5D5PA

Hcgb from methanococcus maripaludis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
157
Chain Sequence
NIENTIKSAYEESLNNARFGDKIEEIDAIQSTIKSAKNVTVATSNEKKFKVVSDIISRITDANISMLEIPTNSADLTRMPALNKGLIAVDSSDADLIITRGRLGIPGSGSLLLIMDKKGRILTGSVSPSSIIHKNPIDKTVELELITALERIGIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards artificial methanogenesis: biosynthesis of the [Fe]-hydrogenase cofactor and characterization of the semi-synthetic hydrogenase.
pubmed doi rcsb
source organism Methanococcus maripaludis (strain s2 / ll)
molecule tags Transferase
molecule keywords HcgB
total genus 46
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5d5pA01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 5d5pA02
3BRCA 3WB0A 2F95B 5JJJB 1VF7A 1EEXB 1EGVB 2D0OB 1H2SB 4GYCB 1IWBB 1UC5B 5JJNB 1IWPB 3AUJB 4DK1A 1NBWB 2F1MA 5D5QA 5D5PA 3WB1A 3LNNA 4DK0A 2V4DA 2F93B 3WB2A 4L8JA 1DIOB 1MMFB 1T5EA 1EGMB 2D0PB 1RSOA 1UC4B 5JJEB
chains in the Genus database with same CATH superfamily
3SIWA 3GUHA 1ZCBA 5F21A 4XQCA 3W1VA 5AVRA 2W11A 2PFGA 3FDFA 4TLLB 4YJ3B 5FOSA 3ZYZA 4DLRA 3NKFA 1JDJA 5CYGA 4LJ4A 1HLGA 3VR3D 4K0KO 4GOKA 2GTSA 1JHDA 2X8WA 2ZFUA 4MP8A 3OX3A 1T9GR 4I9FA 1JHZA 3T3PB 4ITUA 1YF2A 4IHJA 2GDSA 3J81N 5C9ZA 2ST1A 4ZT3A 1UXOA 3QOWA 3FWYA 2H0QA 2GN8A 5L95A 2Y9PB 4WZZA 4D97A 1NYLA 3FGNA 2Q0OC 4NABA 3MIIA 4ED9A 5K8UA 2ZSBA 4AK9A 1OZ0A 1NKTA 1QZXA 2CE4A 3IAS1 4CM7A 4UTNA 2XGOA 2OFFA 2K5UA 4TMZA 5IVPA 4HDMB 2HX1A 4D5GA 4F86A 1RZRA 3ZK7A 2ZRAA 1T2DA 4GLFA 4LSWA 1QHYA 4R1MA 4JI3O 2FPKA 2YZNA 4RPLA 3AG2B 3WQQA 3Q8KA 2XMDA 3DGFC 4QUGA 3TLXA 4Q82A 4Z1OA 1C4KA 2BGUA 2XWSA 5B3JA 5I9IA 3ZJZA 4N21A 5L3BA 1AQNA 3VJLA 4EJ0A 3J80A 4I4LA 1U2DA 3KSRA 4P2GA 1YDWA 1XL6A 4JJAA 4TMXA 1NXPA 4ZVQA 1QYDA 3TOSA 3ZCPA 5KUKA 2GSMB 3ZHSA 4OOFA 4YAOA 1ILWA 1H6BA 3Q6MA 2B3TA 4UUPA 1EK2A 1TCVA 3K9BA 2JLRA 4ESVA 2AKYA 5L3VA 2E4VA 4XM1A 3L0ZA 1W0JA 3LY8A 1PFQA 3AB3A 3DBRA 4J1TC 2EL7A 2CZQA 4FLUA 4R54A 1YQDA 5ICGA 5GINE 4KVAA 1PDOA 4Q4JB 2YMQA 2J48A 4KGZA 4ZYLA 3WZ2A 3AEIA 1MSWD 4ZJYA 2P4UA 3KZVA 1M74A 3NTVA 4P1ZA 3ZWDA 5JQGF 4BC1A 1XDWA 1A76A 2A67A 5K6RA 2HRDA 1H65A 1NOJA 4BCDA 3KKLA 4JI1O 1B73A 2IW3A 2QX4A 2QKCA 3GFPA 3P9KA 1X1EA 4IRXA 4TKUB 4M1YA 5C31A 1QU3A 1CFJA 3N2LA 4FR0A 2G5GX 1N2EA 2HNAA 2R9VA 4FK5C 5EY5B 4ZU1X 3P2IA 4IG9A 3FZEA 5CIYA 3WWDA 1M54A 1P8AA 2D62A 1K6XA 1O6CA 2PA3A 5A5GA 3DL2A 3F96A 1Z5WA 1KU9A 2FMLA 1OFUX 4HKTA 1M56C 1NE2A 3L0IB 4ROSA 4A6PA 5BURA 5LIRA 1B0UA 2BHRA 2A59A 2XIQA 3QX8A 4K05A 5ALLA 3OCCA 2XB2A 3RLIA 4R84A 1T24A 3TTXA 2UZ3A 3QVSA 3FPKA 1CY8A 4MULA 3N8GA 4D0LB 3Q87B 4S1TA 4MVRA 3H13A 2WLSA 3H01A 5LLTA 2PL5A 3N8HA 1G5PA 5JNSA 1QU2A 4PZZA 3IR5A 2DKOA 4DR7B 2ATIA 4HK4A 4ZVOA 4UCUA 3IURA 5LZ4A 2JBAA 2OK8A 1ZM2A 4ZVUA 5CG1A 1DMRA 2O7VA 2AX4A 4KBGA 3BZUA 2J4FA 4JLJA 2V6MA 5FB3A 4C4SA 2CLIB 1H3FA 3EZNA 4RTQA 3UT0A 1ESEA 4DWOA 3X2QB 4WMLA 3GLUA 2EJUA 4XCVA 5LUBA 2PH1A 2Q9AA 4CS3A 3EAFA 3HVKA 2JARA 3A25A 3PHCA 4XSHA 1NW8A 4M8NE 4AG5A 2CDNA 3L6UA 2BUAA 1UMKA 3BWVA 3PZRA 1OFGA 2L0XA 4JI6B 4GYJA 4YCDA 5CEJA 4OF4A 3JXEA 4HFMA 4UARA 2VTBB 3RSZA 1DWOA 2OXFA 2H1HA 2BIFA 3LTEA 2F90A 5TQVA 4U6QA 5CT9A 4EHFA 1SKVA 3I0ZA 3I4LA 3TOXA 1A4IA 3ZHVA 1C4XA 4M21A 1FP4A 5HBRA 1HYBA 4P53A 3P32A 1JLKA 1U96A 3CS5A 4D3XA 1EM1A 5DM4A 3MOIA 2D5AA 5CM9C 1Z4NA 5LMUB 1YMQA 4LZLA 4XGRA 3DZHA 4JYYA 1D1SA 2WZDA 3FI9A 1MAWA 1HH4A 2ZJ3A 4D9NA 4FCVA 5C52B 3KSBC 4DS3A 3HKCA 1USIA 2EG9A 3K53A 5J9FA 3T3GA 4YRIA 1SXQA 3K04A 4G81A 2OE2A 1Z25A 3IR6A 2MMGA 2OG1A 4F38A 4QM7A 1SBYA 3EGIA 3V4FA 4RULA 2VJAA 4XW2A 1CIPA 4Y2TA 4FLZA 1MJHA 5K0GA 5KSYA 3SM3A 3R9XB 1Q1BA 1T5IA 4QPJA 2C78A 5EIAA 4AIRA 1I2CA 1RPOA 2X8AA 2H48A 2ZW9A 3GBVA 4UEJA 3WBBA 3QEBZ 4ZT6A 2PJRA 3WNQA 4R1SA 4J0KA 4MW1A 2QX8A 3RNLA 4BUCA 4DKXA 2Y4UA 2JKYA 2BEWB 4MVSA 2D1SA 3PSHA 4EY7A 1QFSA 3G5LA 2QYOA 3I30X 4PC7A 5HMLA 3UA3A 2E85A 4LZOA 3F6YA 4RY9A 3WP0A 2PYIA 3MZ0A 2PGGA 4JENA 3QPUA 5KYXB 1XEWY 2VP9A 2E5LO 3E3LA 4LDNA 1CKEA 3OZGA 5A3QA 4LHXA 5CLQA 3NBUA 5DYTA 3UMSA 5IT9N 1Z0AA 3GAAA 4RH1A 2XRZA 3PDUA 1XMVA 3I53A 4K9NA 4LPSA 1AGPA 2VH1A 5I5EA 2WI8A 4CS2A 1OH6A 2FTKA 3RG2A 3D7NA 1IDSA 5FL7G 3RGBA 2C4TA 3GZJA 3I72A 4O2AF 3JCUZ 3SCZA 4C1NA 3L7LA 1JEAA 4E5MA 2YZMA 4R2MA 3GLSA 2G1AA 2JZOA 1TJ3A 4Q19A 3EXHC 3SSNA 2LW1A 3H7AA 1QHHA 4JKYA 2UXCO 1HTWA 2BHLA 2OSVA 3KXIA 4DZTA 4JT2A 1KI7A 3EDYA 3K0FA 3UA4A 4EYKA 3OU7A 4L8LA 2IXEA 1WQ1R 4EYEA 2D2EA 3A11A 4US1R 4TROA 2G40A 2XTZA 2IJIA 4N3NA 2R6DA 1M2WA 3Q88A 4QAQA 2C8VA 2ZYWX 3ORRA 4BE4A 2F9FA 4ZFNA 4FBLA 3IAEA 3C3BA 3IAS6 5DVZA 5IY5C 2JGAA 1S1CA 2OWDA 2VJMA 2Y77A 3LCVB 5C0OE 2W2XA 5FLXA 1NAHA 5JXWA 5H9VA 4V02A 3IEUA 1W581 2PUGA 2B25A 1EK5A 1J0AA 1Q84A 2J67A 3KPJA 4L16A 4L4XA 5REQA 1H8HD 3O91A 5BW8A 3K0CC 3AHDA 4H7JA 3K6JA 5ANRB 3SC4A 3UXMA 4CMIA 1B23P 1QX4A 1M2KA 3OY2A 1LZKA 1SHJA 2BGKA 1YIAA 2HPHA 1EB8A 3F7OA 3ASZA 4LNAA 3JAMA 1GG8A 4ZVKA 1KMIZ 3L7IA 4CV1A 1PK8A 4MVJP 4YLYA 2WPDG 1U0JA 4RD6A 5A3RA 3B6EA 3BTOA 3O83A 4RTPA 1X15A 2AYYA 4F04A 2QE7G 1HSOA 1NOIA 1SD2A 1KARA 3MA0A 2H8KA 2AOTA 3DJFA 3ONDA 4E09A 5TJ9A 1G8AA 1XA4A 4N54A 3OPQA 2RGUA 2GRAA 4ZALA 1AN9A 2RHOA 3BHIA 1AZSC 1I7PA 4CIBA 3ZTYA 4JELA 4MNTA 1W0KD 1JLSA 3IV7A 4MX8A 3OQOA 3BRCA 4KFCA 5FPSA 1BA3A 4L9AA 4Z8YA 4BW9A 2AOWA 2G5TA 4JVSB 2V4MA 2PZKA 1CHDA 3IDZA 1PUIA 4RABA 1FJXA 4GGPA 2NO0A 3FGPA 4CIXA 3PFWO 2R2AA 1Q7EA 2JFUA 3N6RA 4OHXA 2X8BA 3K9AA 3HYNA 3K03A 5ALOA 3WGVA 3PRKE 5JCJD 2YMPA 1TZKA 4I55A 3LC7O 1RCFA 3L7CA 1WHSA 4KXYA 3DDZX 3SC2B 3W78A 3H8JA 2ECFA 1WZUA 1WO8A 1R0KA 1WB5A 1MH1A 1LWOA 2ZRHA 2PRSA 1VLZA 1L4YA 1H4VB 1Y8RB 3KE8A 3PCXA 4P4GA 5FFMA 3BE8A 1QHTA 1KEEA 2H7CA 2KKWA 2QQ5A 2OP1A 1GTG1 2K87A 2H16A 1BQZA 2R6FA 1VIYA 1PZGA 2AL7A 4FXOA 4GBJA 5P8WA 2WA3A 4IIGA 3ZS9A 4DCSA 5K0SA 1ZINA 2E2WA 3OZRA 5AD1A 1F0PA 2ZYHA 2IZ5A 2LWIA 3OG9A 1JEYA 4LF8O 2D5LA 3IJPA 1ZOIA 2J30A 4IDOA 4OGLA 3O4FA 4QU8A 4P2ZA 1AI7A 3CXRA 4G25A 4NS1A 2B6NA 1E7SA 3DE3X 5HZMA 1DL5A 1L7MA 3OBBA 8MHTA 2HREA 4QFCA 1HWYA 1VMIA 1DS6A 4YYZA 5I8ZA 2X2FA 3KBBA 3KDSE 1UMBA 2Q1UA 1NZFA 1N0JA 3QKTA 1VKJA 3ZLJA 1KK0A 3DVQX 2OV4A 3LDHA 4NCHA 1XHXA 5BWCA 1JKXA 1ZSNA 2CL6X 2I4LA 2RI1A 2CL0X 4TSFD 5L8VA 1KH2A 1I1HA 1UL1X 1WMDA 4II2A 1P17A 1K7DA 5JAQA 1XDSA 1Z88A 4G5OA 1MOZA 4H15A 2C2HA 4K7JA 3RSCA 4ARCA 1JPVA 3S2SA 2WWRA 1RZUA 3R7DA 2A3NA 2VBIA 3DWIA 6REQA 3RUDA 4I3GA 3UPUA 1MN6A 4J7AA 4REOA 1TPYA 1UKBA 2P9QA 3KJFA 3R4CA 1UFQA 3LT1A 4MT8A 4FLTA 1UMDA 4P36A 2VN8A 2ZIUB 2HRBA 4K6CA 3DG9A 3NS7A 3INNA 4MQEB 1WB4A 3NTRA 3ZE9A 2XCTB 2EWWA 4ROTA 1EX7A 3HEMA 4LFBB 3PLNA 1LV8A 3I83A 3M49A 4BNHA 1FVFA 2YWJA 1L5MA 4HDNA 3C6KA 1JLMA 1H93A 2GYYA 4L3WA 4R50A 3BXFA 4UBNA 4E15A 5H8WA 1GM5A 5H80A 3M6LA 1MOPA 2QRUA 1WF3A 1ZJ5A 3HN2A 4UKDA 4X3PA 3WG7B 5G4KA 4AKHA 1I80A 1RYBA 3VQVA 4G5FA 1JKJB 1NDQA 1UXHA 1N8RW 2G72A 1RM0A 2IW1A 2LO1A 1SA0A 2OCYC 4CLXA 4CQLB 4F4UA 3KD2A 1QRDA 1F0NA 5E6SB 1Q1GA 2OQVA 3GWKC 4BPBA 2ZXWC 4YXFA 3V48A 1FF9A 2IT1A 1VJRA 4INJA 4J7ZA 3OFKA 4WFFA 1KH3A 1MXFA 2FQYA 2QSZA 3CJQA 4M0EA 3C3TA 3QBVA 4F3NA 3DAOA 4D8YA 3ZMSA 3ZDCA 2DJVA 3TQOA 1PR4A 5B3JC 1UFOA 2RK3A 2P27A 2X6RA 3I23A 4WVFA 2A1TS 2ILMA 2O2SA 2ECKA 3JCZA 3LO5A 3GU3A 4LHVA 1RYDA 3TAHA 3V4ZA 4D7TA 2REOA 2RHJA 1R15A 3EWSA 3TBKA 3OPVA 4HMPA 1DBVO 4YJFA 3IPAA 2F3QA 1GZ5A 5KKAA 1BS3A 4L6CA 1P49A 2VG8A 3H86A 4K8XA 4CW7A 1U0NA 1YXMA 1XD9A 4TQUS 1IOZA 4YRNA 1OXXK 4MR8A 4MPTA 4DRXB 2IBTA 3ZWKA 2QP4A 5K0ZA 2P4HX 2P9BA 4JHXA 1O77A 2UUAB 3MBIA 2B36A 5GZ6A 4X90A 3AHCA 4DR6B 2WMOB 3TAXA 4FD2A 5HM6A 5BW5A 2E82A 3VTFA 3E5HA 4Q3NA 2KB0A 1DARA 1SHLA 1IRIA 2FCAA 2MR5A 4UHHA 2IK8A 2PL9A 1CD5A 5EZQA 3OJ0A 4N41A 4K9PA 1KDYA 2WWWA 5KWEA 1TA8A 3ER9A 3Q8MA 2FW6A 4TWAA 5A9RA 2ZPAA 5DTIA 2FL4A 3IB3A 1DK1A 3G7UA 1WDWB 4LRYA 3KO8A 1Y34E 5KWSA 4LQCA 4FFNA 3T5CA 4M99A 1YULA 1O0SA 2D54A 1BOOA 2H1CA 3HC7A 1B0ZA 1XQXA 4UTXA 4ARAA 2VRZA 2WR8A 3WG9A 1HLDA 4IMRA 2VJMB 4X62O 1QR2A 4I5SA 2FWJA 2JB9A 2X5KO 5K20A 2XT9A 3LVBA 4D4HA 2BGGA 1FS0G 1T3GA 2DUUA 1QDLB 2PZFA 4JAVA 4KTVE 3C4VA 4GNKA 1GCGA 1KGSA 2BPOA 3H2KA 3RAEC 3AL2A 3EQ6A 4KQWA 1U7XA 3RREA 3ITEA 3SHWA 4PAOA 1UBNA 4NHOA 2M9MA 4RK7A 3RBAA 4ZDWA 1QE3A 1V4VA 2FUG6 1CUXA 2QD2A 2ZE5A 3LSTA 4EOGA 1C9DB 5LZ8A 3I2JA 3IAXA 5A9GA 1QOZA 1ESZA 3RV4A 2V7QA 3ZHUA 3LRTA 3PHGA 3CRZA 2RBGA 1EB9A 2AOTB 1GPDG 3QVKA 1T5TA 1JXQA 1YZVA 3HG7A 1EGHA 1T25A 3CNQS 3PD7A 2ZVPX 5TPWB 3TZQA 4CL3A 1L4KA 3P19A 3OJFA 4H1HA 2UVDA 5U1PA 2F4NA 3OM9A 1BGVA 2CKMA 2CFRA 2ZAOA 3MXOA 5CVVA 4HLCA 3ZKWA 2XIJA 5AESA 2FZ5A 2O2GA 3MJEA 2HBZA 4U0KA 1CERA 3VKHA 1NNLA 4HSGA 1WVGA 1WVMA 4FNMA 3V7WA 4KQ9A 4TKUA 3CVVA 3W7WA 2EDCA 2IYEA 4JSRA 5FPRA 2QEQA 1BXGA 3COWA 2EZUA 1HFWA 2HA2A 4NKRA 5AKZA 1OR8A 3VZRA 1M3SA 3DBIA 1DSSG 3UT5A 1VKOA 4KHPB 2EC5A 2ZI6A 3GRAA 4GXTA 4R8SA 1XU9A 1RMTA 1E59A 2GNAA 2WKPA 2YOGA 2ZLBA 3QLVC 3UHFA 4LS3A 5FA8A 2C58A 4H27A 5LYJB 3V2HA 2BFOA 4YMUA 4W5QA 2J0SA 4HWRA 4X1KB 1R9JA 1U4SA 4LYAA 2CUNA 3RVSA 3WL4A 3D6TB 1AH2A 3Q7SA 4CDRA 2YFYA 3BX1A 1TVKA 1T4CB 1FXWF 1U9CA 2WVHA 3A3KA 3F8WA 5E79Z 2VQ6A 3OICA 2PPLA 1IK4A 1C80A 5J3JA 4C7UA 5TS2A 2FWBA 4NYMQ 5JJCA 4FW9A 4OA8A 3PE6A 1HNWB 2X86A 4HV4A 1E77A 1WV1A 3KE9A 4Y2UA 4KAXA 4OJNA 4V0LA 5D01A 2Q6AA 5K8LA 1VDMA 3KTAA 2W6NA 1KWKA 1GG9A 1TQ8A 1Y6JA 2C7BA 3D2CA 4MWDA 1ZEMA 5AIAA 2OHFA 4ZHSA 5IW8A 1KRXA 2JJ2G 3L79A 5T4EA 2JVIA 3OZFA 4EY4A 2ZTHA 4GRAA 4KQGA 2Z5UA 1Z45A 4N7BA 4OI4A 1BH2A 3NFRA 1JKIA 5AKYA 4C0BA 1NS1A 2BN4A 3ZNNA 3CLSC 3PC3A 2R7AA 1PNMA 7ABPA 1FXHA 2F1HA 2AMLA 1OYYA 1SOVA 1HNWO 2J9ZB 2HWXA 1DP4A 3L4SO 4MR9A 2FG6C 3VR5A 2W4IA 4ZI7F 2C61A 1VF6A 4FZ5A 4CDGA 5GP1A 4AWBA 2IEDA 5TISZ 4WN3A 5I9SA 3AM4A 2FMHA 3BORA 1Y42X 3R09A 5C80A 1TAGA 5CDHA 3VVMA 5HUHA 2GF0A 1BH6A 4KUMA 5F64A 1TMOA 1TA4A 3HUUA 5KWJA 1WP4A 1KECA 5L3EA 3AERB 2QX6A 1RHKA 1ZOSA 2R5WA 1Y4UA 2YIVX 3R4VA 4KFRA 3VYTB 1O5OA 1S1MA 2I3DA 2L35A 4AZ3B 1ZRSA 2BSAA 4DW8A 1RMYA 1LX7A 1QTNA 4ATNA 1U0TA 3NBQA 3PJFA 2O14A 1WUTA 4JAUA 2GN1A 1ZWLA 4Z9XA 2C4MA 5L3ZA 4H1WA 1PJCA 1CY0A 2O1SA 2J46A 1ORRA 1K8RA 3B89A 2B30A 1W8DA 4LOIA 4AKTA 4AN0A 5BXQC 1S4MA 4U00A 2D2XA 1V8ZA 1XELA 3FFQA 5JC8A 1RJFA 2R85A 3IODA 4K9DA 2FPOA 1O87A 2PG3A 4JZYA 2OB1A 1A5SB 1U7WA 4QVGA 1JDTA 3UPDA 1EWQA 4P35A 5BRNA 3UAZA 1EX1A 2JC3A 3NTOA 1LBIA 2GCPA 3ENWA 3FTPA 3FAZA 3VPXA 3TE6A 4I1SA 4Q3DA 1XOIA 5CT8A 1ZJZA 4J3NA 5B4UA 3L6EA 1YBMA 3QLUC 3I8XA 4YRSA 4PEVA 3K5IA 4N5MA 3IMEA 4NAVA 2Q0SA 5IABA 2I7TA 3OMNB 1P1IA 3O9OA 3K5HA 1C8VB 1OW3B 1HDGO 2ZYGA 4Q3AA 4F4LA 1KFKB 5F1KA 1B8VA 1JDVA 1G55A 1KIMA 4UVHA 2FDXA 2WT8A 3KFVA 1XIVA 1WBDA 4JK3A 1LSOA 1KOJA 2ZDQA 2V0GA 4BIZA 1QHGA 2JKZA 4MARA 4RPCA 4DJAA 4YJFB 4F6RB 1G4HA 3DOOA 4OHCA 1E0JA 5I7OA 1RPAA 2GQ0A 1U9JA 3O1JC 3LU1A 2W2TA 1NW6A 1Y3FE 1OCCB 4I5GA 5K3CA 2BFDB 1PR0A 2E18A 1CSEE 2XCIA 1T35A 3KSDO 3EG9B 1VKHA 2CXRA 2ZIXA 1L8OA 1E99A 4KAJA 4U2GA 1WJGA 3QPAA 4BIIA 5BT8A 3R3SA 1E92A 1ZO8A 4R6XA 3B8NA 4QTZA 2BGRA 2YZKA 1X1BA 5HS6A 5I4KA 5IVKA 2XUIA 4R2WA 1AV7A 4I0XA 1M67A 1IN7A 4M98A 2P9JA 1NIJA 4L5CA 1PNTA 2PSHA 4X7PA 3NNSA 4B32A 3ZY3A 1XR3A 3PQ2A 1EJ2A 2YNMC 4J8PA 1VQNV 1D7OA 4Y9TA 4YECA 1YCDA 3ZIUA 4BBJA 3R3HA 3RC8A 1G6Q1 3VM6A 1P31A 5B2ZA 2IIBA 1FYDA 1JZQA 3I56V 1US8A 2PA0A 2Q8PA 5REQB 1GO3F 4J9YB 5BMVA 2R8OA 3QEOA 3SXUB 2LE0A 5HSGA 3ITNA 1REQB 3RSQA 1RCTE 3V4PB 4ZGGA 5DLDA 2QAGA 4WJZA 3TNLA 5JJIA 1DTSA 4F84A 4URYR 5DM60 4Y30A 3H17A 5IFKA 2IS4A 4TTAA 1W2WB 4KQKA 3CYOA 3WRXC 1NTKH 2PMBA 1S77D 4BLRA 3BK2A 3PUWA 4MRMA 4MWGA 4ZU3A 4FFDA 6NULA 2HMWA 5DGIA 3EZLA 3EFOB 1YK0A 4HPXB 2GN6A 3AF4A 5LOVA 1E5TA 1U9ZA 4N82A 4IF6A 3OEHA 4BO2A 1NNSA 1BQ3A 1IONA 3T6KA 3ILYA 1N92A 4NX2A 3CYFA 1C8BA 2CLCX 2V97A 1QCCA 4POAA 1RWMA 3FPBA 4Y9DA 3ABRB 1YKFA 3QFCA 2P2LA 4NJMA 4UDOA 1JA0A 1G2IA 1A9TA 1D6JA 3D3WB 3KEGA 4FZ3A 3V4OA 4BRSA 1H6DA 4P93A 1MX1A 1XHLA 1PZEA 3D8SA 3FMOB 1S2GA 4KW7A 3ELWA 4CH4A 2X0FA 5KMGB 2XMZA 2DLNA 2V55B 1MX3A 2B4AA 4OV6B 4ZDJA 5B7GA 4GX5A 3JRNA 2XUAA 1P45A 2IGBA 4I9QA 3HR4A 4TN1A 4HOYA 4ZMSA 2XQFA 2Q7DA 4I1VA 3SZRA 4PHGA 4F5DA 3HRKA 2GCOA 3OTOO 1G9SA 1M5TA 3F1LA 4WV3A 1U3DA 4ZRMA 4PDLA 1D4AA 4TKLA 5KU7A 1MC8A 4EA8A 1JR2A 2GM4A 1LU9A 1EEXB 2NWQA 1TLTA 1C0PA 1ZUIA 3KKOA 3QELB 4OUDB 5LYJA 1EZJA 8LDHA 2LZ0A 2ODQA 4AYTA 4LYEA 4QULA 3QU7A 2ATCA 2VEOA 4CI9A 1XKLA 3DKKA 1UFVA 5CNKA 2HFKA 4MYUA 4B3CA 3OTHA 3LYUA 1V7ZA 2DMRA 3FR8A 1U3FA 3PT9A 1XEXA 4HWOA 2N05A 4RPJA 2CDBA 3ZU3A 4LY9A 2DQ3A 3B4SA 1KR5A 1YJAA 1CUZA 1Q0RA 4UD6A 5JAMA 1GZ7A 3WS7A 4Z1MG 2R62A 4M9QA 5IDWA 1W1WA 1YL7A 3ZZNA 4C4YA 4E14A 2VZEA 3W7BA 3DSQA 3O4VA 4BGUA 3HZRA 3NRJA 3N39C 4NLLA 2M6LA 3SR4A 3CUTA 3LVFO 4X71A 1FEZA 2J5QA 5KYKA 4O4JA 1PP4A 4A0FA 3K15A 4BTVA 5BUQA 3JYHA 4HWTA 5EYPA 5B66Z 1UKZA 1Q0PA 5BMVB 2I6TA 2PH3A 1QH1B 1AO3A 2PIAA 2QMOA 3OHSX 2Q8VA 2PS3A 1VGRA 3HTXA 3T9EA 2PU5A 4J7KA 3FW1A 4CHTA 4R2IA 1KJYA 3PV0A 5FA6A 2ZRIA 3MT7A 2BTQB 1KZ6A 3PRJA 4HAVA 4X44A 3A4LA 3FWZA 3ZBTA 4DDHA 4RMNA 4TV9A 4OU4A 1QTQA 4FOOA 3DAPA 4MTCA 3QNMA 3QPDA 2EHJA 3I5DA 4IJUA 4RFLA 3CY6A 3ZV5A 2JCBA 3HNRA 1WPXA 3FNIA 4J0DA 3A3YA 1PNLA 1HYGA 2IRWA 2LTAA 2VP3A 5K8CA 5GIOE 3SK0A 1XG5A 4U5QA 2Q5IA 5AFSA 1EWRA 5TEWA 5CFLA 1UC5B 3HE3A 1HRKA 2ETVA 2D7CA 2OLEA 5JQWA 4PR0A 2D1TA 1GG2A 2FWNA 5H3CA 4NXMB 4ID9A 2HJFC 4M1KA 3HM9A 3NDBB 3DBRB 5A5DA 2VDWA 4QIWF 1MO2A 4E0BA 5JSQA 2W93A 1HEIA 3HCAA 1AKTA 1PX0A 3IP3A 3ITDA 4I19A 4IQFA 5AM5A 5E9QA 5BSTA 1UMCA 2VYND 1E1QD 2YXNA 3G2KA 5DYYA 1SHTX 1W4BA 4NV0A 4PSDA 2N1MA 3MW8A 3NBFA 5DLEA 1X1AA 3B7GA 5DSTA 2TYSB 2XT0A 1M90W 2HGZA 3Q2KA 4QXRA 5BWOA 3DTVB 3BGWA 3E27A 2ETNA 1M8PA 4C08A 4OX9O 2OCIA 2Y2UA 1SVWA 3BCRA 1NW7A 3AL3A 3IA7A 4KRGA 5EHGA 3WL7A 3TDNA 2BYTA 3T1HO 4Z1VA 3VFDA 3TI7A 3B8HA 4GKVA 3M99B 2DOSA 2OGUA 1X7XB 1KY3A 4UCWA 5TT1A 4LJRA 3OEHG 3OFSA 1Q86W 3I01A 1G0NA 1I01A 1E2LA 3KT0A 5I7AA 4MIKA 3SEQA 3RLFA 1Z28A 3SSOA 3WB2A 2QJ1A 4H3VA 4QDKA 1FLDA 4GI2A 3MTIA 4P32A 3U10A 4W5OA 2XSZD 1ADGA 1XEXB 8GPBA 4I50B 3LL4A 4KGXA 4LNHA 3EMKA 5FA5A 3RJTA 5DT9A 421PA 2QP3A 3P52A 1KE1A 3GD7A 1C4WA 3GNSA 3IDSA 2OIEA 1UADA 2XODA 4GX0A 1I6WA 2CGOA 1AUXA 2M32A 2PVCA 1X86B 2YCLA 3ILSA 1R6NA 2OYQA 5KNBD 1KQGA 4JQSA 4K6HA 2YOFA 2QDXA 3FY4A 1QMPA 3M1LA 1E9FA 1XZFA 3Q3IA 3QQPA 3C4QA 3DV9A 1LK0A 2PNFA 2RHRA 1TJYA 5K9ZA 1M1YB 1G38A 2FUEA 2RGNC 4KE6A 4WN9B 5TF0A 2OOKA 3KAQA 4UVIA 3E84A 5E2BA 3ZZTA 4BV3A 4ERXA 1E3WB 5I8WA 4KPYA 2QM8A 1CF4A 4M76B 3H5IA 4X9QA 1QCZA 1UC9A 1AJPA 1U6KA 2HRZA 3ODGA 5JLAA 2J87A 3R23A 2OAQ1 2E5LB 1NF9A 3D6MA 2WEKA 1OYWA 1CETA 1EU1A 3GMIA 1NXQA 3G02A 1F0KA 2AUMA 3L6BA 3CT6A 4IIEA 4PLZA 2J3QA 2IPMA 3S27A 3IC7A 4Z2WA 2TRSB 1FP4B 1Q17A 3P2YA 2HO5A 1I4EB 2JFYA 2MSNA 1KY5A 2ZWMA 2OECA 3NWPA 1A5TA 4HTFA 3SC6A 1AN0A 3TR6A 3TAUA 1RYFA 3U7QA 3Q7RA 3UVEA 3VPHA 4LNUB 5HE8A 2I1LA 3GAMA 4LBYA 4V0QA 1F9EA 2C2MA 5EKDA 4ACBA 5JMTA 1I14A 1MOQA 3OT5A 1XROA 4OMFG 2YJGA 1OU0A 4MVJI 3GA7A 3S3WA 1FX0A 3LBIA 1UBCA 5B5EZ 3LWNA 2GB4A 2HQ1A 3V2GA 2V7PA 1BSMA 4B3DA 1M5RA 4JTDB 1KEEB 2B8JA 2OCAA 4NSNA 9MHTA 4M9UA 3V4LA 1TUBB 5FD8A 5EJAA 5TPZD 1L5ZA 1ZMOA 1V26A 4BLTA 2M2IA 2M6YA 1TRHA 3NHUA 4BE9A 4LDRA 4UVEA 3O8RA 3FRJA 3HU3A 3TNYA 3LWDA 2GARA 3NETA 5IKMA 4UE6A 8AT1A 1YGYA 2Q67A 3DF9A 1D0IA 3EXFA 1GN4A 1QUFA 2PK3A 4H3SA 2OXTA 1PEKE 2AEEA 3U3DA 2ZR2A 1AS0A 1JJBA 2H3HA 1CFZA 2OPBA 3PXCX 3FDJA 3G82C 4ALIA 4PD4F 1CZUA 4QAJA 4CCWA 1Y3AA 2FETA 4X1KA 2Q5QA 3E3OA 3PX7A 5CBPA 2EL9A 2GT1A 2V8OA 3D59A 4H17A 4PCAA 4CF3A 3ZZMA 2R86A 3VBCA 1QQ6A 1NVXQ 3RYTC 4O4IF 2CMHA 3ZRWB 2I4OA 2FZCA 2I2FA 1Z12A 2NU7B 3ANMA 2Z4TA 1BCSB 4L0QA 2OENG 3PXUA 5CXUA 5A06A 3CBQA 2VDUE 5LBQA 9ATCA 3ER6A 3WMXA 4KEAA 2Z30A 3DHNA 3S5JA 5K1XA 4C6HA 1OBOA 3ON5A 1SXJB 2AVDA 3B20A 4MPRA 5FULA 2FWPA 2ZUWA 2ID7A 4EBFA 5ELXA 1G8JA 1KK2A 2VBCA 1QH8A 3V42A 1D6NA 1KSHA 1MFZA 2RHWA 4FOTA 1NKDA 3USES 2WFMA 2AWNA 4ZO7A 4FEGA 4G4IA 4BEVA 2I9KA 3PP8A 3ZJUA 3MT8A 3LT5A 1XZBA 5FV4A 2JH3A 1AX9A 4QJ5A 4Q21A 5B7NA 3WTCA 1EX6A 3FOCA 4AO8A 1PRYA 3SQOA 3I0MA 1VMGA 4Q93A 1B26A 2H1RA 4G8JA 3TFWA 1Y48E 5KVCA 1KPGA 1GVNB 2R3SA 4UBLA 5FTMA 2AR7A 2W2LA 1BDHA 5A2QN 1MX9A 3I2IA 2X0DA 4UM8B 2DQSA 4FMCF 2C03A 4MV1A 3T5TA 2P77A 5J2UF 4AM8A 5B2EA 4D25A 1IBKB 4R7GA 3I45A 4N6GA 3NHSA 1MV5A 3ODPA 4HAZA 4Z99A 5EE9A 4Q6BA 3ZD8A 5IM4A 2DYRB 3H6GA 1T4BA 3FYHA 1R10A 1KP2A 1Z08A 2J7KA 4LWQA 1P74A 4MS1A 3E48A 5U4QA 3UNXA 3CE9A 2BKAA 1CVLA 4KO2S 1G41A 3DO6A 1QGUA 3TOCA 3MTEA 3P0JA 2E4AA 4DIMA 2NSLA 3ESYA 5CDFE 3KDPA 4JR2A 3CCFA 4P9OA 2ODAA 2Q6IA 3VU1A 3UV6A 1XTKA 2HVJC 3B6JA 1PL6A 2ZE6A 1JQLB 1OCZC 3CZAA 3NGLA 2AX3A 4NYIR 5B2FA 3FN4A 5C8YB 4K1LA 4RD3A 1BS1A 1QJ4A 4ARIA 1M73E 4GKKB 1D4OA 2JHGA 1RQ7A 1XZQA 4ZAFA 4BNKA 5IN4A 2VPPA 4DRXA 3WQRA 2BM8A 3BJEA 4PQEA 1AB5A 3OGCC 2RHDA 3AHFA 1JE1A 1IN5A 4B6GA 2BFBA 3ED1A 3T15A 1Y8RA 2I2WA 2QMHA 2X6QA 3BTUA 4TQAA 1CP9A 4DDTA 1LDBA 2QD1A 3A4NA 1FDSA 3HYRA 4ICGA 1MO4A 4LOKA 1Q82W 3QKIA 1Q7TA 2JAWA 2TSYB 3DBVO 3EUWA 1GTZA 2XTNA 1PK9A 3GQBA 1GAJA 1T9CA 3LX6A 3P4UA 3R20A 1YZGA 1IY2A 1B3QA 3OF3A 2FEOA 3QTTA 4GQBA 5HF8A 1V1RA 1INLA 4OLJA 2EWMA 1BTOA 4GCZA 2H4FA 4UOEA 1Y9JA 1ZM7A 3MRVA 2VHTA 2FSSA 2OBMA 4IHQA 4PBSA 4V1CI 5TLSA 4J0JA 4IV0A 1RRFA 5P21A 3IP8A 1R0WA 3AEZA 4ZYTA 1QYWA 3EZ2A 3T4XA 4YMGA 4LXIA 3ESAA 3RVQA 5AVSA 3L7JA 4G07A 4R1TA 5GONB 1KZGB 3QUSA 3CMMA 3IUNA 4UNQA 1RSZA 1OT3A 3VPCA 4BP1A 1HUQA 1K68A 2Q6KA 2WAAA 4M37A 4CF7A 1Y1TA 4UUNA 2DYKA 3ND8A 3LL7A 3LT0A 1RXCA 3TTSA 3SF8B 2XXAB 1FYXA 1Z4QA 3IULA 1Z5OA 2X5NA 3O4IA 4OXNA 4B6OA 4J49A 5B1YA 1EH5A 3DEZA 1E62A 1J0EA 4XUCA 5B1AC 1WEHA 3OHPA 1YR2A 2HPVA 3B1KA 3CLRD 3KAKA 3SOZA 1FXKC 3ORQA 1UXKA 2W9XA 1FFHA 2IFTA 1CRPA 1ISIA 1X14A 4D4LA 1NLYA 1IPEA 2BI8A 2YV1A 3KHTA 2COUA 1T15A 4QG7A 4RAOA 3Q3HA 5L51A 1LB1B 5LOVB 1E2MA 3R24A 3FBTA 4JB0A 1KI1A 4HTFB 3EX7C 3W1EA 1P9OA 2ZB8A 3TW6A 4DSTA 5DXFA 1DKLA 3R9XA 3FOWA 4N23A 1OQAA 3K9WA 4YJHA 4UB8Z 1G8MA 1NSTA 3CZQA 4Y7CA 2GDJA 2VSFA 3OBIA 3H9VA 2H51A 3WJ1A 1ZR4A 3HWRA 2B9ZA 2QWRB 3D0RA 3N2GB 4IDFA 3M70A 5KKCA 1OFIA 3C5VA 1NNEA 2WW8A 2VF5X 3W5IA 2FGJA 1PUXA 3ASUA 2H9YA 4KIWA 2IS1A 5CFQA 1PGJA 3W5SA 1DGQA 3GR6A 5FRDA 5CDTA 2FW7A 2JJYA 3HJAA 1J70A 4QPKA 2X3UA 5KC8A 1XEFA 1SXIA 3ABLC 1PSZA 2HPZA 2ZCVA 1JE0A 2EFCB 1UBKS 5HCIA 4D6YA 2JGJA 3N7AA 3BXPA 4HXYA 5EE3A 3Q3CA 5CH8A 1XOUA 2O3QA 1PEAA 2Z2ZA 2HSDA 2P3LA 3M81A 3O92A 3NHWA 2IH1C 4J9VA 2JHAA 3UJ9A 1PLKA 3E7WA 4AJJA 4CM3A 5CVTA 2VK1A 1RPZA 3GRYA 4IKPA 1G66A 1GN9A 1QLJA 4CMGA 5JQGA 2Z5VA 4FVMA 4Y2PA 1V8FA 2XYRA 1IY0A 4HYYA 3SIXA 5C1PA 3D4OA 3E05A 3CTPA 1GNSA 1GLNA 3K0FB 4JEUA 2CBGA 2IJKA 3NWEA 3OTWA 5FX2A 3S70A 3OGIB 5FF9A 1DZ3A 4HAWA 1J0XO 1U4OA 3MCUA 2JRLA 3BCHA 3EVKA 3IQWA 2VTEA 1IHOA 4HUQB 3TKAA 3FUUA 3LUDA 2W42A 4PX3A 1Q19A 3MJTA 4YRQA 2A88A 3W7TA 2VI5A 4UCXA 5HUJA 2XCLA 3FDZA 4KIUA 4HN9A 3PBKA 5CXXA 3MB5A 1MENA 2ODTX 3JQ7B 3UAOA 4FI3C 2BF7A 3QMMA 4UUMA 4D96A 1A9XB 2NPOA 2Q4RA 3WK9A 2CE2X 3NANA 4P7FA 1B42A 4FHCA 2BEVA 1YR8A 3DO8A 4KHZA 1Z0IA 2EF1A 3PDCA 4D26A 2PL3A 3RAJA 4LG1A 2CTRA 1MAAA 4MMXB 1DJNA 2ZR0A 2O20A 4M1TA 2QRZA 4L4SA 1NUUA 3FD8A 4WKGA 2H29A 3KQWA 5EBLC 4NEHB 3RS5A 3TTWA 4A6EA 1XZMA 2NZYA 1X3SA 2G0TA 2ADQB 3L8FA 2HQBA 1NVDA 4DCTA 3F7VC 4U7OA 2VWGA 4TXMA 3UYKA 4O8ZA 4ZVLA 3DYVA 1KO1A 4DV7B 1IM5A 3ZI0A 4CBCA 4A26A 4B3SB 4DA8A 4NCKA 3DBLA 4V0OA 1KJZA 1U8CB 4G0MA 3LF2A 4EFBA 5EL0A 4CKWB 4LJ9A 4ZOLB 2RAVA 4PAMA 2IX9A 4QLAA 4UVDA 2ENWA 3G9ZA 3UGTA 4KQIA 2R8EA 3NJ4A 4D79A 4C2BA 3NDIA 3HLTA 1GZHB 1UWLA 3PQ4A 4BVBA 1SJ9A 2V5VA 2YH2A 3CZRA 3L01A 4FCCA 4P92A 1GNPA 1UK8A 3BXHA 3E9YA 3IBCA 2PMKA 5EIXA 5KQMA 3N0WA 2BZGA 4CU2A 1QR9A 2EX0A 4P2BA 2CLSA 4YT2A 2CDYA 3CE6A 1N5JA 3JYLA 4JBHA 1U1IA 1UJ2A 1BQ0A 3GCGA 1IWOA 1PGNA 1XHFA 2WSSD 4B81A 4X93A 3K2QA 4UZFA 1D0VA 2H4ZA 5CX1B 4FZ0A 1AHHA 1R1DA 4NOMA 4DSNA 1AQUA 1GGKA 4QTUB 1ZJJA 1ZZEA 4P86A 5FLKA 1S5HC 4WKNA 4RH0A 5K3DA 1Y37A 2V7WA 4UXHA 4UVGA 3OUZA 5HS4A 3DM9B 3P9CA 4I1OA 1OC4A 4FILA 4U9HS 4OLBA 1JUDA 3ZHQA 3OCYA 3F9RA 3MDSA 1VJ5A 2VWHA 1JHOA 3T41A 2A92A 1DOAA 1L7BA 4BMOB 2HEIA 3FBGA 3ZE8A 3U5ZB 2PJDA 1Q8IA 1X7ZB 1C4OA 4X8HA 2JGEA 3OOJA 2RGEA 1HNNA 4UM9B 4TV8F 1US8B 1E3LA 2K6GA 3KSAC 3J81k 1F1BA 1QOQB 3CPHA 3QBEA 1G6UA 1MQ9A 1WY7A 4JUFA 5F2OA 3N86A 3PPWA 4NU6A 3L8EA 3ETDA 1YL6A 3KKYA 4FM1A 1G98A 1LBTA 2P65A 4ZV4A 1T3ZA 4IYHA 5DHFA 4DTCA 3W5AA 5TARA 5KDLA 1ZAYA 2TMGA 2ZYTX 1XCMA 2ILTA 1Z6TA 1LPMA 4WECA 5KAPA 3SIPA 2WZCA 3Q1KA 3WIEA 2FPPB 3E3MA 1SUSA 4YWJA 3PC8C 5JSZB 2WTXA 4DV1B 3F6PA 4G09A 5GONA 3EHDA 1Z2NX 4MQ5A 4YDHB 3RJMA 4D3SA 3EFOA 1PS8A 2ZRGA 3ZBHA 4FHGA 2C99A 1JIIA 3TGUH 2J6IA 2PVPA 3H5LA 4X8MA 5EWLB 1RJ9B 1Q0HA 5ECGC 3KXDA 5TGTA 4P3KA 3ZJ5A 4IUYA 3W5DA 1C1XA 1K3FA 3NU1A 4EKNB 2DWCA 3MWKA 3ONFA 4Z4GA 4DA6A 3E9NA 5LCXA 2ECPA 4NCBA 4EHBA 2FFHA 3K2IA 1FIUA 2G7MC 1CY4A 2ZIAA 4G1VA 1RCUA 2WNHA 2EJRA 3O2SB 3UAXA 5A02A 1XTQA 2CE7A 2FP4A 1XDUA 5B37A 3MQFA 4EDHA 4PG6A 2Q0QA 4OSEA 3BT7A 3IT1A 3ZVMA 3Q9SA 4F9GA 2XD4A 2XAQA 3QW2A 4ZTBA 621PA 1O97C 3HXKA 3C3SA 4JOSA 4OQZA 3WK7A 3JVEA 5JC1A 1ULUA 3DCNA 2OGZA 2O8DB 3OQIB 1R6UA 2O3SA 2J6BA 3OF2A 2CT8A 4HGNA 3H75A 2XX3A 2H7XA 3DT8A 3MVEA 2F59A 3Q4GA 1B93A 2QE7D 1D2DA 1J1IA 1U5BB 1N7JA 2Y0EA 4YHHO 3K9HA 3QP9A 4YBRA 2FJ0A 4C4PA 1B04A 4ZANA 1YD7A 2PTMA 4MI6A 3VDRA 2C97A 3ZWOA 5LOVF 4FGZA 4DLBA 3AQIA 3HVHA 1XU7A 5HDQA 5CA1B 2DN9A 1E4EB 1GU0A 1T1IA 2YXBA 4I4TF 5GGYA 4Z9BA 4EFNA 1GV0A 1JCHA 3ZYCA 1QV7A 1M2NA 2C7RA 2XH8A 3K1ZA 1FFXB 1BD4A 3QRWA 2J7PA 1P6UA 4K8OA 3PNOA 1HZZC 3F0TA 5EWJA 1K6EA 2F1MA 1EVIA 3C6XA 3S55A 5EZYB 3BCSA 1XEAA 4Q12A 2IYQA 3QE3A 4C4XA 1W5SA 5LLDA 3FB5C 2W2PA 3QYAA 4RQFA 5T4BA 3UMVA 1JEYB 4HQOA 1N1MA 1YBVA 2ZB3A 3K0HA 4MHOA 3RAPR 4F2HA 1BAPA 1SZCA 3A6FA 2BZ0A 2AG1A 1BCSA 3ESQA 5FHQA 3EISA 4F1WA 3ZW7A 2OXIA 4RF4A 2C54A 1MEEA 3CCBA 4R51A 5D2CA 3AF6A 1RHJA 1MU0A 4D46A 3OLYA 4P33A 2X8LA 2QT1A 5DV9A 1ODJA 1MVLA 3B1FA 4WX2B 2J5KA 5HA5A 4HEA1 3IEVA 1K0UA 3SJBC 3PTLA 5JWRA 4UASA 3DUWA 1QLNA 2QSYA 3KOMA 3WFJA 4QM6A 2WU3A 3PC2A 2B37A 5AI4A 5IPFA 4G1FA 3F7YC 3UTCA 3NVDA 4LV8B 1V95A 1YQWA 1X8JA 4OHYA 2H85A 3TSWA 1DWQA 2JJ2D 3SMQA 1OXMA 4MRNA 4UNNA 5BWNA 3H5NA 4LRTB 1JEOA 5FI3A 2VHEA 5JS7A 3ZDBA 1ECCA 2OZLA 4QDXA 1CLUA 5IJAA 2BGIA 4UBMA 4PHHA 1EFVA 1FDWA 2ISCA 4NMWA 1WCIA 3VA7A 5DW0A 1G5RA 3RJ5A 3PGMA 1L8DA 3OKFA 4PO3X 1SRQA 3D6AA 1D5NA 5SV2A 4V1CA 3ABSB 1OWOA 4DABA 2JEZA 1Z2OX 3JSXA 5L3CA 2DJIA 4S0ZA 1GZVA 1R0LA 5DHPA 2NLJC 5HPYB 1C1DA 4MS4B 3EA0A 2X9NA 3BC1A 4G2TA 4WBNF 1A8SA 3KHSA 3U9TA 3CRAA 5KIAA 2QR5A 3OTGA 2IKSA 2QRQA 1GM7A 3H4VA 1VE7A 1P1BA 2XNKA 5DP2A 3RSLA 3TL6A 2ZB2A 4PYQA 4BV8A 3N8NA 3WG7C 2WYHA 3HWX1 2YR0A 3B3GA 4O8CA 3CCSV 1ACJA 1O0BA 2CF5A 2WV9A 4CDNA 4IYJA 2PY5A 1BE1A 1PN3A 2C9YA 2XDYA 4OB7A 1KMCA 2RHHA 3FRIA 3NDPA 3MUEA 4LKRA 5IKXA 1N1EA 4KOEC 4CS4A 1C3EA 2ZT6A 3LT4A 4RH3A 1GRQA 4P8RA 1BHQ1 2J0UB 3D5TA 2CMDA 4YAIA 1PV2A 2OV6A 1H85A 4OTZA 1RPRA 1GA1A 3E2EA 1DIBA 3MFQA 4FYWA 1T4CA 1U8TA 2AD1A 5HFJA 3U0ZA 3O8DA 3EYAA 2XOEA 1U97A 1G1MA 4KXUA 4AVYA 1XEWX 4M7WA 3SZ3A 4L5YA 5C4MA 3WB1A 5JYEA 4KQCA 1GRRA 1KKMA 1M8JA 1L7EA 1SVIA 2HWUA 3U37A 4C0LA 4CMKA 3CUSA 1E1MA 3H0KA 1F23A 1Q7GA 4FDUA 3N0RA 1KE2A 2P3OA 3ABKC 3EHBB 5F1PA 2XAJA 4C6RA 1KHHA 3RTCA 4KXMA 3N7TA 1OILA 3RARA 4MMYB 3RYHB 1KBHA 4D3ZA 1IN4A 3C87A 1L4UA 1WXHA 1TF2A 5AKXA 1NBHA 3BFPA 2R6R1 1WPRA 4HNGA 1SOMA 4LX0A 3RJZA 4FFBA 1ZNQO 3GFTA 4MROA 5H6QA 3RS9A 3VR6D 4UV9A 3H1LH 1PKEA 1ZJYA 3DEKA 3RGWS 1DWUA 3TVDA 3WIUA 3AEXA 2QPLA 4BBZA 4YRRA 4E5SA 2QTVB 3SM9A 1MHTA 5ECWA 3GD5A 2PX6A 2P68A 2C5FA 1W6RA 3MUFA 4XDJA 3H9EO 1NR1A 1ECJA 3AT1A 1KI4A 4W8GA 4Z1MD 2CD9A 2EATA 3GWOA 5AXCA 2E75B 1H1LA 1AGYA 1CDEA 2KM1A 3ANXA 3DD5A 3M1IA 1A98A 2OZLB 4LQDA 4TTPA 3UB2A 1DTWB 3VPAA 3GN1A 4PSCA 2E76B 5B3SC 4W4LA 4DO2A 4HAMA 4HF7A 1FDRA 4TYYA 3LFTA 2AN3A 5G3ZA 4TWBA 3TXAA 1T6XA 2RKOA 1FRQA 5JWPA 2DHRA 4G0OA 2CZGA 4GKAA 3JSLA 5C46F 3U7HB 3KLPX 2VPIA 5DYGA 2JI9A 3VSCA 4U3JB 4KV7A 1QWSA 5ALNA 1HLPA 2J1LA 4PO1A 5EWMB 1NW3A 2V3CC 1GWNA 1IEVA 1KP3A 1C1DB 4RKQA 3GFBA 2PUBA 1XJ0A 3OO1A 2O2EA 2EV9A 3AMVA 3C24A 1J8QA 4AJLA 1N2IA 4EUFA 1HDRA 5EEGA 2CDCA 2UZ1B 3KB8A 3L7AA 1WIWA 2ONYA 4V03A 4WOCA 1JP7A 4PYLA 3MINA 4QE9A 4QUJA 3ZDAA 3L8MA 4S05A 5ESRA 2ZSIA 1JH8A 3VNBA 4KJXA 3I4FA 4KQ1A 5M04A 1FPOA 1OV9A 4CUZA 3L0OA 3LY5A 2H7YA 1QBKC 2DYSC 3RWBA 2XZDA 3BBPA 3BD8A 4RM2A 2WQZA 1CG6A 1DQNA 4HBGA 4JGBA 4CG1A 2W43A 4FUTA 2BMFA 2QROA 4PINA 2EG5A 4V3CA 3FHJA 1D03A 4O29A 2WD7A 2Z56A 3ZEIA 5CA1A 4J6FA 5FOVA 4CH3A 1QB7A 5DI3A 2OXCA 1WZNA 4RHTA 3ICVA 4IKEA 1TF5A 4HWKA 2AE1A 5F7JA 5HGJA 4EF5A 4XYBA 1XI2A 2CZCA 4BQSA 4GPZA 3FPFA 4DIKA 4I08A 1URFA 2HLDA 4JN6B 4L4ZA 4EVQA 4WW0A 3O4RA 3AR7A 2CEKA 2VAWA 1Z5NA 2IKQA 5ED0A 2VAXA 3B1YA 3WL3A 2YSUB 1AMNA 1M1NB 3ZN0A 3IUPA 3IV6A 4N8DA 3BCCH 3O8OA 4U5XA 3NX4A 2A9QA 2HIGA 2ZUDA 3ENNA 2W0SA 3DV0B 2D8MA 3HN6A 5ER6A 2WZBA 1LLQA 1MEJA 3RDPA 2DPXA 3FHTA 3U80A 3ZIDA 2PWZA 1ABBA 3QU5A 4RQTA 1Y9ZA 2J0EA 1NDUA 4MUKA 1JYEA 1FFYA 4OHWA 1IBSA 3I2GA 3L0DA 4XKJA 4AS3A 4RV9A 5KHHA 3G4SV 3GV0A 4CR6A 1Y67A 1FRVA 1GEEA 1ZGGA 2OAGA 3ILHA 4TSRA 5IZCA 5K6TA 4TYPA 3KPVA 2E5WA 2PKXA 3AR3A 1L5NA 4MI9A 5IWAB 1EFKA 1PNRA 5LQAA 1IXZA 1IBCA 1KEUA 3FVWA 2PLAA 4I7EA 4JL5A 1QYXA 2Q5JA 3UGQA 1OTXA 1TA0A 3IA2A 5DTJA 4R98A 2F4VO 1ZGHA 1SN7A 2O1EA 3LT2A 4D6PA 1O3YA 5KJ6A 1W52X 4JCOA 1I7SB 4TMVA 3WRYC 1YZYA 5D3MA 2OSBA 4ZCLA 4BLVA 5B1EA 1D2MA 1EP1B 4ME6A 5JY1A 1XZDA 3DBHA 3G8YA 1F4LA 3FTCA 4OM7A 1N6OA 4WXPA 5JJNB 3MWEB 4DLLA 1J95A 4A8JC 3SLKA 1GGVA 2CN1A 4EGJA 2O5RA 2A9HA 2RGBA 3GJ6A 3JVUA 2GHTA 3KNZA 4LJ5A 1C14A 2BUCA 2F1RA 4AJIA 4EHHA 3KAJA 5AG2A 1LNSA 5JV5A 3K0BA 1PGPA 1F6WA 1ZM3A 4OXYA 4IXMA 4MO2A 4EMBA 4BO0A 4IRMA 4FLWA 1N1GA 1USWA 4HYEA 3IERA 1EZZA 4LRWA 4RMHA 2LR0A 3ZKAA 1P1JA 4KLRA 5GQSA 3OOWA 2REQB 3NVAA 5KQLA 1TTTA 4AB1A 4QKQA 4J75A 1S0VA 2ZRLA 1S5LZ 2WJAA 5IKEA 3ICQB 2D1FA 3JZIA 3WK5A 4M0MA 4RMJA 3PUZA 2LW7A 2M7WA 4RKEA 1ID8A 1W5AA 5EMMA 4EF6A 4OBXA 4RL6A 4US0R 3ZWQA 2VH5R 4YUVA 4AL4A 5IRCD 1GFSA 1DAPA 1FNDA 1UBTS 2EINC 3ZMTA 1SMKA 1ZN7A 3A32A 4QOEA 2PAAA 3KQSA 4LF9O 3ABLB 4B3RO 1Y5IA 1I13A 1SQVH 2DR0A 2XRMA 2CYAA 2NG1A 3AF1A 3H2ZA 4TLMB 5FBWB 1CVRA 1N2CE 1OWMA 5A1TA 1CB0A 2Z4RA 1BMTA 3BWEA 3U48A 1XLTC 1YRAA 4DBLE 5L3SB 5C34B 5IKPA 1GMGA 5H0IA 1PV0A 3ZQ4A 1QRAA 2DQZA 3GEHA 3QBTA 2PSFA 2YMLA 1XA3A 1RQXA 1G64A 1WMFA 1COWD 2HXGA 2BCGY 2F43A 3W9SA 3CG0A 4AG6A 3K5LA 1ZRHA 1CUYA 1Z0JA 2RAFA 4IDEA 1T9KA 2R5FA 4TXHA 2EGUA 4EFKA 5KNCA 1ODTC 1JNXX 1MZEA 3ETEA 1Z34A 3WAKA 2QWPB 1K73W 1DCMA 1JKFA 3ORFA 2OBBA 4N3AA 2WJ4A 3LFHA 3RNOA 3UJBA 2C5GA 4J4BA 4R2LA 1JZSA 3BF8A 1SXPA 3DFFA 1UJ4A 1QMGA 4O33A 1M6EX 3CX7A 4AF6A 4DKJA 4RCZA 5JNTA 3IP9A 1Y80A 1EUDB 2EULA 2NUTB 4QEDA 1CUIA 4P54A 2IU4A 1NP6A 2IYUA 2YXYA 4B1FA 4EX7A 1IHXA 4JAVC 3NBXX 5CB4F 1ZKMA 3TEFA 1P5RA 2CV0A 1TU3A 3Q8XB 2O4UX 2PPVA 3EVTA 2XTMA 1YITV 5ALJA 1I4LD 1M4UA 3N87A 3IAUA 3NH9A 3LYAA 4DCGA 1NONA 3M8KA 3NOOA 1YE5A 2FH5B 1H66A 4TMYA 3P9QA 4DADA 3T61A 3VSDA 1YT5A 4AC9A 4PDMA 1KU6A 2FQ1A 3EGXA 3G0BA 2CJFA 1YCIA 4BNMA 2BL4A 5DULA 1U1CA 2W6OA 1UBEA 1KYZA 1F2TB 3VVLA 1YRLA 5CTAA 3OE4A 4AUMA 5C51B 3KQNA 5EHQA 3TLZA 3UPTA 3U7RA 2JFQA 4ND4A 3EVBA 1VSQA 4ZO6A 2O0JA 5IT0A 2CLMB 1UPUA 2J3EA 1SVOA 3MMNA 1PBNA 5KB3A 4KXNA 3N2ZB 4H77A 3R5HA 3OZCA 1AKQA 2CWDA 2PJZA 1DDGA 1V0JA 2BM9A 1FMFA 3ZV6A 1UMCB 1QUEA 4IVQA 5AOCA 4REQB 3NBKA 5AXDA 2OCKA 3IVCA 1XZPA 2C83A 3NQ41 1ZDMA 2A5JA 2UVQA 2WIAA 2H3EA 2EOAA 3G5TA 4XYMA 3TJTA 4IMJB 2R2GA 5CM2Z 5DNDA 2P62A 2AUNA 2QYTA 2X19A 1VQ6V 4OL0A 1DTEA 4F8EA 1DQRA 4LJ6A 5LHIA 4B3GA 2Q07A 1DAFA 1RLOA 3DDOA 1IG0A 3RTDA 3IC9A 1SVLA 1ZHOA 1Q5OA 1R6BX 1CS0B 3EGOA 2B9EA 4B8YA 1DIGA 1ZMXA 3PEUA 4DEXA 2JATA 3O8NA 4FGJA 3QU2A 3GUVA 4FE3A 1FTQA 1LDGA 1LK5A 1QZTA 3UBMA 3LZ6A 3K1AB 4L3VA 4M1QA 4BBAA 3RUEA 1X70A 1SFRA 1VQ7V 3JU3A 4E1VA 5CHEA 1GZUA 4H7PA 4LIPD 3ZWMA 1G5HA 4YAFA 5L3SA 4NQRA 1I4DD 1Z75A 4BAYA 1RACA 1TL7C 2L82A 2RKBA 3PKZA 4MRRA 1R0ZA 5AI6A 6LDHA 5IYZF 1PR2A 1U98A 3E2MA 1M5IA 5JI2E 6YASA 1H2WA 5F98A 4PYKA 1SZJG 2XOXA 2Y1KA 4XBFA 4ZAZA 1LBQA 2JGDA 1V5EA 1F2UB 2WKRA 3FNQA 5IH3A 2RHBA 3T1NA 3SYTA 2DQ0A 1AU9A 1RW4A 3TTVA 1Y7LA 4MR9B 5ALDA 2JFHA 4Y2JA 4YROA 1VCOA 3TLBA 2XY4A 4B09A 4OHMA 5SY6A 3AUTA 1KEWA 2QKAA 1M6VA 3FBWA 1N7HA 2NVBA 4WFKA 1RBQA 3EXAA 1XTBA 2NU9A 1QHIA 5EVJA 3V33A 1C2TA 3C6MA 3KJXA 3KL2A 5IVDA 3W2FA 4YX9A 5K6AC 1G6OA 1HY3A 2GASA 4AY6A 1KO4A 3ETCA 3M4YA 1N32O 4F3RA 4IGIA 2BHNA 1AD2A 1O1YA 5HFMA 1XP8A 3ELUA 5BSUA 1LNZA 3DGEA 1PUJA 3S99A 1NQWA 2JLYA 4TTQA 2P0EA 3EZGA 1U7OA 4GMHA 5A2QA 1QZUA 3HKDA 4XSGA 2ZDIA 3O4HA 2I7CA 4R8KA 1WCIB 2LUOA 1F9AA 4G9BA 5TX7A 1VPWA 5EC1C 1R5OA 2VEDA 5JJKA 3A04A 2CEAA 3DVLA 3NM4A 4LK2A 4FONA 4CC6A 2Y8EA 2H6EA 3AINA 3ZDFA 5AW1A 1U8EA 1S8OA 2GJAA 3DDCA 4MJXA 3T3EA 3U61B 1JXAA 4UU7A 4WQMA 2ORVA 1TZ2A 2G4CA 1OLXA 1SQ0A 1XVVA 4K6KA 1L5VA 1SZPA 1VE9A 4Y6GB 3TPCA 1QKKA 4DLYA 3N58A 5A5FA 4HZ3A 3FYSA 3CURA 1RVDA 4FFRA 5JSYA 1QSGA 3W7XA 3KXKA 3ST7A 1KJ8A 2YJNA 3BE4A 4OL9A 4ZZ1A 2JFOA 5KJ1A 4TL7A 3L1VA 3I34X 2B2XA 2P1DA 4HXEB 5ALVA 2X4GA 2CJYA 2ROQA 4MVCA 4TMKA 1TO1E 3ZD7A 5KNCD 4H2DA 5TC4A 3TCUA 4QOHA 2QUIA 1YR9A 1CUAA 3KKPA 1B14A 2OZKA 3F6RA 5G02A 2N04A 2P3QA 2CNWA 1N77A 5BZBA 4HGZA 4ZO8A 3U40A 2Q28A 3CNBA 3CEHA 3DO5A 4BQNA 3A0BZ 5K4AA 3P9YA 3WWYA 3SVLA 2C8JA 1HKUA 3IT0A 1LR1A 1KP9A 3PUKA 1VCIA 3FHCB 1R9GA 3NUQA 2A3QA 3CISA 5AQ1A 5KQGA 4OPAA 2O5CA 2Q4BA 1ZN2A 2YTZA 2D0IA 3TOZA 1W36C 1TAEA 5K0CA 1J1UA 3WSWA 1ISRA 4EW2A 5BR8O 4EMSA 1W59A 1KC1A 5JBQA 5LA6B 3DC7A 4K26A 3E53A 1MJ5A 1BJKA 2XQKA 3AF2A 4HI0E 4TRRA 1K7SN 3VKFA 4M46A 4JP2A 3PF9A 2GEBA 2JAQA 4PDRA 2WLKA 1LPSA 4PXSA 2ORIA 3ZPXA 1VHQA 4IM7A 4L9RA 4BASA 2F43B 3GT4A 4G1MB 1QGAA 5JAZA 3CS3A 2FOLA 1L7PA 4CNBA 2AKEA 2NACA 1NVPD 1FMJA 3MGKA 2SCUB 4AI8A 4BVEA 5AVVA 3UGJA 1OAOA 2AW3A 1TIBA 4JGSA 2JVJA 3LLVA 3OX2A 4HUQA 2J32A 4OREX 1CR6A 2VNSA 5A71A 1II8A 4KE7A 5GIPE 4GRIA 2A5FA 1SM4A 4MTGA 2FJPA 3V1KA 2XWPA 4AQYB 2EQAA 4M0FA 4MW5A 4HRVA 1KSJA 4JOQA 3VPBA 4KQEA 3ZWVA 2FPLA 2RE8A 3V2IA 1LJ8A 4J10A 1PG2A 1LC3A 2LD4A 4FC6A 4MLCA 4MRMB 3L9WA 4RJKA 1C9NA 4OQLA 4Y2XA 3ZX5A 5B3LA 2HVKC 1F6DA 1JQKA 2ZZKA 4MUHA 4IRUB 4OIMA 5A05A 7YASA 3KQHA 4M9CA 1EGVB 3EBOA 3DGEC 2L6LA 1EK6A 1NBME 2EJWA 4IEEA 4YJ2F 1WNSA 4DTIA 3WLJA 4JLKA 4CG3A 3SPJA 1NXOA 1Y76A 1DOZA 2ZJZA 3MELA 1Z5VA 5DGHA 3K2EA 4XJTA 2O3TA 2NVUB 1D9ZA 3ONNA 1L3CA 3GJRA 3U7EB 4EJ2A 4DGSA 3HXLA 3B52X 3EXEB 2B8EA 1OLXB 1TCUA 1EAYA 1FPMA 2ID4A 3GO4A 4YHBA 4ETMA 1QFMA 3JTEA 4M22A 1CYDA 5EMKA 1Y4DE 4XFKA 2FZEA 2UZ1A 4JODA 4PJ0Z 1EK0A 3DVAB 1VRVA 4MYHA 4UREA 2GFHA 3PITA 3RS8A 1S3FA 1OH5A 3A6PC 3R7BA 4U6SA 1E0AA 3K5NA 4MVJH 3TRKA 1U81A 2VC2B 3OOHA 1EHIA 2Y4OA 2ATXA 1W88B 4NTZA 3S2IA 1GKUB 4A8JB 3CUYA 1ZU5A 3GPIA 2HCFA 2ZPTX 4X66O 2EU8A 2O52A 4ZOAA 3S8YA 1WHTA 1W46A 1IHPA 3LZDA 2XUPA 4KX3A 4S1PA 1FD9A 4MW3A 1F4NA 2IS6A 1U7HA 4ERNA 1U8YA 5DNUA 4JYAO 4FDLA 4DR2B 2YVUA 1CS0A 2WWVD 4H0LB 3U09A 1DLIA 4AYWA 1V48A 4GHWA 4KR2A 1IXSB 1IL0A 5HVNA 2WHXA 3U0VA 1BE6A 1O54A 1KU0A 2AGVA 5EIFA 1YZUA 2IYZA 1MZPA 3JWEA 3R5KA 4V3BA 1P4RA 1I08A 3PR1A 4QXMA 1U0FA 1XAJA 4EI2A 2IPLA 1H2MA 2UXBB 2GZDA 4OP3A 5MHTA 3RIMA 3ESBA 2PD6A 4NMXB 3D3NA 2PUCA 1FSZA 1ODIA 2HU7A 3GT0A 1J2RA 1NDHA 1TAQA 4GKJB 3UWDA 2PSDA 3F71A 1Q6IA 4ZODA 2WUFA 4HAOA 4BCCA 5FYQA 1GN8A 4PN3A 1L7AA 3M2TA 5DRYA 2FA9A 2XB4A 4CH6A 2GI4A 3A6HA 1J8YF 1H2XA 2OCLA 4OKSA 4QWMA 5HG0A 4OKIA 4MVQA 1NBMD 3UFXB 3OEEG 2XQVA 3H4MA 4KRYA 2P6PA 2WSYB 3P27A 3T7KA 2JANA 4BFWA 1Q91A 4Y2QA 4ZHQA 3AL0C 2NIPA 2KQXA 1NRXA 1Z0FA 5GVSA 4RVCA 3D6HA 4MWBA 5D3MB 5KU1A 4ARVA 1EESA 1V45E 3O3MB 3FIUA 1U04A 4M7PA 3HVRA 4UFPA 1KKLA 2ABWA 2QXUA 4O3FA 4IOJA 2I29A 1YA4A 2BFWA 1K8QA 1V96A 2HI0A 3C4JA 4ER5A 1P0PA 2M6SA 5D6OA 2ZBDA 4HLQB 1OH7A 3W8RA 4N76A 1CY1A 4XR4A 3LFUA 4B08A 2AG0A 2Z2XA 3EY9A 2FFAA 2MSLA 3AVXA 3VJKA 2H07A 3N2KA 4Q7QA 3UXEA 3ESZA 3SJCC 2P4SA 1BN7A 1KS9A 1N3IA 2VHQA 3KR2A 3KTOA 3UO3A 1BU8A 2HJSA 3EUEA 4TZ6A 4ZK2A 2GWHA 3K0SA 3V3KA 3TXSA 4M8LA 3KT3A 3QXXA 4MCJA 2MU1A 5E2IA 3WBFA 3Q8LA 2OCHA 1GFWA 1TM3E 3D1VA 3QKUA 3WK8A 4BNYA 2QLTA 3CEJA 1JVSA 1Q16A 3AJ8A 3THOA 1ZUHA 3K08A 1PJLA 4G23A 5AKKA 2IGTA 5BY1A 2RKWA 3FNGA 3E35A 2GEFA 2R60A 4H08A 4LZAA 3EFBA 5ERGB 2RMKA 3HDYA 5CA0F 1WDLA 2JNWA 3P30A 3CU5A 1OCZB 3ZR4B 1VE1A 1DNPA 3LV8A 3C3CA 5CLLA 1T1JA 5C35A 1I3LA 2X14A 2X2PA 3FPLA 3U1TA 1RXVA 1P4JA 4QE3A 1CZRA 2O7SA 5JZOA 4BJ6A 4IGKA 2ODEA 3QWAA 5JISA 4E1AA 5C4GB 1YS7A 4WCFA 4AJ9A 4OHZA 3GH1A 2ZKOA 3BL5A 3M3PA 1P0FA 2XRFA 4CQMD 4F72A 4I50A 2GM3A 5EGSA 2Z5LA 5EZYA 3E18A 3D7SA 9LDTA 4BRZA 1VJCA 4GLJA 4K9QA 2K7ZA 2H18A 5CBGA 3B1WA 3C74A 1AKUA 3H4TA 1QIEA 1E1QG 4YCJA 5HCUA 4D9BA 1S2IA 2Q1TA 4GBED 1TVCA 4DV5O 2CYBA 5K3AA 4DLTA 4YCSA 1M33A 2RI0A 1GKKA 3GRKA 1LD3A 1UP4A 3M6XA 2V45A 3HDQA 3D81A 1QRTA 1FVOA 3I1FA 1NBWB 1SIWA 1WU8A 2ALJA 2YZ2A 4J0HA 2MT9A 3AR9A 4TM7A 4WN9A 1A9XA 4B74A 1TE2A 3IOCA 2VXYA 2RJOA 1EM6A 2L69A 5D86A 1VFPA 3Q85A 4I0WB 2ADPA 3G6WA 1A1SA 4AQDA 5C1DA 2BMAA 3LQ1A 4P0PB 1OKKA 5DASA 2RSLA 4EH1A 2P9CA 1BE8A 4K87A 5AUOB 3LOUA 1J09A 3S3TA 3CX8A 5IZCC 3MRXA 2SKCA 1KJ9A 1LH0A 3OZEA 3EEIA 2BUBA 3TUZC 1YVRA 3B2NA 3C15C 3R0JA 4WLOA 5EXDA 3U7QB 4QVIA 2C1ZA 1V9SA 5DK4A 1OHHA 3OW2U 2IPXA 1AVMA 2DWOA 5FBVB 3LG2A 1KKUA 5LFAA 2NMVA 5A0VA 2H57A 2W6CX 4KR0A 5DYWA 3C3AA 3T5PA 2YV5A 1SOAA 4DCOA 2BR5A 4G0QA 2PX8A 2ZXUA 2ZT7A 2AJ8A 1QG2A 4KN8A 3OAAD 3UKOA 4DM3A 1Y6FA 2PGAA 4KG7A 1Q77A 1JBQA 1E98A 1TUBA 4JI8O 4NE9A 8ADHA 4F92B 2ZR3A 5JJBA 3OIUA 4HAXA 3FVTA 2G83A 1OH8A 5EJ9A 3C1AA 3FUTA 3PNBA 4MB0A 4CKBB 2IWHA 1FTWA 1NW9B 3L0SA 4PONA 4MDYA 3RYFA 2ZP1A 3BIXA 3HB9A 5ITVA 2HBYA 1D2RA 3JAKA 1N25A 5IYZA 3PWTA 4QO8A 1KEVA 1FW8A 1KA9H 1OU4A 2HL6A 2YRXA 1TZBA 5BV7A 4ZQIA 3DHWC 3RTEA 1TMKA 5C8VA 1DRJA 4X3CA 5B6PA 1USGA 1YC2A 2RMKB 4HUJA 4ZMRA 3FPAA 1BCRB 5ILGA 3B6KA 4CT5A 3LPLA 1XMIA 1K92A 4X65O 3ZBPA 3NP9A 5JATA 1NG9A 1C81A 4R5HA 3SHOA 1E18A 3G7SA 5LMNB 1QRRA 3H8WA 1VQ9V 1T34A 1ZL0A 4Z3OA 1NU1H 3HFJA 1ZK3A 3D4IA 1C8LA 1WXGA 3IUQA 1M7BA 1E79D 3JVDA 4EJMA 4ZI7A 3S1SA 3X0DA 4P4LA 4LRQA 1YJBA 3B5IA 3ZRSA 2G71A 4BVGA 4CZ2A 4F85A 1BIFA 5THKA 5JFOA 5HXAA 3SE0A 3JYPA 1ZH0A 1IBMO 2X4IA 1Z4KA 4NBKA 3Q4HA 2FGKA 1JR3A 2QWQB 1NI8A 3CZ9A 2ZYIA 1JDPA 3PFBA 4DLZA 4NTWA 1EWKA 2XVMA 2IL1A 5HIJA 1P2FA 4UXIA 2WY2D 1W85B 2XUGA 3B1JA 3FLMA 4XM2A 1FJGB 4EITA 3C7AA 2OY0A 1A50B 4EP1A 2HCRA 4DMMA 1GDHA 1T3TA 1N7IA 3I3SR 1UIRA 4QICA 3QXSA 3JY6A 4OLAA 5FNVA 1KQSU 3F47A 3ISTA 1C1XB 1T5OA 2W5UA 3KOOA 3DUFA 1JRLA 3NWBA 4HWGA 4JBGA 4RHYA 4V38A 2F9MA 3ROQA 1Z36A 3UUGA 3G5AA 1RHMA 1UBSB 3VSEA 3ZE7A 4EEZA 4QUDA 5I7UA 3H2HA 2ZB4A 1Z6GA 3INTA 1M57B 1UJ5A 3IOBA 2XV1A 1ANKA 5DF1A 4URHA 1V3UA 3DZ8A 3FPSA 4I14A 1GY8A 4UBKA 3WLMA 5JYCA 1TKAA 1E3TA 3EDCA 2JGUA 1OX6A 3NW9A 2ZSHA 4AN4A 1TO6A 2QVGA 1H2NA 1CRQA 1GSIA 3DLTA 1BX0A 3E9QA 3FZNA 4B4WA 3IRVA 3CWCA 3D6NB 3LCUA 1TKRA 2C1XA 2PM8A 2WKQA 3KYDA 4KUHA 4MUMA 4NPCA 2XMPA 4QYWA 3IUSA 3AR2A 4KACA 3W2HA 3K0AA 4RTJA 3EQ7A 3DLCA 4JSYA 5EMLA 2QORA 2KSDA 3BGDA 1Z22A 3DR5A 1KZHA 5GVRA 3LZCA 3KS9A 4J2OA 1GDTA 2EAUA 1CUWA 4R3NA 1U7UA 1R0RE 3E83A 2CJPA 1Z4MA 2VP4A 1VJ1A 1A72A 2PGIA 2PUDA 4QNNA 1I94B 1J5PA 3E5RA 1U2SA 1ENPA 4LOLA 4F1JA 1JIVA 3FB6C 3UCSC 1NTZH 1Z0ZA 3ULKA 3I6MA 1FFXA 1DIHA 1II0A 4LBVA 3KWLA 4HDSA 1VFNA 3RVRA 4BRWA 4PYJA 5LUAA 2BMWA 3GQVA 3I5XA 4EKWA 2K4MA 3RE1A 4K35A 3NIBA 2LVBA 2XVAA 3K2BA 2I4IA 3ORHA 3TZHA 3DCIA 2QZ4A 4ND2A 2E1RA 1XRSB 2C5EA 3TSAA 1GTL1 1W0JD 3AF0A 3CHYA 1YHQV 3CKLA 4LBWA 3NIDB 3D4NA 3HDHA 4EHDA 4IR7A 2I03A 3TMAA 2H3OA 1NMXA 2JJMA 2QTHA 4KH1A 4P3PA 3S2ZA 4AO6A 2BM0A 1EAMA 1C7ZA 2GXAA 3R5JA 1TJ5A 2ERCA 3HXPA 4V0NA 3H1HH 3PN1A 4KPUA 3HJGA 4M1EA 3QYPA 4WINA 3TI9A 1U02A 2E4ZA 4G24A 5FT9A 3VO2A 3ZIAD 1NN0A 2PD4A 3N53A 4R4JA 3M5WA 3ZV4A 3WYGA 4ABTA 5KBYA 1LC0A 4HAUA 4DG9A 3ND7A 2VA8A 3OZWA 4B3TO 1TD9A 4ENUA 1HT3A 4CL8A 4IOMA 1IH8A 5ILOA 1NNUA 1VL5A 4LHWA 4M9RA 3FUVA 3GBSA 1H8EG 4OATA 2AE2A 4N6OA 1AKVA 3CF0A 5CP8A 4N5IX 1WMEA 3VPFA 4V0ME 3K5WA 4OFXA 3N2EA 2Q68A 2H2IA 1KUQA 3DMHA 4PZDA 2YX1A 3HO1A 2W71A 5KHGA 4MYDA 2AJLI 1BQEA 1EFVB 5FL7D 5KX5B 4Z86A 4D9EA 1KYWA 4AMYA 3LW7A 1NASA 4IHJF 4X88A 3FFBA 3PE3A 4N0DA 4NBUA 3TIVA 3LTNC 1P72A 1LS1A 1MCZA 1S7CA 2OAP1 4OXQA 2ZZNA 2QJRA 3QV2A 2Q2WA 4RENA 4Y1GA 3PHJA 4ZCRA 2R9IA 2JEUA 3LKDA 1ZIDA 4W9RA 4XAQA 1OFHA 2X6TA 1SGWA 3CB4A 3AGPA 4DV4O 2G06A 3D36C 3L74H 1DELA 3B5EA 3GGDA 2WT9A 1LX6A 2ZJ7A 1BMFD 3GYGA 4Y2VA 3WWCA 2P2CA 3AKZA 5FPHA 3ZOKA 5DX1A 1CWUA 4DSAA 1AK9A 4AX4A 1GITA 1QLHA 1O03A 1KMQA 2FQXA 5JJJB 1BT8A 4DV6O 1EDDA 1G7RA 2PAFA 4Y6LA 1AQIA 4X1YB 3RC3A 3IVXA 2XTJA 3MK31 2VDNB 3M9LA 4AUEA 5LHHA 1TECE 3D3JA 1FUYB 2PANA 4QYSA 4ZAWA 3OI7A 3TL2A 1HDYA 3AH8A 2H5JA 2FEAA 1PWXA 4MTLA 5CAEA 4LY6A 4NZOA 3CM0A 3N8DA 2X77A 5EJIA 4WCEV 2GBLC 3LQYA 2OWOA 4GLOA 1MGOA 4LYGA 5F52A 4E7PA 4MLPA 4YP6A 1LVHA 3ZLUA 2HXSA 3FMGA 3R7LA 4IGGA 1YRWA 1ZH2A 4D8UA 3GPLA 5CDSA 1TI7A 2OCDA 3RK4A 4BIOA 2PXCA 4FGUA 2Y27A 1PYDA 1KFBB 2QN8A 5CURA 4DMHA 5LMCA 3BEDA 4G0UA 5F5LA 3ROFA 1OA1A 4UU1A 3ZCQA 1T8PA 2EJCA 3ZLVA 2CW5A 4ZI3A 4M86A 2HK7A 4XWOA 3ETGA 1RAFA 3K1TA 5LP6C 4IQ8A 3V4RA 3BZBA 2H1OA 3K9CA 2RB4A 1QC5A 3OZ7A 3QUAA 2CL7X 4WOKA 5GZ1A 1M1ZA 4N47A 2VVTA 1O96B 2JLCA 2PCJA 4QFMA 3W77A 5TY0A 2OYSA 5HK9A 3AG1B 4GGOA 4O4IA 3B1VA 1V54B 2ISSD 1G2PA 3WJAA 5I6DA 3UJ6A 4C01A 4QGFA 4RACA 2AHRA 4INPA 2A9PA 4GMGA 1CDOA 3MWLA 2P6MA 5F7XA 4IT5A 2AF4C 2BI4A 3EXIA 1UUFA 2JG3A 4WFHA 3JD2A 3PYMA 3ORSA 2XITA 1JN0A 4GD3Q 4ZZ0A 3D7KA 1Z2CA 4WKBA 5FTKA 4J9ZB 5EPUA 1YXBA 1EHYA 1HFKA 2A1TR 4ZDIA 1QR8A 4C2AA 3WWPA 3OIVA 3DOJA 5K0TA 3ZGOA 1L5YA 1X8XA 3QHPA 1GNRA 1TGVA 5ETJA 3TN7A 4FLMA 1TOAA 2BD0A 1M0EA 3VGPA 1HQDA 1JWBB 1RC1A 2DAPA 2FUKA 2P79A 4IQ4A 2WTAA 4JWKA 4X89A 1UJCA 3AJDA 1IXMA 3KD3A 1N78A 3D8CA 5L40A 3U81A 3NRCA 3VR6H 3KJGA 3AW8A 3FMPB 4DMGA 4JOBA 2VJDA 1AB6A 1YNSA 1UZLA 3LC2O 3QG1A 1RI3A 3WOHA 3S29A 1U0BB 1DG1G 3D36A 1FLAA 4DUYB 2GHYA 2W90A 4LC9A 1WUHS 2VPZA 5LYJF 3DPIA 5EPEA 2FWAA 5ALMA 4IXWA 3VU9B 3WMRA 2YIMA 4MQFB 2QKSA 1SC1A 2KBFA 4F3KA 2BC9A 5HR5A 3O5AA 4HPWA 4J07A 2ZAIA 2WIGA 1M66A 3KWFA 4JITA 1JR4A 2X0JA 5DN6A 3CIOA 1ZBDA 2CFIA 3FFTA 4UQLA 3RAGA 3WWOA 5DECA 3BWMA 5JPIA 2ZT9B 1FXKB 4PI0A 3SGIA 3H2BA 4HGOA 5LA6A 1GGMA 1TDJA 1U7DA 3EGCA 1Z6YA 4MV5A 4KL1A 1PR3A 4PTLA 5C37A 1FVXA 4YV0A 3S0JA 5JADA 2GJKA 1P6XA 1TM7E 3E15A 1E63A 2YYAA 3DZGA 1R6DA 4FSDA 1K7CA 2LQTA 1B1AA 3RG8A 3KVRA 1C8KA 2GA8A 3V6LA 5FCDA 1IPFA 1VQLV 1R4NA 2LGWA 1T6NA 1Z6AA 3QFHA 5EMHA 5K1PA 4GR9A 4YP0A 5H4HA 2ADFA 5BOVA 4YMVA 5A5EA 1Q7CA 2CLLB 2J5XA 4IH9A 4U2KA 1IWPB 2WNSA 4OPMA 1KJWA 1M34B 5AHWA 3SX4A 4C20A 2BGWA 2O8DA 1RPJA 2INGX 2R8ZA 1KVRA 4BZQA 4YT8A 2GUZA 4EBBA 4ZQCB 4MWSA 4JQZA 2Y1EA 2FEWB 2O9JA 1VPTA 4F6CA 4X64B 3I9V6 3DKRA 5K2MA 4EW6A 1EZ1A 3A3NA 2ZVDA 2XBUA 3AEYA 4E07A 1H5QA 3FPGA 4BJ5A 7AT1A 2PRKA 4CG2A 4JYPA 5FP0A 1YHNA 2WHRA 4EA6A 4IJQA 1WQ3A 3PDIB 2AC2A 3C8DA 1JWAB 4UXJA 5DCLA 4L0CA 5C7IO 3T5DA 3I6YA 4PS0A 1E2UA 3GHYA 3JQBA 4L85A 1M8GA 3EXIB 1NMZA 3OKAA 1ZH8A 3OMWA 4IOLA 4OXRA 4PLVA 4JF3A 3T06B 5GTHZ 1ELOA 2OYRA 3UB4A 4RVGA 5KNLA 1QOPB 1VQKV 3ZGXA 3T1YB 1QQ7A 1UAGA 2ZRKA 5ERXA 4L87A 2YQ4A 3UGKA 2QLBA 2QM3A 4YVFA 5DBOA 2GEUA 4IV8A 3TIXB 4DXDA 4QGSA 3MWEA 3NORA 1RP3B 3UH1A 3G67A 4CGZA 3L0CA 1JT9A 4IZIA 3WGGA 5FI5A 2KSQA 5BN5A 3SICE 121PA 2BKEA 2FZLA 1YVEI 2EBFX 4WXMA 1HG0A 3RFCA 5CDGA 4LXYA 4YY3O 1VBMA 2YVLA 4QDTA 5IHPA 1NQ5A 4GSYA 3WDSA 1LKZA 1O9HA 1RZ3A 2HRQA 3QVGA 4Y1FA 1IY9A 4YGYA 2P9HA 2KX7A 4HNHA 1VG9B 2X23A 3EGDB 1ILEA 1F8FA 1DTOA 2A7XA 3HJCA 1QIMA 5DPMA 2RDCA 1ICEA 1P19A 4NAHA 4YRDA 3DD1A 2NTYC 3L1UA 1YIOA 2Q1YA 3JAKB 4JASB 1VI6A 3RUPA 3K1YA 1V37A 4C6TB 1KZ9A 4PELA 1CTQA 2DFTA 3PT5A 4YALA 4G63A 3SFVA 3H7IA 3EC2A 4WBNB 5L3DA 3KXPA 5CK4A 3RT1A 5DNCA 2XE4A 2RD2A 4JBIA 3OZBA 2J9YB 4Q0MA 4UATA 5AK4A 1KI9A 2ZIOA 5KVQA 3PFNA 2XMBA 1XVLA 3ZDYB 4RWZA 4EPYA 4LYDA 2ZBRA 2FPGB 1T5EA 1FL9A 4C21A 2DBQA 5JMWA 2TS1A 1ZIYA 1RSOA 1SB8A 2ORWA 2YMMA 3R3VA 4HB0A 5TQ2B 3RHTA 2VWPA 2EKDA 3A8TA 1Y0BA 4C5BA 2FUCA 2DSTA 1TQ2A 4URZR 4Q4AA 1L7RA 3OA2A 1DEXA 3DAHA 5JVDB 3LXMA 5KYTA 1LLUA 3L7MA 5BRAA 2P30A 1IHUA 5LDHA 1V1RB 1U28C 1SRRA 1G8GA 1QZ3A 1QONA 1Z6PA 4HNAB 1VEWA 1E2HA 4QO7A 1Y9DA 1O7JA 3LNCA 1BD3A 3ME5A 3MNFA 4J91A 4P4UA 4XLLA 2HM7A 2HWWA 4G8DA 3PPXA 2GJ8A 2XQGA 2WKWA 3ID6C 2F1IA 2A7QA 2O7RA 3LSYA 4R1QA 2YC0A 2GLUA 3DXXA 3IELA 1ZWIC 3LWZA 2NAFA 4C07A 3ROKA 4P0QB 3THYB 5KYVA 1U2PA 4BZWA 1YV9A 1I0ZA 3NALA 1OX4A 3AFHA 1E6KA 4M2LA 5J5AA 1N36B 2EKBA 1VHJA 3F73A 2J4CA 2YXHA 1A7JA 2JI7A 3W06A 1QRSA 2IIPA 4RFSB 3TFOA 2QSAA 1AQYA 1KL7A 1SKAA 1E3JA 4PA7A 2LV8A 3THXA 4QTTB 2BKXA 1EZ4A 2OM6A 4JI5B 1Q74A 1QGED 1FOEB 4HEHA 4NC9A 4DVJA 5IK2D 5DMXA 4DV2B 4R0VA 2CV2A 4R8RA 4KMRA 1EWVA 4LYJA 4LC0A 4P5PA 2YNMA 2RGDA 3LRXA 1G8KA 4NYJQ 1LVGA 3TZBA 4D8XA 2F2TA 3AP2A 1GZ3A 3T9BA 2XF8A 2YJ4A 1FSFA 1WP7A 1WDKA 2IE8A 2AG8A 2PX2A 2VPXA 4J1TA 4KP7A 4XOIA 3ECSA 2AT1A 2X0EA 4F4JA 5H68A 5CD1A 3VI4B 2FFQA 4DJ5X 3WZLA 1TUIA 2ZIWB 1A9ZA 3H8SA 4G36A 4LXHA 3OX4A 4LKOA 4G4GA 3L18A 3QWHA 3KB6A 4PPNA 2WFZA 3FHOA 4GP9A 2Q50A 3DMYA 1JPXA 1JHXA 4K6MA 4BNNA 1U2DC 4RL4A 5G0UA