5D5PA

Hcgb from methanococcus maripaludis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
157
Chain Sequence
NIENTIKSAYEESLNNARFGDKIEEIDAIQSTIKSAKNVTVATSNEKKFKVVSDIISRITDANISMLEIPTNSADLTRMPALNKGLIAVDSSDADLIITRGRLGIPGSGSLLLIMDKKGRILTGSVSPSSIIHKNPIDKTVELELITALERIGIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards artificial methanogenesis: biosynthesis of the [Fe]-hydrogenase cofactor and characterization of the semi-synthetic hydrogenase.
pubmed doi rcsb
source organism Methanococcus maripaludis (strain s2 / ll)
molecule tags Transferase
molecule keywords HcgB
total genus 46
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5d5pA01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 5d5pA02
1DIOB 5JJNB 2F95B 4DK0A 2F1MA 3WB2A 2V4DA 1RSOA 5D5PA 2D0OB 1NBWB 4GYCB 1UC5B 1T5EA 5JJJB 3WB1A 4DK1A 4L8JA 3WB0A 5JJEB 1EGMB 2F93B 1EEXB 1IWBB 1IWPB 3AUJB 1EGVB 2D0PB 1VF7A 1H2SB 1MMFB 3BRCA 3LNNA 5D5QA 1UC4B
chains in the Genus database with same CATH superfamily
3G7UA 3HPRA 4HATA 4LXQA 1K7XB 3BHPA 4FC6A 4I9QA 1BD3A 1JIKA 3SLRA 1X1AA 1G19A 1YS4A 4INPA 2E55A 1SEVA 1I0ZA 1JU4A 3OICA 3SD7A 3GGOA 3HR4A 3VYRB 4BBZA 4DCJA 4IIYA 5CVUA 1G8JA 1RWMA 2DT8A 3JRXA 1M2OB 3TJZA 3AB8A 3CUUA 4TZ0A 3QGMA 2QLNA 4US0R 1ADJA 4HC4A 3E22A 3GVMA 2J7PA 1EE1A 3AG5A 2AE2A 4WXPA 4XGRA 1CEYA 1RR6A 3I8SA 4JJZA 4KL8S 2DUMA 2H1LA 1R3DA 3QMVA 4CPDA 3TX2A 2XAFA 3KHSA 2HW8A 2IYVA 5ALEA 1QH8A 1OIVA 1FJ2A 1DF5A 1ZC3A 1JNXX 3G89A 3J81k 1DELA 3NR2A 4TX1A 3SI7A 5D87A 1JMYA 4W5HA 2HJHA 3Q4HB 4L50A 4DEXA 5J47A 4L0MA 3RVMA 2ZJ5A 1EDZA 5CB0A 3W4JA 1C0IA 1I7FA 1G5HA 4QQNA 3DPIA 4Y9DA 1ZJJA 2DWEC 2QSJA 1XMVA 2WHEA 4F46A 3I04M 4JZGA 2WSBA 1Y48E 4TYMA 4DR1B 1HSOA 3SJUA 3TLAA 4A27A 4DDTA 2YY6A 2WILA 3IE1A 1W4BA 3ZI0A 1Q20A 3B9BA 3RV4A 5JASA 3F5TA 1FDTA 4OREX 1I7DA 5H5JA 1G4AE 3ZBQA 2CLIB 3K6RA 1UC8A 4C4YA 1XC7A 3QXGA 4Q5IA 3CT6A 3P52A 1I0HA 4WFKA 1DKMA 1X7YB 1IOWA 5L45A 3HZRA 3P9SA 5G0SA 4I1VA 2FMFA 1NR7A 1ULAA 3K2EA 1B7GO 4ZAXA 2EZPA 4HVCA 1CUIA 2VO1A 2IYFA 4KQIA 4ZVNA 3OOWA 2IOFA 4BMZA 4NE7A 1BQ0A 3V55A 3AVXA 1G8FA 1OAAA 3OECA 4R7CA 3KWLA 4YJGB 3JQ9C 3W34A 3ZV5A 5CVCA 3KFXA 1I9GA 2D54A 3UGTA 4RWUA 2DYRC 1PP9H 4LE1A 1KMMA 2L2QA 4JFRA 4NBSA 5LQJA 3WY9A 1RI5A 5L40A 1IATA 2FH5B 5EUCA 1D2CA 3I5AA 4L87A 3VI3B 2ZBDA 5ALKA 3GA7A 1QHIA 1OBFO 2WUWE 5G1NA 3S40A 3KKMA 4O6VA 3PSAA 1D5CA 3C3WA 4FCWA 4LZPA 3WLPA 4AICA 1G4YB 4EY3A 4K40A 3PWZA 3NBMA 4N18A 1UT6A 4TQUS 4KBYA 4OXXA 1B0AA 4OGWA 1ZH2A 3QFRA 4OFWA 5DJ5A 4JLBA 1MAVA 1A1VA 4X1IB 5B6JA 3A0RA 1OC4A 1T3ZA 2C4TA 1JAYA 2QL9A 4EHKA 1HI9A 1FMCA 5EBMC 1Z36A 2COKA 2X13A 4I8DA 3T0FA 5IG2A 4YRCA 1C0PA 1CQWA 5J2UF 3GZJA 4PQRA 1JZSA 3QKSA 4UDXX 3EPRA 1I5EA 3O1JC 4J9UE 5KYYB 4MW5A 4OX9B 4M1SA 1FFAA 1S4MA 1YQDA 1C4KA 3HCPA 2QUBA 5C9ZA 2IIPA 1R5NA 1HA3A 3DDZX 4EFBA 2ZRAA 1P91A 5KBYA 3BCHA 5K8IA 2WF7A 1JQLB 2CKDA 1FVXA 4C4ZA 2H7YA 2QJTA 1QJ4A 3R24A 1TZ2A 2VQEO 4OB6A 3GLGE 2GRUA 1MO4A 1VPDA 2X2FA 3WGKA 4D96A 1AHIA 3W7TA 3DLBA 1YDXA 3SPGA 1D4AA 3AESB 4BNHA 1YTFD 2PXXA 2Y93A 3FIUA 3HO6A 1JT9A 2O54A 1QFYA 3O94A 4P5PA 1DDIA 1U5CA 1T2NA 2H1SA 4KNWA 3UC5A 5FQNA 4AECA 1DC4A 1G3UA 2VTVA 5CITA 1RAIA 1Z06A 1H42A 1LQ2A 1MQAA 3C16C 3Q3IA 4OSOA 3LLMA 2PN1A 2Q6AA 3HR7A 2E5LB 1P84F 4X66O 1L7EA 2IHNA 3GRCA 3DGEA 2RGCA 2VAPA 4QJ5A 4A03A 2WD9A 1CZNA 2AHYA 3F5MA 5BSHA 3U19A 2FFRA 3M0EA 2F93B 1VZ2A 2RH4A 3CPWU 2ID9A 3D4IA 3PNSA 4MQ4A 4MWCA 3VR2D 3THYA 2O8CB 2V0NA 4LJ5A 1ONPA 1FYEA 4TMFA 2W7TA 1TK3A 1UBEA 2RG7A 4MRAA 5JJ5A 3BRCA 3U7QB 1WLSA 2QD2A 4NQZA 3JTMA 1K08A 2JJ1D 2IOFK 4PIMA 4K3AA 4FFMA 3I2HA 2GLXA 1T2FA 4RS3A 3A1SA 3OMIB 1GRVA 1SU4A 5ITSA 1R8XA 3VR4H 2YKGA 1ZD8A 4NPHA 4BJ3A 1DKPA 1KVUA 3W6NA 1OAKA 5A4MS 2OCYC 1KMNA 4ZCRA 2XRZA 1JBQA 1GFWA 1CB7A 2HI0A 4X91A 2PRKA 3JZMA 4WFQA 3BE6A 2YWFA 7ABPA 5COBA 3W9UA 3N5KA 2OCKA 1THGA 3FOBA 1O7JA 1YR1A 2PBFA 4EQZA 4D5GA 2QVGA 1FSPA 4P7KA 4HTFA 4LQLA 1R4NA 4RF5A 1N2XA 4LSWA 1SVNA 4V0LA 4RIHA 1TO1E 2EINB 1G8YA 2ZLBA 1GNPA 4UMVA 2Z95A 4CS2A 3HJHA 4KSBA 5DHFA 2J3LA 1WR8A 3GFTA 1W36C 3GFPA 5JLJA 1G7CA 1CRQA 1FXWF 3DBHA 4TV9F 4JEIA 5DTIA 4NS1A 1CUXA 2BSKB 1VG1A 4QGHA 1ZGCA 1RKVA 3BB4A 4FYMA 3BH7A 1EBFA 3ASZA 3OM9A 4GKAA 4L4SA 4OXRA 1J9GA 2W6JG 2VPQA 3O8RA 3EBPA 4IXMA 2AI1A 4QOSA 1L5VA 1Z0FA 2QJ1A 4DRXA 1P7YA 1TGVA 5E79Z 2R68A 4PZEA 4RO0A 5JQGB 2F3UA 3OPXA 4C3OB 5C35A 2NPFA 5DGCA 1X0VA 3I0ZA 3WWDA 2LXNA 3RJ5A 1EX7A 3EQ8A 3LRPA 3TN7A 4D9JA 4D8VA 4KUGA 2IU0A 2LW1A 4DLVA 4B08A 5ILGA 5HIKA 1B93A 4HFMA 4IXDA 2Y4NA 5LA6B 2Q8VA 1E7YA 4MR7B 4Z7NB 4CHTA 4B6FA 1DKOA 4R2LA 1OBVA 5D7BA 2DFLA 3U7QA 3EIUA 1DO8A 3RFRA 2PTGA 1HDGO 4NCHA 5KQPA 3G2NA 4MIKA 3MSXA 4UMEA 1H2XA 4H3SA 2RB5A 2IY9A 3G0GA 1G5QA 2A5FA 3T3MB 1E32A 3IQHX 3RSGA 1P7BA 1T3HA 2CLCX 4J6EA 4MVJM 1FQJA 5E3IA 2JFYA 2BFEB 2GPTA 5AKHA 1OROA 2PIDA 1KR2A 2B4AA 4P53A 5J5VA 4IVRA 3RIHA 3UOAB 1JAZA 5KHOC 5AQEA 1SPXA 2HLNA 3V6LA 1L9KA 1R8QA 3IXMA 3L4BA 4CTJA 4DJFC 3HEBA 2A1IA 1VQPV 2ZULA 4L3OA 1JA0A 1Z0AA 4WH0A 5AO9A 1DC7A 4KIFA 1KP3A 1O94C 2VJDA 4EECA 1N5IA 1XTIA 2E37A 4YPVA 1ZUQA 1O5OA 5DM70 3T7AA 3TGPA 2B8WA 2SCUB 1KRWA 3Q41A 3H1FA 1GXSA 1JEEA 2NU7A 3L2OB 1EVLA 4FGKA 4N3CA 4GD3Q 1FYVA 3DULA 3AR7A 7GPBA 4WA8A 2GD6A 5DWVA 4OBWA 1C4XA 5BSEA 4HLDA 1IJBA 4QGGA 1LUAA 5FI5A 4DGQA 5BNWA 1P18A 1G8HA 3VZQA 5AKLA 5FPPA 3OAAG 5I9IA 2HDHA 4BEBA 3LW7A 1S3GA 4C01A 4D98A 6NULA 3AJRA 4DYHA 5WRFA 2QWQB 5JVDB 2QYHA 1UP6A 4KQWA 2BZ0A 2C0QA 3MDSA 2I4RA 2FWNA 2V7BA 2X77A 5FV7A 1Z2OX 5M3BA 4YT8A 1H3NA 1W6UA 4S1OA 2VH1A 1V3TA 1QBKC 4WY8A 1SOVA 3J7TA 3M9XA 4MUXA 1YQXA 5DLQC 4ZZIA 2P5SA 4GXTA 5MN6A 3TKAA 4FEEA 4QGBA 3PFFA 5ULLA 2PZ8A 4OPMA 3BY6A 5EAIA 2GJSA 4E6PA 4Q6WA 3HLTA 4BJ6A 1PFQA 2FWJA 3OIYA 3INGA 2HYIC 3T4UA 3GWZA 1ZSPA 4XFDA 5CM9C 5AESA 4D4HA 1OBCA 5F1PA 2DSNA 2HN9A 3BWBA 4LI0A 3L9WA 3VYWA 5HQTA 1KKLA 1H1DA 5D3KA 1AKYA 2E4YA 1GGMA 3PQ6A 3K9AA 3IBFA 5AVRA 721PA 5AJWA 3H2SA 2AGAA 5K6TA 1Q1AA 2R8OA 1K8AW 1RRGA 4NYMR 2P2YA 1Q0RA 4BMOB 4LN1A 4KPYA 3JV7A 2NUTB 4HQ0A 3T4DA 4QUDA 1I2MA 3DW3X 4R6XA 4RIGA 4YHHO 2R72A 2IW5A 2KB1A 3BIXA 1Z4JA 2VAVA 3P9PA 4PSKA 1CETA 1OE0A 4LF6O 1K63A 3HKDB 3ZRWA 2IY7A 2QTGA 3QF4A 4GLJA 1WZIA 5EMMA 3BDVA 4R8MA 3H9CA 4YRTA 4C89A 3HJCA 3BEDA 1Y81A 1R73A 1QO0A 3B70A 3OIDA 3ZZTA 5L8VA 2RCVA 1V7QA 2SBTA 3FBWA 5FD8A 4P9PA 2X4IA 4R8VA 4RTRA 4CG2A 5F7OA 5BW5A 1UAAA 3ETQA 2KJQA 1R1DA 2VP3A 3F7NA 3MUEA 1QK3A 4YMWA 1AMOA 1UP4A 1MG0A 2EIJB 4GMDA 2W4IA 2OYRA 3U1BA 3I5MA 4DUZB 4OHVA 3RS4A 5BN5A 4J9ZB 4R1NA 4QOEA 5E9AA 1OU0A 2EARA 3IV9A 4LJ9A 5KNCD 2JLVA 2IYPA 1PT9A 3IC9A 3E9EA 4FKBA 3RWOA 1N5OX 5H2FZ 1CZLA 3K6JA 2W22A 2AG1A 3PUKA 4OYLA 4IIFA 4UD2A 3SXUA 2C7RA 3OP4A 1Q1BA 3HKEB 2ACKA 4C0WA 4PN3A 3AVWA 3MN1A 3L1JA 5FLXA 3G0HA 3KB2A 2BELA 3TZQA 2Q8QA 4X8AA 1KDPA 1XKQA 2A9OA 2Z2KA 5PNTA 1PQWA 5KHGA 1CSEE 3GZTB 3CLTD 4MO2A 2RG1A 4RJKA 5EIFA 1CUWA 1Z0KA 2R7NA 5KOHA 2DWOA 3WGJA 2NMVA 1NASA 2EJVA 3P0HA 1W5AA 5FL7D 4OYRA 3S70A 3KQNA 3NALA 1OCRC 2QUZA 4PGAA 4C03A 4IQFA 5TQVA 1TCCA 3WG7C 1DBVO 1GEGA 5DO9A 4D6YA 1JBKA 1WW3A 1QVRA 2H8GA 3OZRA 5B1NA 3QMWA 4LKOA 5EMLA 4E12A 2VHVA 4BNUA 2AZ2A 5LL6Y 3HLYA 3KQVA 5GPBA 1YXMA 1MNQA 3OQIB 2YFHA 3FTNA 1HG1A 1SVKA 3RUFA 3H4TA 1MENA 1TAGA 5CYPA 4IIVA 1RPRA 3COWA 4BLUA 5C5IA 2AT1A 3IBTA 3WLSA 4AIRA 1QGOA 4OJKA 4JVSB 5A4KA 3KKLA 3EDOA 1XZMA 1YS1X 1ZH4A 2CW5A 5GONA 3KEMA 4PFJA 1DAHA 3AJDA 3ESRA 1SQFA 3EIEA 3G2LA 3SX4A 2SKCA 1M34B 1L7DA 3QW2A 4IJ6A 2OGSA 4P34A 5LWQA 3EG9A 4EJSA 4GW3A 1Z83A 2D4AA 5F77A 4EQ6A 1XB2A 4LBEC 3COZA 2QPOA 5DEDA 2ZUEA 3QI2A 1URFA 2B99A 4KLRA 4W9RA 5SZKB 4NR1A 2X5XA 4GDFA 5C32A 3K9GA 3IBSA 3Q7PA 3QUTA 4Q4AA 3K0SA 3OFND 4XR9A 3AZOA 3FR8A 2OLJA 1ZKMA 3IS3A 3LW8A 4JGBA 1EM6A 4GOXA 4BQPA 3PHGA 2Z0AA 3LSUA 3QV2A 1GAEO 1XVAA 2AG6A 3BMQA 4HGQA 4ESEA 2LKCA 4LFCB 2VP2A 1ORRA 2MK3A 3BAAA 1G5RA 3MJSA 3NANA 3JR3A 3OZGA 4HMOA 1C7IA 1EXDA 1Z0ZA 1HX7A 2CYAA 3O0TA 4J07A 4W82A 3Q8MA 2PH3A 2QG6A 1W5FA 2G38A 4ZARA 2JFUA 5F12A 1XLTC 1LW6E 3D0QA 4YRPA 5HFLA 2F00A 2W2KA 2HRBA 3MUNA 1TKBA 4NBUA 4Q19A 2OYQA 4R1LA 3SEFA 2AF4C 4C3ZA 1QYCA 5HF6A 3AOEC 2BHRA 2DBRA 3VUEA 3FUVA 3WLNA 1Q6IA 1ECBA 1NT4A 2RKOA 2D5IA 4CDGA 4ARVA 1P74A 1MO6A 3CCLV 1L3IA 2WEKA 3H11B 3HO8A 2XOKD 1X59A 4MGHA 5K6AA 3DPUA 1NSTA 2AEMA 3FGPA 3L6EA 4L0CA 4Z9AA 3PS9A 3ISJA 3JAKA 3KYDA 1EJ6A 3IC7A 4GC5A 4M0KA 4ME6A 4RTKA 4OTZA 4TS3A 1RXVA 4PF1A 4UB8Z 4MEBA 1GGFA 1OZGA 3JSXA 3L82B 3UTCA 3OO1A 1RE1A 4DE5A 2HDWA 3UXMA 3INYA 2F64A 2QKYA 1QYXA 3CRZA 3OPMA 1AJQA 4GQAA 5EJMA 1P6XA 2EGGA 2I2BA 2JIRA 3EVKA 3NM6B 1E7RA 2J3HA 2VHUA 1H6BA 5HBRA 4FS8A 6PFKA 3GT4A 3OMXA 1OGIA 3KE9A 3R09A 1DAGA 4ND4A 2CE4A 3ZWWA 5KYWA 1GR0A 5IM5A 3HK2A 1R0WA 2GAAA 3OT1A 4NIMA 3DZFA 3BREA 2Z3VA 5JMOA 2EBOA 5AW9A 2RHJA 4G5SA 2GN4A 4RZ2A 2CFOA 5DFAA 5IT9A 2Y0CA 1QDLB 5UKDA 2ZIOA 4LG1A 3C7TA 2IOQA 1XA3A 1R3JC 1NVGA 3GFVA 5EZSA 2PGLA 4CMCA 5EJAA 2FETA 2I1WA 3C8MA 5TMDA 1WKCA 5A71A 5TQ2A 2QUAA 2XWPA 1NUQA 1YOVB 1GVNB 1JDUA 1X87A 2YV1A 2DOSA 2PGJA 1ODCA 4MIYA 4ENPA 3K92A 1JT2A 1BH6A 1H2BA 2JGIA 5DSTA 4ZOEA 5C18A 1OVMA 2ZRFA 2OILA 5HKKD 4QIWF 2BE3A 3ZRXA 1G5IA 5BR8O 1OT3A 1XRSB 2ZITA 3AHJA 4BNMA 5BYKA 4KX5A 5HQ3B 1MAUA 5IDXA 3R6DA 1N5MA 4Z7JA 2WF5A 1AGYA 4EUHA 4UNQA 4BB5A 3TRHA 4MULA 4Y7CA 3WBKA 1N7GA 1T5OA 3CKLA 3Q3GE 3Q6NA 1GM5A 1NVAA 1PV2A 1IDSA 4LSMA 3O6VA 4K9QA 4UCFA 3X43A 4F2GA 5MF6A 4Q3EA 2TYSB 5JISA 1S2MA 4JLMA 5IJ9B 1Z9BA 4QBKA 5CR9A 2WIGA 1FS4A 2UU9O 4ENWA 1CB0A 2HD4A 1VGQA 2FG5A 4DHEA 3F49S 4V03A 3PRKE 1KIFA 3LQ4A 5K5EA 4Z1MD 1XZKA 3ZRSA 4BNFA 3BJMA 3H9EO 1XR3A 4WKOA 3FOZA 3WGYA 4OOFA 4MRNA 2W2MA 3FUXA 3LLSA 1WDKA 4XA8A 5IVHA 1X74A 3GVIA 5H82A 5A3SA 3NVMB 2P6PA 2W2XA 3X3HA 1B4DA 5IZCA 2Q69A 1F9EA 2LW7A 5KTPA 2HIMA 2FHPA 1UXIA 2J5BA 4B0PA 4NJEB 1QIMA 1U96A 3EEQA 4NV1A 1EM8B 1KPHA 1E3SA 1JLLA 1PGJA 3E83A 5HBGA 4RV9A 1GQYA 4KXLA 4PZYA 1JGTA 1H2FA 5FL3A 1RXYA 2D2CB 3CX7A 2BAGA 3TW8A 1Q7EA 3FYTA 4NAHA 3LKDA 3G7NA 4NR0A 3VNQA 4C6TB 4CKCB 4XD7A 4C2UA 3OCZA 3FTPA 1LX6A 3B38A 4EZEA 2ZRBA 3CBGA 3ZU4A 1F6BA 3BL8A 2Q7HA 1HG0A 3L01A 3H2BA 3HBFA 4C7XA 4KQ6A 3GGJA 2C4HA 3K2QA 2VWQA 1SCKA 1FSFA 4GPIB 1RWKA 4KE9A 4YGYA 3QXSA 3ZYZA 3D1LA 3GJXC 3HHEA 5L3SB 1YCGA 2VI5A 2VCHA 4D8UA 4MVYA 3IGAC 1JVSA 1E9FA 1ZAKA 4KDFA 3I9MA 2V6JA 4NMXB 3OQPA 4I9UA 1GSOA 2OL4A 1CUEA 3G5UA 3TRJA 3ET5A 1TJ4A 1K0UA 3ILYA 4J1QA 3R9KA 4QDZA 4Z0TA 2PYLA 1S0UA 5HQ3A 4IMJB 3VO1A 3WHIA 5BWNA 3LRXA 1JHUA 1CUAA 1KY3A 3FPHA 4EF6A 3CCRV 4CQMB 3VOBA 5IPFA 1YZFA 1W88A 5ALDA 2EFHB 3TCXB 2FUCA 4XSGA 1U2SA 5J9FA 1BOOA 2VPIA 4YCAA 1ODSA 4RJTA 3CUEF 4Q1VA 2WJAA 3MBIA 2C98A 3L72H 1UZLA 5J2TF 1LA2A 4RCVA 4DZTA 2PS1A 4PLHA 2CUGA 2YXPX 1ZWIC 2GI4A 3WSVA 3HJAA 2IRWA 3GJ4A 5HUHA 5I7UA 2J48A 1IBKO 4DANA 1Y1KE 2MSCB 1YJQA 2B9EA 2EJWA 2XUHA 1JPUA 2WM2A 3EYWA 4BKMA 4F2HA 2OAEA 1AXRA 5KJCA 1WVGA 1OWOA 1SQ5A 1Y8RB 4WEOA 1O9HA 1GNQA 1DX9A 1HWYA 1TVCA 1U31A 1ZRMA 1SG9A 4A15A 3H83A 2Y68A 4LV6A 4FN5A 4RV4A 5D5PA 3EEFA 2K1EA 4ZO8A 3E27A 3TAUA 3F5QA 2QGFA 4DV2B 5LP1A 2X6QA 1H23A 3OLZA 3GFOA 2I4NA 1SO8A 3GH3A 4HG2A 2A9QA 1L7AA 4FJ0A 4HYEA 1JJIA 2P9TA 3RKSA 4CV1A 1YZUA 3OI7A 4FHDA 4JEMA 2W2LA 5CFQA 1GTRA 2VWKA 1QR6A 1YKFA 3QSYA 3M99B 1KRHA 1OXMA 2DMXA 1EVJA 3JQ6A 4ZEMA 2FR0A 4ENSA 1AJPA 3BA9A 1PEYA 2C2AA 3OETA 2PT9A 3G2KA 2IP1A 4GM1A 1K66A 4ZC8A 3USZA 4GF5A 4Z5XA 3ZN0A 4PU0A 1KZ7B 3BD8A 3D6TB 2A0XA 2VS1A 3GJ6A 3G6KA 4HP8A 3WX0A 2AEJA 4E2FA 1E7MA 2Q3DA 4EG8A 3TX6A 2ZIWB 3PYLA 3QPUA 5F2OA 4BCBA 4EPYA 3VDNB 3F6EX 4HNRA 3R3XA 5FQOA 1M0EA 3MHSC 4XJVA 4AZ3B 2NO7A 3JQFA 1PF7E 3MHTA 3UBTA 2RHDA 3KQQA 1ISIA 4POAA 1V3QE 5AHWA 3VDMA 4N12A 3RT7A 1SPBS 4H6XA 1ODLA 1PD0A 1WM1A 2J9GA 1LUVA 2PUVA 3R4VA 1AA9A 3SJAA 3SQNA 4TWJA 4BFYA 3PYMA 4XI9A 1NUPA 3ZIAD 2H3EA 3C5HA 1SQ6A 1OAOA 2J4DA 2HFKA 2I87A 4BZWA 4HTFB 1N5KA 2C8KA 4IV5A 2BDUA 1S5LZ 4IUBS 1BJKA 4U2DA 1DJMA 4FT4A 4J0QA 2JFGA 1ICIA 1WB8A 4LWQA 1UK9A 3RYHA 7REQB 4H7DA 4F92B 2A79B 1WZ2A 4QJIA 4M54A 1N0IA 2ERXA 2P6UA 3TUJC 1EK1A 1S8OA 4B8ZA 3MBOA 2GUWA 2UUBO 3EQ6A 2ISQA 4MJ3A 4OG2A 3PIRA 5EE1A 4DPMA 3QWHA 4CT0A 1D5NA 4E22A 1FIUA 5FWXA 4MNTA 4JJ8A 1NGSA 4JNCA 1IRXA 4LECA 4DRXB 1IN1A 1X8JA 3O4JA 3EARA 1A7AA 4JKOA 3H2KA 4MW0A 2ZIAA 2A67A 2Q0SA 4LMPA 2YIBD 5D01A 4MGKR 5DNWA 4EPRA 1AUPA 2DQSA 2AB0A 2XQJA 2O2EA 4N6GA 2FE4A 3IFXA 1NZJA 5FWDA 3SAJA 5KDLA 3MT8A 3QXHA 4NH4A 3ZWXA 2FXVA 3SS7X 2QSAA 1TJNA 3T7EA 1I4DD 3PQ5A 4C6RA 3HDQA 5BWCA 4BFXA 3T1QA 3E4DA 3TNYA 4F9FA 1KAGA 4I4TA 3L0IB 2CTQA 3P19A 4GLLA 4O4IB 1S2GA 2Z56A 5LN1A 2WT9A 3FJ1A 2ATKC 1TMKA 3K3PA 3A4MA 4P3KA 2J59A 4YRNA 1ML3A 1DIBA 5JRDS 1OX4B 2VC2B 1NW7A 2Q6TA 1E5LA 2RIRA 2QRKA 1BX0A 4P80A 3QWBA 3WLRA 4BFWA 4NWIA 1VE5A 2A0WA 2QTHA 1IVSA 1Z7YA 1TTTA 1AUVA 1JR3E 4G67A 4JBYA 1YBMA 2ZRLA 1U11A 3NP7A 4G36A 4GMHA 4TLLB 4TMZA 5D1HA 3M4ZA 3C98A 1WSWA 5DHUA 4UHBA 4ERNA 3G2JA 4FLMA 3AG3B 3EVCA 4UNPA 5TLSA 1O96A 4E33A 1KKUA 2GEJA 2GK3A 3RYIB 2WIDA 4JBXA 2XUAA 5CM2Z 3MGKA 3LDHA 3UJNA 2PZLA 4I8IA 5U9CA 1II8A 2BP7A 5BW4A 1MT3A 4DR7B 4KPEC 5KAFZ 3PG5A 1ZOSA 2BEUA 1H8HG 1D2AA 3OEWA 3MSCA 5IBPA 5ISMA 1ZZGA 5G0VA 1P2UA 3GY0A 1JFFA 3RRXA 4NMMA 3RFTA 5AUNB 3CZ9A 4MV7A 3H1KH 1XDZA 3IOMA 1R3IC 3E7FA 2IUTA 3B6IA 4H15A 2P68A 2Y27A 9LDTA 3DZJA 1HTTA 1H94A 4ZMBA 1LCIA 3INRA 2XB8A 2JCSA 1T4CA 1XEXA 4RF3A 5AHKA 5LDHA 1U1GA 1PEDA 1P1BA 1UPCA 1OWPA 4LCJA 3K05A 4TWZA 5EJIA 5FR1A 3ND7A 5HFAA 1USKA 2FTKE 2W6QA 4UCQA 4B9EA 4RVHA 4HLUA 1ATIA 2HHJA 4XVRA 3WJAA 4O2BA 1OWMA 1X7HA 2HWKA 3IAS6 4G01B 2AMVA 2FPXA 2VHXA 4LDZA 3M83A 4UUOA 3UFBA 4YJ3B 1A7JA 1G4HA 2PKCA 5CH5A 1VSBA 3WZ2A 1B76A 1ORWA 2CLDX 4IIXA 5I7EA 2P8SA 4MP3A 5EMJA 5C0OE 2J9FB 5KNBD 1PJZA 3QVSA 4FDAA 2G82A 4XRGA 5HS4A 3SG0A 1RNLA 2OD9A 2PX3A 3GCDA 5I5EA 3T3IA 3ROQA 3GGSA 1ZVKA 4HT3B 4Q00A 1GV0A 2Q0QA 1EUDA 4GS5A 4QGFA 4C7MA 3SXPA 1Z4PX 2HH9A 3AVOA 4IDPA 2FEMA 4BECA 1I7SB 1RKUA 1GNTA 3LHFA 4D9KA 5L6MB 2O2CA 4NJMB 3U9LA 3EGOA 5CNIA 1RIIA 2QDKA 2X14A 5FUVA 3LTNC 3RBAA 4U5XA 1Z5WA 3NI2A 1TA8A 3JCZA 5D85A 3EOAI 4MVQA 3W7XA 1Y80A 1M2EA 2QRMA 3R0IA 4J0JA 2N1MA 4U7GA 1IUNA 3RREA 1CR6A 4UKDA 5AVQA 4OLAA 1IOVA 1JR3A 1OASA 3ANXA 3LCUA 3Q1LA 3VPGA 4NMWA 4A6XA 2Q8PA 2A7QA 4B3IA 5H5NA 2OMKA 4J03A 1LTKA 3V8EA 5JWOA 3BJEA 3VQXA 1SQXH 2O1EA 2RHWA 1JFFB 2C82A 3DQPA 3MCTA 1O87A 3R3JA 4IV0A 4ML3A 5LQNA 1RKBA 5KI6A 2II6A 3LWDA 1XA0A 2BTQA 4PO9A 4F8YA 1DJQA 4IILA 2FPPA 2HT6A 4PPYA 4EW1A 4B9AA 1V8PA 4H77A 3IPAA 3RS3A 4FI3F 1GTG1 4G1MB 1A5SB 1GKFA 1ORHA 2EQ5A 4DY6A 4G25A 1RTKA 5KYKA 3DD1A 1AKMA 3D6FA 2J6HA 1I1HA 2BFMA 2YIVX 4R2JA 3CO5A 4U9UA 3SBXA 4DCNA 3ABZA 5KHLB 2AJTA 1OJHA 1BH2A 1O1YA 1WCIA 4CM6A 3ICVA 1G20B 1RYEA 4DV1B 1T3LA 1GYQA 4ZU3A 3VQVA 1MOFA 1F4NA 2RONA 4CM4B 2EIKC 1P5ZB 3JD3A 3SIWA 4F9TA 1KPIA 3OF2A 2HUPA 2IU3A 5CK5A 1TM3E 2XF8A 4IGKA 1YDMA 9LDBA 4TLBA 3AF4A 2BFWA 3TQTA 3Q3HA 3DMYA 2FGKA 2JFVA 2C5LA 2MWMA 4JAUA 2X0NA 4FLTA 1PJCA 3GX1A 1PV4A 2FW6A 4ARZA 3K06A 1TX4B 3D1VA 3FPGA 3MTAA 4KFSA 1BRMA 3KZCA 3PUHA 1JLRA 3GJYA 3FH0A 2QTRA 1ZYUA 4P35A 4MVJA 4R8SA 1M1YE 1VCIA 4CLEA 4UVIA 3RAEC 4DV5B 1K3UB 3DCJA 5IKOA 4KUMA 3VHXB 3IOCA 3FUTA 4HWKA 4L08A 4MV6A 2QWXA 4AX4A 1JYSA 4YUVA 4WBXC 4TS1A 5J1TB 5LR6A 1AMNA 5IVKA 2QXYA 2Y1KA 2P79A 2ZKOA 2ZI7A 5D3ZA 3O2SB 3NWBA 5F9HA 1EM1A 2IZ1A 2FMLA 5CB4A 3MIZA 1FP4B 1HE3A 1O95D 4N6NA 4CV2A 7YASA 2WA2A 3U80A 2ALJA 3MTGA 3ETCA 1DDGA 2CZCA 4QUAA 3VR4A 1OCOC 1PJRA 3Q72A 3ZU6A 1QU3A 3ROEA 4KYIB 4XW2A 4D3XA 4X71A 3BUSA 1Q2XA 3JW8A 5T3UA 3RVKA 4XRRA 4O08A 2B94A 4MWBA 3RWMB 1V9PA 3CRAA 1Q15A 1GUYA 5AKEA 3AL2A 5GQSA 2A4KA 3C3PA 3I9NA 1XD2B 1CV2A 3MS7A 3OZUA 4O4JF 1CUUA 5BV7A 1H9BA 4AWXA 5HFMA 1IB0A 2ZDQA 1GYPA 4L2IA 1WW2A 3U17A 3SYAA 3IBCA 3N76A 1U2RA 1W76A 2R6JA 4FJ1A 5H3HA 3KSUA 3LCRA 3JARB 2WUEA 1XUQA 1ECPA 1TMGE 3UAVA 1JG6A 2AZ0A 1KYIA 1P62B 3F7MA 2GNAA 5L3DA 3DE6X 1WCIB 2KWIA 2MT9A 1GL3A 3G8AA 3GB9A 3R3ZA 1MFZA 4UPDA 4Y9SA 1K9MW 4IX9A 2F55A 1IPHA 1GLNA 4B6JA 1V2HE 2B34A 2V7XA 4TL7A 3W6UA 4CMAA 2L0XA 2WRZA 4LCEA 4C7KA 1OOEA 1T1GA 3GLKA 3NT4A 4OQPA 2NU9B 3Q3VA 3DYIA 3E8FA 3C2QA 5DOVA 3SQXA 3CC4V 4IOKA 2A5GA 4FYXA 1LBTA 2P6RA 2IWHA 3ZE2B 3PKJA 2Z83A 2JAUA 4M8KA 4ZVSA 5C34B 1R15A 4PS0A 4YIPA 3DAOA 2PD6A 3K8OE 2GLTA 3NUQA 3PPIA 3QFFA 4CM8A 3BVOA 1I3OA 4OHUA 4COOA 5K20A 2O2ZA 2AC2A 4QEKA 4EG3A 1XCBA 2BEJA 3R23A 2GYUA 2G5TA 2W6NA 4QLAA 3CB2A 1W4AA 2HC9A 2VKTA 4Z8YA 3MWEB 1T2UA 2GD0A 3IESA 3V8PA 2IEDA 3L93A 3VPHA 2CXNA 1IVYA 3O1HB 3ZI7A 2BISA 3ZDEA 4RTPA 2ZDGA 2UDPA 2NACA 2CDCA 4KXFB 1AJNA 2OB1A 2WWVD 1WUKS 3W9BA 1N9GA 4BNIA 1JLHA 3OR6C 4EPWA 3LTEA 2DM6A 3RYCB 3ESDA 2WA1A 1OH6A 2G09A 1EFAA 1Q3HA 2QRQA 3GJ5A 3QKIA 4ISBA 5KNDH 2XTJA 1QIGA 1QBZA 4UNSA 3CSXA 4OHXA 4F6CA 2A33A 1SWVA 1US8A 3W5HA 4MVOA 3K79A 1R0CA 2XUIA 2ZE7A 1DU4A 3FOFC 2ZE8A 3DP9A 4IZIA 2GZSA 1QQTA 2CNKA 1Z0UA 1ACJA 3BGWA 4NFLA 2J0UB 4XIIA 1ZM2A 2WIAA 3ECCA 5TGDA 1N75A 4KFRA 5HFNA 1NU6A 1X3LA 1A9TA 1YNSA 1MDBA 1ZS9A 1E0DA 1SD5A 2VDKB 4HQ6A 2DFKB 3KTDA 3MWDB 4JJAA 1JYEA 4JVMA 1IOLA 4LPKA 3RBZA 4TVOA 5JNLA 2RAPA 2AWNA 3TW6A 3DA8A 1Y6ZA 4U7PB 3ZHVA 1RJEA 3MRVA 2QM4A 1M2HA 1R16A 3KL2A 2HK9A 4UM5A 2XXAA 4RKEA 1WBJB 4GKKB 3H8WA 3U7GA 2EKDA 3E61A 1NG1A 5DF1A 3C7DB 4UCUA 1J2TA 4E07A 5B4UA 1KJWA 4RXMA 1DXHA 1PNTA 5FLEX 2VRBA 1SXJD 3IILA 5FBWB 5MGBA 1KAQA 4MJLA 3PPVA 4X7RA 5F98A 2COEA 4FFDA 3IVGA 4NY1A 3RUIA 3FBTA 2HMAA 3K70B 3EIXA 2QN1A 4URHA 1SC4A 1VXOA 3GROA 2O7QA 1R0YA 2IHYA 4KQ1A 3ILVA 3I42A 4FW8A 1VJ0A 2CXXA 3UAGA 4MAFA 3OQIA 4ZO9A 1PWYE 4RAOA 1BFDA 4D1YA 3F6CA 4RD0A 1U2TA 3WV4A 5LWHA 1JR9A 2VN8A 3E2EA 1LDBA 3NUGA 3UMVA 2OT3B 2PLNA 5EHIA 1FMFA 1ES9A 3ZMTA 1BGYH 1K6IA 2C1XA 2ZNIA 3OURA 4LGVA 1KI7A 4EPVA 1UR5A 1XEQA 1KAMA 2QU7A 3EXHB 4Y0AA 2X6TA 3O1LA 1DJOA 3F7YC 4OQ4A 4YUWA 1TLFA 2C2BA 3H6HA 3ONWA 1JSRA 3U7RA 2E87A 4A26A 1YVDA 1AR4A 1D6MA 3U3DA 2RGXA 2DR2A 5CURA 1JLLB 2FVYA 5K0TA 1QC5B 4N7JA 2IVZA 2J3JA 3BSYA 5K8LA 1EU1A 4C29A 2V7PA 5ELXA 2O5RA 1F7VA 4RV5A 5KSYA 1UFRA 5KHAA 2DPYA 1JJ7A 2BSXA 1T1EA 3MVEA 3KKEA 2BDEA 1MEJA 5DVZA 3RSSA 3QYPA 3SOPA 3DYVA 4R5HA 4D57A 1UJBA 2K9PA 2WLJA 4BOYA 3RUCA 1ISJA 3R3VA 5K05A 3GMTA 1YZYA 4KVGA 4EMSA 4FUTA 5KDOA 2G72A 5L4NA 1YZGA 4Q6GA 3MLAA 1KS9A 1AQIA 4IJQA 4AP9A 2JHFA 3CZCA 4NX2A 2PCJA 3FCYA 4DYLA 2ORVA 1ZH6A 1TK2A 3W5AA 1SC6A 3ENVA 3R0JA 5TVKA 1SFRA 3ABQB 4FIDA 1GTMA 1HQDA 4XDJA 2WPNA 1NKDA 1X94A 3U60B 3BA6A 4QVKA 1SQVH 1X2EA 1E2MA 3R3YA 5NLLA 2E75B 2ZSUA 3EE6A 4FMDB 1UC4B 5E1DA 3VKVA 5B1YA 1TQ4A 1QONA 3OVMA 4DO2A 4RWZA 2G67A 3BWYA 3B6KA 4KRFA 5EVJA 5LCXA 2Y99A 1T2CA 5G4KB 4D9CA 4WLOA 4M83A 3FFXA 3CBQA 4JP2A 4LX0A 5TRTA 3FWHA 4WXMA 1C2TA 2AG5A 4FBLA 3MJEA 2DHEA 3AONB 4FBGA 1WNTA 4HPXB 1CHNA 4J8PA 4X6UA 1GNVA 2X0FA 3SJZA 3GFRA 2BWJA 2KB0A 3BK7A 4FE4A 2QWPB 4WOBA 2W0FC 2QVZX 3O8OB 5BQOA 3QLVC 1GV1A 2PRYA 2FYUH 3TCNA 4R1PA 1KYWA 4ZKEA 4M1MA 1A8SA 2H1HA 3GRUA 3MMSA 1GTSA 3Q9SA 3IH5A 3KR2A 2PVSA 3M81A 4NE2A 2FPIA 4DR5B 4N9WA 1XL6A 2QL7A 1YS2X 4EHNA 4A8JC 1Y67A 4RTLA 3PQFA 1OF1A 5K8TA 2KKWA 1XMPA 5L3RA 5FL7A 4EY7A 2C4KA 3SFVA 1H2RS 3FRJA 2DKNA 1E58A 2H07A 4LVCA 4D9GA 3TK1A 1B00A 3W78A 4LJKA 5JQGA 1MP0A 2FE1A 2FMUA 4OB8A 5GONB 2RBKA 2EWMA 2XTMA 1CNEA 3ABRB 3PL1A 3KJHA 4WEQA 4RW0A 4DK1A 3IDQA 5BY2A 3TRKA 3W8EA 5K3FA 2HJFC 1MX9A 2LCFA 2Q3BA 2ZUSA 3K4QA 3PL5A 4OV6B 2W6JD 3UWDA 3G02A 5LC1A 2AE1A 1J0XO 3N5CA 3KPYA 3ZVRA 2ZT6A 1X42A 4BKRA 4N76A 9MHTA 1Q74A 5TQJA 2OBMA 3ABTA 3STTA 1ZBDA 3BFRA 2DLDA 1VTKA 3D4BA 2ZUWA 5FHQA 4PZAA 3QTBA 2PT5A 4GBMA 1GN3A 1R0XA 3PDCA 4YK7A 5C5CA 1OFGA 5JU6A 4N48A 5CBKA 4LYYA 1O6ZA 5HILA 3H01A 1JS1X 4L4UA 2CHVA 3IJEB 3MMZA 1VM6A 4NNPA 4P83A 3NTOA 3LUFA 4E14A 5GTHZ 1QH1B 1QHTA 2A30A 2WIBA 4DUYO 1EFKA 1ISMA 1V5EA 1P31A 4OVKA 1VL1A 3FPSA 3OTIA 4GL4A 3K9SA 3AF0A 3SQDA 4FWTA 1SZTA 1EX9A 2YRFA 3E1SA 3S0JA 4RLHA 3T1OA 2IL1A 4GL2A 4IR7A 4O29A 1VE6A 3HCRA 3L8MA 1RC1A 4KV9A 4EW2A 4W4LA 5FPRA 3KJNA 4N03A 1G6KA 4G5GA 4JS0A 1E0KA 2DG2A 5CEEA 1BJRE 2GX6A 3AG6A 1K3FA 2NUAB 4PJ0Z 1UIMA 2VF2A 1IY8A 3DL4A 3HBAA 4WESB 1YU6A 3PKIA 5BT8A 1RI4A 2ZB8A 3OUSA 3I76A 4J9YB 3UJ6A 3A9CA 1P17A 2HF7A 5BNTA 4HDNB 2XMBA 2UXBO 4IDOA 1TU4A 3GH1A 4R8KA 1XVLA 3WIBA 4U7NA 3KCXA 2XUJA 4A82A 1L5QA 2XTAA 1IWPB 4LE2A 3LBAA 4HQRA 2OCPA 4Z3DA 1GA4A 1OR8A 4DEYA 4LYGA 2R0QC 1F0PA 2Z58A 2Q2NA 1EB8A 1VLJA 1VSTA 4GFDA 2OPBA 5EP3A 5JIBA 1R2QA 5JBNA 2JJ1A 1GNRA 5AVUA 3OT1B 1OCCC 5KWJA 1EFPB 4B6PA 1R64A 4OGFA 1PTKA 3HSSA 2AQIA 4RANA 3ME5A 3R5TA 4BQNA 2F9MA 2PKEA 2AUMA 2E49A 3H5VA 1L7BA 3STWA 4XWGA 4NBTA 4I4TB 4XUCA 2IHVA 4D4JA 4E5NA 2FHSA 2WK1A 1I0IA 3H2JA 4DTIA 2IDMA 2NUPA 1KYVA 5JNRA 2GAIA 3BXPA 3PFWO 5EG5A 3E81A 3N2GA 1JSCA 5K2OA 5AVSA 4H1WA 1NWCA 1CDEA 2VHYA 1CQZA 1Y3BE 3MTDA 1ISPA 5I9MA 2NUTA 4BJ5A 4DC9A 5KVCA 1TXGA 1KB9F 1QHGA 5DBEX 4BAGA 2XGMA 3MAJA 1T4GA 2IEIA 3C1TA 3GLTA 3TLKA 2CTRA 2C0CA 3ZH9B 1EXNA 5CHYA 4EYKA 3IA2A 3CH4B 3DBRB 4UU0A 4RF4A 3U48A 2X40A 3PXAA 2VBCA 1TVKA 2V3WA 5IAKA 2XNCA 3JALB 2FDXA 4G41A 1V48A 3IUJA 1V47A 2FUG1 4ZJYA 4Q34A 3OKPA 1T13A 1I3MA 2BPOA 1EJ2A 3A9RA 1SD1A 2V1DA 2X8WA 3KYIB 4BQIA 5JFTA 1NQTA 4M21A 3W5IA 4BYGA 3IQGX 2CT8A 1RHJA 2CLKB 1LJLA 1QFMA 2H4FA 3OCYA 3RIXA 4F96A 4ZDIA 3JQGB 4HQNA 2R8XA 4N01A 5FUMA 1BQ3A 1A96A 3AEZA 3U4AA 3KR0A 4NHOA 1PVOA 1RAHA 1XQ6A 1DQNA 4LVOA 2XUZA 3W5UA 2C9OA 1HNXO 2XZPA 2CD7A 5IDYA 3BE4A 4PPQA 4CC5A 1E59A 1Z16A 1RABA 2PQ6A 5T57A 4BTEA 4YAOA 1JQJC 5EJ2A 1E5QA 3A6KA 3B82A 3P9YA 3U6BA 2RH5A 2PY6A 4PV7A 5HIAA 1JDNA 1NNLA 4D2IA 1T0JB 4PAQA 3VHRA 4C0XA 1YT5A 4YJ3F 5EN4A 1Q84A 2I6UA 1GD1O 3L7IA 4GGOA 1XRRA 2H5JA 2BEKA 4Z1MA 1NATA 2DAPA 4AMVA 4KE6A 1CY4A 3I12A 2QYOA 3WS7A 8ABPA 4BW9A 4RL6A 2GAOA 4EOGA 1Y76A 3UAXA 521PA 3IO5A 3L8CA 4X64O 1ZZEA 2WM9B 3C3BA 5A4IS 2O8EB 3LI2A 1KO1A 2BI4A 3MFQA 3FOEC 3N2KB 3EQZA 3Q11A 4YRFA 3BWMA 1ZK1A 3FJOA 1L7VC 2OGUA 1HY3A 5FI3A 4JLWA 3KZNA 4AQ7A 3E4CA 4Y2YA 5IWAB 4DNOA 4KAJA 3E22B 1FX1A 1AO0A 1BU8A 3JQBC 4S1TA 1TQ8A 1PTJC 4UUAA 5ELMA 2HU2A 2BH9A 1DCMA 2OA0A 1EVKA 2V4UA 3OCUA 4X7PA 4YY3B 1UOEA 2G1JA 2BHLA 4R6WA 4AMBA 1G5FA 4PD4F 1DG1G 1YAHA 4QRIA 1QU7A 1FDIA 2WTXA 4UCXA 4E31A 4BY9E 1V26A 4D02A 3FWYA 4O5AA 3DMFA 1JHMA 1PWHA 2FWMX 4TQ9A 4F12A 2QQEA 1SUSA 2R9IA 3LNCA 3TXXA 3LYHA 2PY5A 1WDMA 4S1PA 1I51A 2NU7B 2OENG 5KB3A 1UF9A 3N0XA 4EF5A 3U9SA 2CBZA 3G49A 1L6RA 1L0BA 1SUAA 1OZFA 3G80A 3NBZC 3PRHA 2ICAA 2ZYWX 3ORRA 3TBKA 1ZJ5A 2PGAA 3OE4A 3MJDA 1IMJA 2PXHA 1O2DA 3LBNA 4G97A 4HQKA 4FGLA 4RKWA 4RYDA 1CE8A 3O4RA 2X2OA 5DCYA 4EHDA 2JHGA 5JXWA 2XNKA 1QTIA 1EMDA 1W8DA 2O2DA 4IX1A 2J07A 3DXFA 1E4YA 4A23A 1O94D 4J49A 2W2KB 1J56A 3DKKA 3UJDA 1R18A 5CLJA 3T9EA 2OWDA 2I1QA 2JGDA 1VB5A 3S68A 3UENA 3OZDA 5ALRA 5B1EA 5IM4F 2EJ7A 3K08A 2FQXA 4EY8A 1VG9B 4EYQA 4JUCA 3ZU5A 1WG8A 2BR3A 1MB0A 3HBMA 3PNVA 4V24A 3GARA 3K9HA 1WAZA 4ZD6A 4RFSA 3DS8A 3WKAA 2O2JA 2QI9F 4EG6A 5G3ZA 3DO8A 2QE7D 3E84A 3WKDA 3N8GA 2JDIA 4TWBA 4YN3A 5FCDA 3VO8A 3AVTA 3PQCA 4OLFA 1UXJA 4XDKA 2GF2A 2QD3A 1SBYA 3DHVA 3F7OA 3PLRA 4D4GA 2FEOA 1P0CA 1QV7A 5A3VA 5AOCA 3ELBA 1L1RA 1JWAB 2WMDA 1FXSA 1W96A 2FWPA 2V7VA 3CUWA 2ZRGA 4UTOA 5DMHA 4LE0A 2H7VA 3JCUZ 2CLLB 3EF0A 4ZALA 1Q17A 3ZD9A 1BEEA 3ZCQA 2XYHA 5AUPB 3KT0A 4CCAA 1S7GA 1D1TA 1UBTS 3CUKA 4B7KA 2D0PB 4PCLA 2P5YA 1JIJA 1XP8A 5E6RA 3T0GA 4DR5O 1CHDA 3ZIDA 4LHEA 4AM8A 4EFDA 3JQDA 5IC5A 5FOWA 1J23A 1FK8A 1A4UA 3RADC 1GL9B 3FDJA 3B52X 4IW3B 3WV5A 3HNRA 2F8LA 1EFRG 2IYYA 4A5SA 5KNCA 3OUZA 2Z98A 3PE6A 2BYTA 4KE8A 1FAFA 2BP7B 1BDIA 4LXUA 1EE9A 1YQWA 2P3OA 1KUQA 2VOEA 1Q0LA 2BEUB 3MS2A 1QNFA 1ISGA 3NHYA 4JC0A 1V1RB 4JR0A 3ROMA 3IHWA 3JYHA 5IUKC 3UV3A 3JVVA 1XTUA 2H51A 2ETVA 3HZZA 4YBZA 3SGLA 3SICE 4N0EA 4OXSA 2R84A 3ZK9A 2B5OA 2E6UX 1V55B 2Y1CA 1IWBB 3I64A 5EXXA 4R6ZA 2NQ8A 3AR6A 4PPFA 4WOCA 1DFHA 3C3TA 1VMDA 3ZMUA 4FK5C 1BS1A 3GG9A 3WAKA 4INAA 4PQYA 4F3NA 5L3QA 2HHCA 3A6DA 3DZBA 4K2AA 3HXMA 2BFBA 4OFZA 2EATA 3AJEA 3B5IA 3TTYA 3AOGA 2B7CA 1ZIDA 3O9VA 1PPJH 3PJFA 2VZ0A 1IX9A 2OHJA 4Z4CA 3QELA 4PGFA 4G86A 1XJ5A 4YCSA 3HUDA 2R2AA 4D26A 1NKSA 4PXSA 1SC1A 3G13A 2C3UA 2VHZA 4G2TA 2H0AA 2GNOA 2JGRA 1E3WB 4BNNA 3ZDCA 2O3JA 1UFOA 2CB0A 3DE1X 2J9FA 3CE2A 3O4VA 4LMAA 1VFPA 2Q3JA 3HYSA 3DC6A 3I9V6 3LA6A 4R2KA 1KC3A 3IEXA 2HWYA 4JAVA 3R7FA 1ZCJA 3WXMA 2QQFA 1L5SA 3U5TA 5C8YA 4GDMA 1GPAA 2C9ZA 3O8QA 1N1MA 1J8DA 1K7YA 3ZEAA 2JA2A 3R0XA 4GEKA 1GJRA 4LDQA 2I7DA 4PA7A 1DIGA 4YLEA 5D51S 3IKJA 1QORA 3OG9A 2AS0A 3DEHA 5FNVF 1B8OA 2HPVA 2IU6A 2OGTA 3U37A 2GBLC 4PSVA 4HX9A 3JQQA 1E99A 3UKJA 1MUUA 3AG7A 3VDQA 4PELA 4NXMB 5FIUA 4UEOA 5K3CA 2H2FA 1RYMA 4EUKA 2C54A 4HWGA 5JY1A 3GDWA 2PTMA 3RU2A 1C8VB 1ZD4A 2HNKA 1M8JA 2RGUA 4DTCA 1YS9A 4BNTA 3FFTA 1NW9B 2W4QA 2GESA 3OE7G 3H7IA 3C3DA 2P1DA 3N0RA 1LDNA 4GM4A 1KC8W 2AJCA 2WMOB 5HE9A 2XGGA 1TOAA 3GLIB 1Z6ZA 4ZVTA 2PZBA 4MV9A 5F9MA 5TQ0B 1HE5A 4BNDB 2PS3A 3AV3A 3H1EA 1UPTA 5H9CA 1FFTB 4LKRA 2EBFX 4Q4AB 4DA9A 1VQ9V 1PNLA 3CXCU 3CCMV 3CWQA 3JWEA 4YP9A 3WNQA 4DM7A 5B30A 1E63A 2H16A 2G1KA 5EC8A 4QFDA 3DD5A 4H2DA 8ADHA 1I5RA 1JEOA 221PA 1Y6RA 2HMYB 2WWFA 3V4VB 4LK3A 3JSLA 1E6WA 1NXOA 2F9FA 4FDLA 4Y1FA 3DLIA 5FV4A 5HDBB 3ZGZA 1BHJA 2J0QA 4FLWA 2VJMB 3TLJA 5AVJA 1ZXXA 2G40A 4B6GA 2C3PA 4O1IA 3QITA 4DT1A 2BGKA 4HNQA 3HDGA 3BXGA 2CL5A 2JFZA 2W6IG 1AKQA 1M6HA 2INGX 4KFUA 1Y8CA 1L7NA 2ZSHA 3UV6A 4X92A 4B3TB 4MUMA 4DN6A 3PEVA 3SNKA 2YJZA 3CEJA 3E35A 2GA9A 1SRYA 1J5EO 5H8WA 1JG7A 3OIWA 2WDPA 1YB4A 3K03A 1QHXA 4JLDA 5HKLA 1V4VA 3PT5A 1Y6GA 1I9CA 1NJ2A 2ZSKA 4KLNA 2I6GA 4KE7A 2YW2A 3ZZMA 5LA6A 1P2BA 5B5SA 4E4EA 4ACAA 4EPTA 4MS1B 4HNGA 3EXEA 2VWPA 3OPQA 2D2IA 2GCOB 3TLXA 2F8MA 5EEGA 5B5EZ 2UZ1A 2BGRA 4KI0A 3OJOA 3VQYA 3PDIB 4HDMA 4I4CA 4M86A 4E7PA 1H0RA 3F5DA 3OAAD 4UVDA 3N2ZB 2VJBA 3L7MA 1XU4A 1M3SA 2DFVA 2GCNA 2J85A 1GUZA 1UXOA 1ZVMA 3KQPA 4GOLD 4NOKA 3WLLA 2YWGA 3IXLA 4JQZA 4TGLA 2OXCA 1XJ0A 5I7SA 3H0EA 2Q5ZA 2I78A 2BFEA 2X4LA 3UAWA 4EKDA 4EHBA 5A5FA 2ZWIA 2PYJA 3GRYA 3K0AB 2P8JA 3I37X 3FYHA 2DP4E 2G70A 2GTIA 2OBLA 3BHNA 3PXCX 4V0SA 4YDRA 2I4OA 3DZGA 4KOEC 3ON5A 4PC6A 3U4CA 3VVLA 2VZEA 4NLLA 3BEHA 1EG2A 4BAZA 2ZTLA 5A6SB 2HJ9A 1TGOA 4BFTA 3EXIA 2AN1A 5DBHX 4KL1A 3JR7A 3BKWA 4H7JA 1U65A 1AKRA 1F2UB 4HDSA 4NBVA 1Z2CA 4TLDA 3ADBA 3FA2A 3MILA 2W2TA 4H0CA 4Q1DA 3FHLA 1L8AA 3WGLA 4TXMA 4EJFA 2FL4A 2BGMA 2DWDC 1XZNA 4MARA 5JCOA 3HC7A 2ZIXA 1GM9A 3SJCC 2HAEA 3E8HA 1ADBA 2QVCA 3L92A 4L2IB 2A9VA 3W7BA 4GX5A 4YMTA 1H3FA 1L0LH 1MABB 3AUSA 2W2PA 3LF2A 4BO5A 2H92A 3O8DA 2DPLA 2ZVJA 4U4AA 3WJ2A 1MSWD 3K73O 1LU9A 3M5PA 1TLTA 1T9AA 2G76A 3JZFA 3RCBA 5IAAA 3IB3A 3TECE 1E2GA 4QVIA 4FYPA 1CLEA 4DLSA 1LK0A 2VJLA 2OE2A 1GKIA 4O4IF 1Y63A 1ULZA 5THQA 4UE6A 2X2PA 5B57C 2QPAA 2YXHA 3B2EE 1IBLB 5DTEA 2FRVA 1KARA 3TZLA 2IYEA 5B1OA 1L6IA 4CH4A 2CD9A 1P3JA 2OESA 3Q3JB 5F3RA 2NU9A 4B40A 3M1YA 2B25A 2VFAA 4LX8A 3GOHA 4L73A 1NE2A 2ECPA 2ZJOA 4QECA 5J4YA 5M5BA 2WDZA 4L8JA 3DBOB 2AOUB 5KUMA 4KXNA 4YJ2A 1Y3IA 3A4YA 4WZAE 3EIWA 1HYQA 1TPYA 1G66A 2B0CA 3SX2A 4HAMA 2JD0A 1DT3A 2KPOA 2PUWA 3RVPA 3O65A 1R0RE 1Q82W 1CZRA 4JC4A 4JSTA 4ARZB 1T5HX 2H17A 5JZBA 2GZHA 2XNJA 1YGPA 3KTAA 3VYSB 4DSOA 2YJ6A 3VU1A 4BB6A 1BEUB 4JX8A 1XNGA 2GXSA 2Q5CA 1QQAA 4FOSA 4GKKO 1YB6A 2WNSA 3NHJA 2CDYA 1I7LA 3DMHA 2IT1A 5FADA 4QPJA 4QNHB 2AFIE 5TS2A 1NJFA 1PR4A 2JGKA 1Z74A 3EUFA 4KK3A 5JALA 2ZCUA 2H1WA 4J1TC 4KJXA 1WUTA 3AWIA 3QY9A 4H33A 1GPJA 3AXTA 3C3CA 2Q4OA 1E9CA 2DHDA 1ZHHA 4P3XA 3ZLUA 1P61B 2PTHA 2VS0A 3SR4A 5KSPA 5MN4A 2IPLA 4ZYWA 4MVJD 1EUQA 3RF6A 4JH0A 1K1EA 3FJYA 1MD9A 2PZKA 2M1XA 1KFKB 3OZXA 1NOIA 3HE3A 2NU6B 2OLKA 3T7SA 5CMUA 2R70A 2V6FA 4L76A 4MUGA 4PG6A 5G1OA 5L3SA 3AG3C 1Z75A 1PV0A 4IDDA 4IM7A 5BT9A 4ABTA 2J9ZB 4UMFA 3IRUA 3KQSA 4QTYA 5IAJA 3LSTA 4EFLA 1YE5A 1O95A 1CG6A 1Q3KA 5AMXA 2P6MA 4M7RA 4HO1X 1P2TA 1FNDA 1X7DA 3QFCA 3T06B 4ZHQF 1NFRA 3CCCA 2I71A 4REMA 3OY7A 4L0QA 2CHEA 2CK3A 2RGDA 3LKVA 4Q03A 3HKEA 3O2QB 4RD6A 1BDMA 1Q0PA 2QX4A 3JARA 1NR5A 2E5FA 2MSEB 2AOTA 4ZZ3A 1FNCA 1MEEA 2YN0A 4XYEA 1CUFA 1NE7A 2ECKA 4HZUA 2VUSA 3HFSA 4LWPA 1P7ZA 3HI6A 1G4UR 3AEUA 1VKNA 2YIDA 2FRDC 1Z2DA 3FZNA 5TSDA 4RTJA 1YIAA 1L5GB 5CDSA 4OQNA 2ZCJA 2XW6A 1KMHB 5AKGA 4O2AA 1T6YA 4EGCB 1FKAO 4TN1A 3L73H 4GYWA 3DFZA 2XNDA 2JGMA 3ABKC 4LTDA 4W1RA 3R6TA 1DTEA 3HB0A 2FZEA 4JYAB 1BHAA 1R37A 1JV2B 3L05A 3UHOA 3K59A 1W85A 1XIVA 1P1KA 3D36C 1Z4OA 1KKCA 2H1IA 3K2BA 3QSGA 2IIVA 3OPVA 4JTCB 4UM7A 2I34A 1T4DA 3BB1A 2XT6A 5BOVA 3RVNA 1QLHA 4BQOA 4MR9A 1V8ZA 3FWZA 1D8AA 1GRQA 5B2FA 4PYOA 4CG3A 1WEKA 1HDZA 3PHLA 4WFEA 4WLUA 2LDBA 3BE8A 3C1AA 4J0KA 1DAFA 3GCXA 4MGYR 3ZJ5A 4NZPA 1T2DA 2XAUA 2HA4A 4L6AA 3PXDA 5E0OA 1XHFA 2EIXA 4J0FA 1DC5A 5EPUA 1WV1A 5D6NA 4PR3A 1IULA 3ZCTA 2I99A 2CVFA 4GNRA 4TQFA 2N75A 2WWXA 5M04A 4HH0A 4B44A 2VBIA 1I08A 1D0IA 4IZ6A 2B4YA 3SHFA 4MP8A 2DYRB 5AK5A 1N6LA 1I4EB 1WSBA 2M9MA 5TPZA 2H54A 4L0DA 4RK5A 5B3AA 1N0NA 3ASOC 3TW0A 1DPFA 1JXAA 3AR2A 3IJRA 2NVUB 1SK9A 3VDRA 3X1MA 4D3FA 4UM9B 4U2KA 4MVJI 5HZHA 2C4VA 2OWOA 4MW9A 1I6KA 1TCBA 5LP6B 1HR0B 2A57A 3L84A 1GQRA 4X9XA 5KAPA 1WF6A 1W48A 3WB0A 2HU5A 3JYNA 2GN6A 4Z9YA 1EBBA 2JIZA 3CLUC 1SCJA 3FF1A 4KN8A 3IVMA 4TKZA 4JLOA 3AZQA 2P9ZA 1PQYA 4LMRA 2JJ1G 4KCGA 3KLBA 4YAJA 2IF2A 2Y8EA 5JI2E 4CIVA 3JYLA 4QHYA 2V74B 2MU1A 2OXRA 2AV6A 2PR2A 4NV0A 2Q3EA 2PFGA 5CBPB 3GUVA 2YDXA 2RC6A 3IIJA 3O82A 5C4IA 3DBLB 4ZYYA 1HDEA 2EU8A 3FB4A 2WTUA 4JQOA 3ER8A 2ATEA 2Q5FA 4IZOA 3CTPA 4B3FX 3L18A 4E4YA 3LDEA 5HDQA 4EY5A 1P75A 1EIZA 5F76A 4DBLC 4OJMX 3AY6A 4HRVA 1KAHA 2NSDA 2VNIA 1KH2A 1IBRA 3WG9A 4RL4A 5TMEA 4GT1A 3DSRA 3ZQ6A 4XB6B 3V1YA 2CGEA 4DR4B 2LCIA 3OU7A 4H18A 1WNFA 5CXUA 1CS0A 2A5LA 5FOTA 2A94A 3CZRA 3OX1A 1QV6A 3ZVMA 2E48A 1WD7A 2QTTA 3W8RA 4KR2A 4ZOLB 1RHUA 1P2VA 2AFIB 4CLHA 3UPTA 4Z3OA 4UFZA 1HDCA 4JF3A 2PBZA 2P4HX 3EXHA 4YHBA 4YV0A 5M29A 3DZHA 5JH7A 4WXRA 4MKFA 1CTQA 4GIBA 2HCFA 2XRFA 2X7XA 4G5OA 4EB8A 1LDEA 2XSZA 4V0NA 4XCXA 1G20A 1QWOA 3OKAA 4LF4O 4BAYA 1K5GA 5A5GA 3R5FA 4F4LA 1Y1SA 3LL4A 4D3ZA 3GXOA 5BQ3A 4XQCA 5JS7A 5TMPA 4TWIA 3SZ3A 1JFSA 4LRYA 4KTTE 3OY2A 1YB5A 4RLSA 1XK7A 1HV8A 4ZI7B 3UPUA 1US6A 2OR3A 3OUFA 3DE3X 4LRTB 3TLCA 2C8VA 4D9BA 1LQUA 1V11B 4RS4A 4IP0A 1YJCA 4PICA 3QTLA 4I7EA 5EZ6B 3H5TA 4C6HA 4F86A 5LQMA 1Y82A 3GDFA 3LDUA 1IM5A 3O8LA 1Z8HA 3BFVA 4C4SA 2VP0A 3BZUA 3L49A 1WD5A 2ST1A 2C4WA 3A14A 3RF7A 2XUGA 2F1IA 1MO2A 2QRPA 2Q0OC 1GITA 2E2WA 4ARAA 4NTXA 2O05A 2QTCA 3P2OA 1QH1A 3HY4A 1UFKA 2AOXA 1E7QA 1P6UA 1R6AA 1JJOA 2D5AA 2F3RA 2P4UA 5F2KA 3X44A 4LNAA 1ZI6A 1C30B 3T4XA 5EOVA 1V16B 1VDMA 3IIMA 4C3UA 1BHBA 5KO2A 2OZVA 3E3MA 3VR5D 2UVDA 1PBTA 3G1TA 4WK6A 4JVNA 1YD7A 3DF9A 4IKEA 4K6CA 3TEFA 5C8DA 5TT1A 1FUKA 3EHBB 2D1QA 4K9PA 5IKEA 4ND1A 2YZNA 3U7JA 5K0JA 3RRYA 1WBBA 2NVOA 4NTZA 5ALUA 3S1LA 2VEOA 2BMFA 2Q1UA 3R7SA 1Z4IA 5HCIA 4TRNA 4NU6A 1R0SA 3PWTA 4MV8A 1QG4A 1Q12A 4B46A 1UMCB 3B7PA 5IU6A 1EGAA 1WLYA 4PZ0A 3R9XB 3GLQA 3LHSA 4I4TF 1GN6A 1GPKA 4JB0A 4ECEA 5COAA 3GI1A 2XTZA 3CWBH 1JU9A 1R0LA 3PJSK 3T1VA 1U0GA 4QFMA 2YMQA 2ODBA 1GM8A 3OJXA 4C1BA 2OK7A 3NV7A 3OPYB 4G4GA 4P0QB 4KHPO 1O54A 2QB5A 4L5BA 4X60A 3TPCA 1S7CA 4WUVA 1AS2A 4TMYA 4REQB 2Z3WA 3SP1A 5BXZA 2PI5A 1OPRA 1VYUA 4NOLA 5AUQA 2XAHA 2HNBA 2PMDA 1Q0ZA 1E79D 3LX4A 4E2LA 1U99A 3AEIA 4MW3A 1ZVVA 3AG1C 4ZREA 3V32A 1H2YA 3SC3A 5CTAA 1A72A 1SKQA 3K2IA 1ZL0A 4I2NA 3WI7A 1E2IA 3AL0C 5LUAA 3A6HA 3ZS8A 1HYEA 3KQTA 1GGKA 1M0SA 4CH5A 1G5TA 2XOEA 5AW7A 4K9NA 4GUDA 1TO2E 2V7WA 4U2FA 1U9IC 1V11A 5JCPA 2J41A 1Z56C 3E5MA 3PHCA 3MYYA 5ALYA 1TZMA 2IM9A 2IF0A 4IV8A 5E3HA 4YRZA 1HL7A 5F64A 1BDHA 1RYYA 4DV2O 2EG9A 4ZGGA 2JI7A 1ROPA 2WNHA 2QTVA 3D7LA 1JHAA 3H8JA 2BOCC 1H4SA 4HAOA 4LSZA 3V2IA 4CKEA 1JCHA 2OXFA 1NVXQ 3IVRA 3ZZ0A 4K0KB 2LRHA 2C29D 2D1TA 1SUBA 3A1CA 1B2LA 3WO1A 2JVKA 3ZN2A 1JR3D 3DSQA 3A2MA 3K4PA 4QLBA 5CT6A 3EFOA 4JOSA 2W6MA 3I4CA 1A0OA 1U9CA 2JEOA 1WV0A 2PKYX 3WICA 1V16A 2A3RA 1N9GB 3W5SA 4TRMA 2KI5A 4A91A 2COUA 1QH8B 3GMDA 1Y1TA 4GLXA 1RZUA 2WJGA 3SF8B 3JY6A 3H17A 1GG8A 3HM9A 2GD1O 2JAPA 1EI9A 1ZNYA 5GV7A 2O57A 1FTYA 4ANFA 4EG7A 1QANA 1G7SA 3USES 4HXYA 3WWZA 2NR5A 3PGMA 5F2VO 2YWXA 2QW0X 4AJKA 1KH1A 2GAJA 2AC4A 3OLQA 4QUJA 4RNCA 3BQNB 2O8NA 9ABPA 3RJMA 3PUZA 1R6DA 3OZCA 4H3KB 2FEPA 4QXRA 2BTQB 3CUTA 4GQBA 2WD8A 4OBEA 3MWDA 2ZW9A 3KTFA 5DULA 5BRAA 5CCDA 2O14A 2WB4A 1VMEA 3WAGA 3U7IA 1Y3AA 2H4ZA 4U3JB 1V7ZA 4NZOA 4DVGA 3LK6A 3IKTA 1UMKA 3L70H 2ZJBA 3GFSA 3JQ8A 4JPRA 1K9SA 1NL3A 3LUPA 3EN0A 3CNLA 1X7YA 4CQJA 2WWWA 4YQZA 4JB3A 1BQ4A 4AFNA 1FPMA 1KVTA 3M6UA 4KXRA 2O23A 1DRWA 4JKIA 4UBLA 1UQRA 3DMNA 3HDJA 4W1QA 2AG8A 5ECWA 2Q45A 3V2HA 1PGOA 4J0EA 4A7PA 1U7UA 3GPLA 2UUBB 2B8NA 1RCFA 2NN3C 1JQAA 2D00A 3CUYA 1PW7A 1WZUA 2GCPA 2I1LA 1U0OC 2ACVA 4EL0A 2QYSA 4NDAA 2PXCA 1I1QB 1UPUA 3UYLA 1GK9A 4YAKA 1VKOA 4J2OA 3FZQA 1IEXA 1ZJYA 4CKEB 1NMZA 4Q12A 2PZEA 2ORWA 3EC7A 3KRTA 3WK9A 4LBWA 2JVDA 3W3AA 2OD2A 4O02B 1BFUA 3RW0A 3DXYA 3VX4A 1L9XA 2IE8A 3H8SA 3ML1A 4C05A 1QHHB 3JWIA 2KYRA 4N23A 3DC7A 1ETUA 1Q0UA 3B7WA 3W6PA 4ZOCA 1K6JA 4B7ZA 1RAAA 5F35A 3ZWCA 4LFAB 5KYWB 1ZY2A 4KVFA 1ZM7A 3EAGA 2HCTA 2O8FA 1HXHA 1VHTA 2E4UA 3ROGA 3CMCO 4UVBA 1J09A 1H8EA 1ESDA 1UBRS 3H4VA 2RMKB 4ZHSA 1IZ8A 3QFTA 3SYRA 3A36A 4ND6A 1VSQA 3CMAV 1K4KA 2GTPA 3FZYA 3GLFB 1SHLA 2B6HA 2NXWA 1KS2A 3FVRA 1SVLA 3HCNA 4G1EB 4J6FA 4O25A 3FCUB 4XYBA 4BUJA 2Q5HA 1V5IA 2TMYA 3DDHA 3L0BA 3LZ6A 4U6QA 1BRTA 2VJAA 3HWX1 3JQAD 4ICIA 3UB4A 4C07A 1QP0A 1A4IA 1GPWB 4PC7A 4OHKA 4UCVA 4ZEWA 3KEGA 4L28A 2I7XA 3A05A 4JEHA 1ZLXA 4AJ4A 4M8NE 1VLQA 4F5YA 4L07A 2HBRA 3UQZA 1YF3A 1BCSA 4L8YA 5THKA 3DB1A 5IP5A 4J94A 1KZYC 1T1RA 2W83A 4Y6PA 3ZD6A 1HR0O 1JMVA 1EGMB 1N6IA 3J81A 3OLXA 1NJ1A 1RPAA 3DOJA 4UHKA 2YWCA 3WP1B 4BFCA 5JSFA 3OHSX 2ZJAA 4K03A 3LWNA 3FMIA 1I32A 1U8EA 3IR6A 2OFWA 1UL1X 4DJTA 2CXQA 4DWOA 4EGJA 3K57A 2X8AA 5DLYA 1A9RA 3LO5A 4WK4B 3TLGA 5HUQA 3K9WA 1C3VA 2PCLA 1SB8A 1HQKA 5KCMA 3UWOA 1X7XA 2ZSBA 3DL7A 3THYB 2WPDA 2AKAB 2MJLA 4WKGA 4HBZA 4J3NA 1ODIA 5H4GA 5K4GA 3QTCA 1QHSA 4Q6BA 4YMIA 4C88A 3I9OA 4TTAA 2YSUB 4W6QA 5F21A 1W36D 4HWRA 1GP2A 1RCTE 5ADWA 1IE3A 1E3QA 4CKBA 2ABWA 5BWOA 1XLWA 5JC8A 4DLUA 1EA5A 5JANA 1NM5C 1Y3CE 1EP2B 1U0SY 3PTLA 3RUDA 1KFCB 2PX8A 2PI4A 1TZCA 1E9DA 2WLMA 3Q2OA 4RQAA 4UHCA 2Q3LA 4FPXA 1WQ4A 1YDEA 4R51A 3FMGA 1X77A 1IURA 1SOMA 2IYAA 4J0DA 2RH8A 2YQ5A 4K35A 1LV7A 3UVEA 2FXIA 2VQ6A 3RBXA 5HF8A 2KQUA 1XZHA 3GLFA 1HEIA 1FP7A 1BWQA 2O07A 5BWLA 5EXSA 3T4EA 1NBMD 4OPHA 2FR8A 1D4OA 4Q05A 3GW8A 4U00A 1T25A 3PP8A 3Q7QA 4OHRA 3VC7A 4M89A 1V6SA 3CNOA 1T9KA 4FYVA 4BKQA 3VOUA 2WM8A 1PNVA 1UEXC 5ARDA 4UUMA 1SN7A 4L51A 3IKVA 5K3SA 1QLNA 4J7ZA 1H2NA 1SZJG 3B13B 4YASA 2VLIA 2XWJI 3D7RA 3LDAA 4J10A 1SXJA 2W8BB 2PT7A 4L5IA 3TOXA 4URUR 5L3BA 2C5EA 1H2SB 5KQLA 2PA3A 1WB6A 2H7XA 1GGVA 4OHYA 1T8PA 2X58A 2Y9PB 2BUBA 3THSA 3SPIA 3R0VA 4G1BA 1FFDA 2X19A 3G1UA 4JBNA 4AC9A 4OJYA 1I3NA 1W52X 4JYYA 2G63A 2JB9A 3RN4A 1A69A 5G1PA 1QTRA 1KR5A 1VP3A 4WL0A 5TDHA 5MHTA 4ER5A 1XDSA 4E88A 1N8RW 1ZI8A 1C9NA 4DF3A 1DCKA 4BN4A 1P7PA 2B9ZA 3THRA 2XVXA 1G9XA 1DO0A 3ILHA 4MGIR 3U4IA 3QUBA 2O1XA 3K0BA 3QVOA 3R1IA 4EG5A 2EQBA 1XELA 4YCJA 3U10A 3DAGA 3CRMA 3FB7C 3HA7A 1L8LA 1UBMS 2Z1DA 4MZDA 4NYMQ 4BVFA 4WESA 3ZCCA 2OCCC 2X5NA 4NU0A 4YQEA 3W06A 4EKYA 2XV1A 1OIWA 5B36A 2XE4A 1AX9A 4J16C 1FXHA 1XZCA 2IXFA 3GAAA 5SYMA 1Z63A 1OV6A 3EGDA 4YECA 1JTVA 2FZWA 3ABSB 1SXJC 1Z0DA 3PC3A 4BX2A 1RI2A 2O0LA 3LC0A 2NT3A 4YS6A 3CVYA 2ZJ4A 1HT1E 2EIHA 2HGZA 4RKYA 4UHDA 4UHHA 4C4AA 1RM4A 5E6RB 2CGNA 3E2MA 1NJ8A 4LPSA 3B6ZA 6ADHA 2WZBA 1BQEA 2B5UA 1DWOA 3QG5A 1A2QA 2PKWA 1L1QA 2MSKA 1W0JG 1DIRA 4BNDA 3UTDA 1V9LA 3L1IA 5ERYA 2G4CA 3OLVA 3WK7A 5EXTA 3KXLA 2RH9B 4ZA2A 2B4QA 4RH0A 1Y6JA 4WKCA 2ORED 3MELA 1JECA 5JXGA 1ZQ9A 3CONA 1GFZA 3C6ZA 4RESA 4AVYA 5L6LB 4FYIA 4IIHA 2NV6A 4ZVRA 2E3JA 2X6RA 5E4JA 3S8MA 5J4VA 3D6HA 4G37A 4N1AA 4QPNA 4TLMB 2OVFA 1V8BA 2WSMA 4JLAA 5FOXA 1ISSA 3WL8A 5TARA 3V1TC 3A37A 4ZT5A 4DT1B 5KREA 2IIQA 1D8TA 4FP9A 1VBNA 1EFLA 3ORYA 4K81B 3AIOA 3CJQA 5B7QA 2P9JA 3I5XA 4F4DA 4B2LA 2IJHA 1IHYA 4IMPA 1U0HC 4UVEA 3DMGA 1P2FA 3C3KA 1R0KA 4YP1A 1UP7A 5JECA 2P9FA 1MC1A 3DDUA 5JZOA 5KPJA 3NORA 1B16A 5KNCH 2WJYA 3H1BA 2IS4A 4TYWA 1N2CA 1A95A 1HLDA 3CZ5A 4HX2A 2YRXA 4EBFA 1ABBA 1D2EA 1M75A 3E18A 1M7HA 2Q41A 2RGNC 2ORYA 4B3HA 1AP5A 3C4VA 4P54A 3SJCA 4NXNB 7REQA 3A27A 3EXEB 1KY2A 4HB3A 4YMGA 1B8PA 1RYDA 4ZCTA 4IUYA 3DGFC 1DAOA 4AY2A 3ETEA 1VQNV 1VPVA 5GADl 1OPXA 1JHZA 2BY4A 2X8LA 3NWEA 4MLDA 2Q4RA 4WK2B 5KDDA 1KOGA 5J4LA 5E7MA 5B6PA 4AMUA 1PWEA 4WCEV 4B84A 4JX9A 5JNSA 1Z62A 4MDEA 3JATB 1LBSA 4B2PA 5ECYA 2BFDA 2X0DA 4BV9A 2XUKA 5FPTA 1CDZA 4H4EA 4LGYA 2R48A 2YZMA 2FSSA 1PJTA 4UVHA 1RXCA 5JH7F 1UM9A 1THMA 1UBOS 4MIEA 4ENVA 1ZITA 1T9HA 2VHCA 4AJ9A 5KINB 1UKZA 4J42A 3QOWA 1XQ1A 3E3AA 1AQYA 1E6MA 2P40A 1WHTB 3EMKA 4JI3B 3ETJA 3QLTA 2WY2D 2O8CA 1A5TA 1KF0A 2A2ZA 2DJ5A 5T67A 3D4LA 1EWKA 2WAOA 5KNBH 4V1CA 1T5IA 4QOJA 3IO3A 4BRSA 5I6DA 3GEMA 1CF9A 1VCNA 3DFKA 4N8EA 1L4EA 4WKNA 1I1OA 1K8ZB 2O50A 4WK0B 3DLHA 2VPXA 1UPAA 2Y0DA 3HZHA 4JSYA 4W1SA 4G0VA 4GLBA 1ZESA 1SEPA 1AGXA 4BRUA 3ZGXA 4QBGB 1NZDA 1J24A 3AP3A 3AG4B 3K9LA 4JLJA 4JYPA 3EJ6A 2B4TO 2I3ZA 4PBSA 5AXAA 3VTKA 4XASA 1PX0A 3N1UA 1I7QB 3NR7A 1AURA 1Q6YA 1EGQA 1QFJA 4DMRA 3BHJA 1IHPA 2FB9A 1ZGGA 3D59A 3U40A 3WK4A 4D92A 1VQLV 1T0BA 3TSZA 1S1CA 5ALWA 1YR7A 4E09A 3EFFK 3QE4A 1HO3A 4LFCO 1W75A 2BGUA 1ECFA 4IO1A 2Q5IA 4WACA 3OZSA 3OZVA 3WSTA 1V2GA 1Q1ZA 4GPEA 3C1UA 3PCTA 5KTRA 3IUYA 4OX9O 2X5KO 2XD9A 4HB4A 4FM9A 4WJZA 4BEJA 4CCYA 1SXQA 1B26A 2C2GA 1FNSA 1CJTC 4LGCA 5ITWA 1AI5A 4PZLA 5AVZA 4RHUA 4K2HA 3RFXA 1TECE 2PKQO 3KKYA 3HA3A 1UQTA 3TDNA 2GBCA 4RLQA 2IH1C 1XZ8A 3T61A 3LWZA 4BP1A 4JVLA 1X86B 4EFMA 3R77A 3T12A 3HJRA 3WLIA 4F3TA 3B3GA 1E2PA 1JQBA 4KWIA 3AF3A 5FPSA 5IEJA 1IDN1 4L6CA 4M2LA 4EVRA 2VDOB 1PR5A 4CM9A 2RAFA 4PA3A 1GZ3A 2C61A 3H16A 3B1XA 1N4CA 3IJPA 1O4VA 1OTYA 2PV0A 4HEQA 2B1QA 4P3NA 3RBVA 4J1NA 4K6HA 1GFIA 1EWTA 2VDPB 3S8EA 2RC5A 1HL3A 1R50A 1N5LA 4JV5B 3UT5A 1ND6A 3KIPA 3H8VA 2PGDA 1IY0A 2H06A 5JDIC 1P60A 1FFXB 2PJRA 1V54B 4UC0A 4RKQA 2D62A 4Y9RA 1WAMA 2FA9A 3O90A 4V3BA 2I5PO 2YHIB 5AI5A 1WN7A 4TT3G 3KOOA 4FFNA 5EWMA 3WNZA 1ZI9A 2YV2A 1PVDA 1DQYA 3ZJYA 2J0UA 4E3ZA 1TA9A 1NULA 4RBNA 2JW5A 4K8RB 5K4HA 3VPXA 3AVYA 3USCS 2XEDA 1G2IA 3OSZA 4EGAA 2FU5C 1D9ZA 2AUNA 3ZV4A 4KQKA 4MW6A 1UKAA 1XK6A 4GXRA 6GPBA 1F0NA 4UM9D 4YYZA 1K68A 4K1LA 5FJIA 1LEHA 3U7EB 4DDVA 3RTEA 5A5DA 3IUQA 2WJ3A 5KYXA 2O6HA 3CR8A 3HYNA 1KDYA 3M7IA 5FWNA 2ZI4A 5K3AA 3B36A 4B5KA 2H0RA 3LJKA 4M1TA 3C70A 3G8CA 4X3CA 4IAOA 1ADYA 2XLBA 2Q62A 1CRLA 4M3NA 2EXXA 3H6KA 3TQIA 3PENA 4K9SA 5EVCA 3ZG6A 2IXTA 2FZGA 5CT5A 4JU8A 1M2NA 3WK8A 3GN1A 2NZWA 1NOJA 3PC8A 3HB3B 3IUNA 3SZMA 2VSXA 2GJ4A 1EXMA 4CM3A 3LQ1A 4Y2XA 5HCNA 5CNMA 2W6PA 3ZCXA 3DFUA 4OAPA 3K58A 3H3JA 1QCCA 2QM7A 3HFGA 4P98A 5DGHA 2GEVA 3EEBA 4O0LA 1BIFA 5IVDA 1KBZA 1GKKA 1MA0A 2C94A 3QLUA 5JXJA 4P58A 4HSGA 3PQEA 1H65A 3VC3A 4GKBA 4DCPA 1NSFA 1ZUIA 2G1PA 3FMOB 1OJ7A 3KD3A 2H00A 4FKMA 3UCXA 5DGDA 4OQEA 1K33A 1FU8A 3LUDA 1DHTA 5T41A 5FBRB 1N4AA 1LSUA 1PK7A 3E6AA 2WMNB 2ZRPA 5FUWA 1MQSA 4KKVA 1VQ8V 5H80A 1YZHA 3D02A 5KWSA 2DERA 2X1LA 1TYCA 4B3MB 2DQ0A 1F6WA 2HQBA 3C1OA 4KWEA 4A2QA 2IYSA 4AKIA 4IIJA 1FRVA 1PT7A 2AQHA 4IBOA 4OSPA 5E2IA 4UZEA 3UQ8A 2NVUA 2HRQA 2FAXA 1UBGA 2V7QD 4FFVA 1WY7A 1C2YA 2DU8A 4LDAA 1YRHA 2BFFB 1RLUA 1YBHA 3HGMA 3RVDA 3I6IA 3HXQA 3K5MA 1VRCA 5CDFA 3UKMA 2KLHA 4P86A 5KWIA 1J2EA 2FJ0A 4WFIA 4DWJA 4DZRA 4FDVA 3SNHA 4URWR 3R7WA 3X1YA 4RY2A 4U9HS 1RACA 3SHWA 1XLUA 3CJHB 1Y1QA 2H5EA 2NADA 3TTTA 3HJTA 4JYMA 4BJHB 1FP6A 2CTPA 4K0KO 2BGTA 3LHDA 2P4VA 2FFAA 2G6TA 3GLSA 4MMYB 2VP5A 4FZJA 2FPKA 5KC8A 1IU9A 2VTBB 3CT4A 4HEJA 1YL5A 2DFPA 1N4DA 2GPAA 3PUVA 5AM3A 4BIUA 3OA2A 3BDIA 5EXEA 4Z4GA 3N59A 1JIUA 4EVSA 2BJVA 1X7WB 4G0PA 1FXVA 1KOFA 1TM7E 4IH9A 4ZANA 4F1JA 3QVJA 4RJLA 2IDKA 3M5CA 1RI3A 3OQNA 2J9YB 5FTKA 4OGQB 1GGJA 1E1QD 2WVAA 3VVBA 5ICSA 4DA8A 3OESA 3VNVA 2BM8A 3HXLA 1OTXA 2LIVA 4H6VA 2DY1A 1N0JA 2L18A 2ZUBA 4U9IS 4EO7A 3P9IA 4IHQA 4XFKA 5SICE 1A9OA 2ZR8A 3MRXA 3TQSA 3WQHA 2N1BA 4LBVA 3H9JA 3WK6A 1X15A 1NV9A 1TF7A 1XPJA 2ZROA 1I3KA 2WG1A 1XCLA 4MKXA 1GMGA 3H13A 3QTTA 4AT1A 4F5WA 1K3TA 3ZDAA 3R2JA 3SY8A 4BVKA 4Y6OA 1N7JA 2X5JO 1FXKA 5CXXA 4DG8A 3PX3A 1WP8A 4BR6A 1YI0A 4NECA 4B4WA 1SXHA 2SNIE 4HZIA 3V8MA 4FLUA 5IUNC 4G9EA 3L8FA 4Q24A 1PFKA 4AY5A 3SHVA 1V8DA 4I50B 1FJGB 4LVUA 2ATXA 4JBGA 3ADCA 1NN3A 3ES9A 4GMKA 1FY2A 5GONF 4ITUA 3ZWAA 2C2OA 5DU2A 3R8CA 4DBVO 1XFDA 4S05A 1UDXA 1ZLZA 2ZR9A 1FA9A 1QMGA 5FEMA 5SZJA 4P4GA 3UM9A 2B7BA 2XBUA 3X2QB 2BFCB 1TZJA 1A32A 4NARA 4BVBA 1MHTA 1G5PA 1GHTA 1Z13A 4RHEA 3JRNA 4MLZA 5FTWA 2XKKA 3H97A 1PR9A 2K4MA 2CNOA 4JIGA 4OY3A 3QV1A 1RP3B 4NENA 1ENPA 1ULTA 1IVNA 2BCGY 3CLSD 3HUFA 3I0MA 5HA5A 3EHEA 2YXBA 2YEVA 3E3LA 4URYR 3LQKA 2GN0A 1YIDA 1VCHA 1HMYA 2GK6A 3VYTB 1KVQA 1R5BA 3VXKA 3BABA 4QFCA 3D6UA 4WVLA 4XB1A 3VX3A 2JCBA 3FKSG 1FXKC 2CHGA 2ZJFA 4B2IA 4MHOA 5DT2A 3W2TA 3L4KA 4OI0A 2WT8A 4B6QA 3AKYA 4L8FA 1PLJA 4DR3B 3SQMA 1E6CA 3F96A 4YCMA 1JEYA 4OBXA 2EJTA 4KO3S 4B4OA 5FTNA 3BZWA 2AR0A 3GHHA 1Z6TA 1M1XB 3GWOA 2CFCA 4EI8A 2IX3A 5ITZB 2ZXWB 2IW1A 2PMKA 2WT4A 2NO1A 5CA1F 1JH9A 3U16A 1KYTA 4JI6O 2Q7DA 2PH1A 2Y1GA 5E4FA 1E2DA 2KSQA 1SAYA 3JASA 2FN9A 1OAOC