5D5PA

Hcgb from methanococcus maripaludis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
157
Chain Sequence
NIENTIKSAYEESLNNARFGDKIEEIDAIQSTIKSAKNVTVATSNEKKFKVVSDIISRITDANISMLEIPTNSADLTRMPALNKGLIAVDSSDADLIITRGRLGIPGSGSLLLIMDKKGRILTGSVSPSSIIHKNPIDKTVELELITALERIGIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HcgB
publication title Towards artificial methanogenesis: biosynthesis of the [Fe]-hydrogenase cofactor and characterization of the semi-synthetic hydrogenase.
pubmed doi rcsb
source organism Methanococcus maripaludis (strain s2 / ll)
molecule tags Transferase
total genus 46
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5d5pA01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 5d5pA02
1RSOA 2F93B 5JJNB 1IWPB 1MMFB 3WB2A 2D0OB 4L8JA 2F95B 1UC4B 1EEXB 5D5PA 1VF7A 4DK0A 2F1MA 5JJEB 1EGVB 4GYCB 1H2SB 5D5QA 2V4DA 1NBWB 1EGMB 2D0PB 1T5EA 1DIOB 3WB0A 4DK1A 3WB1A 1IWBB 3AUJB 5JJJB 3LNNA 3BRCA 1UC5B
chains in the Genus database with same CATH superfamily
4LBZA 1G2PA 4KUHA 1OTYA 3DHYA 4HQOA 2C2BA 1I6MA 4S35A 5EJ9A 5G0WA 4ZVLA 4PGHA 4X62B 1KXJA 5J58A 4HAXA 1AUOA 1U94A 2RJOA 5H6RA 4IHJA 1HR0O 4B79A 1G6UA 3TLKA 4H37A 4R9UC 4ZVUA 2NNLD 3RGBA 2E82A 1EFPB 2QJFA 3R3ZA 5JFTA 3AF1A 4WNAA 3ER8A 2FHPA 1CJMA 1GAWA 3UT5B 1DMSA 4CL8A 1PJBA 2ZJYA 1QR8A 5IAAA 1NBMD 4R8CA 4AF8A 1SC6A 4KQMA 3K9CA 3LQYA 1NN1A 1L7DA 4UDNA 4K9DA 3CD6V 1DK1A 5FL7A 4KYTA 4KLZA 5EK0A 2NU8B 3LG2A 1UJNA 3SS8A 3ZWBA 3EAFA 4TV8F 4EYSA 2ZRKA 3QVVA 2HIGA 1RBZA 4D45A 5AI4A 1OIVA 2N3ZA 4JEIA 3SQLA 1STOA 4C89A 3GGOA 3SPJA 2CKDA 5JANA 5K03A 4Q21A 1YMVA 3BF7A 4EQZA 2GM5A 2R87A 3C3EA 3NHMA 1L7XA 4LNAA 1AHNA 4RIIA 3PHLA 4H3VA 4J4BA 4BGVA 1CFJA 3OU7A 5KNLA 1CB0A 2IBMA 1UDBA 4RPGA 4L6CA 4TSFG 5KOJA 2H4YA 3FFBA 1R6AA 4M0UA 3T1CA 3BBLA 3NTVA 1G8FA 4DV0B 4C3OB 2P4SA 1HDXA 5L4LA 2V9ZA 1RE1A 2QM7A 4ZGGA 5JJKA 5JAUA 5AG2A 2GAOA 2PZBA 4GRAA 2UZ1B 5LU8A 4X97A 1WBBA 1XL0A 2ISQA 4W5JA 2ZE7A 5HTKA 5KHLB 1BE0A 1GTOA 4MPDA 3QNMA 4HDOB 4FLMA 721PA 5IKPA 2W37A 1DBWA 5AM0A 1UOEA 1IHYA 3J81N 3PKJA 1VF6A 2F2TA 2UVDA 4XEHA 3DMNA 1I1OA 1Z6TA 2JFNA 2IZ6A 4KRYA 2YOFA 2C3UA 4B7UA 3EZNA 4KG7A 3EZFA 4HB0A 3CKLA 5E7MA 1R3DA 5IK2A 4QM6A 3JAWB 4Q3DA 4Y1RA 3FWKA 1Z5UA 4IXTA 5FBZA 5BQXA 2QRVA 5HJ7A 4MW0A 3ABMB 3DTVD 1WHTA 3GLGB 4MV0A 1YDHA 1UKVY 1AHIA 4Y2TA 4IIFA 3NOXA 1W46A 1HURA 3QFTA 4ND2A 3TJTA 1I5EA 2DPXA 2P35A 2OTCA 1NW7A 3UFXA 2WYIA 3H5OA 1UXJA 1XEFA 1L8XA 1XRLA 2VYVD 5DI3B 5KHIA 4BN5A 4Q4AA 4GYYA 2FWBA 4LOKA 1WCYA 3IP9A 3VR3D 4EBBA 1UOOA 1K7SN 5DXFA 3LPLA 4C6TA 2P5TB 4G8BA 1QK3A 2HFEC 3L6RA 5F3WB 3D4IA 2G0AA 4AQDA 1DC3A 4CH4A 3FGZA 2H06A 4G1BA 3TR5A 4M89A 1U8ZA 5CR9A 5DN6D 2WUEA 3VFDA 2GR9A 3W6ZA 2PLRA 2WLKA 4PSDA 2NSDA 3RYHA 3AP1A 3CPWU 2NQ8A 1KY2A 3UWPA 5GMOA 3JD3A 5FNVA 5EC1C 1G8SA 2ZSDA 3VI4B 1X8LA 3ZGVA 4JUCA 2FPOA 4XYGA 4XOIA 2IJGX 1PD3A 1T5HX 3CZRA 4HRYA 3LSTA 1B0UA 4F3NA 4KIFA 2AC4A 1Z3IX 1CUAA 4W1RA 2Z98A 1RWMA 1D5NA 2WAAA 3AKDA 4I14A 1J33A 4LSZA 3U48A 1ZNWA 4JOBA 4JL8A 1ZK2A 3WK4A 4CKCA 3HY4A 1QLHA 1JIQA 3I12A 4GR5A 2R84A 4HDNB 3UOWA 2P2GA 4A1FA 4K3UA 5TGZA 4V3BA 4CI9A 4WCDA 2EP7A 3DYBA 2XKBA 2MYPA 2ZYDA 2ZYWX 1Q7YW 4FFMA 3O38A 5A5FA 3RVSA 2X0JA 4GP9A 4TKMA 3AVXA 3SGIA 2CTWA 4KNVA 2F17A 1VBNA 3AEUA 2XQGA 4KFRA 4KE9A 3KTFA 3RDPA 5FL7G 4L6IA 3SQXA 2B5UA 2YQZA 4OHRA 5LGUA 4TTQA 2NZXA 4UM7A 4COOA 1QHHA 1F2TA 3WXMA 4RL6A 2BJVA 2VFAA 4QQFA 2WWFA 1F0KA 2H4XA 5DCWA 8OHMA 4ZV9A 4MWGA 4IZIA 4HEA6 4E2FA 2AZDA 4TYNA 3AG4B 3SCZA 2GTIA 4DEVA 3RODA 1C30B 1X4TA 2ZU0C 5AW3A 3OURA 4F11A 3CUKA 2C8JA 1O5IA 1UR5A 3DOCA 4UBLA 1OQAA 1MX9A 4EK9A 4CL3A 3A4IA 1H4VB 5EMHA 4EJ6A 1U7HA 2QTVB 3L6EA 4E5NA 3EQ9A 1VCIA 3UJPA 1JIUA 2D2IA 4V0LA 1JB1A 4KGDA 1Z82A 3AG3C 2WAOA 1TFRA 1JF8A 1MB0A 2EBUA 5ERXA 1UBEA 4FFKA 2QM0A 4RK1A 2BY4A 4XOUA 3RFFA 4MUGA 1EUZA 3FPBA 1O1YA 4V0RA 4WF9V 4YRNA 3FYCA 2YXLA 1CEYA 3PUJA 4BKMA 1V9CA 3F7OA 1HT1E 5EIWA 4LXYA 5CPFA 2OV4A 4F1JA 1PKEA 1IAQA 2NUTA 4KB5A 2E3CA 5H83A 1YI0A 1E1LA 4EYOA 3W2TA 1UT5A 1QFZA 2NUAA 4LJYA 3ZVRA 5ISMA 4QYWA 2CYAA 2I87A 2GN6A 1Q1BA 4A73A 5BN5B 1QHNA 2WF6A 1GG9A 4JYCA 2AOXA 4L8VA 3EDRA 3E9RA 4NBUA 3Q3JB 1RP3B 3EGXA 4L5IA 1F9AA 5F1OA 2HA7A 3HJTA 4FP9A 1SU7A 3MINB 5FF9A 3VKFA 1YS1X 3KJXA 1QR9A 2PZSA 2VP3A 3F4BA 2CTRA 1NJIW 3HSYA 1Z45A 1JJIA 5C0OE 1DF4A 5IDXA 3A6FA 4NMLA 3AY0A 3TR0A 3HCOA 3DXZA 5DX1A 3N70A 2HZBA 1TIBA 5K3SA 1KY3A 2COKA 3R6GA 3IHKA 4NR0A 1NHWA 4BMNA 3NM4A 1Y3FE 4I5SA 3BIJA 1I4LD 4EITA 3TGWA 2PMKA 3DKIA 4HBNA 1JLLB 5BT8A 2PY6A 1ISSA 1HL3A 3BTSA 3PPWA 4I81A 5A2GA 1XQYA 3KFVA 5F1YA 2JGFA 2FN3A 2ZYGA 1C0IA 4G85A 5J23A 2AJTA 3T0GA 3W6PA 1VPWA 2P30A 1BJTA 3F7YC 5GINE 1M76A 3FSEA 1T2VA 5J2TA 3KLPX 4AZWA 4E88A 3GJ0A 5GZ6A 3TW0A 2D0PB 4BMCA 4XVUA 4HHEA 1WUTA 1YGYA 3IULA 4DF3A 4TX1A 3DF7A 3EQ2A 4KI0A 5CW1A 2JJMA 1I4DD 1T9HA 2W6ZA 3TZCA 5T6MA 2VYQA 5FLYA 1WUHS 2AXEA 2ZM6O 4IIJF 5LZ2A 1T8PA 3L8DA 1CP9A 3SIRA 4PG8A 1P1IA 4GPZA 4MVJH 4RJJA 2N47A 3OICA 3CRMA 4E09A 1DUIA 2PANA 3R3XA 1QVFU 4S1WA 2C9YA 3AB3A 4PFKA 1QPGA 2W6JA 1XJQA 4HQLA 1UBRS 4IYHA 1QE3A 4DK0A 4G4SO 2I66A 4PX5A 3H2IA 3PNOA 5B1AC 2JH3A 3DOOA 2NT3A 1V1JA 221PA 4NWIA 1M2NA 3VTZA 2R4TA 5L7YA 3BQ9A 3TXQA 1T5IA 3DAGA 2XZOA 2EZ9A 4ILKA 1JZQA 1SJ9A 3OQOA 1JG3A 3M33A 1P7GA 5ITWA 2PM8A 3U26A 1IVSA 3W2IA 2Q8PA 1KS2A 3ZWYA 1VYUA 5EZYA 4FMTA 1W4RA 5K05A 2PCJA 1E9DA 3EULA 3PFBA 4MUXA 4RLSA 4RZXA 2C3MA 3MJDA 2VVTA 1QRUA 2YXHA 4DBLE 4FM9A 3EHDA 5D3MB 1G2IA 3ICWA 6ADHA 3Q4HA 5DWQA 4D80A 2VSOA 1UWLA 3CTMA 4PYKA 2QRMA 2CCJA 2VDRB 1J2JA 1RR6A 5HCUA 3WSTA 4NHEA 2Y1KA 4LSMA 4E33A 5IYBO 1RCFA 3HR8A 3T7JA 3WL4A 1IXSB 3NRJA 2YIBD 9LDBA 1FQJA 3PXUA 1RXUA 2AFIB 1PGJA 3IEPA 5BNIA 5IDQA 4AN1A 3NJ8A 1OXKB 2FEWB 4YRDA 4C7XA 2J6HA 2AJDA 2QYHA 4A91A 1YBAA 1WPQA 1EFKA 2OCAA 3ACBA 2R9VA 1M6WA 4UAVA 4AUNA 2OBNA 2W6PA 2H1SA 2RGYA 3S27A 4BO2A 1G1AA 4A9AA 1U9IC 3RS8A 5JAQA 1Q50A 3KSRA 2Z08A 4JT8A 4RVHA 1I3KA 1GUDA 1Q7CA 2BV3A 3R8FA 4DC9A 3RRBA 2HMSA 3EC2A 121PA 4TTJA 1B0ZA 3EF1A 3C74A 4MR9B 1JJFA 3MILA 1OZ0A 5IABA 3FN4A 3KYJB 3TBFA 3IO5A 4KQCA 4QTUB 4JSYA 4ZOBA 4Y6OA 1ZXXA 3H87A 3CKKA 3S68A 4L50A 3ZI0A 1RM4A 1SFRA 1Z0UA 5BW5A 4KQFA 3LP6A 5BUSA 3RCBA 3OI7A 1GZHB 4G5OA 3ZN1A 4OA5A 4OXXA 5I9IA 4M1ZA 1Q77A 2P40A 3EQ8A 4E5UA 2BMWA 1V6CA 3ZLUA 2FJ0A 1R8JA 1SO8A 3FWYA 3BZWA 2WKSA 1P91A 4ZTBA 4C4RA 3JAMA 5BWOA 2X0KA 1SCUB 5KYKA 4Q48A 1VI2A 4PAMA 4Q7LA 1N5MA 1LJLA 1SUEA 1IUKA 2GHTA 3COZA 1LZLA 3PJSK 4GBGA 1EVKA 1T1SA 2X6QA 4JDPA 1H2XA 2VHVA 5FPKA 3PG5A 4RTPA 3DE4X 1R00A 2WFZA 4P1ZA 4B4KA 4RHTA 4KO2S 5KWIA 3DE1X 1MX3A 1JHZA 3K6JA 4BMXA 4PGMA 3HJUA 2J3LA 4Q03A 4L8JA 5C3MA 1ZICA 1JJOA 4CM7A 4W9NA 2XIJA 2J9GA 3STYA 3RYIA 4DA8A 1GG5A 5HUQA 2QEQA 2PLFA 2IVZA 4ARBA 3ETHA 1W5FA 3KQMA 3ZHVA 5BMVF 3OZSA 1CNMA 2PKEA 4DEXA 3L4BC 3NTLA 3ZPXA 2J48A 4CCSA 4KE6A 5EGSA 4ZWNA 1DXQA 3RW9A 4RFVA 4YEDA 1CJTC 2Q4EA 3LNTA 3BCCH 2O7VA 2HR3A 4UCFA 3QVLA 2WLHA 3MB8A 1N2CB 2Z83A 3TLYA 3BBPA 2FRDA 2A58A 1MTOA 2FEPA 1MRZA 1KSFX 1UPUA 2BFEA 1DTEA 3PD0A 3QSGA 5J3JA 4HN9A 4P36A 4ER0A 3PFNA 2XAHA 2VDWA 3LSSA 4RVGA 5JJIA 1MO3A 2Q3DA 4G1UC 1HNZO 2PEZA 2F4VB 3JD1A 2I2BA 2XZPA 4W6ZA 1MXHA 2OCHA 5CPBA 3BKXA 2WIAA 1WDMA 1YJ9V 2HNAA 4ZKDA 3N7TA 5CGZA 3B52X 3BREA 2ZSAA 3LXMA 1VPEA 4IOKA 4FLZA 4EA6A 1K8QA 4YO8A 1K7XB 1CF9A 1J5PA 1E1RD 3T5DA 2X3YA 2JK1A 1IUPA 4NYMR 3UMSA 1T2FA 1FS6A 2VO1A 3NYIA 4N3BA 2CLHB 3G82C 3OE7A 5KKCA 1XNRB 3OZVA 2RONA 2VTVA 1TVCA 2IL1A 1J20A 5DH9A 1LPSA 3A6LA 2ZCJA 2EX0A 2H3EA 1VOTA 3FD9A 4BNGA 1UPCA 1JHQA 5KIAA 3OTFA 3EG5A 8ADHA 3EG9B 1Z17A 3HU5A 5CIQA 4GX5A 1BW9A 3HVHA 2ZWMA 3O26A 3KVRA 2BBWA 1HE3A 1MB4A 3QEKA 2MSEB 1O08A 2WJPA 4RJ2A 2XMZA 2OAP1 2EFEB 2HHAA 5CDHA 3IDSA 3R20A 4DMMA 4DABA 2E4VA 1BROA 3H5TA 3P4UA 2V7UA 2RI6A 5GWXA 4FMCB 1HG0A 1CUZA 2QT0A 3AKZA 1VGQA 1N36O 3HNOA 4V38A 5AKEA 3I9JA 1URPA 4UM8B 3K1YA 1M2OA 1CHNA 4L0DA 3D6UA 2H1LA 2XWJI 3USZA 4I9NA 4MVJI 3IDQA 5CA0F 1NF9A 3KIPA 1WCXA 3RVYA 2BTQA 1DXHA 1JHXA 3KZVA 4PYOA 4ALNA 1ADFA 4LBWA 4GIBA 1Z6ZA 3EH2A 3KV1A 5JSHA 1FDWA 1M3SA 1M2FA 5J4YA 2EZOA 5B7PA 4JUAA 4RZ3A 5GW7A 1OLXB 4TSFD 1OB2A 1WMEA 1BXKA 4KPUA 4O2AB 1EVIA 4IHKA 1DIOB 3K0FB 1OX6A 2JLSA 2EJ7A 2ZI3A 4AZVA 3DKVA 3LZCA 5EP4A 2JS3A 2I7DA 3ZMSA 5KVAA 3FSGA 1NXTA 3Q5GA 2DTDA 4ZYVA 2E89A 5SY6A 3A1UA 3GLRA 4N0MA 3L06A 1TMKA 2AHRA 4CV3A 1KAOA 2OC9A 1XIVA 1P3DA 2IP1A 5L7WA 1E61A 4B9AA 4TT3G 2UXDB 3R7NA 2JFFA 3AW8A 3BGDA 1Y7TA 3LH5A 4F1WA 3ZRVA 1VQ8V 4A03A 3SJCC 2VP5A 2H2IA 2AJBA 2HLDD 4TTVA 1XL4A 1C9JA 5EY5B 4KJXA 1FLVA 3E2MA 2QKYA 1KO4A 4KIWA 5B36A 1W35A 3OPYA 1MA0A 5LYJF 2VHXA 1DS6A 4BOYA 3IC9A 1NG1A 4MR8A 1E63A 2AHYA 4X0EA 1T9DA 2IPMA 5B3KA 2RGNA 4P0QB 4D0NA 3QBJA 4W7SA 3V8BA 5DM2A 4XD7D 1I13A 1H9BA 3R5JA 1D1TA 1MRNA 3KWLA 2H0RA 1CRLA 5K4GA 1U02A 3KEMA 2UKDA 1U96A 4R68A 3Q8MA 1EFLA 1FP6A 4WLVA 4UXIA 2GTAA 2LE0A 3K6RA 1F3OA 4K8XA 1X9GA 4X7BA 4BKUA 3ZE1B 2PUGA 3WKBA 5KYYA 1NV9A 5DM0A 3C6ZA 4R8RA 4RMJA 4PXSA 4TKUB 2F8TA 5DEOA 4PXYA 2FW9A 2Q5QA 1L5OA 1Y74B 3IS3A 5SYAA 3UCFA 3ZLBA 4YDRA 3S2GA 2F1RA 4ND7A 4NXNO 2JJ1G 2FYTA 5F5NA 2H1OA 2YZMA 5L3EA 3ZX6A 3WJ2A 3THYA 3N07A 1ZYUA 3W5AA 5K1XA 4MI1A 3OE7G 1DT5A 2R8EA 1YR6A 3H65A 3U3XA 4DBLC 1ZS9A 1Q7TA 5KOHB 1CDZA 1H8ED 1YIJV 4HY3A 4WE3A 3HBFA 5TQ2A 1Q3TA 1RM3A 4Q9DA 3EGVA 4NVRA 4NCJA 2BCJQ 3NCHA 3RN4A 2JJQA 3PB3A 1C1DB 3EXEB 3Q88A 3MOSA 4QODA 2X4IA 3PL5A 1WJZA 4IRMA 3G2OA 3U7IA 3OJWA 1N3YA 3M4XA 1NVAA 2QTLA 1GZVA 2QLMA 5G02A 3T7SA 5IT9A 3OIYA 3UK7A 4HC4A 2V98A 3EN0A 3AMVA 4BAYA 4ABTA 3WSVA 1N32B 2GEFA 2XMGA 1MJNA 1QIGA 4FS3A 4ZKEA 2GZAA 3LJKA 1WE2A 1T91A 3GEHA 3R7LA 1RYZA 1YR3A 4E5YA 3H5WA 1QKIA 521PA 4FDTA 2CH7B 3LO8A 3KQQA 3P52A 4EPYA 3G88A 1T5OA 2B92A 2P6MA 4M1YA 2QQ0A 1TKBA 2X42A 3R3SA 1JLHA 1RWXA 4WWHA 2ZIWB 2H17A 1G5RA 4GL2A 4DA6A 1G2OA 3G7NA 3INGA 1AQJA 2Q1YA 3V1TC 1E6CA 4D4JA 4ZI7F 4MLDA 3ZHYA 4Q4CA 3S44A 4KFTA 3TNFA 3GFBA 3THXA 1FTGA 1QRTA 5LIPA 2D00A 4MRMB 4RVUA 1O95A 2WB4A 3GD5A 3E5NA 5BUZA 1U2GC 2JLAA 2ZRMA 1NX6A 1LLQA 3QA3E 4BS9A 1BHJA 2G1KA 5F78A 2CBXA 3HYNA 5KU1A 1FXKA 2P11A 1EAYA 2YWJA 5KHKA 1PL6A 3QPUA 1HYQA 4MGZR 2GPTA 1G0NA 4GCZA 3UEOA 4IG4A 1CQIA 3HR0A 3W3AA 1J0DA 4X64O 2XNJA 1LSOA 3RADC 1V8PA 4TLCA 4IKOA 2ZRAA 2QQGA 1JEJA 3OPNA 4PIPA 1L5ZA 4LWPA 1YS4A 2W0XA 2GEKA 4JLJA 4M36A 2ZTHA 3A0HZ 2QTRA 2RHBA 2XRFA 4QNRA 4DLSA 1VG0B 2C2WA 1K8ZB 3BWCA 3N0RA 3LX6A 3NHFA 3A1FA 4GOND 1F51A 1CZRA 4C1NA 1HE8B 4EGJA 2QLNA 5C7OO 2VS0A 4UU1A 4K9QA 4Z1MA 1KJNA 5ESDA 1CR6A 3QFHA 3STLC 5JNLA 1ZVJA 4WZBE 2PLNA 1FC0A 3DMTC 5DEIA 4ZKIA 4Q5IA 2V96A 1PFYA 3VXKA 3HN2A 1ZWIC 1U3UA 2QSAA 3CMAV 3VJLA 5C1IA 1FTQA 1M8FA 4QGFA 4YALA 4XPIA 5LP6C 3F5FA 3JQBC 1WOYA 3WK7A 5CW2A 4EKEA 3HLYA 2GD2A 3HABA 3NHKA 4JC8A 1RWNA 5FI1B 4KMOA 1XZPA 3QFFA 4MCHA 3HJCA 2QJWA 2ADMA 1XVVA 3PQEA 1PG0A 1A9XA 5DBHX 4D9MA 2GRAA 3ZNNA 3H17A 1AXRA 1N33B 4Z0TA 3U3ZA 1SVIA 4Z9XA 1VA5A 3DEAA 1H65A 4ZEVA 2FR1A 3I56V 3FBWA 1V8DA 4YIHA 1XMOB 1VLZA 4K9LA 1EBFA 4XCQA 3B1JA 5IVIA 2ZJ3A 1JDTA 4CM1A 3HCDA 2N1BA 4IDFA 1FVOA 5KCMA 4LISA 1I80A 3PA8A 1H4SA 2MSKA 4B35A 1W36C 1MSWD 1SKYB 4ZAGA 4P82A 1HOTA 2QZSA 4I5GA 1WSDA 5JJEB 2O8NA 1QZZA 5HXAA 4JBHA 3VBBA 4EPVA 4DPMA 5H7XA 5IDJA 3FWNA 2FY8A 4QUAA 1U4SA 2QY9A 3EFOB 1P0CA 1APBA 3AETA 4AN4A 1IBLB 2ZB2A 5KTOA 4KWIA 2FZLA 3A2NA 3FNEA 4EECA 2D54A 1OXSC 4NOKA 4NQZA 5DRTA 4BMYA 5HTOA 2DSTA 4D44A 1DIGA 3DBHA 2JBAB 1S8FA 4LV8B 1RCTE 1XWIA 3MAJA 1H2KA 4F7WA 3ACCA 5JOQA 4L57A 3DAHA 1NE7A 2O2EA 4LF5B 1H2WA 1OJLA 5A5DA 4JL5A 2H8GA 3DVQX 1YCDA 5KMGA 2BM8A 2HCBA 3FDJA 3KS9A 1W7AA 4JA2A 1KK3A 1AKQA 4DR3O 3DL7A 2A0WA 4TMTA 5JJ5A 1RI2A 3RBZA 3A06A 3VDMA 5FBQB 4QEKA 3FGOA 2PGAA 4KIUA 3DVSX 1HE5A 2ZZMA 3GIWA 5JQGF 4LVCA 3M1LA 2ZS7A 2WILA 3NP9A 3L7LA 1S3IA 1BWQA 3DNMA 2JGJA 7ADHA 1S7GA 1M1NB 2JCSA 4TKLA 4YQEA 8GPBA 3ZVNA 3E3LA 1E1CB 1EEHA 1TOAA 4ZOLA 3G2JA 1L5FA 5ES3A 2X3FA 2OV3A 1DBPA 4WOCA 1PTJA 5J2UA 1MG5A 5IAEA 3VNRA 1PL0A 2EP8A 5I5GA 1MLDA 4OI2A 3DZBA 3TDKA 3HKCA 2LCFA 3WDLA 1G3UA 3EASA 4MHTA 2FFHA 2JK5C 5CJ2A 2EV9A 1I4TD 2Q4OA 1SNYA 3RU3A 2GZ3A 4DDTA 3DC7A 5KYWA 4MIYA 3SBEA 3UF0A 1RT9A 3CU5A 3P9IA 5H59A 3TQTA 3GJ7A 4B3GA 4AF6A 2YNMC 3UWKA 1UDAA 4S1PA 4GGMX 1LWOA 1FDTA 3RHZA 4EY3A 3CJTA 3C2QA 2Y99A 2QAGA 5I48A 1IN6A 1QLEC 1DX6A 1SUBA 1H2NA 3F6BX 3E61A 1GKIA 4E5MA 1R50A 3T7TA 3D8RA 5G0VA 3JZIA 2Q8QA 2BFCA 4CV2A 3NDIA 1MW8X 1UL1X 3ELWA 4WDQA 1AX9A 2PRYA 3IQGX 4IIYA 2Z5LA 3CF2A 2R48A 3ENNA 4V1CA 2JG3A 1B06A 1NJ2A 1JFVA 2PG3A 4ZVPA 2CLEB 1FDVA 4CMIA 3HDYA 3TOVA 3DZJA 1M5IA 3ZGOA 5K09A 5ALYA 2FPIA 4BTEA 2PZFA 2CV1A 4FGUA 3KVVA 3CEAA 3T5GA 5LB2A 5BW4A 4FEYA 3AUSA 3THSA 1O0SA 2PY5A 2YUIA 1RZRD 4BO0A 4D9GA 4CM8A 5CK5A 3O82A 4B4WA 5CD9A 1NUUA 4CEIB 3ADPA 1GPLA 1XKQA 2B61A 1Z4LA 1CP2A 2UUPA 4ZHQB 1NW6A 4U2DA 2C5GA 1ZH8A 3D5EA 2XUFA 4I2VA 4OV6B 2Y1LA 1WEKA 1GPMA 4RENA 4TXHA 2B6HA 2YQ4A 2ANCA 5LL6P 4BNNA 2WEKA 3MGBA 3BCRA 2O9JA 3TSWA 2ATCA 3NUZA 4K6HA 4O5OA 5GOZA 2BKXA 1VE6A 3KLOA 5AKJA 3KPYA 2D3OW 3TNDA 3MMPA 1F5SA 3J81A 3CPHA 3STVA 4OD0A 4MWBA 4O6VA 4TL8A 4AY4A 2ZR8A 1Q57A 4EHJA 5E7IA 1LBQA 1Y1TA 2PSJA 3BY6A 1QGYA 4QUKA 1YZKA 2V5AA 2YINC 4KFCA 3Q9LA 4OJYA 5F2EA 1VIDA 1AGRA 4OG2A 4Z86A 4F8JA 3AK4A 3W9UA 3QNUA 2O8DB 4R1TA 3TB6A 3MTIA 3V1KA 3R40A 4W7IA 3OX3A 4J7CA 4G8JA 2IYWA 2WHQA 3O2SB 5G4LA 4BUJA 5K8CA 4ZMBA 1JQDA 2AV6A 3TIFA 4J7UA 1B26A 4FFDA 3ITEA 1Q3HA 3A1SA 1UC4B 4XLTA 3R5FA 1QK5A 3BX1A 4X54A 2WAYA 3EAQA 3QI2A 1ACMA 3LM8A 2P2ZA 4YP5A 4QVGA 1X87A 2EZUA 4FMDF 4JP5A 1PLLA 3MUEA 4H0FA 1QE0A 1BN6A 2QW0X 2XCTB 4Z4IA 2Q4PA 5EYPA 4I3GA 3ZW8A 1BX0A 3DBOB 1JX6A 2GFIA 2YW9A 4BUCA 4BB6A 4B75A 4M1OA 3BMXA 3IVXA 3A6EA 1N6HA 1K6IA 4QATA 1NY5A 3EZLA 3G0DA 1NVDA 3IKMB 1V37A 4NE9A 4DR4O 2ZCEA 3MLAA 2O57A 4YJGA 3A6GA 3EVCA 2BJHA 1YUNA 1SUPA 1R4NB 2W83A 5KSOA 1ISIA 3PFCA 3KAJA 5F52A 4L9WA 5AVKA 5HJEA 3F8WA 4BFWA 3DF9A 4G0MA 2GZ2A 2CXTA 1CUGA 4IF4A 2ZSBA 2NM0A 1Z22A 2BGNA 3OM1A 5AICA 1W76A 3DDZX 3NVDA 3W2FA 2QX7A 1VGRA 1ZEMA 4GQAA 1YTFB 4K9OA 3WLFA 1NU6A 3ZEAA 1AB6A 1SC1A 2O5CA 1Z7WA 2FSVC 2IHNA 1XMQB 1PR2A 1ZL8B 4CH6A 1GGNA 1LB1B 3GFRA 4N6GA 3U7GA 1CY7A 2YW2A 1WPXA 3BEOA 3B2EE 2OV1A 2BM0A 3FPCA 4IQ8A 3RC2A 3F97A 4AF7A 4QLBA 3CCUV 4B3IA 4MS4B 4AMBA 4QDKA 1AJEA 4MMXB 1K97A 4ESHA 1BMFA 4KDEA 4O4HF 2XEXA 3M6UA 1L4NA 4KHPB 4LCJA 4GDMA 5D86A 4GM1A 4JQYA 3A1VA 3FRIA 1OFVA 2R1TB 4WBNB 1HA3A 4C0BA 3BGOS 1T8TA 4EOGA 5HDBB 1VJ0A 1RXIA 1T0JB 3F9RA 2PUCA 3M4YA 3QP9A 1H2YA 4PINA 1N6NA 5DIZA 4C7JA 1HLGA 4ISBA 3KEGA 1ISMA 3VR2A 2EG5A 4U63A 4NZNA 2XA9A 4BDSA 2OOKA 1BQ4A 2WRZA 4PHFA 3O3OB 4WK6A 1K4DC 5IJ9B 1U1FA 4DIUA 3TXXA 2IOFA 4IILA 4IAOA 3T9FA 3MT0A 1FJXA 3EWNA 5L3SA 2A5YB 1YB6A 2ZBPA 3TQQA 2XMCA 5L3QB 3UQZA 4BNZA 1UBKS 1H0RA 3K4PA 3LBIA 2CE2X 1EH5A 2EVWX 4E13A 3ND9A 5K4HA 3K2BA 1IN7A 3OFNA 4F9EA 1P9LA 2H1HA 1U28C 3HCCA 2DWCA 1H2MA 1B8NA 3VDRA 4GYWA 3IBYA 3IMGA 3D6VA 5I7UA 1S9HA 2DQ3A 4AQYB 3RV4A 2FUG1 2NXCA 3TSYA 2GA8A 3I5AA 2BP7B 3P2IA 3FMFA 4GQIA 1BKYA 3PLNA 4QFDA 2ZI5A 4JLSA 3PX3A 4AXBA 2QXUA 1DAGA 4DCMA 1FVHA 1UKAA 2XOKG 2Y67A 3L9XA 4AX8A 3AK3A 1EVZA 5CM2Z 1BEUB 1JSRA 4ZYYA 2ID7A 1AQNA 1U7OA 2AOUA 1GFWA 1E79A 4M1SA 1P84F 2DHEA 1Z7YA 1OA1A 4YWHA 1OYWA 1QH1B 2JJ1D 1GPWB 1H6BA 3WXBA 3T5MA 3TSAA 4TLLB 1XTUA 2VQEB 3IB3A 3K1TA 3E18A 2ON6A 1KDVA 3MJVA 1XZIA 1I6WA 3SJ7A 4B76A 1QGUA 2PGNA 4M7OA 2XUDA 1T6XA 5KVQA 3R3JA 4ZCSA 4ZRDA 4XVRA 4RTLA 3A1CA 3OSUA 4PNHA 2V58A 5IWAB 5CFOA 3TRDA 1SOAA 5GV7A 4UTOA 3M6IA 1UUFA 1GQ2A 5IDYA 3FOCA 1H9CA 4KUGA 3ZHOA 1RPTA 1RNLA 2O59A 1H85A 3QU2A 5DNAA 1Q84A 3QFSA 1QM5A 3OZCA 4AXXA 2QPLA 2OKGA 1T8RA 1VJRA 2DJVA 2RHWA 4BE4A 4DAOA 5CT5A 4XWAA 1MNGA 4FFPA 3A32A 1MA3A 5JCJD 3EIUA 1ZOSA 1RRPA 3P71T 3JYPA 5THKA 3VDXA 4TV9B 1K68A 5IYZF 1W0KA 5ECGC 4WZAE 1GPNA 2G83A 3I0NA 5I3ZA 2K7ZA 2Z9CA 4NG4A 4R2KA 1ZIXA 2QT1A 1L8LA 2JAHA 1GXSB 4TGLA 4DV5O 4D81A 3FX7A 4QHSA 3R6WA 1UMCA 2V45A 1QHFA 1PW5A 4BVJA 1JBQA 1KJZA 2AWNA 1VMKA 1B7GO 2AKEA 3UH0A 4HUJA 4WBXC 3KUCA 1L1RA 1RBYA 3QPBA 4X3PA 2IPXA 4IIXA 4K26A 1N1MA 1UC9A 3VPSA 4H9GA 2X14A 1DLBA 2ICAA 4N8SA 5C51B 4TVBA 4PLWA 5AW4A 1X0XA 3NTUA 3OESA 1BMFG 3Q9SA 1OCEA 2HF2A 1EGVB 2GBOA 1UQUA 1XPJA 3PGLA 2CGEA 2GO7A 4QUBA 4Z9AA 5I7FA 1JHVA 1KIMA 2IEYA 1SCBA 2VC2B 2E6UX 4ZOAA 1DJPA 4E5PA 5HSGA 4J2HA 1YQ9A 5CFMA 5JCPA 2F9MA 3E4CA 1GPJA 5EEHA 1BH2A 2H63A 2JDIA 1XQ9A 4TT8A 2WHYA 3CNNA 2HKIA 4J7AA 3PX7A 1FA9A 4GGPA 4RD0A 1A1SA 1O03A 4QQRA 2IE8A 3K0AB 2YVQA 2YDEA 3GJ5A 4MWTA 3ORQA 2JFHA 3T7DA 2Q7OE 1XEXB 4DBZA 4MWCA 2NVBA 3OFNG 4DLRA 4AZ3A 4W6QA 1H2BA 3OOHA 3SJAA 3OZUA 4ERXA 1T10A 1ECCA 3GI1A 4CS4A 5KUTA 3FH0A 2YWBA 5AT1A 1WLSA 3ZS8A 3B38A 3ZBTA 4RCVA 4GI7A 2JEOA 1JIVA 2QA4V 3LDEA 3PITA 2JKVA 2I4TA 2VJQA 2QXTA 3ND7A 2A57A 3ORRA 4LNUB 4ZFNA 1BFDA 1CUEA 3AESB 2AN1A 2QD4A 2A86A 2J4DA 3L41A 4M1KA 2HVJC 4NZOA 2P22C 1EUCB 3UGQA 3QOYA 2GAAA 3MELA 3W7WA 4G5HA 1BL8A 2CNDA 2CL5A 3R5HA 2F1HA 2H59A 4FC6A 5JZSA 4PRZA 3S1LA 2C0QA 3G0CA 4MRSA 3FROA 2JEXA 3K5IA 4WCFB 1A50B 4JITA 2YC0A 3DTUB 4ONEA 1R2QA 4OQXA 1R88A 5DB4A 4DK1A 1X39A 1CK4A 4JBXA 2F00A 3DFKA 3I9V1 3ZZUA 3H1IH 2C3OA 2YHIA 1Y1SA 3WL6A 5FI5A 2PMCA 4BX8A 1DJQA 5K01A 3R6DA 2XTZA 3NKVA 1NXSA 4WK0B 2NMVA 3MNFA 4YRAA 2RGRA 4LP8A 3HPQA 5D5HA 1EHIA 4GDFA 3MF4A 2VAPA 1S3JA 3G8YA 3V9PA 1ICIA 2ZTUA 3AVQA 3E23A 2QLTA 3PGJA 3II6X 2JAOA 4ZYWA 4YIKA 4B2YA 1EI9A 1M34E 1ESNA 4FCWA 5E8JA 5H70A 1XOUA 4GZMA 4MP8A 2V4UA 1W0KG 4MKXA 3DDHA 3WG9A 4P92A 2W2OA 2ZEJA 2CFOA 5K3AA 4G0WA 1JDBC 2XUQA 4BB5A 4YXWA 4CIAA 5J47A 1Z4IA 1RPOA 1R0RE 3CONA 1MVOA 2OCGA 1YAHA 2SICE 5HKKA 2EF1A 1SWWA 5T8KA 3GEBA 4Q34A 4OLBA 4DZRA 3PV0A 3OR7C 4QXRA 4OPHA 4FMPA 3VYRB 3W2HA 2I6TA 4EW3A 1KO1A 2P69A 2C4WA 2JFBA 3ZIAA 2AGAA 3JWHA 1K92A 3CLKA 3C3SA 1GP2A 5I7EA 1DC4A 3F6EX 3H11A 2VP9A 4YJHB 1YZBA 2JVIA 5LVAA 3GDOA 3OVMA 4G9BA 2O3QA 4GZ5A 3B1FA 1Q7GA 1CZOA 1CFZA 5CT9A 3L0ZA 4XUDA 4M49A 1OWOA 4KACA 1PYDA 4J10A 1EQ2A 3DW3X 1GCIA 4BE9A 1E3IA 1X7DA 2IZZA 2I2XB 4YJ2A 3KXIA 2IYTA 5CYGA 4EFMA 4O2BF 1VRWA 4CZZA 2JDIG 2QKCA 3REFA 3UK0A 2V7BA 2CLOB 2FDRA 4GXRA 3QWIA 2ZXWB 4BMVA 2D0IA 5BOVA 1V9LA 3FSRA 4YPFA 3U7JA 1U0NA 2W98A 3T34A 1M2JA 3V8EA 4L76A 3ZWKA 4IMPA 1WRBA 1A3CA 3KFLA 4B6EA 5KTTA 4PG6A 4B0OA 1ZW1A 5JCZA 1UQRA 4GKAA 1I0LA 3HXTA 1T9KA 1L4KA 4J4HA 2W6ID 3LD9A 4I08A 2P1DA 1JDZA 3H6GA 2XLCA 2HXGA 1LRLA 3ZLTA 2EL7A 4ZAZA 5TVKA 2R8RA 2KSDA 4LK2A 3JD0A 2DQ0A 1KYOF 3CZPA 2WZBA 2D1TA 2ZR2A 4CBCA 4JLBA 3I9FA 4EY7A 5AI6A 4LXXA 1JEEA 2A5LA 4IS2A 2IU3A 4D4MA 2TMKA 1I9CA 3UMBA 1M4UA 5IVKA 5JS1A 3TN7A 4HMQA 1K08A 3QX9A 1KRWA 1ZMOA 1U2TA 1GNTA 4RPKA 3MIZA 1Z33A 3IO3A 3NIWA 3DT8A 4M9SA 3S70A 3RSHA 2GK3A 5LA6B 1W6RA 1X92A 1M0EA 4QU8A 1SA0A 4AKIA 2OGZA 5FH9A 1TUEA 4GRDA 3HJAA 4YP7A 2FCRA 5JCXA 2R6GA 3KAPA 2ZWPA 3D9QX 3KT0A 3O91A 3BQNB 4QXQA 4BLUA 5EMKA 3P5SA 3FE2A 1YTUA 2GWHA 3PBKA 1H22A 4Z7QB 1VHWA 3DDUA 4RZHA 4CRWB 2VRCA 1QBGA 4HQRA 2DZDA 1Q6UA 5K3CA 4N0PA 1QFJA 1UDCA 2BN4A 4RNCA 1OI3A 2ADPA 2J5XA 4M37A 3OFVA 3B1XA 5SZIA 2R79A 4LHEA 1EGQA 1OTXA 2GN8A 1INLA 4RUFA 4DC0A 2DFNA 1F5NA 4RTNA 4V0MA 1YGPA 4MQFA 1M67A 1FJHA 4DJJA 2CZQA 5CIWA 1ZIYA 1O5OA 2EKPA 4B7ZA 2YZGA 4FFVA 3MRVA 2CE7A 2BF7A 4JUIA 2ZT8A 1TEZA 1GNVA 1M2EA 4X5OA 3O2QB 3QLEA 4PTYA 5JBIA 3LLMA 2AG0A 3DCJA 2Q2QA 5BQPA 4NBSA 3A4LA 5BPFA 5DOVA 4WAUA 1BS3A 3DT6A 2RI1A 2CL6X 3KQWA 2FPLA 4EJSB 1G63A 3FLMA 1NQOA 3SPHA 4GM4A 1HK7A 4N0QA 3GP3A 3ZIAG 2GX6A 1JEQA 2WJ4A 4Z3OA 3PNVA 3TX6A 4WVFA 4PDMA 2XB6A 3UKDA 2OHHA 4R1OA 3VR6D 1QIKA 3PDWA 1LBSA 3V4SA 4XX0B 4HXEB 1N34O 3O8DA 4R0MA 4MYCA 4D57A 5AUNB 3HFRA 4B7AA 3JQQA 3PS9A 3C1UA 3RVBA 2DG2A 1A2KC 4XWWA 5EQTA 4H13B 1H2AS 2ZS9A 3N9IA 2IDMA 4X8LA 2XYRA 5HMMA 2Q7HA 2RJ3A 3IJRA 5DNDA 4D8WA 1IWOA 3RVOA 2JGDA 3ZVKA 2Q3MA 4H1TA 5CYFA 4F8YA 1PX0A 3X1XA 2FW8A 2QWNB 4ZI5A 1GFSA 4X1OA 1H8HD 4FU0A 4NU6A 2VT2A 4FVTA 1W2HA 2HF8A 4JI2B 3WU2Z 1Z4PX 2EX3A 2R62A 3RVPA 1VMIA 4CN8A 2QE7D 3PJFA 3F5MA 3SZGA 1QHSA 5A5VA 2HYIC 2I8LA 4JNKA 4LTDA 2W71A 2XH8A 3PHBE 4E30A 5IZ4A 4WJZA 2AH5A 4HV4A 4BFYA 1Q2UA 1RPJA 4PHHA 2UUAO 4LYFA 1EK6A 1WP4A 4MR7B 3REQB 1EP3B 2VZEA 4O4LA 1XZQA 4WW0A 3H9VA 5DM60 4CM5A 2RNBA 4LE1A 2ATVA 1MAAA 4J8PA 2EFHB 3GLIB 3R5SA 3NAMA 4FWBA 4N5LA 3DC6A 3QHAA 3UAOA 4CUZA 3LDHA 1X1SA 4J0KA 1P5ZB 3K30A 4FBGA 4X6YA 1S8AA 1Q3KA 1IXZA 2BBSA 5AK3A 4RHYA 4UHCA 2W6JG 4RE6A 1YMQA 5HZMA 5K3DA 1T1GA 1ZKDA 1U8FO 2IF0A 3MSCA 5DJ5A 2W6QA 3KZCA 1YHNA 2O2XA 5JS7A 1E66A 3MT7A 3W8FA 3A1EA 4S0XA 4DJDC 3CCVV 1RZUA 3UQ8A 2D06A 1RAGA 3ESQA 1DO2A 3I0MA 2H8KA 3TCXB 2IYLD 3E27A 3EGWA 1P1RA 2XR1A 3K9QO 1YS9A 4Q9JA 4N18A 4QO8A 3IUJA 4RVDA 5C1PA 1TU4A 3G6KA 4MGEA 1JTVA 3BK1A 4DB4A 1R64A 4HWSA 3TMYA 1Q7RA 1YF2A 3GEGA 3Q3IA 1D2CA 1RTTA 3OOSA 1SGWA 3OF5A 4LF4O 3AY6A 1K5DA 2CJWB 4B6SA 1R74A 5CX1B 2YJ6A 3FMGA 2J7PA 5K0EA 5H4HA 2WJ6A 1YBMA 1OA0A 3MWJA 3T1NA 1N75A 2C95A 4GFDA 2OXCA 5DLDA 1C41A 3CXRA 3LWBA 5KVVA 3TCUA 1XZBA 4ACBA 2PYLA 3HZZA 3D8UA 3DVLA 4RVNA 4E2ZA 2ZYSA 1KKLA 5EKSA 5E2BA 5CMUA 3M7IA 1YE3A 3WGVA 2Z5VA 4X89A 1PK8A 1FP2A 1O94C 3HDHA 5CVUA 4MW2A 2A9FA 1L4UA 1QO0A 2YY6A 2NT4A 3GFOA 1ZAYA 3N2KB 4HQKA 2B9EA 3ZMVA 2LBPA 1SBIA 5DXJA 2IZ5A 3ZCTA 3KL4A 4MV9A 4JUDX 4F9TA 2V3WA 2O3SA 3ZK8A 4EI8A 3O4IA 1I2DA 2C2KA 2NP6A 3IUSA 3KUKA 3DV0B 3H2KA 3WAKA 3PIDA 4KXYA 4Q6BA 1QS0A 2ZSIA 4RS4A 2K5UA 1IVNA 1Y3HA 2XGSA 1XLTC 2ATIA 2WLLA 1QIMA 3TTYA 4ECEA 4LV5B 4F9FA 5E3JA 4M7PA 4DS3A 3KDSE 3U80A 1FMJA 4H1HA 2CN1A 5CGQB 2AMVA 4L22A 2G76A 4A8JB 2JGIA 5BSWA 1YFJA 4NU5A 3I58A 3R7DA 4CNQA 5HNKA 4EI2A 3DAPA 4GC5A 4JVSB 3RIGA 2YXYA 2QSZA 4FPXA 5EEGA 3IUYA 4NU0A 1QH8B 5C93A 3SOZA 4WXMA 3TEJA 1ZBQA 4RGBA 2BGKA 2PK3A 1ZI8A 1RQXA 4OO3A 3G49A 3DDNA 3SM3A 5D00A 1YVPA 2AYXA 4BAUA 3KEOA 2AN9A 1U3WA 2WM9B 4IV8A 4MUFA 4PQEA 2WU8A 4ZVTA 1GYQA 3F73A 2HHCA 2GEVA 4F45A 4QOIA 4C04A 3OFKA 2I2DA 5C4MA 2H94A 2J07A 4WX2B 1JBKA 3NYWA 2O7NA 4CM9A 1WQ4A 4CMHA 5KNDA 3PIIA 2NX2A 5NULA 5BSKA 4DG8A 5FPQA 1YBHA 3JV7A 1HE1C 1KHTA 4TVKA 2NVWA 2BEUB 3U1BA 5C5IA 4A0HA 3VKVA 3RUEA 5F7JA 3OMIB 2FZGA 5DZSA 2Q46A 3HA7A 1N9GB 5AOVA 3DD1A 3W8RA 3K70C 2ODNA 3ABKC 4EPRA 4D97A 5CX4A 3U16A 3M6FA 4Q24A 4EMUA 1L5QA 4EL0A 2DFTA 2XTNA 3HCPA 4EFBA 1ZGAA 3SHTA 1H5UA 4MP6A 1R5JA 3C7DB 1FBNA 5IANA 1YR9A 1EDBA 4GMHA 3U39A 1Q43A 2W2PA 5FTJA 2R44A 3LUPA 1A9RA 3TLZA 1H6DA 4PC3A 1MDFA 2VJPA 3T15A 4EO9A 3L9DA 1RIFA 4N54A 4XLLA 2J6IA 2HIAA 1TGYA 4U0KA 1JR9A 3ISVA 4OX9B 2OD9A 4ER5A 4Y7CA 3SLKA 4G2KA 4YJKA 4CVNA 1RKXA 4NDAA 2CCKA 3LK7A 4HT3B 3U9TA 3FUXA 5CJJA 2BE3A 4BECA 2J3IA 1A82A 2WF5A 2E21A 2Y8EA 3I09A 4WV3A 3L1JA 4DIKA 5LIRA 2ORWA 1U8EA 5C8VA 2HSZA 4K8OA 1QVZA 5BSEA 2HK9A 3GV0A 2EHDA 4ND4A 1PJ3A 3H3JA 3G9ZA 3GY0A 3HV2A 4Y2HA 2ZJAA 5B12A 4U9UA 4YC7A 1RLUA 3VU9B 4ON9A 3QQ5A 3K5PA 3AFNA 2ZYRA 3N74A 3GJ4A 3GGCA 2UV8A 1SY7A 5CDSA 4R41A 5LGNA 4FOOA 2ES4A 5ICGA 3OECA 4ZCRA 2XPCA 5A06A 3UJDA 4Q4HA 1S2DA 5FLKA 3CCQV 1ZCBA 4HTFB 4B82A 4G89A 1GADO 1F4PA 1I94O 4WFFA 4WINA 4LXUA 3HDTA 3NS7A 1JXOA 1XI2A 2C96A 1Y8CA 1IMOA 1KY5A 4KWTA 1V5IA 5FL7D 3V4LA 2VPYA 3KP1A 1M6NA 2AX3A 2C77A 1CS0B 3URKA 3WMWA 4EW6A 2OGWA 5D3ZA 5JJLA 2BEWA 2HW8A 3RNOA 4FD2A 4KRFA 4DV6O 4MV8A 5JFGA 3N8NA 2ORVA 2XBLA 1P8JA 4X6LA 1U2DA 3KPUA 4ID3A 1YQXA 2BDTA 4AP5A 1X19A 5JZMA 1JR3E 2UZIR 1BWPA 3L8GA 2CVFA 2X2OA 2E3JA 1QGOA 1FNSA 5L9AA 1JDVA 1AQ6A 1GQOA 4OQZA 1ADGA 4X20B 2FSIA 4YCMA 2HKOA 2FOXA 2C03A 4OGFA 3A31A 2MW2B 4JT2A 2VBIA 3AUUA 4XDZA 1V5GA 4L8YA 4YLGA 1OAAA 3GGPA 4YY3O 3N0XA 3MOGA 2WIGA 3MWDA 4GOMD 2B4YA 1ADJA 5IX8A 4WK4B 1AQUA 4UNQA 4IHJB 1SBHA 1HDOA 2E1RA 1HEUA 3RT1A 4NZMA 3L46A 1IHOA 4ND3A 2AZ4A 4RMIA 4ZCPA 4WNAB 1OH6A 4YX9A 4MMYB 4U3FH 1QYIA 3EOZA 3CVJA 4LHSA 4PAOA 4JEUA 5EERA 4Z4CA 2HPZA 2RGUA 5SYNA 4EPWA 2Q6TA 2ZK7A 2Y9MB 1R9GA 4IDNA 4OGKA 5IK2D 1YTLA 1V3VA 3HJFA 5CA1A 3K2QA 3QNWA 3CRNA 1PL8A 5IYCO 4B7KA 5FBRB 2XNDA 1NQVA 3OQPA 4YDSA 4DR1O 4I1YA 3P4XA 1SCNE 1U81A 2HSGA 5AFSA 4L4YA 2FQ1A 1Y42X 1Z0KA 4LEIA 4X3CA 2CNNA 2XRZA 3OR6C 2PLAA 5BR4A 4V03A 3BS4A 1XZLA 3E8HA 3SYTA 4ARIA 3NOVA 3U4MA 1A4IA 2GCIA 4GWGA 2ZSUA 2GNAA 1S02A 1JR4A 4RS3A 1K8RA 3TZLA 2ZUDA 4EKGA 4JT9A 3F5TA 5GP1A 1NTOA 4MVYA 1T0IA 2PV0A 1E6EA 2C4VA 4QPZA 2V1DA 3GARA 2NQ2C 4O3MA 3WO0A 1KBHA 1GCAA 3JRNA 4P2GA 3S2ZA 3I55V 5KOJB 4GLOA 2R5WA 4Y2GA 2MYNA 2FWAA 2LR0A 4JJ4A 2OZEA 1MG0A 4OHYA 4XWGA 3ETQA 1OFGA 2VNAA 3V2UA 1N6OA 4HD8A 1ZW6A 1KPIA 3FNRA 4QUEA 1VLHA 5L6LB 1W4ZA 4Q1CA 3QY0A 4EVSA 4PWZA 4DR7O 4RYDA 1CY4A 4QPJA 1VBKA 5DM70 2YUTA 1NQXA 1VQ4V 4X1YA 1HXHA 4PZYA 3QHPA 1ODFA 1S9DA 3JW8A 1R3IC 4IZ6A 2C8KA 3Q2KA 4Y1RB 1N5IA 5HRAA 4EUNA 3BXZA 4D3SA 2QRVB 1W8DA 1RWVA 3VSCA 3KHKA 4NNOA 4OB7A 4BBZA 1E9FA 3I52A 4KXNA 3GAMA 4OXQA 3H9UA 1UDRA 4DLWA 1WHTB 2DX7A 3SS9X 4MP3A 4CEHA 4IQFA 2BSAA 3N8HA 3INRA 1CUJA 5KAPA 1WLEA 3UFXB 5I9LA 1KQSU 2OP0A 4RETA 1VTKA 2P67A 3KQTA 5HVNA 1MOZA 2V7QA 4Q4AB 1FF9A 2F3UA 4KAAA 3YASA 1LDMA 2ZRPA 2FP4A 2VP2A 4JI0B 4CKEA 1C3LA 4C6TB 3ZWVA 4NC9A 3KOYA 1VKJA 3TQCA 3TE7A 2N75A 4ZDWA 1ZHOA 5FTNA 3OLVA 1DTSA 4J0QA 5M29A 4YMLA 2QI9F 4MRRA 1GO3F 1NR5A 1XZAA 1C2TA 2WQZA 5JXIA 3KB2A 4U2KA 3PEVA 4CMEA 4OQMA 1VKHA 5BSMA 3DVRX 3QE3A 2Q8VA 3RYHB 2BEVA 4K9SA 5A0TA 2SCUA 4JVLA 3GVXA 4C0AC 4J76A 5FNVB 2QVGA 5U1PA 2ZVPX 4EG1A 4TZTA 2JHAA 1JQKA 1T0HB 3H2HA 1SCIA 4CT4B 4OYRA 1E3LA 1QVRA 2B25A 4DKXA 1D04A 1JI0A 4OKIA 4MJ3A 1ZRMA 2DH6A 4DDKA 3UJNA 3V97A 2Q7XA 3DKKA 3P3NA 4U9IS 3NORA 2G17A 4CKCB 1OIXA 2V3CC 3RKUA 5IBRA 5AIBA 3CVVA 1TNDA 4PY2A 3W7BA 2UZAA 1PNOA 1IWPB 1NX9A 2ZDGA 4RWZA 3ENVA 1JVMA 1LUVA 1KDPA 1EA7A 3JQEA 4HFNA 2YY5A 3PHJA 2FPXA 4UMEA 4K81B 3AEUB 4DRZA 2NAFA 3KZ1E 4JKYA 1PCXA 3PE6A 2XNDG 4NL4H 4NIMA 1J70A 3T0IA 5AW9A 4BZWA 3S8EA 1QHHB 1F2TB 3H9EO 1QQBA 2Z8XA 3S29A 3EZGA 4RVOA 1FQKA 1Q7BA 3SBXA 3IX7A 4OKSA 1B4DA 5CD1A 2XMPA 4Z1MG 4U5QA 3LY9A 3OETA 4KR9A 3A3OA 3MLBA 2CD7A 4DCUA 3AQIA 3BMOA 3TNJA 4JR2A 2JIRA 4D99A 3SHWA 2KB1A 3CLSD 3NGLA 1NP6A 5IUJC 5KHAA 5CVJA 3PU6A 2EARA 2ECKA 1PFVA 2QQFA 3EXAA 1ODKA 1I24A 3IKTA 1BQEA 3IFXA 4UVIA 2ORED 3WBBA 4XKJA 3G2MA 1RZVA 2FFJA 1UBNA 5HS4A 2DRIA 3GFQA 1SQ5A 1XQVA 5FPSA 2PUSA 2DLDA 4D8XA 4U7JA 5AOAA 3L6DA 5EJFA 5EL0A 5HW0A 4Z99A 3QIVA 2EGUA 4DY6A 5DE3A 1SVWA 2C5LA 4RQEA 4B08A 1EB8A 4A26A 3IMKA 4S12A 4NFHA 2BEKA 2NUTB 4F96A 1Z0FA 5ARDA 3AG1C 1AUQA 3KKPA 5FI0B 1OOEA 1NZ6A 3BGSA 1IY2A 1SOUA 3K15A 2I2AA 4G0XA 4UUQA 3S1SA 4MW5A 2NUAB 1GKKA 3ZG6A 2PFKA 3FGNA 2F1JA 3C5EA 2VHYA 5D7NA 4EIWA 1BYIA 5DLYA 3V8RA 4QDOA 4O0LA 5GIPE 4NYMQ 4FZVA 4FNAA 3CRW1 3OKAA 3VM6A 3O3NB 2ZT7A 3EGXB 4DSAA 1QE5A 3QMMA 4BMZA 2XQVA 3QEMA 5E4JA 3EVAA 3P9QA 3PEYA 5HOQA 2DWEC 2JK0A 3K9LA 1T5SA 2BMFA 5CLIA 3BDVA 3ZHUA 3L2OB 2V7QG 1TAUA 3K0DA 1AH2A 1UOPA 3GR6A 4G1MB 3K3WA 1CJUC 1OWPA 4JI3O 1SRRA 3FOAA 1PQWA 5HEKA 5A0VA 5BSGA 1BHAA 1NSYA 1WDKA 4AULA 4H7FA 1ESCA 2DR0A 3VPXA 1KJIA 5DMXA 3ZH2A 5B58C 4OXKA 2OP1A 3H1BA 2Q29A 2ZCUA 1N8KA 3E1SA 5A3JA 3ZHRA 3QXXA 4UCRA 1I0IA 3NLLA 3EA5A 2AW5A 1K27A 3DJYA 2A9QA 1IK4A 1YTFD 7AT1A 1ZMXA 1WV0A 4BWGA 4REQA 5A6VA 5J2TB 2DUJA 1KO5A 3HLKA 4MITA 5ADUS 3LX5A 1DVRA 5L3FA 3IURA 1MQSA 1PNKA 2OGSA 3F9IA 1PJRA 3VPFA 3DMRA 3MQFA 3A14A 2VYNA 5A4KA 3S3WA 2H9IA 4MTFA 3LFTA 5BXYA 4FNOA 4EPTA 3K9GA 5LQJA 4V0OA 4K6MA 1GRQA 3SM9A 2ZRCA 2FVXA 1K8YB 2FTKE 3BWVA 3X3HA 4L8GA 3CPJB 2IGTA 5THQA 4R4JA 3W4JA 3F6RA 2N42A 4UXJA 4IBOA 3QE4A 1ZH4A 1A4RA 3L9WA 4E4RA 2Z2ZA 4FMBB 1SUDA 1XP5A 1SBYA 2ZKIA 3IAS1 1OXBB 4EA8A 1VSTA 3FYIB 2DULA 4ZYLA 4JF3A 3TQIA 2IW1A 2DTXA 4P7FA 1R6TA 1Z5PA 5HIKA 3RK4A 5EHIA 2PZAA 1BT8A 4JI5B 3DR5A 1BO6A 3V2HA 2FPWA 5JY1A 2TMGA 4KQ9A 5ALSA 2JI9A 1EM1A 1ESZA 5F1PA 2XITA 4TZ6A 1B6SA 1KJJA 2AMYA 1IN5A 2BCGY 5EZYB 1GPUA 1U3DA 2WMDA 1ORHA 2Q7DA 4Q1VA 5IY5B 2PBFA 2JEZA 4CKZA 4G26A 5DVZA 1XELA 1RABA 4COKA 3Q4HB 4N49A 3ESZA 1FZQA 3V2GA 4OMDA 4JWKA 2VF5X 3EOBI 4LWQA 2GBGA 2O05A 3AV3A 3A9TA 4MVJA 1ZJWA 3ZNPA 3BGIA 1UAYA 1E1YA 4R50A 3GP8A 4M0FA 5JBNA 4JCCA 3QO8A 1MGPA 3RGWS 1QAQA 5G0UA 5LMZA 1JA9A 3IUMA 1UJ2A 3EEYA 2ZIXA 4KKXB 3RIHA 1FXHA 5BR8O 4JP3A 1GM7A 1BWRA 3EHBB 1QQ7A 3NNSA 5L95A 1FJGB 4EB6A 2GCGA 4ZPXA 1CT9A 1C1YA 1DCFA 4G5FA 1T5LA 4OL9A 2GH1A 4JI1O 1GN8A 5H1YA 1CR1A 3IE2A 3L7CA 2DQYA 1Z6XA 2E4XA 4I1SA 4MDHA 4AX4A 3KR0A 2G9RA 4TT3D 2VQFO 1E7QA 4I9QA 4AD8A 1G2QA 3VVMA 2WP0A 4TVSA 3HCFA 4PBRA 1CE8A 1G7SA 4PV7A 1ZRNA 5JMTA 4JTCB 3BCSA 3CJHA 4Y9RA 3OLZA 4GVPA 4NMMA 1NM5A 1TAQA 4YRPA 1VQ5V 3ZEIA 5BRJA 3FI9A 4OI0A 2JAUA 1G7TA 3S6JA 2B37A 2B4QA 4AB1A 1OV6A 5TE9A 3ZUPA 1EBBA 5KVCA 2B83A 1NZDA 3E8FA 3IODA 1N2SA 3IP6A 3GBPA 1PR3A 4WZ6A 2IYYA 3N2YA 4KO1S 2YV2A 4E15A 1CF4A 2WA3A 2F7SA 5IAOA 4MWZA 4FEGA 4MO9A 3GJQA 4PS0A 4ZU1X 1A4UA 1R6DA 1PWYE 1BFKA 3HXLA 4GLBA 3KE8A 1WBDA 4QTZA 4G1FA 4A2WA 2QUHA 3COSA 2M32A 3D6MA 2EWMA 5DGCA 4LPSA 3T3EA 3SPIA 2JFQA 3LBAA 3NBKA 1U2PA 3PC8A 1B00A 2GEBA 4DY4A 3A2FA 1KSJA 2WHRA 4P5PA 1SZXA 1VJGA 1V1MA 2WKRA 2ZSFA 2REXB 3OOYA 5I3CA 5T6BA 1PR4A 4OLHA 5JO0A 3FSJX 1H2GA 2NO0A 4F72A 5DRYA 4PANA 1BIFA 2NLOA 5DO9A 4YAKA 3QVXA 5HZGA 5TS2A 5E1BA 1L9KA 2Q5IA 3OE7D 4I4TA 3EXHC 1BYUA 1P4HA 4WACA 2Q73A 3ZY4A 4N8DA 2XHEA 1TC1A 1L5HA 5JC1A 3RYIB 4IEEA 4TSRA 1Z4QA 1RP1A 3NVAA 4ZZ3A 1S2MA 3AV0B 5B3JC 2M6RA 3VNVA 2IP2A 1WXDA 1E3SA 1NR1A 3ZZMA 1EHCA 3Q3VA 2PX6A 1JHYA 4G2NA 1KYYA 3KM0A 2C9CA 3CC4V 4NP6A 1XF9A 3DC2A 1Q21A 1WZCA 2WU4A 3IPXA 3LCMA 3KSBC 5KJ1A 4B81A 2P6UA 3VVBA 3WFVA 4KAXA 1CUCA 2ZRJA 4RTSA 5AK6A 5ILQA 3VJMA 4DG5A 3FNHA 2BFEB 3D54D 3I6QA 5KJCA 3E58A 3QIAA 4CDRA 3HZHA 2VDUE 1P7CA 1PV2A 4DAEA 3S28A 1JJ7A 2VDWB 3ZV6A 2H18A 3T6KA 3U31A 5FPRA 3IHLA 2IDJA 3CG4A 4B71A 1ZUNA 1XRMA 4KO3S 4B3DA 2H52A 2VQ6A 3N2IA 2FN8A 4JJ8A 1DKUA 1E1QA 3H9BA 3U37A 3U1VA 2GK6A 5ARBA 4XGIA 4QARA 3MCVA 1II9A 4UOZA 3LVRE 4UE2A 4OGQB 4PAGA 4RMGA 1U1CA 2WLTA 3SVLA 1LSJA 3R5KA 4XH9B 2HEPA 2QRKA 4YV7A 3G1TA 2CMDA 4MIKA 4MIOA 4QGHA 3FSGD 1ZD4A 3FHLA 2IQ5A 1D5AA 1XXHA 4LWSA 1GUAA 1OCOB 1MT0A 2FPRA 2G04A 4WN3A 1CNEA 3DLTA 2M98A 2FPGA 4XWYA 1BW9B 5JDIC 3EXG1 2KLHA 1NNSA 3WYNA 5ECYA 2WPNA 2P06A 4DKJA 3MERA 4GZ6A 4ENPA 4WFKA 2XX3A 4HWGA 2PZJA 3W6NA 2C5EA 3M5PA 1XILA 5ALGA 5A4IS 3BPZA 4FJ2A 5G4KA 3U81A 2AD1A 4HYQA 1LPPA 5C7IO 1K73W 5TF0A 3HG7A 1M2OB 3QF4A 4H0LB 3BMNA 3G9XA 4XB1A 3QTTA 3CF4A 3IR7A 1GTZA 4H4EA 1Z29A 3M1AA 1KIAA 2BTQB 1TMOA 3WP1B 3HGTA 2ZB4A 4I7EA 4PQYA 3NGMA 4UD2A 2CHGA 3O2JA 2XDAA 1CTQA 6ABPA 2RARA 3AB7A 3UICA 1JH8A 4D9BA 3L05A 1BJRE 1TF7A 4R84A 3HU2A 4G8CA 1U7TA 1EUDA 4HAMA 1KI8A 3LQFA 4KPUB 2NXEA 4JU8A 2ZW9A 5CXXA 2ANBA 4YRCA 2X86A 3KELA 1T6NA 1QP8A 1E79G 2JVJA 2ORYA 4OHVA 3D6FA 4YRTA 3WK6A 3TTXA 5BORA 1JA8A 5D2CA 4FN4A 2IRWA 3HB4X 1O96A 4ZVQA 4MROA 3ISJA 1C4OA 4PC2A 3UWSA 1USUA 1ECFA 1EM8A 1YHQV 2WM3A 3ECAA 2QVLA 2PSSA 4FPPA 2DVMA 3TJRA 5FPPA 1SD5A 2QDKA 3HCEA 3TQSA 4RK6A 4FFNA 2IGBA 3W2EA 1XFDA 2ZANA 4QREA 2QUBA 2XB2A 1NGSA 4L4RA 1TW2A 4XE5A 1YB5A 3OPYB 2OV2A 2FI1A 3ZNOA 5DDIP 2J5RA 4MR8B 1KSHA 3BXOA 3H1AA 5C4IA 1WXXA 1WW8A 1YACA 4BVEA 1VQNV 3Q40A 5IAJA 4DA4A 5ADHA 1NPDA 5HCIA 4D7AA 4TQUS 5T4EA 4LZZA 4KR2A 3L6OO 1K1EA 2QJ1A 3OQJA 1T6BY 1VG9B 2QMOA 4LVOA 4MQ4A 1M7BA 1N6PA 2FG6C 4UVAA 1NC3A 3NHUA 4BYGA 3VZDA 4HLNA 2NYAA 5MFZA 3EA4A 5KYYB 1PEDA 1UKEA 1T1IA 1L8OA 3NAZA 3X44A 3WG7C 3L1KA 3R23A 5BV7A 5KSWB 1WQ3A 1PG5A 4RFSA 1E1QG 1KVUA 2L42A 3TPFA 4LJAA 2EXXA 5C9ZA 4CT5A 4GWKA 2ZNIA 4W5OA 1BQ3A 3V8PA 2LWIA 1NUAA 2XI4A 4I99A 1US8A 3THYB 3OJLA 1LQ2A 2G25A 2RGCA 1O95D 3G7SA 3DOJA 4X66O 4Y2XA 4ZARA 4HNUA 1AGXA 2A4MA 1A88A 4DIDA 2EP5A 3I6ZA 5TQ2B 4HLUA 3V55A 1TPZA 4OF4A 1IBKB 4CFSA 5FA6A 4MUBA 2LGWA 2I7CA 4CL2A 2XCIA 2Q2OA 3HO6A 5MN6A 1HY3A 3HN7A 3W3AD 3B6JA 3B9RA 4I9FA 5CLHA 1KXZA 2O7RA 2BFOA 4AWBA 3O73A 1PRYA 1EUQA 4NTYA 1Q83A 1OV4A 4ZYXA 4UVBA 1AA6A 3CHXA 1DAHA 3WYEA 3FCXA 1IN1A 2UYGA 3T1TA 5FDFA 1E7WA 2JFGA 2CHFA 1CVIA 2P2SA 3VR4H 3UCSC 3AOEC 3B78A 5I6DA 1TZJA 1Z5OA 3U60B 3FTEA 4GI3A 4E7PA 5BRNA 4FT2A 1OWNA 3OZDA 4Z1MD 2C3PA 3TCKA 1EZVH 3FVWA 3DZGA 1P4AA 1GILA 4YMHA 1SQXH 4MDEA 1SIUA 2B4KA 1ZI9A 4Y2QA 2F8MA 5ELXA 4X8OA 2I99A 4IYIA 3ZIUA 1AK1A 4KTTE 2GF0A 2QR5A 3SC4A 1QYWA 3LFUA 2JH9A 2ZIZA 5B3SB 2F8SA 4RJIA 4WPGA 4JHLA 3CZCA 4KWEA 3V46A 4KBGA 1XUQA 4BUZA 4IL5A 2W43A 4L5JA 1EEXB 2IOHA 5HQ3A 3UOGA 3THXB 1LU9A 4DV7O 2BR3A 3K0GA 1CUVA 1FW8A 4G9GA 4WKOA 3KZNA 1FXKB 4KNWA 4NBWA 3G7UA 2I7TA 2H1RA 4RKQA 1T4DA 2XAJA 1CQIB 4ISCA 1BDIA 3VA7A 5KNCH 3LS2A 2F59A 1IRIA 3FA2A 4WUTA 5AYVA 2ERYA 1RPAA 4GBJA 3M8KA 3C24A 2DCMA 4M8KA 1BXZA 3OJXA 4A0FA 2DY1A 3KQOA 3CCJV 4XSHA 2HPAA 4HH3C 2IZ1A 1DOZA 5SZHB 1EA5A 1I1NA 1Z6GA 2AJCA 4LS3A 4C05A 4IGIA 2JHPA 1XRRA 3RNLA 1AC5A 1W96A 1L7BA 2Z8YA 2ZBFA 4G07A 1GZSA 3HM9A 3TLXA 1EU1A 1KEKA 3WBJA 1B43A 1LX7A 4P7GA 3TX2A 5CT4A 4AJJA 3G1UA 3ZE6A 3L02A 1U0GA 1ZD1A 2CLFB 1UPGA 4LFBO 4KGVA 4YXWG 1DJMA 4ER3A 2YS8A 2WMOB 2IK8A 4L73A 1FYFA 1G9XA 1IZ0A 4AYXA 1MFPA 2EIJC 3SU8A 3LNMB 4XPIB 1N3LA 1ISRA 3MTEA 2AHZA 1P7ZA 1OX4A 2Q68A 1PN3A 2AC2A 1J25A 5D7BA 4YCCA 4LYJA 1RP7A 1C1XA 3CV3A 3R4CA 3Q87B 4QJ3A 4AZ0A 1A9XB 1JJAA 1PJSA 2Y1GA 3KSDO 4B09A 4B6PA 4XB2A 3JTMA 3VO2A 2DU8A 1N8TA 1PDWA 4F6CA 3IAYA 3U62A 5F23A 1CEXA 5C32A 1T3TA 3PPIA 1QK4A 1RXVA 3BEDA 1Y6RA 4KKVA 1B0PA 1Q0QA 3GUUA 4JY7A 1E4EA 3GA7A 4PTLA 3CZQA 2Z4RA 2CVPA 2A88A 2JRIA 6GPBA 4LSWA 2IS4A 4B7XA 2WM2A 3VOSA 5JNRA 4L28A 4EO7A 5H6QA 1FYWA 4G0QA 3PTAA 2WAXA 1KFCB 3REOA 5GJWC 2VR1A 3Q2OA 1R9MA 3RR2A 1ZIOA 2UYYA 1T9CA 1ESDA 5JAZA 2OBYA 4UE6A 5HIMA 3KC2A 2YH2A 1ESMA 4EJFA 1KBQA 4P35A 5AVWA 2WF8A 1QHYA 1AKRA 1G4AE 5D1HA 1LY1A 3ESXA 2CUZA 4J1TA 1ZD9A 2FLWA 2GGSA 3COJA 1N6LA 2OFWA 4F3TA 2PGLA 1NW8A 2JL1A 4BO6A 3LDCA 3AETB 1FFYA 1F6DA 3RUDA 4MRPA 3V00A 4URWR 5T5QA 1DWQA 3QO5A 2P5YA 1XU7A 1P7WA 3OZIA 3W7UA 4ZCQA 3DBHB 4UC0A 3H4IA 1J2RA 1QRAA 2GHQA 3PIRA 2HU2A 1JS1X 2V1XA 1YRWA 3SQDA 3G5LA 3CN7A 1MZFA 4N03A 4YP0A 1I1HA 1ZK4A 4B4UA 1E60A 1EN5A 5LSAA 4KRXA 2G63A 3TTWA 3EGOA 1G38A 2Z95A 5KMGB 3UPUA 1X38A 2DHRA 4EGAA 2VF2A 5GV8A 1SVSA 1QU2A 4RF5A 4A8TA 2WNIA 3AJEA 1EINA 2OD2A 1OKKA 2Y71A 2X0NA 3JALA 3CO0S 1KGSA 1O0BA 4BC0A 1SUAA 2OHFA 3OX2A 3R0XA 3WB9A 3GHHA 1OBFO 2VP6A 4MVSA 3P5BA 4Q9HA 5CURA 2EILC 4E51A 3CG0A 2JGUA 3TL3A 5ALTA 2XWPA 1PNTA 4NXMO 1WPGA 3HN6A 3LI2A 5LXTF 1TK3A 3RTBA 3RRMA 3BWBA 4ZOLB 2CMFA 2VPPA 1ENYA 5FJJA 3QY9A 2HV8A 2C07A 1C3VA 5KCZA 2HT6A 5J2UB 2RHMA 5ADWA 2OYSA 2YIJA 1XUOA 3NH9A 1CUUA 4CI0B 1JPJA 3C3PA 1I36A 2Z5GA 2EJVA 4N65A 3HKCB 1L3CA 1Y76A 3G6WA 2X0RA 3V4OA 3OIUA 3T5PA 1XR3A 2QNRA 4RAIA 2PTHA 2HA4A 3FD8A 4H1WA 2YQ5A 1J5XA 3OZGA 1ZR2A 4UBKA 4FYYA 5KYWB 2R4QA 3CLUC 4KHZA 3B7WA 1UEIA 2GT1A 4YLEA 1JHUA 2MYTA 1ZHHA 1FS0G 1KFEB 4U7WA 3OF3A 1E69A 2BUBA 2W5UA 3FLAA 4O4IF 2G5TA 4JEHA 4YNBA 4MUKA 5G41A 3TLMA 2UVQA 2QD3A 4ZU3A 4Y0NA 2QAGB 4FFBA 1P2DA 1R8QA 1K9SA 2WIBA 3DE0X 3ZKWA 4YAIA 3WWPA 1WAMA 1D3AA 1C50A 1KO7A 4C9BA 2YCBA 4QIWF 5DASA 4C7BA 1FFTB 4MYSA 4NRDA 2BFCB 3QPDA 4YMGA 5G1NA 4ETIA 1PEKE 2D2CB 1S7CA 1Q5OA 4GSYA 1XZEA 4J16A 4FLWA 4C4ZA 2PWPA 5EPEA 3TKAA 2VF4X 3RRJA 2XOKD 4DLPA 4V1CB 2OLJA 1DWUA 2QRNA 2XDQA 2H5LA 1KP9A 4GZRB 4CMIB 4BQFA 1EFRA 4LJRA 5LLTA 5IRCD 2Y4OA 2XXAA 5KX5A 3HDQA 1IQRA 2FPIB 1ENOA 4PZPA 1A9TA 3WLSA 3GFGA 4BMSA 1ZOOA 4CFYA 3PRJA 3HXQA 4B3RO 3S5UA 2VAMA 3E8SA 4B44A 2R6DA 1KWKA 3GMDA 4FEEA 5IXYA 4PVCA 3B20A 1DAEA 2AXQA 4CGYA 4ZOQI 4WXEA 5AMXA 1TQ2A 1RAIA 4CM8B 3PUKA 4N0EA 3ANSA 3HWWA 4JI6O 3C8DA 1P9NA 3PRYA 2CGNA 3OUFA 1IHXA 1XDUA 4TTIA 4ED9A 3AGPA 3LGSA 2DUWA 3VDNB 5DWDA 5TGTA 1W0JA 4EB8A 3X2QB 4MW3A 1VGVA 4QXOA 2Z2YA 1ZJZA 4KV7A 5EBMC 4DMGA 5IPFA 1OCCC 1HZZA 5GQSA 2JGKA 4RD4A 4HZ3A 2GEDA 3TD2A 3WGKA 1BD3A 3C7CB 2P78A 4OXSA 3T4DA 2XIQA 3PE4A 4OH1A 3TOCA 1Y1PA 3LOQA 1ZCAA 1JDNA 1UDWA 2ID8A 4DR2O 1LD3A 4LCEA 3HSSA 4M8LA 5BO5A 2RHRA 4XM2A 1B3QA 3RWMB 4PJ0Z 3UAYA 4AG5A 4FDLA 4WADA 3FB5C 3LUJA 5BWLA 3ENQA 1QMPA 3QPCA 5K6TA 3EW7A 1J0BA 4M0DA 2VXOA 2PSHA 4F46A 2BUAA 5JYDA 2GYUA 1KEEA 4OHUA 5F3DA 3U17A 1OROA 1IMJA 3QI7A 1R9NA 1EIWA 5FOQA 5HHTA 2CJXA 3I04A 3BICA 1QZXA 3KSZO 1PVVA 3HY3A 5T4BA 5CDFA 1DOHA 4YCNA 5EWJA 1KIFA 3W7AA 4DJFC 2HA3A 1BMFD 3LLVA 1ZRSA 4RTOA 3N2LA 1GUYA 3K9HA 3UYLA 2CKMA 4BY9E 1XEQA 4LR3A 5EJ5A 3JU3A 3JSAA 3G2LA 5TT0A 1X59A 2WVHA 1IEXA 4GI5A 5J4KA 4H27A 4IFBA 5EYPB 3BWXA 1EB9A 2RHDA 5KLVH 4PA7A 4RACA 3VR2D 2AI3A 1LPAB 3L7YA 3B1YA 1Z8HA 3L8HA 3ZZNA 5I9MA 5A04A 4B43A 1SXGA 1JEYA 1FEZA 2WKPA 3LWNA 3UMRA 4NFSA 1M2HA 3DG9A 3E3AA 5EHZA 2G5GX 3HUTA 2ZSEA 3M6AA 3DLCA 4YJGB 1S77D 3K1AA 4MLCA 5DYIA 1E1NA 1VPDA 3L6BA 4NEHB 2ZQMA 4ZO7A 1PGOA 2AKYA 3OFND 1UODA 3IQHX 1B41A 4OOEA 1XV5A 1AD2A 1GPH1 5JDCA 5IVHA 2IHTA 4BR6A 3VU0A 3DUFA 3KJEA 1RXWA 1V55B 2GWRA 4FN5A 4A6PA 3MJEA 4AMGA 4R1SA 4XX1A 1SMKA 3BF8A 2QNIA 1LWNA 1YDEA 3C5WP 2OFPA 2DECA 4HXGA 4BRWA 3Q2IA 1ZY2A 1WXQA 1IDN1 5JLAA 1HLPA 2ZRLA 5AM3A 4II7A 7YASA 4DV3B 2CB9A 2Q1SA 1EFRG 3T7RA 1U2QA 3EVDA 1C0PA 4FR2A 1X13A 4B3MO 2J30A 4KR3A 1E79D 4NG5A 2WTXA 4UU0A 4QLAA 3PR2B 1XROA 2LDBA 3I6IA 2GZMA 1Y7IA 2Y1CA 4ZZ0A 1LBHA 3GJXC 1SQGA 2VJLA 2C2ZA 3T38A 2YS7A 2Y76A 2V4DA 1TEHA 4KIJA 3UK1A 1ZR4A 1UKCA 3LHSA 1V8BA 2B78A 1M1YA 3NWPA 3KKLA 3QFRA 3OTOO 3V8VA 3ZGNA 1MDBA 1XHEA 2I62A 3NKFA 3LUCA 2G88A 3FOWA 1NIPA 4I1RA 1RRGA 3ZU2A 5L3SB 3JRWA 3G0GA 2HJGA 4JLKA 2NSHA 4IGGA 4IVPA 2ET6A 1K7FB 4DR6O 1G20A 1NNI1 2A06H 3QKSA 3R9KA 1TM2A 3QVUA 1FNNA 4UCVA 5I47A 3N39C 1MRSA 2D3WA 1RJ9A 5LD2C 2MINA 4MHOA 1C8VB 2WIDA 1CWUA 3C45A 2TYSB 4MW7A 3RAGA 1SURA 3X2FA 2QL6A 2C5SA 4TQGA 2G8NA 4Q4DA 1GNRA 1W0KD 1VL6A 4K6CA 3I6YA 3CCBA 4US2R 3CRCA 2EKZA 4L8FA 1GM8A 2OXEA 4OPAA 3PNBA 4QGBA 2HXSA 3LXRA 2AW9A 4IOMA 1JL3A 3ZJTA 2NO6A 1OTHA 1YIAA 2AOUB 1WZ2A 2QGNA 2GKOA 4F97A 5EHNA 4OLFA 3L77A 1BZKA 5AD1A 4FKMA 1L7VC 1NTZH 4RNDB 2NTNA 3SHFA 4G3XA 1HORA 4K28A 1RC1A 3RU7A 1DHRA 4UCOA 5KA6A 3UHJA 1CIPA 4ATNA 4PNZA 3SDLA 5AVQA 3AHIA 3C3JA 2HAEA 4GLJA 3EVKA 3NBQA 3F1KA 3OMAB 1HSOA 1QGUB 3S2EA 3BK2A 3GPIA 3E22A 3HCBA 4JOSA 1ODLA 3PEFA 4DQLA 4IFIA 2PNJA 3ZY5A 4MTCA 3R77A 1RFGE 2G38A 1EXNA 4Z3KA 2MWMA 3HUFA 4D2IA 1MABA 3LK6A 1T26A 2JDID 2GS9A 2XMBA 3AEXA 1VQ9V 3OQHA 4M8NE 2ZG6A 5DHUA 3SMQA 2BKUA 2NACA 3RANA 2IY7A 1SKVA 5E7QA 1E9BA 4FSXA 1O54A 3QKUA 3SDSA 3PEWA 5TEWA 3H5NA 4RIHA 4YRIA 5ALOA 4DSTA 3CH7A 3V4VB 1OCRC 1PUXA 5F73A 1FL9A 4DJ5X 5BP7A 2AB0A 2GN4A 2QVBA 2WFLA 3ANYB 4B0PA 4B7EA 2HCJB 4PA6A 3AJAA 5DHAA 3NPMA 5ALDA 4LOHA 3HA5A 1XB2A 4TM8A 5AKKA 4Q66C 3BH6A 1N7GA 1M6EX 2R9AA 4JBGA 1UMCB 1LH0A 2D1RA 3IR6A 1BD4A 4Y2UA 1CRPA 2FZWA 3LW7A 1RSZA 2HBYA 2YWFA 4PZUA 3CN9A 4JI4O 4Z4GA 4F4JA 4O0MA 4I55A 1J2UA 1KETA 2A0UA 3SVTA 4HPXB 3BHMA 1BCSA 4PWYA 4QPDA 4HSGA 2ZVQX 3V3TA 4JV5O 2EU8A 3THWA 3JS5A 4RQUA 4GXTA 2C9DA 4RKYA 2OV6A 4IIEA 2JASA 1JHDA 1EE9A 2I4LA 3OP4A 1W5AA 1DDIA 4UCSA 3GC6A 3EBOA 2OORC 2Q67A 1K4CC 1PGQA 2VUHB 1Z36A 3R0JA 2WWVD 4W9MC 4PCAA 3T9EA 4BLPA 2I71A 3MAGA 4CKBA 5FPHA 1GT91 1LBIA 1GWNA 3AIIA 2JIDA 5ESWA 3TUJC 3ZMZA 2C9ZA 4KX3A 4M3NA 3GH1A 1SR8A 4JLNA 3WOHA 4DNQA 2J9FA 1DV1A 1BSVA 4EYEA 5A9RA 1I33A 4GM0A 1UJBA 1UIMA 3OZ7A 3CLRC 4AZ3B 3P0RA 4MKZA 2YMLA 4ZXFA 2ZB8A 1JMKC 3BH7A 4II2A 2Q1UA 4ARVA 1DINA 1G5TA 2W2KA 3L8ZA 4CWAA 3IT1A 1WQ1R 4NBTA 4MTOA 3C6BA 5MGBA 4I36A 3I1IA 1FQOA 3F8SA 3CZ5A 5LQSA 1O6CA 2ILVA 3BRWA 3IAAA 1W73A 3O8QA 3ZYCA 2BKAA 2DBVO 3SJQC 4IKPA 3ZGXA 3EXIA 4IFEA 5J4HA 2GQ0A 4YXWD 2EFGA 1MCZA 2UXBO 3L4BA 3GDHA 2Q21A 2CXNA 1SH7A 2HGSA 4KMMA 5TPWA 2B21A 2XAGA 1DAIA 4MJXA 3AR2A 4XTRA 1DKPA 2EJCA 1P8AA 1F20A 5KDOA 1JPNA 1ZL2A 4CG2A 4P0PB 3F6YA 4PW0A 3NALA 5HF5A 2IYAA 3WLEA 3ZIAD 4F4CA 2BFFA 2N0SA 3P45A 3WJAA 5DYTA 3PGVA 3G13A 2DUNA 4H44B 4LYHA 1Z7GA 2IH3C 2FZVA 4N12A 5I8PA 1DP4A 1FP1D 4KZPA 4B3XA 4W5WA 3ZD7A 5EZ6B 2WA2A 4QQ8A 3PXBA 3IVAA 2AZ0A 1JE1A 4WFJA 2YHIB 5IN4A 5FHQA 4XQGA 4CM3A 5BNTA 3TINA 5JVDF 4BNFA 2AGVA 1G9SA 3EUAA 2AK2A 2LKDA 4NCHA 1RAEA 2WYVA 3W8NA 2I67A 3K5OA 5IULC 4H4DA 3LC2O 4TRJA 3RAEC 3C43A 2A35A 3NWJA 4GEKA 1U3GA 2FFBA 1IPEA 2X4DA 5K0JA 4PDLA 3H3FA 1KEWA 2OT5A 1WUIS 4I1UA 4NFLA 4C22A 2PXHA 2R47A 4OQ4A 2RKOA 3ZW9A 1J22A 2IYSA 4C6SA 1YU6A 4AJEA 2IJJA 4IM7A 1XA3A 1YZFA 3HB7A 3IQFA 4CN9A 3HI6A 3UATA 3GLVA 3UIEA 4GSKA 3DR3A 1B14A 3HBLA 1NN0A 3NBFA 3MS2A 2A4KA 4MRVA 2P9CA 2KQUA 2R65A 2ONCA 1NKTA 2QLFA 3GDGA 2P2NA 4ZQGA 3DDCA 4FX2A 3H11B 3RC3A 3JVUA 3I8SA 2FW7A 4RGVA 1ECJA 3A2LA 3PE3A 2W6JD 4FXPA 1EZJA 4IY1A 3T9DA 1JJBA 2Q07A 4YWJA 4R1MA 3PLAE 4P30A 5D01A 2CNOA 1WXHA 5DI9A 1KB9F 1GL7A 5JWOA 1HDIA 3UTCA 3VPDA 4HRXA 2QRGA 3F47A 2ZAOA 5BV1A 5JNSA 4ARZA 4PI2A 4YJ2B 2QI9C 3OQIA 3S0JA 3IUBA 3O8LA 1IY9A 5KU7A 1PR5A 3P7MA 2Y0EA 2P9EA 3G1WA 1MR3F 1KK1A 4B17A 3MWGA 2VRCD 4MB6A 3UZUA 1G9TA 3WGUA 3HB1A 5IM4A 1QDEA 3AJ9A 1MIHA 3QE0A 4WKNA 3VSBA 3EJWA 2GLUA 3FPSA 1CQJA 1YU9A 5BWCA 3GNQA 4DEYA 2ODTX 2OSVA 2WUWE 2OM6A 4KR7A 3ZXUB 3TS1A 4D8UA 3JYQA 3EY4A 4IH1A 1E8NA 4KVFA 1J7JA 1T2NA 5IBCA 1U8AA 1GTSA 4F2HA 4ZXPA 3GPBA 1R4MA 3JQDA 2QUZA 2NXNA 1JWBB 4I50A 4F38A 1N2EA 3EIHA 2I34A 3VX4A 2JJYA 1V54B 4M0LA 1PZXA 4HGPA 1YJXA 5DM6V 1AKYA 4BWYA 5CNJA 4DCPA 1AS3A 4XVQA 1DLIA 4M88A 3UM9A 1H4TA 4JKOA 5FFNA 1M7GA 1GL3A 2CF6A 5JFOA 4G1EB 3MFYA 3BB1A 1XQ8A 2QK4A 3H2SA 2DEUA 1A9OA 4UEQA 1LS1A 3J7TA 4RZUA 1UBUS 1QZ3A 5AKYA 4LQCA 3F2IA 1SA0B 5HIJA 1TUEB 1KYXA 4BEJA 2QTZA 1KI1A 3WZ2A 1SCDA 4ZO8A 1RYNA 3RSLA 3TNLA 4WN9A 1KS9A 1IJKA 4P38A 1QP0A 1VIYA 5LMNO