5D5PA

Hcgb from methanococcus maripaludis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
157
Chain Sequence
b'NIENTIKSAYEESLNNARFGDKIEEIDAIQSTIKSAKNVTVATSNEKKFKVVSDIISRITDANISMLEIPTNSADLTRMPALNKGLIAVDSSDADLIITRGRLGIPGSGSLLLIMDKKGRILTGSVSPSSIIHKNPIDKTVELELITALERIGIVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HcgB
publication title Towards artificial methanogenesis: biosynthesis of the [Fe]-hydrogenase cofactor and characterization of the semi-synthetic hydrogenase.
pubmed doi rcsb
source organism Methanococcus maripaludis (strain s2 / ll)
molecule tags Transferase
total genus 46
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5d5pA01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 5d5pA02
3WB2A 5D5QA 1MMFB 2F93B 1RSOA 1EGVB 4DK0A 1IWPB 1EEXB 4DK1A 5D5PA 2D0OB 1UC4B 2D0PB 3BRCA 2V4DA 1T5EA 4L8JA 1H2SB 2F1MA 2F95B 1NBWB 1DIOB 1UC5B 3AUJB 5JJNB 4GYCB 1IWBB 3WB0A 1EGMB 1VF7A 5JJEB 5JJJB 3LNNA 3WB1A
chains in the Genus database with same CATH superfamily
1Y67A 1QIEA 3SHFA 1YIAA 5FBKA 3PUIA 4Q15A 4IKOA 2ZB3A 4DDUA 3Q5EA 1VZ3A 3E89A 1HTTA 3JXEA 4P86A 3U9SA 4MARA 2X9QA 5IJAA 4ZZIA 1ZI9A 3M9LA 3DDNA 3E7XA 1LI4A 3LDEA 3CD6V 5CT9A 5PNTA 4BQPA 5CH8A 4MR8A 5A4MS 8ATCA 1W1WA 5AKGA 2DUJA 1NE7A 1ZD1A 1RJ9B 1CYEA 1E0KA 2B4KA 3RYCA 1FS5A 4CCAA 1BQZA 5DI9A 3CF0A 4LDPA 1HSOA 2FP3A 4MYCA 1QOQB 1G16A 3IB3A 2OFXA 3I5AA 3OIVA 2ZIAA 1V4VA 2RAUA 4BLSA 3NAQA 1DRWA 1IBSA 2Q2WA 4LZLA 1OW3B 5AI6A 3FHCB 1MU0A 1PHPA 3LGXA 1M1NA 4V24A 1N4DA 4QWWA 1C4XA 4AX4A 1Q3EA 3PZBA 2X3UA 4FBLA 3LT5A 3RS2A 1OI4A 2WTEA 3NO4A 4GVLA 4A8JB 5KO2A 3GK3A 2Z5UA 2CLCX 1TU3A 2OYCA 5DVZA 4QYWA 5IZCC 1V16B 3G6EV 4IOJA 3DFIA 4C78A 3WFIA 3FH0A 4MJLA 5EYPB 1NKDA 4Q34A 1U9JA 2H92A 1ZJWA 4BVHA 3HGTA 1H1LA 1S5JA 1IDN1 2FZWA 2IU3A 1H38A 3UPUA 4BXOB 4P2BA 2AI3A 3FPFA 1KDVA 4P7BA 2H1RA 2RHGB 3AETA 5A4KA 4DPLA 3RVNA 3CZQA 4G5XA 1YRWA 2NYVA 5JC8A 3RAFC 4PG7A 2PZAA 4NPAA 7GPBA 4ZYYA 2J0UB 1AGXA 2GD0A 4R1UA 2A1IA 4BX8A 1IVSA 4PQEA 1XF1A 2HGSA 4D9FA 4G28B 2OV8A 3GJTA 1IRXA 1JEYA 4HNTA 5AW4A 4J4BA 1Q0PA 5FL7A 3C3CA 2BR5A 5AHKA 1E66A 4OV6B 1NVDA 3B9BA 3EFOB 5H16A 2Q1SA 1XHFA 3QF7A 2PKXA 3WL5A 5BNWA 1XQ1A 2X3FA 3L5KA 3IDOA 2ID8A 5B6PA 3HVKA 4AQDA 2FSIA 4BE4A 3UKJA 4EMTA 3E2EA 2YS6A 2RIPA 1LVUA 1J25A 3MWDA 2F67A 2XVYA 1QLNA 1TF5A 5BSEA 1Y3HA 4IY1A 4DA6A 2R2GA 4DWWA 1KZ6A 1QV7A 2GJSA 4E12A 2FW7A 4GOKA 2PRJA 2JGRA 4QSMA 1DINA 4TQ9A 1V2GA 3ZHSA 4KTVE 5KHKA 5B58T 3NRBA 4M8NE 4NBWA 1DLBA 1YTUA 4EJ0A 1SVOA 1E9SA 1IAQA 1DTOA 2VSYA 1COWA 2R6DA 1MC1A 2QJWA 1YITV 1EBBA 3T5PA 1HM5A 3D6AA 5NLLA 2TYSB 4TQUS 2HWYA 2FEMA 1Z0JA 2AG0A 3BBPA 4B6OA 1ISJA 4HDSA 4HX5A 4CIAA 4NBKA 1GO3F 1FYEA 4QODA 1KQ3A 1BKSB 4QATA 4PQRA 1JTVA 2CNWD 5D8DA 4PBTA 2B36A 1JQDA 2DEUA 2I6XA 4JU8A 1K5PA 3ZMSA 4TUYF 2H7YA 4ON9A 2QUJA 3JQ6A 3PRHA 1Z2AA 1G8GA 1EM1A 1L0BA 3EGVA 1XKLA 4R2LA 2UUOA 4OK6A 2FV8A 1EB9A 1SY7A 1PV2A 3G5AA 1Q82W 2WIFA 3KL4A 2A14A 4Q7KA 1SKYE 3KT0A 3WWEA 3T7KA 4KACA 1J0XO 5L3ZA 3LHFA 3KWLA 1D04A 1XD2A 3DPSA 1MIHA 5TR9A 5D3MB 5ABPA 2D2FA 3G88A 3L82B 3HRIA 4DR2B 4UDXX 2COEA 2JFFA 5H5JA 3T0GA 3GHHA 5MN6A 4KDEA 2HLNA 2GZ2A 2X6RA 3GGCA 1GNRA 3C6MA 1E5QA 1ONOA 1ZNYA 5FO1A 1WNSA 3HSSA 5ICMA 4NYJQ 4LFCO 4AJ2A 5M7EA 3OCZA 1KBHA 1OBFO 4I1OA 5C9ZA 3KXKA 1MX9A 5FPTA 5EL0A 2WF5A 4OOEA 3VDQA 1XPRA 1NY6A 4ZVOA 1XNRB 1VQNV 1WA8B 1CS0B 2FUNB 3CKKA 1UBGA 4X5OA 2PG3A 1CR4A 3MTBA 1RC8A 2P6JA 3KTAB 4FYJA 3GLKA 4B7AA 4DK1A 3CUEF 3M99B 2VP9A 3WNCA 4JCCA 2C9MA 4MCJA 2AEEA 4AROA 3BREA 2W83A 1YMQA 1E96A 1AUOA 4EQ6B 4RHTA 3RF7A 4HPWA 2P3SA 4JOBA 4BQRA 1DADA 4OGLA 2IXBA 5EIHA 1VC2A 1TA4A 1TPYA 3FTEA 1E9VA 4JZKA 2ZJYA 5JJNB 4GHWA 5HS6A 4QT4A 1JPNA 4KBYA 1GZ5A 4C87A 2I80A 4YAKA 1VPVA 1Z8NA 1M72A 5JSUA 5ALFA 2H94A 1SCQA 1U2DA 2CFOA 3F71A 3CCBA 4Q9KA 5JVDB 3UWPA 3NJ4A 5K05A 3ULKA 1YB1A 3L6CA 4YRJA 3HCDA 4B32A 1FQWA 1KS9A 4FGLA 5H02A 5IBQA 4KQGA 4PSDA 3QM1A 4ZOBA 3ITKA 2N9UA 4TV9A 2Z5LA 3MUOA 1F1BA 3EZFA 4GI3A 4ZTZB 3KG2A 4UEQA 2VHXA 2A9KA 1ZW6A 4BPRA 1NJGA 3GO4A 1USGA 1GARA 1RPJA 2XUOA 2C9BA 3HEAA 1JQJC 1ULZA 1QFSA 4Q00A 3BB4A 4AYWA 1AA9A 4R7CA 3ZWDA 1YQQA 2JFVA 2E1RA 5G0UA 3E22A 1E4EA 1H8ED 1U3GA 2A5JA 2CVZA 4CEIB 1UAGA 3UAVA 3DMHA 1N8SA 2ZJFA 4BP3A 5KA6A 4ARBA 4E2FA 4TTPA 4JSRA 3OE4A 3P9YA 1KSFX 2WM9B 4KGDA 2XAHA 2EFDB 4ZAYA 2PZFA 2ZYAA 1EP2B 4XUDA 4LDAA 1VE9A 4B48A 1ONPA 2HADA 4KNWA 1Y3AA 3GN1A 4KQEA 3ENVA 4Z2AA 4I7ZB 4X62B 1IBCA 4KK4A 5HIKA 4N12A 2WKWA 1G4UR 5AJWA 4X6LA 1DAHA 2X1HA 3A0RA 2W22A 2P75A 2AOXA 3OJFA 3RASA 3FB4A 1SC1A 1PLJA 4X97A 4X7MA 5CNMA 3FLAA 5C8YA 1YS4A 4EEXA 2Q8QA 3C7KA 3H18A 2CE2X 5T4BA 2XKJE 5K3FB 4N49A 3TTWA 3T3EA 4JQCA 4YPVA 2DN9A 3I4LA 2LW1A 3MXOA 1ECGA 1LVGA 3C43A 3MTQA 1QZUA 3RIXA 1VJ1A 5KX5F 4B84A 3A4TA 4R71A 3ZMVA 4ARVA 1K9MW 4BZPA 2O8FA 1IH8A 2J6CA 2OFPA 1F6DA 4IHKA 3NVKI 1ODFA 4KFTA 3WGVA 5AQEA 2Z6UA 4CPDA 1AI6A 1DAOA 2QI9C 2CNKA 2QOEA 4UNIA 3MWYW 4I5DA 3QW2A 3AINA 3WNDA 2G17A 3WIBA 3IJRA 3ZEAA 3WAGA 5LZ4A 1PD3A 1E2KA 3IPRA 3CNBA 2FZEA 1GSOA 1KI2A 2R6GA 1JIUA 3EBLA 2EFYA 1KKUA 5EGNA 4DDVA 4GU5A 4R41A 4M49A 4J76A 4IOKA 2X9LA 2JIRA 1HEUA 4LXIA 2Y0EA 3HUDA 4LRXA 5AMXA 5BQPA 4JXKA 2C7BA 3TLXA 3W5HA 2GN8A 2XDQB 1WEKA 4X65O 1CJSA 4DIUA 4CETA 2GDZA 4CMIA 3LCCA 1QO9A 2RGCA 3K05A 3GMSA 3QVKA 2YV1A 3F5FA 4M0LA 1GCGA 1PJZA 1WKBA 2JFYA 5I9MA 2IEAA 3NDJA 2IY8A 1CQJB 1MQ8B 4HX2A 4RVHA 1Z74A 4W4KA 1KB9F 3BKXA 5MN5A 4UUBA 1UK6A 4M1ZA 3KPUA 3U81A 2VFAA 3E61A 4UAGA 2IEZA 2OBMA 2C97A 1YHYA 3G0OA 5SICE 5K0LA 4XI9A 3OZUA 1JZSA 1KMMA 5EP3A 4C88A 4JASA 3UY4A 3IHKA 1P75A 1ZXLA 2OLEA 4S1PA 3FPCA 3SIWA 4N03A 2OA0A 1K5HA 3IS3A 4CTOA 5E1BA 5GY7A 1B73A 3ZK7A 2YC4C 4PA6A 2HHHB 4RY2A 1OYOA 3QKTA 4XWKA 4DBZA 1WQ4A 4LYGA 3EGXB 2ST1A 1KYOF 1XZKA 4GH5A 3OR7C 4AZVA 3IR5A 1P29A 5HJ5A 2EIKC 2ERYA 1NZDA 1DIBA 3EULA 4H18A 3VR4A 2H0QA 3CVVA 1ZI8A 2YN0A 1K5SA 2QWXA 2UUBO 5CA0B 1CUVA 3WDMA 2Q3LA 2VJOA 3G1TA 3MCWA 2PF4E 1M73E 1X77A 4CQJA 3HKCA 1X42A 4IO1A 3T7JA 2Y9PB 4I2NA 7MDHA 4N5LA 1M6HA 3CYFA 1U31A 2IBMA 3UG6A 1QQ7A 5A3JA 2VJCA 2XJ4A 5ICEA 4N3GA 5DGXA 1WHTA 3O74A 3RGGA 4KNYA 1X86B 3ZWOA 2DHEA 2ZUTA 5EHIA 4C2BA 4WW0A 3R3XA 2NZ8A 3L7DA 2H31A 4LJ8A 2C07A 3FNRA 4NJOA 4KOEC 4NP6A 3ESYA 2ODTX 2XNJA 4A36A 4KXFB 2FW0A 4IDOA 1TKRA 3HACA 1RIFA 2AUMA 1A71A 5HKBA 3KQVA 3H11B 2ZU6A 3Q3EA 4HYQA 3JAKA 3LBHA 4X88A 3SSMA 4QYXA 2NIPA 3SJCA 1P2DA 1DX4A 2XUKA 1VL2A 2RG1A 5JXIA 2JGDA 1XALA 3A3PA 4BDTA 5BY1A 2V7QG 1PT5A 1R4MB 1CZNA 3AIIA 3WWDA 2CXTA 2EX0A 2HV9A 3AESB 3K70C 5HOEA 1O1YA 4A6XA 4FILA 4DSZA 1BXKA 1TUGA 3SR0A 5LQKA 2P7IA 1HQYE 4LF9B 4KQMA 3N8GA 2VHCA 2YVUA 3MG9A 3NVDA 4OP2A 2DYRC 4R54A 1RI1A 1EUQA 1JG2A 4DLZA 1E6KA 2IYQA 3AR9A 1GDTA 4FE7A 3F4BA 2Y1LA 3CRZA 2RGYA 4E22A 2WLNA 4TVKA 2Q41A 3RS9A 4C22A 4G8BA 4Z4GA 1SU6A 4DR7O 1BXGB 2QE7G 3PKIA 3L8CA 3ILSA 2WSSA 3ORYA 2PFSA 2H7XA 1MRZA 2WHEA 2FPGA 3SFZA 3KFLA 1ILEA 2JAOA 3ESAA 2C94A 1PVOA 2FHSA 3SYKA 3MZ0A 4KE8A 3H1JH 4WLEA 4JJZA 4BQSA 4BNGA 3WNZA 1HYQA 2PT6A 5DW0A 1UBUS 4Z9FA 3R7LA 2C77A 4IKEA 4JI0O 1XHEA 2WHRA 3GMTA 2IJHA 1J8MF 2M6SA 3NGXA 1XKQA 1UEIA 4UQLA 4KYUA 4D3YA 2GEKA 3NP7A 5BN5A 2C4KA 4C04A 1Q7YW 1P7VA 4OQ4A 1S9HA 1GZUA 3GLSA 4ND4A 5LXTA 1S2IA 5CVJA 2IWHA 4QOIA 5GZ3A 4FFKA 4PM4A 1LC3A 3DXFA 3PWSA 1YE8A 1OXKB 3I83A 2MMGA 1HEIA 2QE6A 1FSZA 1W75A 2PL5A 4E2ZA 4W8OA 1A32A 4FS3A 3AV0B 1O6GA 1DKPA 4HAUA 3ZZTA 2ZB2A 1M75A 1NQ5A 2XJ9A 3DW3X 4A3SA 2FCAA 3W4IA 1E0SA 3ET4A 4JLNA 3SF0A 1QE5A 3MQ2A 2X7JA 1ODJA 3PUJA 1Y6ZA 5DEOA 5LL6P 4WEQA 1YEWA 2AJBA 5SYNA 1UK9A 4DCGA 3R9XA 5FHQA 4I50F 4BFYA 2K9PA 1MF7A 2PUJA 3QLJA 4G4SO 1QAQA 5DV9A 3SS7X 1OROA 2GM9A 2GK3A 2XVAA 2JJ1D 1MV8A 3WC4A 3DQPA 2XWSA 2H3OA 1JAYA 1O95D 1TM1E 3KB8A 2QLMA 1EVEA 1JBQA 3EXIB 3TRJA 2BEUB 3NUGA 3QVLA 3PWZA 1P8JA 5ED4A 5TMBA 2OHVA 4HZUA 1UFVA 4NABA 1GM7A 5B4VA 1P9WA 3A1TA 1R9MA 3O8NA 2B4YA 3LBIA 3ROTA 5DLEA 3OQBA 1N7IA 2GR9A 1RAHA 1C8KA 1GA1A 3NHLA 3FCOA 1OGIA 3W6NA 3D3WB 4BNKA 3CCUV 4DCNA 2GRJA 2Y71A 3PFKA 7ABPA 2VQEO 5C52B 1JLSA 1Z0DA 4BB6A 1G8HA 4UMEA 3GYGA 5HM6A 4YMIA 1YRHA 3KALA 2UVDA 3LXUX 1H5NA 3PGVA 5IYDO 3Q6NA 1PR5A 1D03A 1YS6A 4KXLA 2FPSA 4Y9DA 2X5JO 1U9IA 4LSWA 4GBGA 2DQKA 1WSBA 1JR9A 2AQIA 4EYGA 4F2DA 5HSGA 4MTGA 3ANMA 1ISHA 1U2GC 3RSGA 4X1IB 3PDCA 4K05A 4CQLB 1X1QA 3UK2A 4XWYA 3TRDA 2WI8A 4RHCA 2GZMA 1G6UA 5F35A 5UKDA 4ENRA 3G71V 1D2RA 1DELA 4BC1A 3Q5GA 3DWEX 2Z4SA 4EYQA 2GRUA 3DAFA 5BT9A 3JARA 5H83A 1YMUA 4RDHA 4F1JA 2I2WA 3R6DA 3SXUA 2GZSA 1K1EA 3COJA 5INTA 4GL4A 2JI8A 3QKUA 1IVYA 5B55A 2RH5A 5DBEX 2R6AA 2GEUA 1QVVA 5DKFA 2JC3A 2XGGA 4IXMA 3UUWA 1QVRA 2UXDB 1CRWG 5F5NA 4IIEA 1H8EA 4Q6GA 4IDBA 4B3RO 1SG9A 5EXDA 3MYRA 1N1MA 3H5VA 1YO6A 1II8B 4TM8A 1U3FA 1EM8A 3F74A 4DYHA 3HPRA 3DZFA 3PDUA 1MABA 3I6QA 2VF2A 2V59A 3P9QA 3BGOS 3N8DA 1UXOA 4OA8A 1X7ZB 2LJ2A 1NVMB 1YZQA 5K0SA 4KVZA 3U31A 2JIBA 1QCZA 3PQCA 2QRJA 1KJZA 3OMNB 5HFAA 4WOJA 4G0PA 5AJTA 5LYJA 4GX1A 3BF7A 1A82A 1P2FA 4DILA 3AF1A 1EMDA 3OUZA 2OFOA 3NM6B 2P79A 5CDFA 4XX1A 5KWVA 4K6CA 3UK7A 4QO7A 1R1DA 1GD1O 2A0WA 1XMJA 4D4LA 2QM4A 3MRTA 3ZCQA 4DANA 3CW8X 2Q3JA 2MINB 3FPEA 2P90A 1CERA 2BM9A 4J0EA 2WLMA 1BFKA 1SBTA 2BTOA 3IQWA 4UPDA 1PNVA 1IU9A 3SNKA 2GXAA 4RH3A 1P0IA 1YI1A 2W2VA 3OTWA 3BEOA 1TMGE 3ND6A 3RRJA 2ZIFA 1O58A 4TXJA 3AQ4A 2OP1A 2OBNA 4TKVA 1EJBA 1N36O 3J7TA 3OLZA 4HPXB 1IJEA 1R3KC 5A02A 1PR2A 4DZRA 3G9ZA 4DLAA 1ZC4A 3H4TA 3CVWA 1ZJ6A 5LMNO 4ZDKA 2AHOA 4NBLA 3KTDA 1T4MA 4OK3A 5IHXA 4RD4A 2FZCA 1HT2E 4L4YA 4BWVA 2VDPB 1PWYE 4YI5A 4GCZA 1CTQA 1UBFA 3L6UA 3MN1A 3NHSA 1GZ6A 1DZIA 4YN3A 1KJ8A 4UD6A 4RK1A 2VYVA 5JNUA 1XFAA 1JX9A 4WLOA 4YP0A 4EZEA 4ZGWA 2L19A 3CA8A 1N2SA 3SJBA 2E85A 2NGRA 3MILA 3PEWA 4F92B 1EWRA 1E1CA 2VBFA 4MIEA 4RC9A 2ZTHA 3AWDA 1QLWA 2B7BA 1P5FA 1OASA 1CF4A 1Y8AA 1YAJA 1Y4AE 4R1QA 1UINA 2WU3A 4X64B 4EHNA 4FSXA 1PGNA 4GZ6A 3WMFA 2X19A 1XN1A 4EKGA 3CLRD 1CT9A 5E4FA 3DDWA 2C8VA 3G7NA 2VXBA 1GGFA 1R6UA 3EISA 2QTOA 1MZFA 4C0JA 4JLPA 5G1NA 1P19A 4A5UB 3ZNPA 3RUIA 3KQYA 4DQ0A 2PH7A 1J99A 1LV7A 5KQMA 1ZNZA 5JLJA 2QSZA 2OO5C 4OIFA 3AVVA 3Q8LA 4ABTA 3OC6A 5AKLA 1KP3A 3EVFA 3SN6A 2HDOA 3QWFA 4K6FA 3G0HA 3B7WA 4L51A 3HFRA 2WTBA 1PTJC 3UMGA 1FUYB 3TRFA 1KD1W 4G0VA 4H35A 2K4MA 4EJSB 1TZBA 1UXIA 4ESOA 4DIKA 3COZA 3H2BA 2COUA 3RSOA 4QUEA 3A3KA 1CBUA 1HTBA 4RO0A 2WWHA 2VOJA 1U80A 5EKSA 5B53A 3X0DA 4YAUA 4RLFA 2QZ4A 4Z1OA 1NM5C 3P9ZA 1V47A 1YHQV 4NI5A 3L0CA 3GRCA 4F12A 2Q4DA 2VC2B 4D4MA 4DRXA 4HADA 3T3PB 4XM2A 4RZXA 1F2VA 3FFXA 5KNLA 3KUCA 2QTMA 1FLDA 4P3YA 3L2OB 5PGMA 3R5XA 3BS4A 4K8ZA 4Z2YA 4PRKA 4HDMB 4PCAA 3LCUA 3DDCA 4PC2A 1FL9A 4JI2B 1V54B 1TMOA 4RDIA 3MTDA 1W0KA 3B1XA 4GOLD 1OY1A 5IMSA 1RYHA 1JECA 1NYTA 1R74A 2GVNA 1L0NH 3N1UA 4A2QA 4DUPA 5DEDA 3UKOA 2OZLA 1L7DA 1EFRG 3RIMA 3UC5A 4ZV9A 1V8DA 5CUQA 2C5LA 1TYAE 2O8DA 3P0HA 1EE1A 2PGOA 1NVWQ 3QFCA 3AVWA 1C8BA 4I6GA 4L5BA 3QK7A 4UNQA 3SPGA 4EMSA 2RHHA 1JI0A 5KYXA 3QPVA 4D45A 3PPVA 4S1NA 3G17A 1BMDA 2WT4A 1C1XA 1YB4A 2FI1A 1ANKA 4E7OA 3V6MA 1V55B 1DBQA 1CIJA 5K3DA 1DS6A 4ENQA 2EGHA 2DYSB 1QJ4A 2BGUA 3G5MA 4R69A 3VV3A 3IBGA 1FFEA 2FDXA 4WECA 5T3YA 4DDWA 4D6TH 3NXKA 2WWVD 3ZHXA 3O8LA 2E76B 4RKQA 4BMCA 1K4MA 4LV6A 3CVXA 3TX2A 2C4HA 2Q7XA 4GS5A 3TNFA 3F5TA 1B4DA 4BZQA 1VLZA 2EZ9A 1J97A 3AOEA 1UJ5A 4U1RA 3KD3A 1NC1A 1EBFA 1H66A 1XLTA 3D3NA 3I2JA 4M1WA 3QYPA 1R8JA 3C3MA 1IBKO 3QEMA 5IPFA 2P9FA 2WT9A 2P78A 4TS4A 1RYEA 3NHBA 5J4VA 5KHAA 1AXGA 2GCOB 3PVCA 2JGNA 4G09A 4PJ0Z 5M3BA 3HL0A 1TECE 1I94O 4MNTA 3NONA 3ZBPA 4TL8A 4CU5A 5DHAA 5B5SA 5KVSA 3N39C 3CCVV 3FXAA 1H8HG 4ACAA 3CRCA 3U56A 3WIDA 3G2OA 1H2RS 2O0JA 3MSCA 2QU7A 5KJEA 3JY6A 1M76A 4BV9A 1LW7A 3I2GA 3B1JA 3DE6X 1QG4A 5B6IA 5DHUA 4CM8B 1Q44A 5FAXA 2F1HA 2WG1A 1L7VC 4GKKB 4GOXA 2HYDA 2NZYA 1Z0KA 1P4GA 4QTZA 4EKDA 1L5MA 1C5KA 4W5WA 2V1UA 1G17A 4WADA 2YC0A 2C5BA 1TUIA 4B47A 3K09C 1KDPA 1SUBA 1YV9A 1QHNA 2BEWA 3D0KA 4JR0A 5FWAA 3UB2A 2ARKA 2OHIA 4JSYA 3PL1A 2HJSA 4B3TB 3CEJA 2XSZD 5DIFA 3TECE 1R50A 5KKNB 4FGSA 2D5LA 4D4JA 4BMXA 2QW0X 5FWYA 2HCBA 2P4SA 4RFLA 1NF3A 2X9VA 3GLIE 4EGJA 1NW4A 3JAMA 3W5SA 1GYRA 4GMGA 4L4ZA 2F59A 4Z7JA 5EBLC 1L5YA 2NT3A 2YVAA 2WFAA 4ZICA 3R7WB 1O95A 4BATA 2Z8XA 1A8QA 1I24A 2WILA 3IPYA 3KD2A 3NKVA 1NQTA 4DSAA 3UYLA 1F7YA 3ASOC 4RL6A 3EGEA 3DBOB 5A3RA 3OCWA 2X5KO 4D41A 2YWEA 3W5AA 1OLUB 3MBOA 1JR3E 1TIKA 4PGHA 1KUQA 3PG5A 3VSEA 2ATEA 3JQ7A 4YIKA 5A2GA 2M2IA 1LD3A 1QRRA 1T9GR 1FFXA 1Z4NA 1MVOA 3C15C 4DHWA 4QT0A 4MKIA 3D2BA 4PVDA 1KAMA 1QFYA 2UU9B 3K9CA 5GONB 4UBMA 3GFQA 2ZXUA 2EIMC 4M9CA 2G80A 3M4JA 4EF6A 2OTJV 2HSEA 3QF4A 4JROA 2BMJA 3RS5A 1JSCA 1ND5A 1TU0A 3KQMA 4JEIA 3A58B 2W90A 3QE4A 2DLDA 3QVWA 4RQBA 1JFTA 3LVFO 1GPMA 2FL4A 5AK5A 1P7CA 4FFVA 2RHDA 4LJ9A 1N9KA 1AUPA 4I4TF 3W6UA 4IJ6A 5FA6A 3EZGA 3Q6MA 2J6IA 3OO0A 4ITUA 3IQIX 3L6DA 4V0KA 1JDZA 3DEZA 3F4KA 5I47A 4U8GA 1Y33E 1K8YB 3ESCA 4M0KA 4HX9A 1RLIA 4AYXA 4C0AC 1PGOA 2FSFA 3RTAA 3CZ9A 3KPVA 4B81A 2N46A 2A9JA 3HBNA 1W2BU 1ISPA 3KEMA 4NFSA 3T1HO 1BA2A 4F84A 2D2IA 1NBIA 5LQCA 1PT8A 1VIBA 3NTQA 4PNZA 3CCQV 4BNFA 3H9BA 1RRFA 4BNXA 1CB7A 1NV9A 1OFUX 1UXKA 1HYBA 2GO7A 3ROKA 1TL7C 4WKOA 1J1IA 1PEYA 3FKQA 5FNVF 4PANA 1OZGA 3WGLA 1PS9A 2MK3A 4DR3O 3P9XA 4DIBA 1Z4QA 2OO3A 2ODNA 2GA9A 5JSFA 2O06A 4H7EA 2IW1A 1YS2X 1RXCA 3INYA 2G71A 3E8FA 3WLPA 4B73A 1Y0BA 3BE4A 2NO5A 3E9YA 2F7SA 1IQ0A 2KBEA 1DX9A 2QJFA 3K6KA 2DWPA 4JOSA 2JD1A 2XE7A 1K98A 4BFCA 3BFKA 4O2BF 3UXMA 3C98A 5KEIA 3LP8A 3LQ1A 1JDUA 1EFKA 4YO7A 2HI0A 3L0YA 3DMDA 2HJVA 1R6VA 3AR4A 1B6TA 4B82A 3FJYA 4BJ5A 4J3NA 1SUDA 3WJ7A 4ENUA 2G5PA 4H0CA 4CIDA 1E2QA 5IJ9B 1VARA 1FBNA 2X4IA 3JQPA 3FDXA 3ZV3A 3DBHA 1RYMA 3R6LA 2QWRB 2YFQA 5F7JA 4WXHA 4K3UA 1UH5A 3Q10A 4KLZA 3L46A 2FB9A 2AFHE 1ADFA 1FX0A 2R72A 3KQPA 5CYPA 2AG8A 2AQ8A 3EODA 3U0VA 5FFMA 1GXSA 3K72B 1P8AA 2L35A 3EJ6A 3RROA 4E88A 1EK6A 1MZVA 3HK2A 4E94A 4BOYA 3KQWA 4Y8VA 4TUYA 2JRIA 5EJ8A 2O8CA 4D9IA 1PGPA 4YXWG 5P21A 1ICEA 3AHEA 5CMLA 1G19A 3SR4A 3OAAD 3QU4A 1QLHA 1FTSA 3OTIA 3R5SA 3AJEA 4KXXA 3HY3A 5LR6A 1TO2E 4H7KA 3UAXA 5A7FA 4RD0A 4EUNA 4D4HA 1F3OA 1KRXA 5DJ5A 4NOLA 3EASA 2CTWA 4C4PA 2CL0X 3IC7A 1E1QD 1ZN8A 3DBLA 2VK4A 1NLZA 3P94A 4GOMD 4L0CA 4NNOA 3TLMA 1BE3H 2CWDA 3OX1A 1XCJA 4BGEA 2OGWA 2EINB 2ZIXB 3L75H 4M54A 4ML3A 1K8AW 4G4GA 3MQ4A 1QQBA 4DUZO 2BKEA 4HR7A 1L5FA 4P1ZA 2HXSA 4RZIA 3UB3A 4C89A 3WIOA 3QUTA 4F38A 4L0QA 2AMFA 1TO6A 3TLGB 3S7ZA 4BP8A 3TB4A 3IPXA 2ZS7A 5ALDA 2F9FA 5J2TB 3AEUB 3I01A 3QVGB 6REQB 4KMOA 4O33A 3HR7A 4WL0A 1LFDB 2CFRA 1TA8A 3AUUA 2ONCA 1NQAO 4MQMA 4GXTA 4EPXA 4CBCA 2I55A 3OMAB 3RS3A 5FD8A 1W29A 5CEJA 1SU7A 2Z95A 3ZWMA 2X86A 3G0GA 4HQ0A 2B8WA 1HOXA 4BDSA 4AZSA 3EXFA 3KZ1E 1GNQA 3FGOA 3TFQA 1I33A 4MS4A 1YAHA 2A4MA 3E9CA 2OHGA 3UGJA 2NPIA 4UM7A 2BP7A 4TMVA 4Y30A 1VHJA 3VR2D 1GPNA 3EIOA 1N3IA 1IUNA 4XD7A 2QRVB 4MUFA 2OHOA 4TLMB 1Y9EA 5IXYA 3QX8A 4M8SA 3WAJA 4ZVUA 1OAOC 1HNWO 4L72A 5KPJA 2EC5A 2PSSA 5A7GA 5CB6A 1XZQA 5IAGA 4MA0A 4WUVA 1ZK0A 4OA5A 1OB5A 4OUKX 3B12A 3F3YA 1TADA 4H6WA 4UEOA 1N2XA 4QVGA 2OTLV 3VTAA 5EJAA 3SF8A 4WNIA 5K1ZA 2YVKA 3AB7A 3JD2A 4RTLA 1E20A 5CITA 3DA8A 2J5BA 3L6OO 3VH3A 2CT8A 2LW7A 2ZSIA 4RORA 1JMKC 1G3RA 1XU9A 2B4TO 4I1VA 5ITZA 3H2KA 3SEZA 3A6LA 1B1AA 1NQXA 1Z2CA 4ZU6X 3B6IA 1E63A 1SN7A 3PJRA 5KQSA 4A8HA 2E5FA 2R3SA 2N1BA 1DP4A 4HGYA 3ZVMA 1RM1B 4TTVA 5LA6B 4JMLA 5ALHA 3GDGA 4RXTA 4TMXA 1RPOA 1OJ7A 2H4JA 2OQIA 3HH8A 5HF9A 3I56V 4JYZA 4E7PA 5AVRA 3HV0A 4R98A 3P45A 5JAPA 1NXVA 2QT1A 4GQIA 4HAYA 5LQSA 2FPRA 4BX2A 3GLGB 1ECJA 1CUAA 4EBBA 1CQWA 2LNDA 1F23A 4EM6A 4R6WA 3P0EA 5KWEA 2O2IA 4TTQA 2UUCO 1VG1A 2OY0A 3K2QA 4FOTA 1VE6A 3D3QA 1CY2A 3AG6A 3HPQA 5F73A 1NQVA 5KX5A 3OU6A 3A28A 5F33A 4A15A 4FS8A 4XPIA 4J7UA 4XTCS 3WX0A 2VQ3A 3A27A 5KSYA 2WFLA 5MFZA 4ZOQI 2JFZA 3LBAA 5KWIA 1DU4A 3WA6A 4Y6LA 3P2EA 1H2YA 2OUKA 4GT1A 1Z4PX 3UAGA 3KQUA 2KPOA 2ASVA 1PFVA 1KQSU 3CEHA 3FA2A 5DWQA 4C7OB 3MW8A 1WPBA 3FYUA 1EFLA 1BT8A 2OT3B 4P3PA 4DJAA 3E70C 3AU8A 3TB6A 3QSYA 5DMHA 3S2FA 2R6CA 4U3JB 5I4CA 4R2IA 5I9NA 5CYOA 4DCTA 4FKZA 3WI7A 3QUBA 3GRFA 4GO1A 4HK4A 3RT7A 1RQPA 3L8DA 1CR6A 5IY5C 4BO2A 4EP1A 2WG2A 5JO9A 5C3UA 2YIBA 4DM3A 1RR6A 2XUPA 2GYVA 3KSZO 5IAEA 3VJMA 1AF4A 5JDCA 4QDKA 4DIDA 1XTQA 2OCPA 1C4OA 1E3LA 2CNDA 2CVQA 5K0EA 1J07A 5BVHB 4AI6A 3B5EA 5H6RA 1T0JB 1DWPA 1VF6C 2IH1C 3CUUA 3I01M 1Z6XA 2OCBA 3H5AA 3W8NA 3TKYA 3FOFC 4PRLA 3T5AA 4YMTA 3WR5A 1U3CA 2RGNC 3W2HA 2PKWA 1HA3A 1M1XB 2YW2A 1Z2PX 1A5SB 3ZYZA 2WPDD 1JTEA 1BOFA 2O7RA 3WGJA 4PBRA 5EPUA 1C14A 3CVOA 5IC4A 3K6JA 4NESA 4C2UA 1TK9A 4MAFA 4CR8A 3NIFB 3L73H 4KVAA 3TPZA 3ZCCA 4OLJA 4E46A 1NULA 4XX0B 4L4XA 3NDPA 5C5EA 4L8GA 1Z0AA 2OV1A 2X15A 1V5IA 2DKNA 2R4TA 3ETDA 1PJ2A 1A8SA 3NTOA 4AICA 2NQTA 1T10A 1EAMA 4UCVA 3ZCTA 2A3QA 4CV0A 1P9OA 4FU0A 3DT8A 5JI3E 4RH1A 3TBKA 4F5YA 4CMGA 4FEAA 3RYFA 1B0UA 5EMNA 2C4NA 3O4IA 1UWCA 4G1FA 3BB3A 1HR0B 1RP1A 2PO5A 2PGLA 3K32A 5LGNA 1SPXA 2VHYA 4DB4A 4RFSA 3ZU5A 1Q1NA 1QHEA 4HDNB 4PPQA 1FE8A 4GGMX 3W1EA 4AURA 2Z09A 2P62A 4DR5O 1MD9A 1G55A 2ZBVA 4E09A 5HRUA 4PSCA 2ZS8A 1TYCA 2Y4NA 3O8RA 1KMNA 1XK7A 5JCOC 4A27A 4J1TA 5DCUA 1JB1A 1XXLA 3MHSC 1CB0A 3JWJA 2HR3A 5F2VO 1JDTA 3V1UA 1OWLA 3SYLA 2F3TA 3VNRA 4FTWA 2FQWA 3DVAB 2XB9A 4DPKA 1IXZA 3JAMN 2Y6VA 5AI5A 4F4DA 3ROQA 1TJNA 4FKMA 4KRYA 2WINI 1M7HA 4C2TA 2OC9A 1QU3A 1OWNA 4XB6B 4C01A 4DWVA 3B8NA 4UULA 3V8EA 2W6NA 5DX0A 2WD7B 1JJBA 1J5PA 3PFIA 4CKCA 4LXUA 2QBYB 4TV8B 5B1BB 3H0CA 2CF6A 4NHEA 1M10A 4E3ZA 4ZEVA 4FZVA 1X13A 4JODA 1E2LA 2KS6A 2CL7X 2LP7A 2ACWA 5AXAA 5C1PA 2VSXA 2FFRA 5HMMA 4O1HA 1B93A 4EG4A 1QE0A 2WE7A 1T2AA 1R4NA 1LDGA 3VX3A 1YB7A 4R9SA 1QX4A 3TZBA 3UWKA 3DOOA 1SQBH 1DKMA 2JLYA 2FPKA 1A2BA 4DA7A 2EJVA 2AOUA 3AHCA 3GP3A 4A92A 3GVXA 3Q4GA 5T6BA 1JALA 4RHFA 1XAJA 1M34A 4IVPA 4EKWA 1NJ2A 3TAUA 4JTAB 3RFXA 1QCYA 3KPJA 1WF3A 5CXSA 5ITSA 2BC9A 3UW1A 4Y18A 1RVV1 1RHQA 1JU4A 3AFIA 1X7DA 4P9PA 1ZSVA 3GCGA 4C1NA 1T2DA 3CXCU 3C39A 1EZ4A 1M2GA 4YJFA 1T3ZA 1M6VB 3F6YA 3HA7A 2XGJA 3R6WA 1WMFA 2P0AA 3C7AA 4L22A 1E9AA 2A3NA 5IF3A 2HSZA 1C7RA 3WJ2A 3T5DA 1SPBS 5KYWB 2JATA 3BMCB 3FR8A 4TWKA 5JZSA 3CH6A 4NF2A 4Y9UA 2XY4A 3BB1A 2WSLA 4DKXA 3UQZA 8AT1A 3LCJA 2RGWA 5J4LA 4N23A 3R0ZA 4EF4A 3NP9A 1UBJS 5LP6C 4Q7QA 3E8XA 3I5XA 2BFFA 3E15A 1G59A 2CLHB 3JTEA 1EUCB 3AB8A 3GDFA 4AY6A 4D7TA 3HV2A 4JI4O 1BHQ1 2EWWA 4TTAA 1ETHA 3LGAA 2EGUA 1D3AA 1NW3A 1EWTA 1IG0A 3R0JA 3N2KA 3D4OA 3BCUA 3G1WA 1GEGA 4UPEA 4I50A 4BWAA 4QU5A 4XSHA 4NJEA 1OA1A 1M2HA 3M4NA 2VUHB 2WMOB 3QLTA 3DO6A 1XJ5A 4M87A 4BKQA 2PO7A 4NATA 2A88A 2PTGA 1I5OA 5EHQA 2UXXA 5M04A 3T1OA 1Z4KA 3AEIA 2ZCUA 1ZQ9A 5BY2A 5FAKA 4CKWB 1U5CA 3VSDA 1O4VA 2OR3A 2SCUB 4B83A 3TRIA 3WMWA 2JG3A 3CF6R 3W06A 1GU7A 3HB7A 2NXEA 2I8CA 3WWZA 2WJPA 2D2CB 3AP3A 1U0GA 1OU4A 3EZYA 2LKDA 2QMZA 5CVVA 3UB4A 4WSOA 3JW8A 3RRBA 3C1UA 3QKSB 3EBPA 2HIHA 1ESDA 4KN6A 1N6OA 4O3FA 3R44A 3KRTA 3OTGA 4YYZA 4WXPA 2XF8A 2PU7A 4JC5A 2WKPA 5KVQA 1UDBA 2JKYA 1RFGE 1Y8QB 2XNDD 3VC2A 2Z83A 3O26A 2AHYA 4H1UA 3VR1A 3TVYA 2CTRA 3RUFA 5KOYA 2IEYA 1BJKA 2DBQA 2HRCA 5KVAA 3WIEA 3GLUA 1FXKC 4ILKA 4RHEA 3KVRA 1P72A 2ECFA 4N65A 5JAHA 5DPMA 3T94A 4YB8A 2R48A 1I5RA 4Q4LA 1FDRA 1P1RA 5AH0A 2FUG1 2I8LA 4EK9A 1XU7A 4D0LB 2MSKA 2O5VA 1AB6A 4PFJA 2X8JB 2XXAB 4DSOA 4M89A 4ZU3A 4PGAA 4KYVA 4NBVA 3V9PA 1Y4SA 4HGZA 4OBWA 1DRVA 1W87A 2I2XB 2OQRA 5BSKA 1WDMA 5CB4F 2ZREA 3MINB 2CUZA 3QJYA 1JJFA 2BFCA 3TMKA 4BL5A 3DJYA 1CJTC 4V38A 3ACCA 2ZUFA 4D7SA 1OH8A 3GD7A 1FJHA 2ZBFA 4ZI7F 4E30A 2Z4TA 4GSLA 2RBKA 2DQ0A 3OFSA 1U7TA 3N0TA 1N1EA 1IHXA 4DWOA 5AR1A 3OFKA 3D6UA 4YDSA 4J7ZA 4Z49A 2K5UA 4IM7A 4HLDA 3HMQA 3D4LA 5EGSA 5DECA 2ODBA 4RAQA 4BMPB 2PT9A 1ZOIA 4LUCA 2ORWA 4B79A 2ZWMA 3G8YA 3ZDRA 4HSEA 3G6WA 2IQ5A 1SCIA 2Z9CA 3JR3A 1UAAA 2Q9AA 1VQ1A 3B5IA 5ALTA 4J0HA 2G72A 1MQSA 4EO9A 1AC5A 4BQNA 2P9BA 1YONA 2ODAA 5AXCA 3TXYA 2FMIA 3H8WA 3LMKA 2PKQP 1EFHA 1B74A 1ENPA 4MSWC 2ZB4A 1FTWA 3QWIA 4G89A 4XQ9A 1J7KA 3NIGB 2FA9A 3LBFA 4AKEA 3FUWA 5IHPA 1Z0SA 2PV0A 1FDSA 1MB0A 3ADDA 2PNJA 4CC5A 2JEUA 2VRBA 3PZRA 3HUFA 2GM3A 3B13B 4PINA 4CUKA 4QQNA 3T5BA 1C30B 3P32A 2WJJA 4FLZA 4RIFA 5TISZ 2ZZMA 1CK4A 1QGYA 4I1IA 4G0QA 3ANYB 3P0RA 4TX1A 5CA3A 4XQGA 2C2GA 3L4JA 1ZGAA 4ND2A 5DHPA 1U1GA 3AM5A 1PZHA 3SR3A 4NMHA 4HQLA 2NU8B 4L8FA 1G8AA 1E1RD 1FSGA 5FR1A 3LY8A 2MTBA 1GNVA 1M2JA 3BIXA 4Z9YA 4NQRA 4FC6A 3BTUA 3GG2A 4K9OA 1KAHA 2SECE 2XDAA 4R8SA 4RF4A 3I37X 4C6SA 4KSYA 3MUFA 1RHUA 1XR3A 3WGHA 2F1RA 1MAUA 2D2VA 3EXAA 5FORA 3H5TA 4XVRA 1T2UA 2AXNA 5IT0A 2UVPA 4BFVA 1KFKB 2WUGA 2ATIA 1TRHA 4A8PA 3RBXA 1DOHA 2PV7A 5ER6A 4BVEA 2XWBF 1TPZA 3DCJA 3R3SA 1ZEMA 3T99A 1T8RA 3PGKA 2ZDIA 3VMMA 1DLJA 1U97A 1C9YA 1L1EA 4N0PA 4MVCA 4RF2A 2D5AA 4RGYA 2ITCC 3U13A 1VFPA 2XOXA 1GQOA 2PBRA 4CJXA 1TGYA 1A77A 3PC3A 1IQPA 4C14A 5HKKD 1VJRA 2Q6VA 3B1WA 1RADA 1A5TA 3ASVA 1F8XA 1IOVA 2WAAA 3AG2C 2CLEB 3KKYA 2HQRA 3FZYA 5EWMA 3RBAA 2VRWA 1DHTA 3G59A 3ZWCA 1Q17A 3DMNA 2UZ1A 2XPCA 1KH1A 1Z28A 4MQEB 3H8SA 4CKXA 3ZS9A 1TEVA 2KYRA 4E4RA 3JVDA 3ONNA 1TZKA 1VI2A 1JG6A 1XHZA 4AFNA 3BE6A 3GHYA 2QRPA 4EVSA 3MM4A 4ZJZA 4A10A 4XQEA 2B92A 4Y1GA 1R6KA 1EG2A 4X60A 1DAIA 4D6XA 3L79A 1XXHE 1VL6A 4DIMA 2CNWA 1SHTX 5KOJA 5F5LA 5FHRA 2W2NA 5BN1A 1PNQA 1YKFA 3CR3C 2VHVA 3AF2A 4O29A 3ZW7A 4OBXA 1W36C 1XMOO 3RWRD 3ZW8A 3U3KA 5IBPA 3DG9A 2YHIB 2BFMA 4OQQA 1BS1A 4ZC8A 4BLWA 1SHJA 3SSNA 1CUIA 2VSNA 1U7PA 3FCUB 4IQFA 2Q69A 3HN6A 5I4KA 2VSFA 2WU1A 1KPIA 1UM8A 3QTLA 5JQWA 3ZVKA 4IIJF 4G24A 4BJHB 1J5EB 2ZB8A 1Y63A 1VCMA 3SDBA 2OOKA 4NBNA 1JAIA 3G5LA 4GNRA 2O8EB 1VJDA 4L3OA 4UXHA 1KK2A 4X66O 3DUWA 4A1OA 3Q15C 5HE8A 1P77A 2W2KB 2B0JA 1E5LA 1Z5GA 3GD5A 1V1JA 4RK0A 3LLSA 4RLSA 2QZPA 2NT4A 1AHIA 2FG7C 4EG1A 3M5PA 2D7DA 1CCWA 2BI4A 1J7JA 4N8SA 1EIZA 2DJIA 3CPHA 4JSTA 2GHIA 4Y0VA 3K58A 1Y6QA 2IS4A 2DJ5A 2Q3MA 1R0LA 4HMPA 5FTWA 1ZL8B 1PW7A 2N1MA 5KDDA 2I33A 2JASA 2VDJA 1HNZO 2FP4A 3N9IA 2BF7A 1WZNA 3L92A 4MPPA 5E0OA 2QIPA 1VZ2A 3SFVA 5IU6A 1TNDA 4MB0A 2M32A 1NPYA 3ZRVA 3DR3A 1RJEA 1KJJA 2XKBA 2B2NA 3I2YX 3OIGA 4TT3D 1Z15A 3T1YO 3LX5A 3PRJA 5JECA 2HOQA 4BB0A 1LZLA 3GQVA 4FZRA 3PD0A 4QPPA 4RVUA 1RS0A 4D8VA 1GG2A 1L5RA 2ZYWX 4UKDA 1N3LA 4YI3A 1XLWA 4D2IA 3QUSA 5HP4A 3OF5A 4LQ4A 4UCRA 1NUQA 1T4BA 1M2EA 5B5EZ 4Y9RA 3T5TA 2XYVA 1R8XA 4Z0HO 2QK4A 4KZPA 1NKTA 4FWBA 4BBPA 4F04A 4Z4CA 2KQUA 4ZO6A 3ASUA 3L7LA 1Z25A 1YDWA 3A9TA 5THXA 1M0SA 4DG9A 1DAKA 5K0NA 1U4SA 2OYQA 5DASA 3ZGOA 5BW5A 2GD6A 4ZK6A 3BJZA 4I4NA 4YV7A 4RZSA 3TAHA 5TGDA 2JLVA 1EFUA 3CNOA 5H3HA 1T24A 3RSCA 3AVQA 3UT0A 4Z54A 2A5LA 4NPCA 4CLEA 3IMGA 2XTZA 3LQYA 3V2HA 2QJTA 3EVBA 3GLHA 1GPBA 4Y1EA 1PLKA 3LW8A 1K6XA 1V9CA 1WBDA 3TGWA 5IYCO 2B30A 2QR5A 5L3SA 1M2FA 2V7BA 3EXHB 3VJRA 2HF7A 1P18A 4F8YA 1BGWA 3EB9A 1PAUA 5IMBA 1RHMA 4DA4A 5B7PA 1TVEA 4BFUA 4H3HB 3HM2A 1JIVA 4YAFA 3K1TA 5TLSA 4LN1A 4CLRB 5JEDA 3HWWA 4ZHQB 1W19A 2HT6A 5D86A 5A62A 4FCTA 1K63A 3E9NA 1FX1A 1T2CA 4DCSA 2RH4A 3VZCA 2C2WA 5JW6A 3V2GA 2AZ0A 2JFXA 4KITB 4L08A 1LTKA 1N6LA 2Y69C 5A4FS 3T3NA 1OCZC 2YTZA 1TKCA 1USKA 4D3ZA 2XB2A 4TYYA 4NICA 5FADA 1ESZA 2AC4A 4WN9B 3OF3A 1PFUA 4OATA 3ANNA 3RVJA 1JL3A 1E7MA 5F1OA 1KYZA 2CVOA 1GAJA 4BZXA 2YRXA 3O3OB 1TM7E 3TM5A 2OCYC 4J49A 4X8HA 3EVTA 1EJ0A 5AM0A 3MHHC 2Q4OA 6ADHA 1O5IA 2FWJA 1KBQA 2JI6A 2B37A 1Q3KA 4ZT3A 1OILA 4WOPA 2RCVA 3OQ6A 4AZ3A 3U44B 4AQYO 3B85A 4XDGA 3U4MA 4IVQA 1NTKH 2OILA 2ZPUA 1GKKA 4WK6A 1YKGA 2J48A 4TVSA 5IFKA 3IUPA 3HP4A 3HN7A 4MVJP 3QA3E 2NNLD 3KQSA 2RJOA 4O6VA 4R6XA 4DW8A 1GZSA 2ZQYA 3RN4A 1ZWIC 1OYYA 4Q1VA 1I30A 4B43A 5CLJA 4CIWA 3WMEA 3G0BA 3ZJVA 1ZVMA 4YRSA 3EYAA 2Q0QA 7YASA 4BFXA 3IO3A 3UJ9A 2WK1A 2XW6A 1ZK3A 1U7XA 1N5RA 4FWIB 5IM4F 4BQIA 3ABKC 2FMTA 3RI3A 2VPYA 5GTIZ 2J8ZA 3V34A 4MVJI 4LNAA 3TCUA 1E7QA 3CWBH 4XUGB 3DZGA 2AEFA 5KC9A 4FQ5A 4MO9A 4CLHA 4A2WA 5I9SA 1ROPA 1KHHA 3TLAA 3RKRA 1ZG3A 4OKNA 2YN4A 2VJMB 1HE4A 2XUIA 1S76D 1LFAA 3A6HA 3UCXA 4RADA 3TGLA 3HNOA 2G9NA 2ISSD 4W5JA 1I0HA 2EZ8A 3QKWA 3KJIA 2XB8A 2QORA 4U39A 3MAAC 4QELA 2HX1A 3RC2A 4J07A 1KYIA 2K2QB 2EFJA 2DBYA 5A04A 1JT9A 1G20E 5EHXA 1L9XA 3C3PA 2DC1A 1SWWA 3GJ5A 3N70A 3PF9A 3SVZA 4NCKA 3AY0A 3QLVA 4JVSB 2ZYGA 2B3DA 3HKDB 2AN4A 1X7XB 5LD2B 3FPHA 4QUGA 4IWXA 2YDYA 4DBLE 1G7RA 1UDXA 1G5PA 3M2TA 4RA9B 4UHEA 4YIOA 3UJBA 4ASUD 4GLJA 3JALA 1XZLA 2GTPA 3A6FA 4KJXA 5U4XA 4H31A 4IG9A 2VATA 2Z6AA 4MXDA 2AR0A 1JKMA 5HTOA 1MNAA 1KY4A 5EKUA 4P0PB 3V7NA 3ABOB 2IHZA 2BEJA 4WPGA 3GPIA 5MDHA 2P8SA 4RJJA 3AJRA 3ECSA 5IAAA 4LOAA 3GFPA 3DV2A 1NUSA 2BTQA 1NOJA 1Y3BE 2ZBGA 5J5AA 1BCSB 4MVQA 1K3UB 2HK7A 5K2MA 1RMYA 4TMFA 1E2JA 4KJZA 3GELA 3K71B 1IOWA 2W4QA 1VBMA 4U7TB 1IOLA 1PE0A 1VCIA 2AXTZ 4UBIA 5DGDA 4I14A 3MT9A 2GM5A 4LHWA 3AFGA 5FBVB 1RZ3A 4RXMA 4F96A 3GLFA 1UWVA 5FULA 5ALIA 1PGJA 1TC1A 1LPOA 2O3UA 2O3RA 4OIMA 2BH2A 3D4NA 4UFNA 3UMMA 4QKQA 1BROA 1ATIA 5ERXA 3QUCA 4R4JA 1XCPA 5L4NA 2YIDA 1RKVA 3QNMA 4NV1A 1CUEA 2CV1A 3F6PA 4WCFB 3FWKA 2J9RA 4YMGA 3ZHTA 1IATA 4LRUA 1WPGA 3SYQA 1LUAA 4BAGA 3ROMA 3QTTA 1DEAA 2UKDA 1Z08A 4WNAB 4BV2A 5CHYA 1F2DA 1QDUA 1MN6A 3KVNA 4HLUC 4NXMB 2IT1A 5FPKA 1O4WA 2EDCA 3CG0A 3AG5A 3NNSA 3TYXA 2HHLA 2QAGA 3RCBA 4H0FA 4KO1S 5FPOA 2YWHA 3R6TA 1B43A 1QHTA 4DXWA 1U7DA 5F98A 5HKKA 3IV9A 4GD3Q 4QBFA 3QU9A 5K99A 4JI7O 2YJTD 3ICWA 2LRHA 5IUJC 1MA1A 3V4PB 1PL7A 2GTIA 3GRPA 4HEA6 1N9GA 3VO9A 2YXEA 3W2EA 4CKBA 2CLKB 1D7AA 2ZWOA 2VS1A 2AG6A 2IV3A 4RDXA 5K8JB 3EXG2 3K35A 4O2AB 3L4SO 2OBBA 1M33A 2ZZNA 2FWBA 2Y4OA 1SXHA 2XUFA 4ZODA 2EU8A 1FVOA 1WUYA 1T3GA 4C2AA 4EB0A 1TX4B 3AR3A 4FDVA 5ALMA 3AUTA 4ZYTA 4P0QB 1PV4A 2QTLA 5JSHA 821PA 4MVJD 4E5KA 2M7WA 1DC5A 3EA5A 2QGZA 4X92A 1KJQA 4F93B 1UPCA 5CLFA 5TB5A 1YOVA 1AUVA 2XRZA 1ZIOA 3D81A 1PG0A 1CUBA 3O4RA 1DC8A 1XF9A 3V7WA 2HVJC 4NTXA 5LB4A 2OHHA 5E3JA 1MH9A 5KCMA 1D0IA 1Z26A 4LC9A 3GT7A 2GFHA 2HXYA 3KDSE 2QG6A 3CCFA 4JB8A 4TPKA 1QQTA 2A0FA 2YXHA 3P1JA 4XWWA 3RFRA 4LDZA 2WQZA 1EG7A 4JJGA 5HWSA 2W6PA 4WZAE 3IBSA 4EGAA 1FRFS 1O9BA 1FS0G 4XB1A 4CL8A 2AJDA 3T7IA 3UUFA 1QQAA 4JQYA 5FPQA 1CR1A 2Y6UA 2IITA 5TXGA 4MVOA 3B9PA 2ORIA 3RVSA 3AETB 1VRCA 1CP9A 3ZY5A 4LF7O 3N0VA 4J9ZB 1OLXB 2F4NA 1N2CA 2JVIA 3B40A 3NEJA 3U3DA 3ETHA 3CINA 3KDAA 4KFUA 4LHVA 4HYEA 2JJ1A 2EFGA 2OCHA 2J33A 1JFRA 3OUSA 2E18A 2C98A 1RSZA 1X7YA 3KAJA 1PD0A 4HN2A 4EJ2A 2FQ1A 4FFDA 1EGHA 3SHTA 1ABFA 3FHTA 4V1CB 1N6HA 2IHKA 3S99A 3C48A 4XJSA 2FMFA 3JYOA 4J0KA 3VO1A 4EHJA 4Y9SA 4D0RA 3VHLB 2QYTA 1R3IC 1OFVA 4K9DA 4MWOA 2XTJA 3OQJA 2C5FA 5JZBA 2REQA 3TEJA 2AZ4A 2B69A 3SPJA 3ER6A 1YR1A 3FE2A 1BDJA 1J5XA 3KSAC 1QV9A 2R68A 3L1JA 3QNWA 3IQDB 4ZALA 1YQTA 4JI5B 1CF9A 4R31A 5H5NA 4BLOA 1T4DA 2CDCA 2QL6A 16PKA 4RKRA 3KOZA 2REXB 2DT5A 2B7CA 3TGUH 3GRUA 2WAYA 1DO0A 2QTNA 4EA9A 4H77A 2GPTA 3KKOA 1DJNA 1Y6RA 3E2MA 4NU8X 2PX2A 3DHWC 1CRZA 4ECEA 1W5BA 4LVOA 2HEPA 1N1GA 2QN2A 3IP1A 2ZRQA 2OV2A 3H3XA 3FPKA 3UIEA 4F3KA 2UXBO 3G23A 1VBFA 1JLMA 1FQJA 5CVCA 5IDVA 1CUXA 1U8XX 1A0OA 1F51A 4HDSB 3O8CA 3D54D 1XRLA 4HNVA 4MVUA 3IXLA 4KP4A 4EI8A 3QG1A 4O59O 1TM3E 2J46A 3ORQA 1J8VA 2XUGA 4MPJA 3A2LA 2VDWB 1E8NA 4UZEA 5KPDA 4C4YA 4RQUA 4KPUB 4I08A 1PJRA 2Q3DA 4Z51A 3HEMA 4LV5B 2CMDA 2J32A 3M9WA 4IZIA 3FDIA 1PDWA 5EE9A 2DR2A 3F90A 3M6AA 4G0WA 1NURA 3OMXA 2FY8A 2I7DA 4TZTA 3PX3A 5KIAA 2AE2A 1T1GA 1EJ2A 3COYA 2A79B 2PWAA 2W42A 4D9HA 1T0HB 2RI1A 4QQFA 3HQ4O 4LHYA 4K9SA 2IH5A 2B9VA 1BMTA 2RGXA 1P39A 2ZT8A 3KVVA 5TJHA 4H08A 4PSUA 4ZPJA 2HA6A 4Q4AB 1IY2A 4OAPA 2Y66A 4U7HA 2YHUA 4KU4A 4FNOA 3CRMA 5LZ7A 4BFWA 4IG4A 4R2HA 2NU9B 1Q7CA 3AZOA 3IKVA 1P5JA 3V1LA 5BWCA 4EH1A 3ES9A 2QVYX 3NETA 3MIIA 1X19A 2Z04A 1YL5A 3QU2A 1N34O 1BU5A 2EULA 1KP2A 5EQTA 1IUPA 4MKRA 4FX2A 1BDBA 4C0QC 2HMSA 4I5IA 5K6TA 3FTPA 1CVLA 4R6ZA 3TL6A 5KDLA 1WL8A 2JZNA 3DE4X 2YV2A 3WYGA 1ZJ5A 5EZYF 1FKAO 3OA0A 5LKRA 4QHYA 3OD4A 2ZKOA 1RJGA 1U99A 3BJMA 1I4DD 4JL6A 2P2LA 4H7IA 2QD1A 3JVUA 1QAMA 3BWVA 1AR4A 3TI7A 2R9VA 3I1YA 1RHRA 5H9WA 4W63A 4QM7A 3OIUA 3HCNA 2PFGA 4HFMA 3HA2A 2AJLI 3WK8A 3RFTA 3T95A 4U2GA 3C3YA 2SKEA 1M2OA 4HDRA 4C7MA 2YEVB 1A1VA 1M0WA 2ZBRA 4BLRA 3PDWA 4C6TB 1XNQO 1JRLA 2NZJA 5KB3A 3ADOA 4NONA 4EYOA 4K40A 1JEQB 5IVHA 4WZBE 3TR6A 3CF4G 2WTUA 3V4FA 4KXYA 2C04A 4MW3A 4LBEC 4CTMA 5JY1A 2GGSA 3IUYA 4MUEA 2BF4A 1D5NA 4NXNO 1M2VA 4PGGA 5FBQB 3O93A 2O23A 1Z0FA 1SFRA 3OLXA 4D9NA 2JLBA 5K3OA 1GL6A 1HYGA 3H1IH 3RHSA 1WMEA 3EVAA 4FPXA 5JI2E 3UCFA 1O03A 4B6GA 1E6LA 1KIMA 4QLAA 2ISCA 1ZR2A 1OTXA 1ZBQA 1PX2A 4TXMA 3AVXA 5FIUA 4B46A 1E4EB 4FCWA 2YYAA 2P27A 2I4IA 3JPYA 3MAQA 2XEDA 2P4EA 4KHPB 4B6QA 3WV4A 4CEJA 5DLPA 5K8UA 2PT7A 4JVLA 1Q5OA 3VPGA 3SZUA 4ASUA 1S2NA 3EC7A 5GGYA 3I61A 1SXQA 3A0RB 4AS3A 4ZKEA 4W4LA 1NW9B 4LE0A 1H2XA 2OSBA 4GZ5A 4JP8A 5F23A 5KJ6A 4AQ7A 3PXUA 4FQ7A 1TUEA 1NHGA 1R5NA 3RVBA 2ATXA 1I01A 3L8FA 4OHMA 1OR8A 4ZAFA 4Q1BA 5E6UA 4R3NA 3CZ5A 5I7SA 5HS4A 4DLWA 4LVNA 1LWNA 3BRWD 1MRNA 4CIXA 2Q1WA 1CX9B 1Z4JA 4WESA 2D1QA 4MHSA 3VV2A 2PWPA 4QGGA 4X61A 1SIOA 2EFHB 3LT2A 2QS9A 1YJCA 5F1KA 3L7AA 3FAVA 2G1UA 1OZ0A 3ECAA 4K1LA 2FETA 2WBLC 5IAKA 1V5EA 4EIWA 1XQYA 3DL2A 4DMUB 2G09A 1R6NA 1C3OB 5E4YA 3FOZA 2P5TB 4LWQA 1E79D 4P82A 1A9QA 1J9GA 1Q2XA 3F8TA 4C7VA 5KYVA 4AHCA 3V4OA 2HDHA 4O63O 1L9KA 4G4SP 2AN9A 3H2ZA 1HV8A 3U16A 3EIWA 1OREA 4V0QA 4LOJA 3OE5A 3LKVA 5FDFA 4B08A 1BRMA 3NAZA 4FLUA 3FLBA 4XDYA 2PEYA 2P06A 1ESCA 1CJCA 4FR2A 1OH6A 2WWTA 1F0PA 3WL4A 2WJGA 2O7QA 3IDZA 1SQFA 1Q91A 1KI7A 4LVUA 1DJMA 3PDJA 4TSRA 3ZBQA 4E1BA 4H7PA 4EHDA 1SESA 3MWJA 2DHRA 4ZP1A 1TW3A 2PYDA 2HMAA 1R6BX 3K8QA 1SXJE 3O95A 1ZZGA 1EH5A 2OORA 5LZ8A 3A10A 3QSGA 1GSHA 1MB3A 5K7SA 4D8WA 1XWIA 3INTA 1V43A 2AFIE 3FCCA 4FR0A 4QFDA 4DC1A 4E1VA 2ZTVA 3WBKA 3NVAA 1DCKA 1ONSA 5AHRA 1QX3A 4IGKA 3PUZA 1PZXA 2ZJBA 4E4TA 3CXRA 3N0RA 4LFAO 1JU3A 3E3AA 1OLOA 4DCUA 5EJ5A 1UBRS 4OHOA 1HQCA 5I48A 3JQAD 4LYAA 2WU8A 4KQJA 3ZPXA 4UD2A 2JRLA 3LBNA 1IJKA 1JHXA 1JIQA 3AFHA 5CURA 3WLKX 5CH3A 1WVIA 3QVTA 1BJRE 2DSNA 2Q5JA 2QDXA 3STHA 2B61A 3HWX1 1M9NA 2BLLA 1N4AA 1XLVA 1R37A 3R7FA 3ZUPA 3HXQA 2PUGA 4BX9A 3IBYA 3IAUA 3ENNA 4QU9A 1G21B 4NCBA 4H4CA 2Q4RA 2E5LB 4LOHA 5CB4A 3ZTWA 2JANA 2P9HA 1G2PA 5LCXA 2XMBA 1OFGA 1PJ3A 4K1XA 4GX2A 4HH0A 2IIQA 5D5QA 3HKCB 2VP5A 2WJ6A 3QVVA 2XSZA 3KZVA 3OMLA 1XRQA 4HGPA 1PJ4A 4O4LF 1JR2A 2X58A 4F11A 4GPTA 3EAQA 4KXVA 3GJYA 2D6FA 1R6AA 4ZI7A 3OJWA 1KTIA 4CMJA 1UMCA 3USCS 5A9TA 3ZIAG 4CI0B 1U0SY 3WY9A 4DT1B 1O0BA 1W73A 3UGTA 1TTQB 5EXPA 5C81A 4ZV7A 2CK3G 1NMYA 3MMZA 4EY8A 4P30A 4IGGA 2ZYTX 2V6JA 5J47A 3ET5A 5HNKA 4R0VA 2A30A 4Q4JB 3SDZA 1X2EA 1PYDA 3ZQUA 1XD9A 2QKAA 2XAQA 3TLZA 2CHFA 2C42A 5IJ0A 3KHKA 1LDBA 5JBIA 3ASNC 3DXYA 1K7EB 4U6SA 121PA 4LF5B 1W4RA 5BN4A 1AMNA 1EEXB 1GUAA 1AZWA 1PL4A 2QM7A 2W0MA 4F7DA 4IINA 3F5QA 1XTBA 1WZEA 4H6PA 3LECA 1JHPA 4ND3A 1PBNA 1O94D 4C0LA 1GQYA 2IJKA 3EXEA 2HU2A 1WP4A 2Z8ZA 3I6BA 5CAEA 3A06A 3M83A 2Y67A 4M9ZA 2QW1A 4G0OA 5A5VA 1CUSA 5A06A 1DGQA 3E1SA 1IK4A 4EI2A 1ZSPA 4F5ZA 5G0WA 5J63A 3WWOA 1YHZA 3WHPA 4OFWA 4MI3A 3REFA 3IMCA 1QCCA 1ZHFA 1A8UA 1UMBA 2ATVA 1QK5A 3C70A 4GWKA 4Y3UA 1C3LA 1T5EA 2FPGB 2H5EA 4IDPA 4S3MA 4MWTA 2QKYA 2YJNA 1YCDA 2Q62A 3M49A 4V0SA 1A9RA 1DGSA 1VE3A 1UZNA 3GV0A 2E5WA 1VL1A 2R85A 3CR8A 1L5OA 3TFOA 2ADQB 2UDPA 1XRMA 4EMUA 3MC1A 2VJYA 4BLVA 3AF6A 2C7RA 2P7HA 2JGKA 3G79A 4PO8A 1UMDA 1LVHA 3RH0A 1PG2A 4O8CA 3FUCA 5J58A 4GLFA 1T5OA 3UKDA 1EQAA 2H06A 4AAYA 2Q3EA 1IK6A 5IYZB 2WYHA 4IWNA 4B31A 1RYNA 2Y0PA 5CJ2A 1UIRA 4ZN6A 5TF0A 2QUIA 3M6UA 1QGUA 5D84A 5E7IA 3JPWA 4F9FA 3MJRA 3D6HA 3IQHX 5LXTB 1P2GA 3QBDA 5AKYA 1G64A 4PAMA 3FFQA 2ZJZA 5IDJA 1WUKS 1AGRA 1VIVA 2FK7A 2FMUA 3QIAA 1KY2A 4BVLA 5D7BA 4BTVA 2DHCA 3E8SA 3S8EA 2GNOA 1ZAUA 2V98A 5LM3A 1F8YA 4KI0A 3G9UA 3A1DA 3CVUA 4B3HA 3ZE1B 2MSWA 3VH2A 2DW4A 2DHDA 4D80A 5LLSA 3M34A 3HDHA 1B41A 3FF1A 3ETJA 1WPXA 4L7QA 5KQRA 1U63A 1NVFA 4FDUA 1GQQA 1ULBA 4MUJA 4BNMA 2Q50A 2IF0A 1S3JA 4F3RA 3FRJA 1K4DC 3R9XB 2AOWA 5HKAA 4KLCA 3WQBA 1YS1X 4UUPA 3ZU4A 2WRZA 1MDFA 2G08A 1W76A 2H7CA 3S1SA 1HC7A 3OLWA 5K0JA 4C0KA 2J9ZB 1X80A 2LWIA 2QWQB 4JUFA 1S1MA 3C74A 1E9CA 3IRVA 2WKSA 5A2QA 3E5RA 1XE3A 5KWSA 4NMMA 3R76A 3FFWA 5D5HA 3GAFA 2AVDA 4DVJA 2NU7B 3ABQB 3CMEV 1KI6A 1IN4A 2P67A 2V9CA 3HYLA 1E9FA 3UKMA 1ESEA 3EPKA 3WLFA 3A36A 3EX7C 5FTKA 4Y6QA 3ABTA 1PYGA 3EXG1 3U48A 3GLQA 3BMNA 3OAAA 4D4GA 4Q66C 1XZNA 3CH4B 2I3BA 5E2AA 1E7WA 3IT3A 5KSOA 3ZD8A 2OGTA 1TVMA 3O1LA 4RAOA 4QFMA 1YQXA 2ZTMA 3WV5A 3SSOA 2H8KA 4GECA 3QXGA 4US0R 4EDFA 2CDNA 2JRCA 4GVXA 3PNOA 1E1QA 3EYWA 1LBTA 2ZRNA 1MO3A 4ARCA 4W9RA 1GVNB 1ZOOA 4NE2A 1FRNA 2J6HA 2HMVA 2V7VA 2A8YA 2HBRA 1TQ8A 3EGWA 3X2QC 3TMYA 3F6SA 3A1UA 2XLBA 4GDFA 3FTNA 2Z2ZA 1KQPA 3I2HA 3P9RA 2XYGA 4S1OA 4FN5A 1ZN9A 1Z6YA 1NX9A 4ND8A 1DXHA 3H2GA 1SULA 1WA5A 4J9YB 3JARB 2FRDC 2ZUSA 4FQ8A 5FX2A 3ERCA 2ZVJA 3K1ZA 2HBYA 1GKIA 2WM3A 4JI3O 3GFTA 3C0KA 1GV1A 1Y5IA 2HJGA 3QXXA 2GPBA 4QUDA 4ZAWA 1IEVA 3W5IA 3OZCA 1CE8A 1RP7A 4ARSA 2DOSA 3CISA 1QO7A 1ORQC 3IQGX 4F97A 1EM8B 1XNHA 3OICA 1PBTA 2CBZA 2J5XA 1Z6ZA 2WUWE 3JQGB 2YX1A 2AXQA 1XKXA 1I80A 2MIIA 2FQYA 2F8TA 4QOFA 3OUTA 1U0JA 3Q7PA 4D9MA 3VR2A 8MHTA 1X14A 2XAJA 1M0TA 5JZ9A 4RPGA 4MVJF 1YSCA 3GJ0A 1Z56C 2B35A 4RM3A 1KZ9A 4IV8A 4CQMD 1TE2A 3RRXA 4ZQFA 5F21A 1S89A 4G3XA 2Z5GA 1ZWKA 1E6UA 3JS5A 2NPOA 3KTOA 3IHWA 2E89A 5AVJA 2ID9A 5KNBD 3WIVA 9LDBA 2C4MA 2XB4A 1I1OA 5BR7A 1N8RW 3J81k 3SJ7A 2W2OA 1L5NA 2YNMC 1YACA 4A2PA 3W7BA 4GMDA 4RYLA 1KMIZ 5CB0A 1RBYA 4BMZA 3PHIA 5HK8A 1ADGA 5C1BA 4S1TA 4RIGA 4M7RA 4QGHA 4G84A 4DO2A 2B1GA 2CUKA 5CYGA 2JI9A 2ADMA 3DZJA 2R62A 5E2IA 1E6MA 3MGCA 1L7BA 2ZR0A 3JX9A 2QYSA 3RS0A 4X89A 1J90A 2WIBA 2WP8J 3DMPA 3UJDA 2B8TA 3O0DA 4RPHA 3B2EA 1VOTA 4E5UA 1BE6A 4FYYA 1TT5A 3LSSA 1G8YA 4A0FA 5K0FA 1BGVA 3FHJA 4YX9A 3IIIA 2C7OA 3ZI7A 2JDID 3ZWQA 1GFIA 2CZGA 1UIMA 4QGBA 3EMVA 4R7TA 4L74A 1FIUA 2AX3A 2IBSA 1MB9A 4EA6A 1KI9A 1RAGA 1T5TA 4ZKDA 3S7TA 1QTNA 3G2NA 1E4YA 4YONB 2PR2A 1Y5RA 3WNQA 4Z0TA 1NE2A 2IPLA 1WKCA 2ODWA 1UEJA 1CNFA 1DTSA 3L7JA 3AKYA 4PIPA 3QH4A 3P9IA 2DTDA 3RYIA 4C05A 3G8BA 3HJBA 1QVFU 3OOHA 4YAIA 1M56C 3TSYA 5KNDD 4GI7A 4FSDA 4QL3A 4X6YA 3H9UA 4RZQA 3T0IA 1IN5A 3OEWA 1EA5A 5B1AC 4WBNF 4V0ME 1HE5A 5JSZB 4ER5A 3SJAA 1FTYA 4WEOA 1RQNA 4GQAA 1TAHA 5F2NA 2CZQA 4Y67A 1AO3A 4WFEA 1E1MA 2WYVA 1K3FA 2ZRCA 2W7TA 4RK7A 1JHMA 5CFRA 1PO7A 2VK1A 4TS1A 2NVBA 2V97A 1D5AA 2BFEA 4J03A 1YCHA 3D2AA 1GTOA 2Q7HA 3L0DA 2Q2NA 1QH1A 3OO1A 3WLMA 1DC3A 3FDZB 2RBGA 5JD6A 2R11A 1Z4LA 3CCRV 1J33A 1E6CA 1XDGA 4UVEA 5DCWA 1QWSA 2DWCA 3IX7A 2F66C 2PQ6A 4DRXB 3HY4A 4ZVNA 2WTMA 2P40A 2XF2A 3ZHZA 2OAEA 2ZRGA 3IOMA 3AEYA 3ZY2A 3FDFA 1YVUA 3UXYA 1LDEA 4Y2SA 1XROA 3CVJA 4MW4A 2GXSA 4TLLB 2WPDA 3DDUA 3AI7A 4UHKA 4HWSA 2BMAA 3UXHA 4TSFG 5ALOA 2OZLB 1XZ8A 1PKXA 1SG6A 1UFKA 4TRMA 4HNUA 3BJRA 4KOAA 4IDAA 3LLCA 1AGPA 4KSBA 3PJSK 4OQFA 4WDQA 5JROA 4L50A 1UKYA 4N7RA 5K3AA 3K9AA 1L5LA 3ZDAA 1I6MA 3TBHA 3S27A 1RU3A 4MUYA 3ICVA 2LVBA 4FJ1A 3LSUA 4L5IA 3EDYA 5D3QA 1BKYA 3GARA 1XA0A 2EF1A 4REQB 2N3ZA 1FP6A 3BHMA 3TQOA 2UZAA 1U9YA 3RIYA 2P35A 3C1AA 4A0SA 3I92A 3GOQA 2V1XA 1QIIA 4HB2A 5SY6A 3K9NA 1O94A 3FNQA 4H7HA 1FVXA 1RJDA 4ZAVA 3VR4H 5CGZA 4DE5A 4TL7A 5FYQA 3RJMA 3RKSA 3U7JA 4HDOB 4UMFA 4NENB 5DNVA 2RK4A 5G53C 3DP7A 3I42A 1KH3A 3JATB 2IYEA 3SZ3A 2IUEA 1EYZA 1DEHA 4RE6A 3PHBE 1EUYA 3WKAA 3G67A 4MTOA 2CHUA 3QEMB 4FEYA 5D1NA 2OKCA 4ZCMA 4A2CA 1SCDA 5EJ7A 4GRAA 1HG0A 3CNQS 3IUNA 4Q3LA 5IWCA 3FWPA 2HA2A 5CLQA 3ZWYA 1NBMD 2RGGA 2PX5A 3N76A 4MUXA 1Y3IA 5EWJA 1W6RA 1E94E 1A2KC 3NEYA 5IANA 2Q9CA 1XEXA 2JIZG 3IKJA 3DE3X 4JC0A 3NR7A 1WB7A 1JDVA 1Z8DA 3LFHA 4DBLC 2ZJOA 3B53X 5JMOA 4IIGA 4YA6A 1P91A 2PRIA 4FOPA 2R7KA 5GJBA 5AVVA 1L7NA 4RQEA 2J5RA 3AP1A 2QUZA 1SHLA 3ICXA 4OXIA 2I34A 1T1JA 3EEYA 2RJNA 3VSAA 1RAAA 2O1XA 1L7PA 1KAEA 3LI2A 3RAEC 5ALJA 2EJCA 2E74B 5CVTA 2CHEA 1R6XA 3E8GA 3H7IA 1XFDA 1WXGA 1U3TA 1U0RA 4HH1A 3P19A 4LMBA 3MJEA 1BFUA 4FYIA 1B04A 1RP3B 5FT9A 2D59A 4QPDA 4GIBA 3M1IA 4QWMA 4B71A 2RHJA 1AKEA 1B06A 3VPCA 3MIZA 4DJTA 3OEYA 1OBVA 2I4RA 3OA2A 2L0XA 3NAMA 3HGMA 2CY0A 2IIPA 4DV6B 4KMSA 3QYAA 1AQIA 1QFXA 3C87A 5A4IS 1I3LA 3CRQA 3LZ6A 3PC6A 4I1SA 1U4NA 4XCQA 3K0FB 2ZK7A 3VOAA 4JAVC 3KOXA 5L7YA 2WWWA 1JDNA 1LNZA 1ZCFA 2WLJA 4Q1FA 5C51B 3P9CA 4IUDS 1T1SA 2HQSA 1XTIA 4GQBA 5HZHA 4LCUC 1EN5A 1D4ZA 3TTSA 1JW9B 2EVWX 3CX3A 1NNUA 6PFKA 2I2AA 3WRYC 1SUIA 2IXFA 2F43B 4TKUB 4M55A 2BGIA 2PMBA 4K5QA 2P9ZA 3QU5A 5FA5A 3HDVA 3RFFA 5C4GB 4RV4A 2OK7A 2YZKA 1JF8A 3MWFA 4LZNA 3A25A 3P9PA 1Q0RA 1N7GA 2KG7A 3A3OA 2ZD9A 1VQPV 2J9FB 1K0FA 5L3EA 1XCOA 1YA4A 3R7BA 2R8PA 4IDCA 5D5PA 1E18A 1OX4A 5DT2A 1SG0A 2VQFB 4AG3A 5J9FA 4ETNA 1XZPA 1Z36A 3HZHA 2ALJA 3EVDA 2GASA 5DBOA 1MIOB 4M1EA 1DBPA 5ECGC 5MF6A 3ZGZA 3MXTA 3GAZA 1QYRA 3UFXB 2PKRA 3G2LA 1M4UA 4PZCA 5D7NA 3BH6A 4RTNA 1IM5A 5FEMA 3AG4C 1SUWA 2NO7A 1H2HA 4F8JA 4A6EA 2ZJ5A 4K6MA 1GUZA 1J22A 4M7OA 1LLFA 4YCDA 2WWRA 2OQVA 4RVSA 4ZYLA 2RHRA 3CCLV 4A1FA 3ZOZA 1A69A 3MRVA 2ZSFA 1GPUA 2HA3A 4EPRA 2YJ5A 3FYEB 2UZ0A 1G3IA 3BH7A 3OZGA 4DA9A 4WA8A 1ZK1A 2O8BA 1E61A 4TLEA 5DK6A 2PXXA 1EP1B 1XL1A 4MW6A 4RF3A 5IN4A 2VWJA 3CXUA 2I0FA 5E9JA 3PC4A 3LDFA 4ACBA 2WFMA 1Q7TA 4DZZA 1BMFG 1NKSA 1N6RA 5A2QN 2JHCA 3ENKA 1ZAKA 3IGFA 1T8TA 2VEDA 3P5SA 1LZKA 4FYHA 2R4UA 4XQ0A 3ZV7A 5DN6D 3LH5A 3E5HA 2XNDA 4M1KA 1NAHA 5K4AA 1VGVA 5F4BA 3G89A 2VT7A 2P68A 4LHSA 4I4TA 4BMNA 2WYUA 3EOBI 4RVOA 1Z6AA 4NAVA 4INPA 3G2PA 3PTZA 3IKMB 4CUJA 4PO1A 5J1TB 1XBLA 3BSSA 4P36A 3BXHA 3DZIA 4YRNA 3FOBA 5IUNC 1PX0A 4IYJA 4BRSA 1I4LD 2ATCA 2RN9A 3PUYA 1XEAA 2IZOA 1DBRA 4NTZA 2Z98A 1X0VA 3CLVA 4RVNA 3TBFA 1M83A 3EZXA 1O57A 2H11A 1HLFA 4OGKA 3DZHA 3H9QA 4M0UA 1OE0A 4G0ZA 2POQX 1DMRA 2NO6A 1E3QA 3TD6A 3WDSA 2GO1A 4EG7A 1BZYA 4NBRA 3TOZA 5FNVA 4LF6B 2RQ6A 4PD4F 4O4HB 3G2IA 1QZXA 3D7SA 3DMTA 2ACKA 3BTSA 2QZZA 1DF4A 2DPLA 4DLVA 4JVOA 4F9TA 3QXJA 2O8CB 2WHPA 3KX2A 3H01A 1EK0A 2HH9A 5IKXA 1NI4B 4L5YA 1LF5A 3TLBA 4F6RA 3WP1B 2PZ8A 1JR6A 5H9CA 4OHXA 4PA9A 1S5PA 1QKKA 3I2KA 4PDVA 4QYSA 4WZ6A 5FTLA 4K26A 3B48A 1WIWA 5CM9C 3QENA 1VQ7V 4O2BA 4B4KA 1EWQA 3KKLA 3IALA 3FMFA 3O8QB 3VKVA 3W7VA 2F3SA 3ACDA 3E5MA 2XAGA 1N7HA 4IEIA 4OVKA 4UM9B 2NXCA 3ZG6A 3RJ5A 5TV2A 5HGXA 1E0JA 1JHQA 1KYVA 1N0WA 3TQFA 1V35A 2JBHA 2FSVA 1L8QA 1QORA 4MPTA 2BMWA 3G3EA 1NSFA 1TDJA 1DAMA 1HDYA 3IVCA 4QOGA 1EGVB 3QIVA 3TQIA 2QTZA 1YS7A 2I4TA 1NWHA 4XTRA 2KJQA 4HB0A 1JPXA 2UAGA 3M89A 1N0IA 2WJYA 3S8YA 2P9QA 2F8MA 1Y7HA 4DGQA 2GN6A 5KLVH 1LGYA 4WN3A 3H1HH 5AVZA 1E99A 4KL8S 5I51A 5EZYA 1E1RA 5F76A 2WWIA 1MAWA 2XAAA 1UBNA 2W43A 2QNBA 3IOYA 4U0KA 3NHWA 3UMJA 1RC0A 3TSOA 2WLSA 2C83A 2EL7A 2YFYA 3IMFA 3C45A 3KR0A 5AVXA 2F3UA 2WW8A 4JTDB 2BH9A 2H51A 2IK8A 3EVNA 3MGBA 1W4LA 3B9QA 4QBIA 4QX6A 2IZZA 2N42A 2B4QA 1U04A 1ZD3A 4GYCB 2V6GA 2ZWAA 3JZFA 3D64A 1RBZA 1M54A 1KKMA 1QVWA 3QHAA 2GWHA 3UOAB 1SD5A 3TFWA 2D0IA 4WXYB 4DV2B 4Q3KA 4YFYA 4OHRA 2OK8A 4D9BA 2WB4A 3ICOA 5BQOA 3H1FA 2GF9A 5ETJA 1JQAA 1NQWA 2P6NA 4X6UA 1Z5NA 3B6MA 2LD4A 1RQ2A 3IXQA 3MHTA 1NKVA 4MRNA 3SF8B 4L0MA 2I2DA 4JLBA 2H1FA 2HZBA 5B1OA 5AVUA 1RQ7A 4KB5A 1U98A 3KOWA 2CKDA 1L8AA 3QEJA 4WQMA 3BA6A 1L5HA 3JYPA 2CXSA 2WTAA 4F4FA 1FRQA 5JD5A 4OI0A 4ZYWA 2I2FA 4FYWA 5BSWA 4MR8B 4QPZA 4HOYA 2XYHA 5LVAA 5JG7A 1LLQA 5ITZB 3VC1A 1PZMA 2FFJA 4IQ4A 3RYCB 4Z1MG 3K0DA 1SIUA 2GNAA 1F9EA 2BGKA 3EHBB 2IUYA 1R27A 4XFDA 1LBHA 3GVPA 5JATA 4MLPA 5AOVA 1YTFB 4RELA 2LP4Y 1VECA 3IKTA 1GPWB 1NVVR 4C4RA 1YR9A 2VN8A 2IEDA 5LIPA 4FT2A 4EVRA 3PQFA 3DGEC 9MHTA 1G98A 2PMDA 3T1VA 4PNEA 1R64A 1L2TA 4BIUA 3WVNA 1WB6A 1MKYA 1P0CA 1LQ2A 1B2RA 1M1NB 2VYQA 1TIBA 1WJZA 2P5SA 3TOVA 4P3OA 4RCVA 2QR4A 3OM8A 3EPHA 2G70A 2EOAA 2LCQA 5EHGA 2BSXA 3RB8A 4HB4A 2XNCA 1IQUA 3IBCA 3K0SA 1FDIA 5KYYA 4Q9IA 3FNFA 5DEIA 5C5IA 3W05A 5JMPA 4BEJA 2D1RA 5TQVA 1Y5LA 3M6LA 1H1LB 3HKEA 2QMQA 4MYTA 3S6JA 2JCXA 5E3HA 2WOOA 5HDBB 3ZCRA 1ULHA 4E13A 5JR3A 3RTCA 2LDXA 3EWSA 3D7KA 4KIFA 1OCOC 3MMPA 4J90A 3RG2A 5U4QA 4AJEA 3JASA 3MT7A 4AS1A 3CUWA 3LWZA 4M1TA 1XRSB 1F9AA 4JXXA 2KI5A 3FNEA 1Q57A 3ZRWA 4ETWA 5KHOC 1M57B 3BFPA 1SK9A 1X8XA 4LYEA 2E48A 4LC1A 3IP3A 3D6VA 1JEYB 3GRVA 4JEUA 3CEAA 1P2SA 3UN1A 4OHPA 3OQPA 3OIFA 5C31A 2HDWA 3OOYA 1Y7PA 3QWAA 1KFEB 1TA0A 4RVDA 4WFGA 4L8YA 2GOYA 1ICIA 3RREA 4MQLA 3WGZA 1A98A 3IHLA 3A31A 2ZYHA 3WHLA 4TT3A 1N92A 1DNPA 3CYOA 2O07A 2FW9A 1DPFA 1ECCA 1L4FA 3QV2A 3SM9A 4RWEA 1RT9A 4QNNA 3MWDB 5B4UA 2XBMA 4H17A 1N6KA 3OE1A 2C9OA 1H9AA 2BE7A 621PA 2QJRA 1A9PA 4DADA 4PYQA 2PQMA 1I0ZA 2OO7A 2J9XB 5EP2A 3EMDA 1PQ4A 2R1VA 3VPFA 2C1XA 3HDQA 2ZJ2A 3W5DA 5IZ4A 3ZGVA 4KREA 2BT4A 1AGNA 4R3WA 1KK3A 1BCRA 4NZ9A 3IC9A 4DMLA 1JDSA 2R00C 1YR3A 4DUYB 4A82A 3DHVA 2ONZA 2E55A 2Z4RA 4I1RA 4LE1A 3I0MA 3QY0A 1EZVH 1G2OA 4EW1A 1RXSA 3AJAA 4KDFA 3DLTA 5I7VA 4X1YA 2ZXWC 2MDTA 2J3JA 3A0UA 4OQPA 2Q6IA 4JOCA 3JQFC 1QGDA 1ZS9A 3L4BA 3BFJA 2YS7A 2I3ZA 1YFJA 3KT6A 4UJ5A 3NOOA 3B1YA 3IVAA 3IEVA 3HNPA 1T29A 3RYFB 1WSAA 3SBOA 3K2BA 4R2MA 2Q7OE 1NHWA 1MA0A 2YY5A 5DYWA 4JQZA 2F48A 1O5OA 5DOVA 1CEEA 3NNDA 1BE1A 1SXJC 1MH1A 4AZWA 4IV5A 3ZXUB 1NH2B 2J41A 4AKGA 1GGNA 1DKQA 4O4LA 3EVGA 3KKPA 1R16A 4NK4A 1E8DA 3ND5A 3SJZA 5JYEA 3LRPA 3H6GA 1XD2B 3ID6C 4G0UA 5HIMA 3HB1A 4D0NA 3JWEA 2EBUA 2YMLA 4L6AA 3GNTA 3VJKA 3P5BA 4PG5A 1RWKA 1S7GA 5ER9A 4GUNA 3FG9A 4RVFA 2Z5FA 3R74A 1A1SA 4DLYA 4KX5A 4NJMA 2IW5A 1YCFA 1KJYA 3KAPA 5JMTA 4G01B 3ZS8A