RA 4GRLC 1MCNA 4LCWD 1SVZA 5A40E 1J05B 4M7JH 4KROB 3FT3A 2FBJH 1A14L 3RWFB 2A6KB 4PJEA 3LKPA 4C4KT 1CR9H 1HSBA 1AY1L 3PGCA 3I6LD 4Y0GA 1D5XA 1I1YB 3VFVB 2PW1B 1CVSC 3M45A 5E4EC 3SGEI 1T20A 3NVQA 4PBXA 5IR1B 4OV5B 4UT9L 3IDIB 1Q72H 3GIZL 4PJCE 2V5YA 4TPRH 4FABL 2YPLB 4YDKL 3CGTA 3OKKB 4N0UA 4H0IA 3PWUA 3WIHH 4XX1G 5FYKL 1T7WA 3D3VA 1I9RH 3ULUC 2DWEA 2JB6B 1EUUA 3VFOB 5FUCC 5ID0A 3GDBA 3L3HB 4FXGB 1D5ZA 4LLVB 3C5ZC 3QIUD 4P0DA 2KDGA 3D2UD 4P4RA 5D5MF 5AYUH 1WAAE 3CXDH 1IGML 5HDOA 4RA0C 4X9IA 1JBJA 4XNZC 4BK5A 1QUNA 2BVYA 2D3VA 1DFBL 2Y07H 2VC2H 4IRZH 4R4BA 2P44B 4K7PX 4UDTB 3SKMB 1V7ML 5BJTB 2BNQB 2F54A 1YJDL 3BKYH 3QUYD 5LG1A 3TVMC 2W0KA 4XNQB 1KCVH 1IGJB 5KG9A 4CAGA 2OTUB 3GM8A 4JAMB 5CEYB 4WU5B 4Z78A 3B5GA 3QQ9D 1JPGB 3UTSA 2YUXA 3DROB 1SYSA 1KF9B 1INEH 1MVFA 3GSQB 1U58A 3OHXB 3ARTA 4H8WH 3PUCA 2VNCA 4QRRD 4QT5B 1FO0B 4O51B 2ZCKL 1VESA 4GT7A 3P2TA 5EU3A 3CCHA 1CDYA 1VDGA 5CSBA 3V4UH 3VWJC 5C07E 2KKQA 3WD5L 4L5FL 4UILL 1WFTA 5E9DB 3CDGA 3AROA 3VFTB 4I2XA 1XF3A 2DQHH 1JYXA 3MJ9H 5B38B 3O2DH 1KCLA 5F7LB 1MRDH 3PWJA 3QXAB 2EKSA 5C0FB 3KHOA 3D39A 2ATKB 2WP3T 1D5IL 1E27B 4HWEH 4PRAA 4WW2A 4OT1L 1KXTB 2R1XA 3RWGA 1NSNL 3U0PA 1LP9F 1IAMA 2WUCH 1ES0B 2R0ZL 4P46B 4ZFZA 4D94A 5MEQB 1JPTH 1OCWH 4RISH 2F8XC 1B9ZA 2CKBA 5BV7B 5IKCA 1QA9A 2PTTB 3RVTC 2GQHA 1KCUL 3KPOA 1AP2A 1ACYL 3L3JA 4N8VG 4PJBF 3TH4T 4S2SB 5SWQB 3JWOL 4UB0H 2A6JA 1BFVL 5JLZB 3CLFL 3T3MF 1NGPH 2ADIA 4JVPA 1RZ8B 4TOYL 3QIWB 1M4KA 4Y4FC 3RAJH 3HUJB 1KSRA 4KWUA 4LDEB 4NNPL 4HKXB 4S1DD 4JG0L 1CFTA 3WIIH 2IH1A 1N5AB 3O8XB 1ZS8A 1BF8A 1S7WB 5E8EB 1RUAH 3TT1H 5CJBA 1ZT4B 2W9DL 3FN0H 3C2SA 1BFTA 3QA3A 4NT6B 3BGFB 4EXKA 1R5IA 1GGIH 2BVUA 1AKJB 4KY1H 1EA9C 1RUMH 1RZKL 1AIFA 1UGNA 4U1SA 5GS1A 4Q58C 2JIXB 1SMAA 1U92B 3OG4B 3DRQB 1CIUA 4MD0B 3QEHA 3HRZA 1BMGA 4JFDD 1Q0YL 5CJOH 1CE6A 5FKAA 2F19L 4MDIB 3X17A 4M00A 4TN9A 4XB8A 2VZUA 4M48L 2BC4A 5KVGH 4B0MM 1M7IA 4EBQH 4ZFOA 4W6XB 5DHXB 5IB4B 4MQ7B 1IAKA 2JCCA 3HA0A 3BEVA 4W6YB 1KJ2B 1CTNA 1CU4L 4Z95H 1PY4A 2WUBH 3WXVH 4BQ8A 3FOMA 3VXQB 3RUGF 5I71B 3GI9L 2NTSP 4M9OA 1MHEB 4RAHA 4U1HB 1XR9A 1BD2A 2IQ9L 1F90H 4JG1L 2XN9D 2YR3A 1NC4B 3P0VH 3QG7L 3V52L 2DQCL 3HNTL 1LDSA 2J2ZA 2PO6C 2ZUQC 3NZHL 3Q6GL 1FL5B 4OLVH 4ZQKA 4EXPX 3D48R 4LU5L 5EUKA 4YHZL 1G7IB 2PYFA 1T1ZB 2FR4B 2BNUB 3BO8A 4XAKD 4LNRB 2M8XA 1HINL 1NLBH 4PJ9B 3VXMD 5FO8B 3IDNA 1Y6KR 4MDJB 2G5BB 2QEJA 4OGAC 1UT9A 2I9TB 1PKQA 3VFRB 1F11A 2ENYA 5LAXB 4DK3A 3U6RA 5F6HI 4P2RB 4R4FH 3MLZL 3ZDYE 3C8HA 3I50L 2PUQT 2ZWLT 4DEPB 5BW7C 5DQJA 4PJEB 3LKPB 1HSBB 1OSPH 2NR6D 4M4RA 3RX5A 4DUWA 4PLKC 3NH7H 1D5XB 4KDWA 4M7JL 2FBJL 2ZG3A 1MHPL 3S34H 3MREA 5JW4N 1T20B 3B83A 3LZFH 3FRPA 4FMFA 5FM5M 4M7KL 3GM0A 3QZWG 4KVCL 4OCSH 2V5SA 3QRFM 1ZAGA 4N0UB 1MREH 3PWUB 1Q72L 1JYNA 3D3VB 1IMHC 4NOBA 2D0HA 4U6YA 5DD0L 4ZODA 2QSTA 1U3HD 5DZOA 3PL6A 1JZ3A 1BVKA 1AC6A 4JFPA 5KVEH 1D5ZB 1I3VA 1EFQA 5KZCD 2P48B 1I9RL 4P4RB 1AJ7H 1CF8L 4H26A 4HIEA 4O5LL 4KDTC 1KTLA 4IRSD 4OFYA 3PP3K 3V4VH 3OKEA 3T0EB 1NMBH 1HKLL 3V4PL 4R4BB 4KK5C 5AYUL 1JPFB 3FB8A 2EC9T 1LDPH 1I1AA 1SJHB 1P7QD 1IARB 1KLUB 3EJJX 2F54B 3DIFB 3QFJD 2OI9C 4X6FB 5DR5L 1T4KA 4MNQD 3C60A 5KG9B 4E41E 1M6OB 2UZIL 5C86A 4BSVA 2DD8H 4Z78B 1TCMA 4GXVH 5EBLA 3UTSB 2ZPKH 1UZ8B 2LAAA 3ZYZA 2G60H 4LPXA 2XA8H 3QRGL 1KCVL 2ARJA 1U58B 4OIAA 1MI5A 2R2HA 2V7HA 5I18L 2ZP0T 1H8SA 3CCHB 4JHBA 1WISA 2L4OA 1HEZB 1D7FA 4JZJC 4Y88A 1JZ7A 3CDGB 3QT2A 1WC7A 3LOWA 2BK8A 4KFZC 1XF3B 3BMWA 1Y6NR 3AVEA 2I26N 4MA3A 1JL8A 4EI5A 1FVDB 4Z7VF 1JYWA 3QDJA 1JRHH 2EKSB 3EFFB 1SYVA 4G6AD 4KPHH 4M6AA 4PRAB 4WW2B 3AY4C 4JO4H 4P4KA 3H9SA 4PRPE 4ZFZB 3K8LA 1VFBA 4R6UA 5CWSA 3T1FA 2OQJA 2NXZC 4Y19E 5HDQH 2CKBB 4X6DB 4NQUA 4S1SL 1QA9B 4U3XA 3JV6B 3SCMC 3KPOB 4P2QA 1G7PA 1JPTL 1OCWL 1AP2B 3QR2A 4CNIB 4JN2A 4J7RA 4GG6F 3IVKA 2A6JB 4R2GD 2FATH 5AD0A 1RHHA 3QQ3B 3LD8C 1JNNL 4JGMA 1P4BH 1JRHI 2MQ3A 2R1WA 4N90D 4NM8H 2UV3A 4ZTOL 3NBNA 2P8MA 4LSRH 4U6HA 1TQBC 1CFTB 2Q7YA 2K9UA 2IH1B 2JTDA 5B3JF 2C5DC 2WQRA 3SE8L 5D5ME 3TCLA 1UXWA 3MLVH 2OR7A 1R5IB 3CFKA 2DLHA 3SKJH 3WIIL 3Q5TA 3W2DL 3W5MA 4JHZA 3T4YA 1YEDA 1RUAL 4Z7UA 1Q1JH 4HXBH 5KAQF 4AEHH 2ICWA 1GGIL 4RGNB 2IFGA 3EKCA 5JW3H 1CE6B 1RUML 3WDHA 1F4WH 1WLHA 5TPWH 1CFQA 5K33A 4LSQH 2BC4B 4NCC1 1CQKA 5F7HA 1M7IB 1UB6A 3ARRA 4ZFOB 1EVTC 1CT8A 3H42H 4LVNB 5IEHB 5ANME 4YDLC 4J4PC 4L4TE 2JCCB 4JM2C 1ZLUK 2NY4D 3TA3A 4KKLD 1J0IA 1LK3H 4G6KL 3FOMB 5CKAA 1PX4A 1JZ4A 4GAGH 2AV1A 1EUTA 4WFHE 1OAXL 1XCQB 2WUBL 1XR9B 2Q20A 4CMMA 1FP5A 3B6SA 4XXCC 4DOHE 1NUGA 2VXVH 4HC1L 1M71B 5GIRA 4ZXBA 1DDHB 1XIWB 3T77A 5DMKA 5B21A 3W9DB 1TTUA 1V3KA 2V9QA 4ZQKB 5FGCE 1GVIA 4IHOA 3TZVD 3P0VL 5CIPA 5F9OH 5EUKB 4FP8H 2HFEA 4XI5D 5CZXC 3BO8B 3TFKD 5DMJB 1D3CA 1N6VA 1DVFD 2LQRA 2VLME 3U1SH 3IDNB 4K8RC 1UJTA 1PKQB 3BXNB 5FYJH 2AXJA 1F11B 3EUUA 3N1MC 5C0DA 4AY0A 1U6AH 2GW5A 3U6RB 2YD7A 4M1DH 4JVUA 4Z7WF 2DI9A 2XICA 4X4ME 1NFDF 4X5XA 4PJBE 1H0DA 3MLWH 3VXNB 1HIML 3VMNA 3QO1A 1CWVA 5DQJB 2E7LA 3JSSA 4ZPVA 3U7YH 4R4FL 1ZE3C 3DUUA 3KXFE 3HHRB 1NL0L 5D7JC 5IMKA 1TCRA 3MREB 1TZHA 3U48A 5AUMA 2BHYA 5C09D 3VWKA 4N0CD 3NH7L 4K3JL 4ZOAA 3GK8H 2UVEA 1JGUH 1DANT 3S34L 2Z9TA 3O6FB 1A8JH 3P4NA 3LZFL 3KDMA 5GJSH 1HILA 2W07A 2VLRB 4U6YB 4KJQC 4OD1H 5I1JL 4NUGH 3K4AA 4LSTH 2VLJD 5ESAA 3ARBC 1WZ1H 1BVKB 3SKUD 2XACC 3QIUC 1MREL 4G7YH 3CUPA 1F2QA 4V2BA 2OMNA 4HIEB 2VZ1A 1S3KH 1KTLB 3AB0B 5KVEL 3OKEB 1NCAH 4JFQB 3FTGB 3LN9A 5EA0H 2ADGA 5IFAH 3HG1A 4OFIA 4IMKC 3ZE0F 4I3SH 2XY2A 5DD6A 2K1MA 3D0LA 1H15B 3DTXA 3MNWB 4NJ9H 1NMBL 3H0TA 1BFSA 3RKDD 1MRFL 3RUGE 4LHQB 3C60B 3F7YB 4Z7NF 3GJFK 1UH4A 4DN4H 1LDPL 3QQ9C 4LLAA 5HPMA 3JV0A 5D93C 5EBLB 4WWKD 1G7LB 1KIUA 1HHJB 2ARJB 3ABZA 4Q0XL 2R2HB 2V7HB 2DD8L 2VAJA 4GXVL 2ZPKL 2G60L 3MJ7A 1IC1A 2BSTA 4XXDB 5DD1H 3MBED 4NUJA 4KK6D 4ISVA 4HLZG 1JN6A 4QEGA 5EOQL 4MWFB 4XCEB 1BIIA 3O2WH 4MA3B 4WI8A 4EI5B 3OZ9H 2CDEB 3EDDA 3QDJB 1UM5H 5EU6A 1SYVB 1YQVL 3QWRD 4F37K 4WO4C 3MV8E 5DA4A 3LEXA 4P4KB 4MCYA 3QDHA 3H9SB 3SDDC 1JRHL 4HMEA 3RNKB 2KPNA 1VFBB 4KPHL 3AS2A 3THML 3T1FB 1KJ3H 2OQJB 1RJYA 2IPUK 3BD4A 4L9DA 4XX1E 3L95A 2Q8AH 4BSJA 3EZJB 3IETA 3AMKA 4JO2H 5CINH 4A6YH 4JPIA 4P2QB 1G7PB 4JN2B 4QGYA 2DJ4A 3IVKB 5CBEB 3BI9X 2P46B 5DUMH 2AJXL 5DQ9A 2C4XA 2R1WB 4X7CC 1H5BC 2N7AA 5EC1A 4U0RB 2NY2B 3EOTL 2P8MB 4EUPA 4AZ8A 3MUGB 2VXSL 3DYPA 2FATL 2OBGA 3RIFF 2Q7YB 5I1EH 4B7IA 4NM8L 1P4BL 4HUNB 3VFMA 4LSRL 4Y1AA 1UXWB 2XNAA 4I9WD 3CFKB 4YX2L 1ETZA 1S7TB 5DJAA 5T5FH 2OXGA 3VGHA 2J8HA 4AK1A 3T4YB 4JRYA 1YEDB 4MQTB 3V6ZA 3P0YH 4Z7UB 3VFPA 4GW1A 4HIXH 2UZXB 5D7IE 3MLVL 4NO0A 2ICWB 5AYQA 2FD6H 1J10A 4E42A 1IGIH 4GXUM 1Q1JL 4RFEB 3ZKXB 1CFQB 4AEHL 1N59A 3ARGB 1UB6B 4KK8C 4X7DC 2X6MA 5JW3L 1SY6A 3WIFB 4PRHE 1TJHH 1F4WL 2YN5A 1BOGA 3TA3B 4WV1A 4MJ2A 1IFHH 5EU4A 2VIRA 1LO4H 1NGQL 2FEDC 3NCCB 3SBWC 2AV1B 4V1DB 1QSZA 2PO6A 5JPMA 1FQ9C 3NTCH 1LK3L 1K85A 4CMMB 4F9LC 3B6SB 4NC1E 4XVUD 2W91A 1NCDH 5D70H 1R3IH 4GAGL 2CKBH 1C8PA 3V0WH 2P8PA 3BP7B 4ZXBB 3T77B 5DMKB 3NIFF 5I17A 3FFCE 3QEQE 4OZHF 4IHOB 4JANA 2EXWD 1C5BH 2ZUUA 1GGTA 2IAMD 2CRIA 2VXVL 5CIPB 2HFEB 5EZIL 5TJWK 4JREB 2FX7H 4EDWL 5F9OL 4FZEL 3KNBA 3PV7A 4XPAH 3OF6A 1HHKA 3TP4A 5F21B 5BW7A 5E2VH 1IE5A 4L8CA 4NQDA 3U1SL 3UBXB 3WL9B 4WHCA 4X5XB 1XGYH 5I1DA 2R4RH 4GG6E 5LGHL 5F6HJ 4C59B 1U6AL 3QO1B 4JB9L 4M1DL 4ZPVB 5I0ZA 3EYQD 1WSST 5I9QB 3CSPA 3DUUB 4D9QD 1LNUA 1HH6A 3MLWL 2BCKA 1MFBH 1TCRB 1NDGA 5EO9A 5AUMB 4KRPC 4WHTA 3VWKB 4TQEL 5ACZA 2VN4A 1U91A 4JFFA 3VA6A 1V3MA 2HFGH 1CFNA 4KMTL 4B50A 3O45A 4M03A 3EAKA 3P4NB 3O4LD 3KDMB 3BQUC 1NFIA 2OXHA 3LKOA 3E2HB 4WFEE 5A2KH 1S7QA 3LH2H 1AFVL 3GK8L 5DRNA 3SDXA 2KBGA 4CVWA 1WICA 4S11A 4I1NB 1MUJB 2A74A 4RCAA 3NGBC 1KCSL 3MCLH 4YHOH 1ULVA 1RJLA 2JB5H 3CUPB 2A6DA 4OD1L 4NUGL 3DPBA 4AL8L 5T5NG 3GFUA 4LSTL 5HYSA 5CD5D 4IRSC 3QDMB 5DFTA 4LCIH 5GJTH 4G7YL 2ADGB 3HG1B 4PGBA 3JXAA 2QL1A 1OLZA 3KR3H 4OM0H 5DD6B 3D0LB 3NN8A 3PHSA 3GHBH 1FNHA 3DTXB 5IUSA 2FIRT 3D1MC 3MRQA 5IFAL 5LWYH 5D6DC 4I3SL 1NC2D 1P2CA 1AGBA 3C6SA 4H88H 4HQQH 4W6WB 1HWGB 3L9RA 5HPMB 4PRIE 4PJXA 4NJ9L 3WFEH 1BVZA 3A6CH 1LEKA 5FYKD 1AHWC 4WCYH 3OX8A 4R90H 3P9WB 4MNGB 1GGCL 2GK0A 3HC0A 4HKZA 1ONQA 1JNHA 2IAND 2PXYD 2I60L 2DM2A 4LSUL 5TGBA 4OCRL 1JUFB 1VGKA 4BUGA 4DKEH 5IB5A 1MPAH 1GZQA 4NUJB 4UT6H 1BF2A 4DGIH 4ISVB 4NJAL 3EFDH 5E24E 4CMHC 1BIIB 4XP6L 4OGXH 4RX4A 3UXFA 5DD1L 3CSYA 3VXTA 5K9QG 5FO7A 5HYIA 4Z7WE 1U8HA 5EU6B 1J8HA 5ISZA 1NFDE 1YNLL 1CXFA 3O2WL 1H8OA 4XPHH 3DXAB 4ZD3L 5GS3A 1CGVA 3LEXB 4LEXL 4MCYB 3CFCH 5HD8D 3U30C 1RJYB 3QSKB 2YK1H 3L95B 1DBBH 3C6LD 2HVJB 2D4FA 3IETB 2BVEA 4QXUL 3HAEA 3G6DH 3KPRD 1RD6A 3BMVA 3VXUE 4JO1L 2A1WL 1TETH 4R2GC 1AXSA 2FECI 2Q8AL 3DO7A 4P9MH 3B9KD 4I8DA 4JO2L 5CINL 4A6YL 3BDBA 1A7NH 5F1NA 5C70A 4FFZH 5DQ9B 1OAZL 1RURH 5EC1B 2IBZX 5J89A 1LEGA 3IJSA 5DYOA 4EUPB 4RMWA 2MPAH 2CUMA 5FUOL 1BREA 4AT6A 4L9LA 1PSKH 5DC9B 4YDJB 1I8MA 2CJUH 3VW3L 5DJ6A 1PYWA 3VFMB 4Y1AB 4KVNH 2P7TA 2XNAB 5IVOA 4LVHB 3ULUF 4UQ3B 5DJAB 5T1LB 5I1EL 1TNMA 4AEIH 4JRYB 4YHKL 3V6ZB 4Z8FL 5D2LA 3VFPB 4GW1B 4NQCE 4RMQA 5F9AC 5LQBH 3ZE0E 3EHBC 3RP1A 3ZZ1A 3VD7A 4RRPA 4LP5A 5T5FL 3OAZH 1MVUA 3QI9A 4KUZL 4QHKJ 5I6XB 4J4PA 1OHQA 4JM2A 3JUYA 1SJEA 4HIXL 2BY2A 4Z7NE 2FD6L 3FT2A 4U33A 43C9A 4GQ9H 1IGIL 4N0YH 4ZSOA 1BOGB 1ZKAA 4MXVE 3AS1A 2XTJE 4WV1B 1BBJA 5HHPA 3TM6A 2X05A 5EU4B 4XXCA 3BP4A 3CXHJ 3MXWH 1RFDH 4J3WA 1MNUH 5JPMB 5TE7L 3CZJA 1ODAA 1D5MA 3VMPA 5L7XH 3B2UD 4APQD 4LRNH 1JHTB 3OAUH 3CH1A 5M7QA 2P8PB 1Z0NA 3IFOA 1QYGH 1IAIL 2FDBP 5I17B 3ZE1E 3TV3H 3VD5A 4JANB 2DRUA 2RFXA 4NBXB 1NCDL 5D70L 1R3IL 5CILH 3A67H 1RK0A 5CJXA 5I1KL 1DVFC 1E4WH 5C07D 5ABDE 5DVLA 3FCTA 4PD4K 2E9JA 4LCWA 1A4JB 5IB2A 4NKMA 3KNBB 1IM9D 2Q86A 1N0LA 3KLAA 3BPLB 4PRDA 4JDTH 2GTWB 5A2JH 3MLRH 4L8CB 4NQDB 2AJ3A 2D9QB 4LLYA 1C5CH 3RIAK 2FHFA 1FFPB 1JNLH 5I1DB 4O2CA 3MNVA 4XPAL 1IGFH 4WI9A 1YMHB 1S9WA 5I73C 5E2VL 1U3JA 1A6UL 5SWSE 1CXLA 4HEPG 1XGYL 1LNUB 2CIKA 2BCKB 4LPCA 2EDTA 4MMXC 5KS9F 3TYFB 3KHQA 4O00A 4N0CC 4BZYA 2EIBA 1JFQH 4ZO7A 1EO5A 3C08H 5ACZB 4YGVA 3O6LH 5T5NF 1U91B 1MFBL 1CFNB 4G9FB 3O45B 4OF3A 3D2UA 5FUZL 1NFIB 3LKOB 1S7QB 4MAYD 1OWRM 5DRNB 4RGOH 3TC9A 3SDXB 1E6JL 5GGVY 3KPPA 2A74B 3FQTB 3MYJA 3CH8A 1T5WA 4POZD 1RJLB 2Y36L 2A6DB 2AI0H 3MNZA 4LBEB 5HYSB 1OGAB 3CFDA 1JF5A 3MCLL 3QUYA 5DQDL 2OI9B 4XMPH 1N64H 5HHXH 1FFOB 2ICES 1BGXH 4C58B 2YMXL 1OW0C 3NN8B 5FECB 5CIPH 5GJTL 1ZHBA 3SJVE 3S5LB 5DJXA 2NX5E 4WI6A 4QRRA 3KR3L 4F7CA 5F7EH 3LQMA 2IJ0C 3QUXD 2MMXA 3L9RB 4LHUD 4WWKC 3GHBL 4P5KA 4PJXB 4ZS7H 1LEKB 5LWYL 5IHBA 4MA8L 9CGTA 3OX8B 4XNXH 1T2QL 3HC0B 2GK0B 3IRZA 3IS0X 4HKZB 3BUYA 4H88L 4HQQL 1ONQB 1YC7A 2XQYG 1JNHB 4HJGB 1MH5B 4OZHE 5C7XH 4XNYL 4WCYL 1CGWA 3MBEC 5TGBB 1VGKB 4KK6C 4DZ8A 5IB5B 2DL9A 1GZQB 3RWJA 4WFGE 1NAML 4L8SC 3DVFA 3EO9L 4D3CH 3QDGE 1CGSH 4MB5A 4U4BA 3CSYB 3VXTB 5FO7B 4DGIL 1U8HB 1P6FA 3EFDL 4PJ7E 1DBAH 5ISZB 1E4KC 4F7EA 2FRGP 4N8CL 3ULUH 2ARJQ 2MSPA 5FV2A 1IAOA 3RVXD 5E6ID 1NMCC 3L5XH 1I85A 2BXYA 3FL7A 3S6CA 1SJXA 3CFCL 4G8EA 1QSFE 3HAEB 3LD8B 4H20H 1RZGB 1CDHA 4B41A 2UWEF 1AXSB 1PY9A 2Q8BH 2WBJC 4O9HL 4OD2A 5GZOD 5C6TH 5K9KB 1TQBB 4HBQA 1QO3A 1UWXK 1TETL 4L3EE 4XPFL 4XWGH 4PP1D 1LEGB 3IJSB 5DYOB 4TUKH 1A7NL 3H9ZA 1T2JA 2VISB 4FFZL 4AT6B 5FGSA 4L9LB 3SY0A 2HT4D 2CDFA 3TLRA 1PYWB 1MELA 2MPAL 2P7TB 4ZUTB 2VDPH 3RWIA 4PGCA 5EIIB 2VDRH 2CJUL 5D2LB 5E7BA 5C0JB 4GMSH 3UX9B 4JPVH 3QUZD 5E1AA 4AEIL 3X11A 1MVUB 2E8ZA 3QI9B 3SGKA 4YDLB 5LQBL 4Y89A 1SJEB 1A6PA 4LCUA 5DZLA 2Y4SA 1SEQL 3NMEA 4HG4K 4PP2B 4EIZC 1KULA 3FT2B 5ICXB 1WV7T 43C9B 5C0AE 4M8VA 4PR5A 1WZKA 3OKMA 1DSFH 2V2TA 4ZSOB 2JJTC 3K4DA 4Y5YC 1L7IH 1ITCA 3LB6D 3CVHA 3F7VB 2XN9A 1BBJB 3GSUB 5HHPB 4GQ9L 4F9LA 5E8PA 3BP4B 2AJYL 3JBG7 3H3BC 1MWAL 4E41D 1A7OH 4XVUC 2XFXB 1YMME 1NLDL 2ZUSA 1KCRL 3B5HA 3DBXA 5GPRA 3MLXL 1RFDL 4RMSA 1MNUL 3CH1B 3FO0L 3VXMA 3IFOB 3VXPB 1EHNA 1HXYB 2EXWC 3WFCL 1NUFA 3I02A 2RFXB 5L7XL 4NWUH 2H2PD 5GRXG 1RK0B 1HZHH 3ISWA 1G7MB 1YDPA 1DQQA 1QYGL 1ZVSA 3FCTB 2X1OA 4LCWB 1F00I 4YJZL 2VE6A 2A77H 2E5EA 4QRTA 5IB2B 4EUPH 2Q86B 1AR2A 3KLAB 5E95B 4U05A 1YQ2A 4LLYB 4K23H 5C9JB 2OSLA 1QFWM 1NUNB 2X4NA 3MNVB 1YN6B 4O2CB 1KELL 4JDTL 3EYQC 1MIEH 3LRSA 1C5CL 5MEPA 1JNLL 2FJGA 4PRPD 2CIKB 3P77B 5CP3A 4N68A 4LMQE 1GIGH 3STBA 1BVLB 4Y19D 1KYOJ 3SGDH 2LU3A 2C7UA 4NP4H 1BJMA 2QQLH 1U3HA 1K5NB 1S78D 4GG8B 1CE1H 1SY6H 5GGQL 3HNSH 1G7JA 4O02L 3D2UB 5FUCE 5TQ0H 4FQQA 1JFQL 3FO2A 3UZEA 3C08L 3O6LL 1C7SA 3BIKA 4IRSA 3O11A 3DLQR 2EO9A 3EDKA 4X4YA 3RTQD 3MYJB 5CGMA 3SPVA 5E2UL 1T5WB 1A3QA 5CD5C 4RFNC 1EPFA 4RGOL 1BHGA 2CUIA 3D18A 4JR9H 5DVMA 1P7QA 5J11B 3WJJA 3QFJA 3CFDB 5C0BE 4MNQA 3QUYB 4QRQA 3HZMA 3SGDI 4C83A 2X4SA 1U2CA 2AI0L 1KJMA 4OZGB 2DQGH 4S1QL 1JWSA 2Y06H 1PFCA 4U7SA 1ZHBB 3QNYA 2DMCA 2EDQA 4NZUL 4AQ1B 4MVBC 5DJXB 2APXA 3LHPH 1WBYB 1KN2L 5CJ5A 3MLTB 1NKRA 3MV7B 3CNKA 3WBDA 4XP4H 1EJOH 4JM2F 2EYSA 1UH2A 3VGBA 4PGEA 4PLJD 5DD5H 4L4TD 4CL7A 5I8KH 3BUYB 3OV6A 2V5TA 3QDAA 3WO4C 3MODH 4DVRH 1BJ8A 3BAEH 5AG8A 4G5ZH 5GS0C 1DL7H 3C5JA 4XNXL 3CJJA 4DZ8B 1HXMA 4Y5VC 3EGSA 5JXEC 5HDLA 4WFHD 3RWJB 1CS6A 2V17H 4P5MB 5C7XL 2AW2A 2HFFA 4JFYA 2A38A 4HWNA 3V2AR 5I8OH 2Y9RT 2BJML 2VL5B 1TVHB 4DTGH 4CGTA 1MLCA 2M26A 1J18A 2EICA 5K9JH 2M2DA 4F7EB 3WHE1 4I3RH 3QHZL 2AK4E 1CGSL 3BT2H 3QIBB 4NDMA 5L2KE 5FB8A 5HD8C 2O5YH 5EO1A 5EG6C 4HULB 1IAOB 3V79C 5BRZB 2VLMD 1ZXQA 3C6LC 5EU7C 1WBZA 5J7CC 3FB6A 1M7XA 1F3DJ 2DTMH 2XIDA 2B8OT 3SGJC 3ZL4H 3AU1A 4N0FA 5KS9E 1WIOA 5SWZE 4G8EB 1KPVB 2AEIT 4YIQA 1Z9MA 4KRMB 4M4PA 4P23A 3GNMH 3B9KC 1J5OH 2DQDH 4UQ2A 1TTGA 3GHEL 1CFVH 1QO3B 4H20L 1A6ZA 4UDUA 1DBMH 3RVUD 3GMLB 4Q97A 5C6TL 3T8XA 4G9DA 2VMFA 4GFTB 2NLJA 4TUKL 1I4FA 1ZLWH 1RV6X 3RWIB 1INDH 2VDOH 4PGCB 4BH8A 2XA3A 3QULA 1OT1A 4IOFD 1J0YA 3JV5A 2EC9U 1A6TA 3HC3H 4YK4C 1LO2H 4YC2C 5EULV 4C56B 5E1AB 3X11B 1IQWH 4TSBH 4YFLF 1BEYL 1E6OH 1WFNA 2QQKL 2GSGA 4LCUB 4OQTL 5A2FA 1OVZA 1MEXH 1EVUA 5CCKH 1QP1A 4XBPB 4PR5B 5J1AA 3NCJH 2V2TB 5IOPB 1X5YA 3WN5B 4P3CH 3CVHB 2XN9B 4FTVB 1YPZA 1DZBA 3SQBA 1L7IL 1AQDA 4MNHA 5B4MC 3TZVA 1RZKC 2J4WH 2P8LA 3ELAT 4YWGH 5BO1H 2DB8A 3RWHA 4APQC 4M3JA 3UTZA 3C2AL 3MA7B 3EOBA 3BKJH 5L2JA 5HSFA 1QPXA 4ESKA 2R23A 1DVFA 1EO7A 3VXMB 3FRPG 3PXHA 4Z77A 1A7OL 4OQ1A 3MC0A 5GGVH 3I02B 3ZHLA 1JVKA 4AMKH 4Y4HD 4TTDD 4OFDA 1LE5A 2J1KA 1DQQB 1ZVSB 2OCFD 4UOW1 3VH8B 4MQXC 4CVZB 5DVOA 2J7LA 2VE6B 5FF6A 5A16A 5L0QC 4JY5H 4QRTB 2F53B 1X5KA 4YEEA 4EIGB 5GHWH 1HZHL 4ZFGH 1G0YR 4IRJD 4N9OB 4X7SH 2EH7H 4CN4A 4UMGA 4MAUH 2A77L 3NACH 5IQ7H 2X4NB 3GGWB 3Q2CA 5LCVL 2UWEE 4HSQA 2GJ6E 2R0WH 6CGTA 3WE6B 1HNGA 3LRSB 3MV8D 5C09A 5E99H 3TNMA 4GUPA 2J8UA 1E28B 1WQVT 4K23L 4P2YA 3W0WB 2B5IC 3MRNB 1J87A 4UV7H 5KSVA 4PJ8D 1MIEL 2FJHB 4XCNB 3FQRA 4OIIH 3MJ8A 2C7UB 5D7SH 3T2NL 2YPVL 1AH1A 3LS5L 1U3HB 2VLJA 1QVOA 4P2OA 1GIGL 2DLFH 1T04A 5KZCB 1G7JB 4MAYC 4FQQB 2QQLL 3FO2B 3IDYC 4G3YH 4DGYH 3TBSA 3WXWH 3WJLC 4JO3H 3W11D 1SBBA 3BIKB 1F3JA 3O11B 1TQCB 5KBNC 1HDMA 5IMOB 2W0PA 3HNSL 4POZC 5EO0A 1OY3B 4X4YB 1QZ1A 3MSPA 5TQ0L 4X9BA 3SPVB 1ZANH 5T1KD 4J3XA 1XH3A 2VDNL 3D18B 2EE9A 4BKLA 1P7QB 5HYFA 3QFJB 4L29A 1S7RA 2F15A 4KZEL 4MNQB 3IXTA 4QRQB 4X6DF 4X80L 5I16B 3HZMB 3D69A 2X4SB 2CO6B 1J1OH 2XZCH 2ICWJ 4M7LH 4K9EC 1KJMB 2ZUXA 3BZFA 4JR9L 1U8LB 3VFGH 4I13B 1KTDA 4WWKA 4FQHB 4K8RH 4N1HB 4KTEL 3BEWA 3I9GH 3IKKA 2HJLA 4NWTL 3QXVA 1T22A 3A6BL 1GCFA 2Y06L 2EYSB 5DK3A 1WT5C 3STZA 4PGZA 1JGVH 3MBEA 4PGEB 4PRHD 3TNNB 2H32A 4YHNB 3G6AA 3T0DA 4YPGA 5IMMB 1QSEE 4P9HL 5F7WC 5IB3A 1EJOL 1MCPH 1KN4H 3CX5J 4N1CA 4L8SA 3VFWB 1J11A 4S0SD 3C5JB 3TYGH 1KPRA 4YDIL 3EGSB 5I8KL 2ERJC 4WU7A 3QWRA 4DVRL 4AH2A 1E4KA 3BAEL 2HFFB 4JN1H 4X9HA 4G5ZL 1DL7L 4JFYB 1BQUA 3FFDA 3MFFA 1X4XA 1MQKL 2V17L 3VRIA 1MLCB 3FFCD 3QEQD 5EWIH 5IT2H 4G7VH 2UZYB 3OBAA 4NDMB 2E9IA 3BZ4A 5I8OL 3RVXC 5E6IC 3MV01 2IPKA 5K9JL 4I3RL 4R2GB 1WBZB 3FB6B 2VXUH 3BT2L 4ALAH 1FV1A 4N0FB 2FJFA 5JOEA 5GGRB 4YIQB 3WHE0 5C0EA 4P23B 3MMEA 5GZOC 1DANU 2J5LC 2DTML 1K4CB 3ZL4L 2CMRH 4ZYKA 4PIRF 3UJIL 4UQ2B 3T0XA 4PP1C 2D31B 4UDUB 2EDRA 5KTEH 2DQDL 4PYHA 2EDWA 5F88A 4M6NH 5HHMB 3T8XB 1P6AB 2NY1D 3QEGH 3KLHD 1QHOA 2GJJA 2A9NH 4Y16D 1H3TA 3QXWA 4DGVH 2EZ0D 2BFVL 4FZ8H 5EIVA 4BH8B 4U6TA 3QULB 1T1WB 1RHFA 3NFNB 3GKZA 2CSPA 4WFED 5SX5H 5F9JA 3QUZC 4HKJA 4KTDH 3ZKMD 1FNEA 1INDL 2VDOL 5TE4H 1F97A 1V3JA 2NY4B 4I0PB 2GSGB 2JJTA 2BMKB 3HC3L 3HUJE 4Y5YA 1EK3A 1LO2L 3V0AC 4HX1A 2GITA 4ZFFA 2YD1A 5LBSH 1IQWL 1Z5LA 2GFBA 4TSBL 5J1AB 2DIBA 4M3KB 2O61A 5MI0C 5DS8B 3UBXG 3LB6C 3L3OA 2APBA 1MEXL 2EYTA 5HVGB 3PWVA 3TJEH 3GSNH 3I2CH 4L4JA 5F6IC 1VPOH 1YPZB 2HWZL 1P7KA 2XWBA 1CDGA 5D72H 3QUMA 4OB5H 2Z8SA 2MCPH 1AQDB 4MNHB 5FHAH 1X5JA 4U6VH 3TZVB 1MQ8A 3CFJA 5IM7A 2P8LB 2IAMA 3RWHB 2V5MA 1J1XH 1FAIH 2HKHH 1Q9LA 3UTZB 3EO0A 3EOBB 4PRID 4DKFL 4L4VA 5GGSY 4LQFH 5L2JB 3LSOA 5E8DH 2EE6A 2R23B 1DVFB 4QTIL 3HE7D 2Z4QA 1DQJA 5BO1L 1FL3A 3D9AH 2H2PC 2W0LA 1MCBA 3H6JA 3VG0H 3OPZL 2HG5B 3KJ6H 1XGUA 5DXWA 1DR9A 5GGVL 3O0RH 5FF6B 4WTXA 3V9FA 5B39A 3ZYOA 2DIJA 1FRGH 1X5LA 3ILQC 5A1AA 3MRGA 3U4EA 3S3PA 2VOTA 4R0LB 4JY5L 3FZUC 3RY6C 4ZFGL 4UOW0 2Q76B 2EH7L 5C09B 4BQBA 3UTOA 4BFIB 2RAMA 2AEWA 3BKMH 2J8UB 4MAUL 4NRZB 4J3OC 2P42B 5KSVB 5BVJA 5KSBB 1OP9A 1NAKH 3GRWL 3O4LA 4PJAB 1RI8A 2NCMA 3FQRB 4MLSA 5JQHC 2WIIA 5DUPL 3CVIH 2Q1EA 3GBNH 1G0DA 2VLJB 3O4OC 1QVOB 3I84A 4P2OB 3VXUD 4U1LA 4Y2DC 1T04B 4OIIL 3NAAH 4Z0BH 3P40A 3O9WB 1DBKL 2HH0H 3HE6D 4PJFA 1JZ6A 4HV8B 4P2RE 1N2RA 2DLFL 1F3JB 3RTQC 1HDMB 3RKPA 2OP4H 1AO7E 3LDBC 5EO0B 1EEYA 1BFOA 1QBLH 1XR8A 5EZOH 4DGYL 4EI6A 1XH3B 3WXWL 2VXTH 4JO3L 4BM7A 3VXOA 5EN2A 4BKLB 3IJYA 4M62L 4L29B 1S7RB 2XYCA 2UYLA 1R3HB 2X4RA 3V5DA 3IXTB 4J23A 1NC2A 1ZANL 3GIVA 3D69B 1U3ZA 4N8PA 5IESL 2DBLH 3E6HB 4P59H 5C08E 4NM4L 3BZFB 1A0QH 4NQCD 4ZOBA 2NY3D 1FN4A 1FFNA 1QRKA 1P53A 1QKZH 1JJUA 1FFQA 4M7LL 5EDXA 2RQ8A 2IANA 1T22B 2Y6SD 2PXYA 3F58H 4LARL 4K8RL 3STZB 2PETA 1K3IA 3W5NA 4PLJC 4F57H 4NN6B 2H32B 1KJ2L 2NQCA 3G6AB 3BH9B 1F4XL 2R0LL 5IB3B 5E2TH 4H5SB 1SHMA 2XTJD 4L8SB 5D1XB 3T65A 4YBLC 2FCBA 5MEOB 4LLQA 2ARWA 3T0EE 1MCPL 1KN4L 3K3QA 2BRRL 4WU7B 1Z9OA 3WUWA 2B1HH 5DDHA 4AH2B 2CRMA 5CP3H 1ZA3A 1IVLA 4FQIH 4WI7A 1NH6A 5D6CA 3TBVA 1A4KA 1BQHA 1FGVH 3OKDA 1TPXB 1ITBB 2FL5A 3C6LA 1KTKE 4MHHG 1RIVL 2W9LA 4PS4L 3BZ4B 1FZJA 5H37H 3KPRA 1DQMH 4FXLA 5CGYD 2IPKB 5EWIL 5IT2L 1A5FH 3O3EA 4D0BA 3B9KA 3SDAD 1FV1B 1RU9H 1V7NH 2FJFB 3PP3H 7FABL 1CBVH 4YFDB 5HHNA 4W4NA 3MMEB 2VITA 2R2CA 1IM3A 1BWWA 2FSEB 4B53A 5SWSD 3DURB 3RL1B 3LQAL 2CMRL 4PJCA 1B4JH 3AXLA 4YQXL 5F88B 4OM1H 1I9JL 3T0BA 3U4BH 1J0KA 3VFNA 1N6QH 4G6JL 35C8L 4IIQB 3LN4A 4M6NL 4LKXB 4IOFC 4HCRH 4CUCA 3QEGL 4TVPE 2OTWA 4X6DE 5CHNA 5IFHL 3NCYP 2R56H 1WAAA 2OL3H 5GGTL 5CFHA 1J8KA 4DGVL 3RJDA 4HKJB 1FNEB 2FEEI 2R8SH 2Z91B 3RDTD 4IJ3B 5ADPH 4KTDL 4Y5YB 3CFEB 4HX1B 4ZFFB 2DLGA 2H6PA 1Z5LB 1O0VA 2GFBB 4IDJH 4JDZA 1G7HA 5IROC 3TO4D 3L3OB 2GTZA 1KEMH 2EYTB 4GKNA 3FQWA 3PWVB 3TJHC 1IC4L 5LBSL 4APQA 3VRJA 2XWBB 3SJVD 2OM5A 3RGVD 3QUMB 4BELD 2NX5D 4NN5B 3TJEL 3QXDA 3CFJB 3GSNL 5IM7B 3I2CL 2IAMB 1DQDH 1VPOL 3KYAA 3MGTB 5C07A 4OCWH 4L4VB 4ODVL 4RGNE 4OB5L 2MCPL 3LSOB 2Z4QB 1FL3B 1XCTA 5F3BA 1IM9A 4Y4HC 4RIRA 3IFNH 4TTDC 5BMFH 3V8OA 5E8DL 4XVTH 2L0DA 2VLKE 1GSMA 3FONA 3WFHA 1JGEA 3KJ4C 4WFGD 1P9MC 3DX8A 2ZSVA 4IRJC 5B39B 3T0WA 2WK2A 3VG0L 4XPGL 2OYPA 3QDGD 1Q8MA 3QB7C 1Y18A 3KJ6L 3MRGB 3J7HA 1RZIA 1I3GH 4F37F 2DIAA 3U4EB 5HYSG 3MO1A 1JGLL 2GY7B 3KYKH 3BP6A 3NIGE 2X5PA 4LRIC 2C9AA 3TESA 4TVPL 4X98A 1RVFH 5FM8A 4K7PH 3O4LB 3S5LG 2IADA 4KUCF 2WIIB 1J0HA 3BKML 2IALA 2E7HA 4MAYA 1FBIH 1QSFD 4JY4A 1ZLUH 4GSDH 1WJ3A 3C87A 3ROLA 1NAKL 3WJLA 4U1LB 2PYEE 1RULL 4N9GA 5C0CB 5D1QC 2AJUL 5HHOA 3CVIL 3GBNL 4PJFB 4UNTA 1CD0A 5I75C 1IGYA 3W11C 4RFNB 3I75B 1YYMH 2X70B 1N2RB 4L3ED 3CFIC 3RVWD 3NAAL 4Z0BL 1AQKH 3VG9C 4DFHA 2HH0L 5FO9A 4FXKA 1XR8B 1K9TA 1C5DA 3NFPA 2ESVE 2HJFA 3VXOB 1L9NA 5EN2B 5HY9A 3IJYB 2UYLB 4KZDL 2X4RB 3V5DB 5EOTA 5HGDA 1NC2B 3IU4L 2N7BA 4MX7A 2BXZA 3IKCA 3QUXA 4LHUA 2WANA 4ODWA 1HHHA 2FGWH 4I5BA 1WT5A 3Q3GA 1CICC 1FN4B 1FLRH 4HGWA 4I18C 5IFJB 3W81A 3RU8L 2PXYB 3IDMA 4J8RB 1ZWIA 5FGBC 2ADJA 4PJHF 2VLRE 1IEBA 1ZK9A 4LSPH 5HYJB 4PLOB 2R15A 4YHPA 5C0AD 2VXQH 1F6FB 1OT2A 3HAEG 5I8CB 4FNLL 5ENWA 3F58L 3RWCA 2KZWA 4ODSL 1EHLL 4ZTPH 1WTGT 4QXTA 3T65B 1QFWH 4F57L 4FQCH 4NGHH 5DLML 1W0VA 4JM4L 4OCYH 2HN7A 3B9AA 4OCNC 3GSWB 4WHYG 4AYFA 5I74C 5E2TL 3TIEA 3WUWB 4P5TD 5DDHB 1YMMD 1ZA3B 4XH2B 4Y7MA 6FABH 4MA1C 5IJVA 4JKKA 3MV9E 5D6CB 5JIPA 1CDIA 1A4KB 1BQHB 3IXAA 5E6IA 1BAFH 3DYMA 3OKDB 4F7PA 2FL5B 2HJKA 4LGRB 3C6LB 4FQIL 2MWCA 3FT4B 3SKNA 1F13A 3KPRB 5GRYA 4HXAL 4KHTH 3I3DA 3O3EB 4D0BB 4MGXA 1XF2A 3UTTB 1JYVA 3QHFH 4GRLD 2H3NA 1AR1C 4XB7A 2AJSH 2AQ3A 5HHNB 2O5XH 1A5FL 2P1YA 5FDWA 2VITB 1IM3B 1KBGH 3IAPA 5GRZA 1H9VA 4LCYA 1CBVL 4W70A 5JR1L 1NBVL 1W8OA 3GJFH 4PJCB 3E3QE 2NY1C 2FEEL 3JWNC 2DOCA 5BXFA 4Y16C 4XRCA 4MLIA 1II4E 3R0MA 3IYLW 1B4JL 2P24B 3QUZA 1RSFA 4CN1A 3OR7A 4MXWH 3GSVA 3P73B 4URTB 4OM1L 4TUOB 5F9WC 1XGTA 3U4BL 2FZ3A 2OTWB 2H32H 1X6NA 5CHNB 3ZKMC 3QNZA 5T33H 4P2QE 3ZO0A 5IHUH 3PWNA 5E8NA 1N4XH 4HCRL 3C5ZD 3VGAC 2RHEA 5ECJE 1PZUB 3DV4B 4NSKA 3WSQH 5J0BA 2XV6B 2R56L 2OL3L 2IG2H 3E8UL 1XGQA 1OAQH 5E70A 1GC1H 2X1QA 3BN9D 1MY5A 1T89C 4YH6A 2ZKHL 2H6PB 5C0BD 1U8MA 1KFAH 5ADPL 4E41A 1KACB 3WMSA 2GTZB 3JWDL 4GKNB 5DC0A 3FQWB 5EBMA 3TT3H 1PX3A 3BPOC 3DI3B 3TVMD 5DFWH 3VRJB 4K2UH 5DMGC 2LTQC 3K8MA 4X0KA 4U31A 4XAWH 1RJZA 2ZG2A 1NCBH 3MACH 2NW2A 1OD7A 3PDOA 4OKVA 4YBQD 2EYRA 1IKFL 1KEML 4XMKL 3QXDB 5DF0A 1LGVA 4M6OL 4E5XA 5GRUL 1BZ7B 3LQZA 3TBTA 3HE7C 4ONOA 4WEBH 3WNNA 1C16A 2NY0B 1DUZA 1FIEA 1XCTB 3DVNA 1IM9B 2VQUA 4RIRB 1L0YA 4Q74A 3RZWA 3BGMA 5AZ2H 3FONB 3WFHB 1UB5A 4W4OC 3IFNL 5DRWA 3DX8B 5BMFL 4L1DA 2ZSVB 3ESUF 3RY6A 2X4PA 4XVTL 2I07A 3U83A 2NYYD 4YR6A 1RZIB 4PRPA 2MJWA 4HC1A 4BA8A 4D9LL 1Z3GH 4V1DE 4D2NA 3MO1B 2B5IB 2IBBA 1CK0H 3ARDB 4Y19A 3SE3C 3WLBA 1S5HB 3BP6B 1AGFA 2AK4D 5L2KD 5DA0B 4FFYL 5KN5A 2HRPL 2BRQA 4J1UA 1PBYA 4YHMH 2IADB 4WIQA 5IBUB 3L3IA 1DLHA 2IALB 5SWZD 3RZCA 1Q0XH 3DHMA 2EIDA 2FX8L 1EH9A 2VUYA 3SO5A 3ROLB 3VJ6A 4Y4FD 3MGOA 4GAYB 4O58H 1IBGL 3HE6C 3RTQA 4N9GB 4XMLH 2YKLH 3TPUA 1CLZL 3I3EA 5HHOB 5EBWA 5GQBA 2HVKA 1B3JA 3G6JB 3FRUA 1IGYB 4GSDL 5D5MA 3BSZH 1K6QH 1HQ4B 4ZAKC 1RUPH 1FFRA 5FO9B 1MJ8H 4FXKB 4HUUA 3QUMH 4FQXD 2C3VA 1C5DB 3NFPB 3S37H 3K46A 4PB0H 2HJFB 1X5GA 3EIFA 1AQKL 5HY9B 3JTSA 2DQIH 3BDYH 3IKCB 3QUXB 4LHUB 3BZEA 4ODWB 1HYSD 4OCXL 1FE8L 3EDEA 4MJ5A 4I5BB 3CDCA 3O41B 5ESQB 5ALBL 5ANMA 5F8RC 4XVSH 1SM3L 3DETD 4HGWB 4L4TA 3V5HA 3F7PC 4R7NA 4GAJL 2PTUA 1A7PH 3IDMB 4QF1A 2FGWL 2EECA 1D9KD 3FQXB 1IRAY 1FORH 2ADJB 1IEBB 3F6LA 4RSVA 5CJQH 4BQ6A 5CEZE 4YHPB 2X10A 3ARPA 1OD9A 5INCA 5DI8B 2XTJC 3BH8B 3RWCB 3NA4A 4LSPL 4QXTB 3QDME 2VXQL 4X5LA 4RMRA 4YHYC 4G6FD 1MAMH 4ZTPL 3RI5K 4YPJA 2VUOA 5ERWA 2MTPA 4OCYL 3P4LA 1K2DA 3JTTA 4TNVK 4XP5H 2DBJA 5C0RH 1LP9A 3IXAB 4KV5F 5D1ZC 1A3RL 4OZFH 4F7PB 5F89A 3VE0A 2HJKB 3F5WA 4OBSA 3MX0A 1WWAX 4NO2A 5CGYC 3SKNB 4G8GD 4U7MA 4MNGE 1MOEA 2D9CA 4UBDD 4YZFF 3SDAC 3V5KA 1S9VA 4PJBA 1F4AA 4C55A 2J5LB 3M1BB 1XF2B 2BSRA 2HLAB 3RIAF 4RWHA 2H26A 1NFKA 5IHZB 5HI4C 1VGEL 4QXGH 3LPGA 4KHTL 1U8QB 2DQJH 1OGTA 4UT9H 2W65B 5BS0B 5CZKA 2GJ6D 2FB4H 4M43H 2AJSL 4WTZA 5IV2A 1KGCE 3ARZA 3GIZH 4FABH 2Z93B 4YDKH 1FZKA 5EU6E 3DX9A 4HJ0C 4P2CG 3VA2C 3NCEB 1KBGL 3EYVA 5FYKH 4HGMA 2NY5C 5CBAA 3MBXL 3AM8A 3CDYA 3DXAE 5BXFB 4XRCB 5CGTA 2K7QA 3OR7B 3MLYH 1VENA 5E00A 5GS0H 3QAZC 2A6IB 1IC7L 5CEZL 5J12C 3QNZB 4BUHA 3UP1A 1DFBH 4MXWL 3PWNB 5E8NB 2DYPD 2CQVA 4QOKE 3PQYE 4QYOA 3VH8G 3RDTC 4B5EA 2D4DA 2R2BA 5T33L 4K94L 4NQVA 1XGQB 5IHUL 4NRYA 1CN4A 4PJHE 3MROA 3RUGA 2K3TA 1U8MB 3QWQB 3TO4C 1FVEA 4ORGA 2I27N 4OKDA 4H1LA 3HB3C 3QQ4A 5K9OA 4RGMB 5EBMB 4LNVA 5ACMA 2F5AL 3RGVC 1T66D 2ZCKH 4HUKB 2Y72A 4X0KB 5T1MA 1RJZB 2NW2B 3PDOB 3WD5H 3R4DA 4UILH 4HS6A 1L7TL 1RZJL 4E5XB 4Y4HA 3LQZB 3TBTB 4XAWL 2EDKA 2G9HA 3MA9L 4JRXA 3MACL 1A1OA 5I2IA 3DUHA 1QSED 3K2UH 1C16B 5EUOF 3AC0A 2WIMA 1P9MA 3DVNB 4IRJA 2OK0L 2WWKO 5IQ9A 1REIA 2P5EE 32C2A 5T1DL 4D9RE 3AGVA 1UB5B 1NSNH 5DRZA 3D6GA 4OZGF 5DRWB 4MZ2A 2CK2A 3MV8A 5DT1L 2X4PB 3IT8D 2I07B 5IVZA 5ADOL 5AZ2L 4YR6B 3CXHK 4LRIA 4PRPB 4G6MH 2XKUA 4PJ8A 2EXYD 1X9QA 1TMCB 2B7DT 1IAIM 3VD3A 5F1IA 5EZLB 4K07A 1CG9A 3SO3B 5T3ZE 4M93C 1ACYH 5DTFA 2VQ1A 3JWOH 1BFVH 2NXZD 3CLFH 2GKIA 2AS5M 4X6CF 4IOIA 5KN5B 2AEPH 4TOYH 2XZZA 1P69B 1EMTH 3P4MB 3ZDYF 3SCMD 5KSAC 3MCG1 5IMLB 3NPSC 3OXRA 3EDFA 4GRWF 3L3IB 5DMIH 1DLHB 3RZCB 3T1WA 3DARA 5A2LH 1T80A 2VZVA 1F8TL 3ZHDA 1WVZA 3VJ6B 4YHML 3MGOB 3BVNA 3RTQB 2W9DH 3TPUB 2H1PL 3LDBB 1Q0XL 4RAUA 1ZHNA 3FRUB 1MAJA 5JMRA 2JELL 1JHKL 3RVWC 5D5MB 1KLGA 1RZKH 3ZE2E 4O58L 4XMLL 4LLWB 1LEIA 3KPNA 2VQTA 2VH5L 2WSKA 3WFZA 4HUUB 4PREA 1B0WA 1Q0YH 2F19H 3FB7A 4HDIA 1K6QL 4UOJA 4P46D 4HUVB 4DQOH 5D7LE 1RUPL 3ZTNH 4M48H 4X7TA 3N85L 3S37L 5FYLE 4AG4L 4I18A 4PB0L 3ULSA 2ZOLB 2LVEA 4U2YA 3BZEB 2XQYK 1IEAA 4MJ5B 3QP3A 4PRHA 3HFML 3L1OH 1CU4H 5ANMB 3N9GH 2Y7QA 4G9FE 4L4TB 4R7NB 3H7BA 5DJ8A 5GGRY 2SEBB 1TIUA 3QIWD 5HGGS 3SDXE 4LK4A 4JG1H 1A7PL 4LLMA 1UWGH 1K4DB 1FORL 3QG7H 2DQCH 3O8XD 5CJQL 3NZHH 1OGAE 1INQA 2FO1A 3FQUA 4NYLB 4LPUA 1DJSA 5DJYA 1OTTD 2VDQH 4AENA 4YHZH 1KTRL 4Z7VA 3FFCA 4P5TC 3QEQA 5FGCB 5T3ZL 2ED8A 3EW3B 1RK1A 4LCCA 1UKTA 5ERWB 4N8VA 4KAQL 1GHFH 1K2DB 3JTTB 4J6RL 3VDBA 1VADA 3B5TA 1W0YT 1LP9B 3MRHB 1MAML 3ES6A 4YE4H 2PN5A 1TVBA 1A47A 3FN3A 3QISA 4MD5B 5F89B 3VE0B 4ELKA 3F5WB 3OJVC 1B6DA 4XZUA 1B0GA 4ZUWA 3MLZH 5C0RL 5ID1A 2Z8WC 2AJZA 3I50H 5EBGA 4PB9L 2O93L 1FZMA 2YUVA 3DHJA 3T2PA 2FIKA 3V5KB 3K4ZA 1S9VB 4PJBB 3QQNA 5DFVD 4GG6A 3SN6N 2BSRB 1YECL 4K3EL 2H26B 1MHPH 4KGLA 1LMKA 5HTSA 4K9EH 1OGTB 3GMPA 4GS7C 4M7KH 5I19L 1SEBA 1NC4D 3INUH 4X4XA 3X13A 3TIDA 1T03H 4QXGL 4Y16A 5D7JD 2DQJL 4KVCH 4ELMF 1YUHA 1FZKB 1FG2B 2IH3A 2ED9A 1G9NC 5FYLL 3EYVB 1RZFL 2FB4L 4BFEA 3MUHL 4M43L 5DD0H 5CBAB 1JHLH 4U1NB 4OI7A 1QBBA 1CQYA 1DLFL 2PW2A 5DUBA 4PJ9D 1UKQA 1CF8H 1UZ6F 3WV0A 4O5LH 3QXUA 5E00B 4KJQD 1WWWX 1M05A 1PD6A 3ARBD 1UJ3C 4XHQA 4A6YA 3LV3A 1BQSA 3VGEA 1HKLH 4P2RD 3RX8A 1EZVY 1J0JA 3V4PH 3MLYL 4H0GA 4QYOB 5GS0L 1AO7D 3KPLB 2R2BB 5F7NC 4IM8A 5DGRA 4BFBD 1GXEA 4NQVB 3BN9C 1YY9D 5DR5H 4NRYB 4Q6IC 1ND0A 2BVOA 3MROB 5FIEA 1L6XA 2XXMB 2UZIH 2NY6B 1FVEB 2KUTA 3MRRA 4ORGB 4Q9CA 5C08D 3QRGH 3QQ4B 4PRIA 3PV6A 3NA9L 4DN3L 5K9OB 2OZ4A 3U82B 5I18H 4JCMA 2HT3D 4NZDA 4YBQC 1UCBL 3HE7A 5T1MB 2E6JA 2YD2A 3AREB 3HZVA 5D2LE 3IB4A 3RJQB 1KIPA 4HS6B 4JY6A 1MCWW 4Q9BA 4LOUD 1C1EL 4JRXB 3LKQA 3RL2A 5C0NC 1A1OB 1D6VL 4KV5E 2YA2A 4OZ4A 2X4OA 4TYUA 5JPNA 5L9DH 4IRJB 5IQ9B 2R4SH 2DWDA 1QRNB 5TF1H 2OTPA 1NPUA 4Z7WA 3K2UL 3T0ED 4WUUE 3A0OA 1A3LL 1NFDA 5DRZB 4XNUH 4YZFE 5CUSH 4F15B 3SE3A 2EIEA 3MV8B 4OJFH 2NYYC 3QZWA 4FS0A 4F9PC 3MOBH 3DMMC 4PJ8B 4PUBH 4S1SH 4WO4D 1OM3L 5IF0A 5F1IB 1CG9B 3SDDD 5C6WH 4HZLB 1WFOA 3GKWH 5DTFB 2VQ1B 4L8DA 2V2WA 4G6ML 3ARFD 1VFMA 4IOIB 5LJYH 3VXUA 3V6BR 1JNNH 4ZTOH 5D2NE 3FB5A 3UEZA 4WJ5A 4XVJH 3HE6A 2P45B 1T83C 3OXRB 3OB0K 2YXFA 4JJ5B 1BQLH 5I75B 2AEPL 1EMTL 1ZT1B 4ZMAT 1UKSA 4I4WA 3BVNB 3SE8H 5DMIL 4F7MA 1ZHNB 5A43C 1GZPA 1UA6H 2Z31C 3I6LE 4FQLL 3W2DH 1KLGB 1MLBA 4JKWA 1PKOA 1HCFX 4JFXA 1ZSDA 3MZGB 4P48A 4FQXC 3F6IA 3JZ7A 3Q1SL 4NQCA 3FB7B 4HDIB 5CEXA 4U1KA 1F4HA 1U8OA 4NN7C 2UY6A 4TVPD 1KYOK 4DZBA 5E2WH 3T08A 1HYSC 3ULSB 4PY8J 1VB9A 4DQOL 3ZTNL 1DBJH 1QR4A 2A83A 3DETC 4PRHB 2D03L 3HR6A 2LV4A 2Y7QB 2W38A 2DN7A 4G6KH 4KK8D 3UC0L 3H7BB 1D9KC 5DJ8B 2QADB 3G04A 1GAFH 2X89D 1JI2A 3L1OL 3U0TB 1OAXH 3N9GL 3ZTJG 3WKMH 4LLMB 4ODTL 4HC1H 2P5WE 4QO1A 5EUOE 3BW9A 2FEDD 5M95B 1INQB 4XC1H 4KKNA 1EHXA 4MA1B 1AI1H 2X4UA 4MB4A 3HMWL 4AENB 1UWGL 2R29L 2V9TA 4Z7VB 3FFCB 3QEQB 4MSWA 1RK1B 4LCCB 2NXYC 4OZGE 4N8VB 4NFBA 4J3SA 2DMKA 2VDQL 2DKSA 1VADB 4RGND 3ES6B 3MV7E 4PTUA 3SDAA 3S8WA 4KJWD 2AXFB 4JDVB 2GHWB 1GHFL 1L0XA 2F8VA 3BGAA 3IF1A 4ZUWB 5ID1B 1G7QB 1E4XL 1I9IL 3JVGC 4JFEE 4UBDC 1FZMB 4YE4L 1HIMH 2VLKD 4X6CE 2FIKB 1F58L 4P9HC 4WWID 4GG6B 2AEQH 1NAMA 2XRAH 2WQ8A 5SWSA 1NL0H 4WGVB 3FT3B 4GRWE 3BPNC 1JTOA 3FJTA 1AXTH 2OS7A 3PGCB 3GMPB 5FV1L 4GW5A 4OUOA 4K3JH 4HFWA 3E0GA 1SEBB 3WHXA 1MCWM 3X13B 4Y16B 3S4SA 4K9EL 3MV11 1B2WH 4YLQT 1YUHB 1XIWD 3O3BA 1PQZA 3V0VA 5JQ6L 2IH3B 3I6KA 1T2XA 4KRPD 5I1JH 3INUL 1VACA 1T03L 1KJVA 2EE2A 4OF0A 2W60A 1B88A 2PW2B 3PJSA 5BRZE 4X9FA 3IDJA 3BQUD 1JHLL 2PYED 3SEPA 1FNLA 4YNYA 2DWEB 4U1GC 3RDTA 3BPCA 5ID0B 1FSKB 3TWCL 4A6YB 1HH9A 2C26A 5HXMA 4LAJH 4ODXA 4D0DA 4RWYL 3HLAA 3PHQA 3WNMA 1OAKL 1MRFH 3ARVA 2ESVD 3LMJH 1ND0B 1U9KA 2EDNA 5CSGA 5D7IF 5KSBF 3SJVA 3RGVA 4PJAF 1CGTA 1A9BA 2BY0A 3WLWD 1NUDA 2NX5A 4UUJA 5FOBA 1I8LA 1T66C 4Q0XH 3G5YA 5GRVL 2B1AH 5JHLL 1YNTA 5H35A 2IQAA 3O6FD 4OFVA 1WTLA 1SYSB 3HZVB 4PJDF 4OZHA 4R97B 1MCOL 2E9BA 5TQ2H 4JY6B 2VLRD 1G9MC 4LSDA 5EU3B 5FFLA 1NBZA 4M6ML 3S37X 4C56E 5C2BL 3RL2B 2VYRE 2X9WA 5EOQH 4HIJA 4OZ4B 5JPNB 1U0QA 1DEEA 1F6AA 3QDGA 4I2XB 3QJHA 1YQVH 2A73A 1F2XK 4Z7WB 5DHVH 4PJ7A 1FGNH 3PWJB 5HVFB 1NFDB 5L9DL 1MWAA 5GSRA 2P47B 1X5HA 2R4SL 3MUY1 5DURD 3D39B 4FTVE 3THMH 3QZWB 5TF1L 2EXYC 3S36L 2R1XB 3RWGB 3MV9D 3U0PB 4DWHA 4XNUL 1P84J 5CUSL 3C60D 5HVHB 4QHLA 5IF0B 1HCVA 1M7DA 4OJFL 1MFNA 3PWLA 1IT9L 2BY1A 2YS4A 5CSZA 2D7NA 2V2WB 2GEEA 3MOBL 4PUBL 3VXME 5IKCB 1EAJA 3VXUB 2ZCHH 2AJXH 4ELME 5ILTH 3L3JB 3HZKA 3RBGA 2A0LC 5KANI 3GKWL 4WJ5B 3HE6B 3EOTH 3OTTA 4QXWA 2VXSH 2ADIB 3V6FA 4L3EA 1CYGA 2X4QA 2D7TL 5B8CA 3WKNA 4XVJL 1EV2E 1JV5A 4I4WB 2F53E 4XPBH 3ARUA 1UZ6E 1JPSH 4F7MB 5IIEA 1BQLL 1GZPB 3L3KA 5C2UB 3KWWA 4YX2H 5ACLA 1G6VK 4XP9H 2Q6WA 4H1LH 1ZS8B 4JFXB 1ZSDB 1UVQA 2DJUA 4QRSA 3QA3B 5IBLD 1ACZA 1UA6L 4KI5F 3LAFA 4P46C 3WUWG 5DGQA 3LIZH 4NQCB 2O5ZH 1WWCA 1AIFB 4U1SB 3VRLF 2XPGA 3W0WE 4U1KB 5CEXB 2NY3B 5GS1B 4FMKA 1U8OB 5HVWA 2YUWA 4MZ3A 4TSAH 4OGYH 5BV7C 3BDXA 3QEHB 3HRZB 3EHBD 3PHOA 1BQHG 4X6BA 2EEDA 1A2YA 2H41A 3KS0H 5FKAB 1ZLSL 2EDDA 3UDWC 4OLWL 2WW8A 1FG9C 4P2QD 1V8HA 5C0AA 2A83B 3QIWC 5E2WL 2ID5A 1IAKB 2EH8H 1DBJL 1NGQH 3G04B 1L6ZA 2VAAA 3BEVB 4NRXA 3AFLA 4XP1L 1NCUA 1KPUA 5DK0A 1GPOH 4IS6A 3O8XC 1GAFL 3UYRH 4N0RA 1YMMA 4NQEE 4JE4B 2IGFH 3BGFC 3BW9B 4JZNA 2JJUA 2KH2B 1OTTC 4FN0A 2Z8RA 1BD2B 3ARXA 4JZOA 3WKML 2X4UB 4Q6YA 1W72A 2CR6A 5EZIH 4MSWB 5KVMC 4ZOCA 4XC1L 1FZOA 1U8KA 5TE6L 5I1AA 1AI1L 4EDWH 5FXCH 3QNXA 4FZEH 2PYFB 3KPSE 4UT7L 4ZDHA 1YEFL 1Q9KA 2Y25A 4PTUB 1PDKA 1KB5L 2VDML 3ARGD 4GRLA 3T2QA 1UQSA 3ULVE 4P3DA 3LPFA 4HK3J 5LGHH 4ZUVA 5DFVC 4JKLA 4JB9H 4NQSA 1U8PA 3CX5K 3OAYH 4KC3B 5SWSB 5I71C 2HMIC 2VDKH 5E94A 1OSZA 1H3PH 4WI2A 4TRPH 3R8QA 1EHAA 4OLEA 4V1DD 4GO6B 1I7ZA 3ALPA 2AEQL 4KU1A 2XRAL 2HTKC 4TQEH 4HFWB 5FK9A 3S35H 1WCBA 4KMTH 3S4SB 5IVXF 4ZXBD 2HA1A 1AXTL 3O3BB 1PQZB 3V0VB 4HMCA 2DI7A 3I6KB 3IDUA 1AFVH 4TULH 4JFZL 3F7QA 3ZDZF 1VACB 2CLRA 1KJVB 2QSCL 1CD1A 2W60B 1B2WL 4PJ9C 1KCSH 5J12B 3C5ZA 1NGZA 3PJSB 5J13B 3IDJB 5LGKA 4AL8H 4HS3A 3PL6B 3RDTB 4JFPB 12E8L 25C8H 3HI5H 1HH9B 3L5HA 1Y6MR 3IU3A 4FQPA 5C0BA 4H26B 3EYOA 4JJHA 4NQTA 4DEPC 4D0DB 2B0SL 3HLAB 5ESVA 1YY9C 3PHQB 2X40A 4HIIA 3GSXA 3TVMA 3NCBB 3FB8B 1I1AB 3LQAC 3RGVB 5HHME 2NX5B 4DFIA 4KHXH 1T4KB 5F96L 3QUKA 3LMJL 4HH9A 4UUJB 5FOBB 1MFEH 2HT3C 1GGCH 4X5WA 4B7LA 1OL0A 2APFA 4BSVB 1UADC 1YNTB 2I60H 2IQAB 4LSUH 1IC5L 3VWJA 4OCRH 4PJGF 2VZSA 1U93A 4LPYA 3LCYA 4OZHB 3ULVL 3H3KA 4MXVF 1MI5B 4LOUC 2ATPA 4ODHL 4OQTA 2B1AL 5IBUG 4NJAH 5CEZD 3X14A 1FCCA 1NBZB 3U9UA 5DSCA 1MHHA 1I1RA 3PNWA 1MFCL 1PW3A 4XP6H 1I3RA 5TQ2L 2UUDH 4HIJB 2X41A 1ZGLP 1UFUA 1DEEB 2C3WA 5BZWA 1WC7B 5D71H 3QJHB 3PGFL 3QDMD 3T0EC 1YNLH 2A73B 1QFHA 4F9PA 1I7UA 4ZD3H 4C4KO 4LEXH 3ZE1F 5BZDA 1MWAB 5GSRB 4PTTA 1EBPA 3PIQA 1ZA6A 1U95A 5L2KA 4RMVA 2L7UA 1JWUA 1FGNL 1VFOA 1A7QH 4M7ZB 43CAA 2AVGA 1ZGLM 4Z18A 4QHLB 1TFHA 4QXUH 3DRTA 3PWLB 5CWSB 1CCZA 1FAKT 4JO1H 2A1WH 3NPSB 3ARFC 4RA3A 5CSZB 5KS9A 2MOVA 4X7FC 2BNRE 5HI5D 2QKIA 2NY7L 4Y4FA 1OAZH 3HZKB 5SV4A 5J56B 1N3NA 1T5XA 2WBJD 4KUCD 3MOAL 5AD0B 5I1CH 1RHHB 2ZCHL 3BE1H 3OMZA 4XGZA 5FUOH 5ILTL 3OKOA 2X4QB 5B8CB 2D2OA 2LE9A 3VW3H 4U6HB 4FQXA 5IIEB 1KGCD 3L3KB 2Q6WB 5EIQA 4MQSB 4YHKH 5EU6D 2XWTA 4Z8FH 4I0KA 4XPBL 2OZ4H 1UVQB 3TCLB 1JPSL 4QRSB 4WW2C 1MCRA 2F8OA 4DK6A 4IMLA 1EFXD 4JHAH 3DXAD 4XP9L 2J8UE 3C8KA 4KUZH 2XPGB 2JKXA 2FO4A 1TDQA 3S3JA 4CVUA 5KSBE 2CO7B 5GISL 4PJAE 3DWTA 4JFOA 2ORBH 3LIZL 1EGJH 2O5ZL 1A2YB 4R8WL 5D96B 1D9KA 3D5OF 1NMAL 3HCVA 2WINA 1MRCH 1PJ9A 4TSAL 3WUZA 5C0AB 4OGYL 4QOKD 3ARSA 3PQYD 1CT8B 3RWDA 4QY8A 2VAAB 4PJDE 3H9HA 1KPUB 5DK0B 2N4IA 5TE7H 2R2EA 5C3TA 4IS6B 2EH8L 5JNYA 3DGCR 5FCUL 1RUQL 1YMMB 3PDDA 4OUUA 4LSSH 2GYSA 2BZDA 2XWJA 1B6UA 4JZNB 1IAIH 2XI9A 1GPOL 1QSVA 4JZOB 2IFFL 1DP0A 2WP3O 5F72S 1LILA 1VA9A 3UYRL 4UAOB 5T1LD 5GIRB 5I1KH 2IGFL 4NKIH 1MCEA 4JKMA 2VO5A 5GGUA 1FZOB 1U8KB 2IMNA 1OP5K 4RGNC 4QRPE 4NNYA 3L7EA 3T09A 4G8GA 2CIIA 3TN0D 2IMMA 1PAMA 2DQTH 4ZO8A 2G75A 5F93C 1S7VA 4KJWC 4ZDHB 4OLXH 4KTYA 2CRYA 4PFEA 4GRLB 2PKDA 5ETUA 4LVNC 1UQSB 5IP4A 2P5ED 4X83A 4ACPA 4KJYA 3MCKA 5C0DB 1S8DA 4D9RD 1A6UH 4NQSB 4PJ7F 2UWEA 1IAII 1U8PB 2X2YA 2AXGA 3GZKA 1H0DB 1U42A 5DRXA 2FH8A 5E08H 3GI8L 2YHGA 1EJ6A 5E94B 1OSZB 1QEWA 5JW4M 5E4EB 1I7ZB 5ITBL 4GAFB 5T3ZD 4ZNEE 2C3GA 5FK9B 2VDKL 5IMKB 1H3PL 4TRPL 1XIWC 1TZHB 1WCBB 1UENA 4HK0A 1UG9A 2UVFA 5JW5A 5FUZH 3L5WA 1R6VA 4E0RA 3WS3A 2AXHA 3S35L 2CLRB 1E6JH 1CD1B 4KI5E 1KC5H 1IZJA 3S97C 5IJKC 3SQOL 2DYPA 1T0NA 3C5ZB 3VRLE 1NGZB 3RGHA 2Y36H 3AAZA 1HILB 3LEVL 1J05A 1CDCA 4TULL 4HPOH 2DS4A 4KDTA 4HS3B 5ESAB 3RPIA 3DO3A 2GK2A 4QWWD 4XNZB 5DQDH 4JVWA 1G6RH 2ZNWA 5DJCA 5CZVL 1I1YA 3IU3B 5C0BB 1BM3H 3EYOB 2YMXH 3GSRA 1PG7W 5ESVB 2EDHA 2QSQA 3H8NA 1QG3A 25C8L 3HI5L 4HIIB 5JHDE 3HR5A 3GSXB 4NHUA 3TVMB 3VDAA 3FO1A 3WLWC 5D7LD 2X7LA 5TDPA 3CX2A 5AAMA 2VRAA 3H0TB 3I6GA 5FYLD 1TJGH 4MA8H 3QUKB 4HH9B 1GL4B 4Y4KD 5C0IA 1T2QH 3WO3B 4MVBD 2CK0H 4X5WB 4F33A 1CGUA 5KVFL 1BX2A 2JB6A 3O6FC 5JDJA 3L5JA 1QSEA 4XNYH 4F7TA 4G9FD 4KHXL 1P4IH 3G6JF 4OTXH 3VWJB 1MFEL 4JZJA 4O2FA 4WRLA 1U93B 5T3XH 2VR4A 2LFGA 3SDYL 2YRPA 2ATPB 1NAMH 3EO9H 5DSCB 1J88A 1QLEH 3MJ7B 3PNWB 4KQ4L 2BSTB 1I3RB 3SKMA 5GS0D 4LFHD 5BZWB 1UC6A 1QHPA 5JXED 1OGAD 3AB0C 1JN6B 2NY5H 4N8CH 3C9NA 4UU9A 3AY4A 3WFBH 4PG2C 1I7UB 4NO3A 2OTUA 5D71L 1N0XL 3LRGA 4PTTB 3JWDC 4LP4A 3PIQB 4WU5A 5CEYA 1ZA6B 1JPGA 1U95B 3LVEA 4ETQA 1JWUB 2H9GA 3C60C 4UZGA 3TGXA 43CAB 4QT5A 1FO0A 3SCMA 4RFOH 1ZGLA 1BBDH 5KW9H 5KS9B 2Y5TA 4L4VE 4O9HH 1A7QL 1MJJA 2QKIB 1OAYL 5IVXE 4Y4FB 2MHAA 2EDJA 4JPIB 2OR9H 4OBRA 3TPKA 4XPFH 1IILE 2DI8A 1E4JA 4CJ1A 3ZDZE 5MENE 2QQNH 1N3NB 1O7SA 1T5XB 1F4YL 1U3YA 2YPKA 4XGZB 3OG6B 5C0FA 3OKOB 4K7FA 3UTQA 2ATKA 1OP3H 3H9YA 1HN1A 3MOQA 4A2MA 1VKXA 4EI5C 3M17A 3D0VA 3BE1L 5I1CL 1ES0A 1GGBL 3LS4H 1GGYA 4P46A 4I77L 3B43A 5MEQA 1P1ZA 1LO5A 3E3QC 5IBLC 2XWTB 2ILLA 4NN7B 4IMLB 2B39A 3GRWA 1ETZB 5CJ8A 4XPTL 3C8KB 4LSVH 4K3HA 4LAQH 4FFWD 4MD4A 2FO4B 2OZ4L 4TSCL 5SWQA 5JLZA 4JHAL 4NO0B 1SEQH 1F02I 4JFOB 3QIWA 1D9KB 1TXKA 3VXRE 3HCVB 4E42B 2EDLA 4HKXA 1N59B 5JTWA 3OJMB 2ORBL 4HMDA 1EGJL 2E27H 2XXCB 5C0CE 1HK6A 2VTFA 1N5AA 2EE3A 4GOSA 3RWDB 2AJYH 1S7WA 5E8EA 3WFDH 4PJGE 5E0QA 1MRCL 2NY2C 4QY8B 4U0RC 4PJ5E 4NT6A 1MWAH 3H9HB 4OGZA 1VFAA 4G6FB 2R2EB 1NLDH 1KCRH 2VIRB 1ZEAH 3KPTA 3MLXH 1ZLVH 1RY7B 3FO0H 3DRQA 2PO6B 4OUUB 2ZUQB 4MD0A 2IPTL 1A1MA 3ZYIA 2VZOA 3RHWF 5B4MD 3WFCH 2BERA 4MDIA 1MFDH 1NCWH 4YXHL 5LVEA 4LSSL 5DEZA 3OKLA 4XT1C 2RIKA 3B3IA 3KS0J 4J3TA 3U79A 4G8GB 2IEPA 2CIIB 2YA1A 2G75B 4OCLC 4KMQA 3ZKXC 3QI9D 4NKIL 3WNOA 1KJ2A 3ARGC 1T7YA 3BRDA 1J9CT 4MQXD 2DQUL 5HYJE 1OF2A 3HMXA 2DQTL 1I8KA 1KELH 1HHKB 5HGHA 4KJYB 3MCKB 1MHEA 3CMGA 3TA3C 3OJDA 1S8DB 4H0HB 1NGXA 2YBRA 4OLXL 4WUUD 4JFHE 1JF6A 2UWEB 3HTLX 4BZ2H 5T3XE 1NC4A 5JOFA 5DJDA 3I85A 5EB9A 5D7JA 2WBWB 5DRXB 1FNSH 2K7PA 1DQLL 5I8EA 3IGAA 4OIBA 1HH6B 2O26U 3NABH 4X8XA 5E08L 3HI1A 2BNUA 1YEHL 4ZXBC 4NC2B 2VSDA 2FX9L 3D25A 3QPQC 1NDGB 2EEBA 5GGQH 4PJ9A 4HK0B 1QBMH 3W9EA 4O02H 5EO9B 4S1RH 4WHTB 3L5WB 1NANH 3WS3B 1EO8H 2I9TA 4HLZH 3SDCD 4JFFB 1X3DA 3ARBA 4JREC 4WEMB 5J6GA 3DSFH 3QIUA 2DYPB 1T0NB 5E2UH 4J3UA 2DKUA 4PYGA 3AAZB 1A64A 2CKNA 1OWWA 1AO7A 2BVPA 1FNFA 4X8JA 2XZQL 4NC0B 4NO5A 5CP7A 3RPIB 3UTTE 5I15L 1GOFA 1KC5L 2X1PA 4XNMA 4ZPTA 1N7ML 2E8YA 2FHCA 1X6LA 4PJIF 5FA3A 1MCHA 4UV4H 4IMKA 5DJCB 4HPOL 4M1CD 3RA7L 5B38G 3GSRB 4S1QH 4RBPK 5EU5A 2E7LC 5I9QC 5C08A 1YEEH 5MP6L 1G6RL 3IDGA 1W72H 5HI3D 1GRWA 4NZUH 1U8NA 3HR5B 4NHUB 4PGBB 3IS1X 4OAWA 1NANI 1BM3L 3FO1B 1KN2H 1RJCA 2X7LB 3AMLA 5TDPB 3HN3A 5KSUA 3SOBL 3I6GB 2APWA 1PZ5A 3MRQB 3VWKC 1BIHA 3UJJH 5C0IB 1P2CB 1AGBB 4F33B 2A2QT 1BX2B 3C6SB 5GGTA 1YA5A 2ZUTA 2JJVA 2MKWA 1TJGL 1QSEB 4F7TB 4HWUA 3E2HC 1P4LA 4JZJB 4O2FB 2CK0L 1QACA 4JPKH 2ITDA 3BHBA 1JI1A 2AABL 3T0EA 1P4IL 4MMZC 4OTXL 4WY7L