The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
157
|
structure length |
157
|
Chain Sequence |
NIENTIKSAYEESLNNARFGDKIEEIDAIQSTIKSAKNVTVATSNEKKFKVVSDIISRITDANISMLEIPTNSADLTRMPALNKGLIAVDSSDADLIITRGRLGIPGSGSLLLIMDKKGRILTGSVSPSSIIHKNPIDKTVELELITALERIGIVVK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Towards artificial methanogenesis: biosynthesis of the [Fe]-hydrogenase cofactor and characterization of the semi-synthetic hydrogenase.
pubmed doi rcsb |
source organism |
Methanococcus maripaludis (strain s2 / ll)
|
molecule tags |
Transferase
|
molecule keywords |
HcgB
|
total genus |
46
|
structure length |
157
|
sequence length |
157
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2015-08-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF11576 | DUF3236 | Protein of unknown function (DUF3236) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Helix Hairpins | Helix hairpin bin | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | B12-dependent dehydatase associated subunit |