5D5QA

Hcgb from methanocaldococcus jannaschii with the pyridinol derived from fegp cofactor of [fe]-hydrogenase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
b'VMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0488, Guanylyltransferase
molecule tags Transferase
source organism Methanocaldococcus jannaschii
publication title Towards artificial methanogenesis: biosynthesis of the [Fe]-hydrogenase cofactor and characterization of the semi-synthetic hydrogenase.
pubmed doi rcsb
total genus 51
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5d5qA01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 5d5qA02
3WB1A 1EGMB 1NBWB 2V4DA 4DK0A 1VF7A 1DIOB 2F95B 3BRCA 2D0OB 2F93B 4DK1A 1EGVB 1MMFB 4GYCB 1IWBB 5D5PA 3LNNA 5D5QA 3WB0A 1UC4B 3WB2A 1UC5B 5JJNB 1EEXB 1RSOA 4L8JA 2F1MA 1IWPB 3AUJB 5JJEB 1H2SB 1T5EA 2D0PB 5JJJB
chains in the Genus database with same CATH superfamily
4WK0B 3F7VC 2HHAA 3N5KA 4Q37A 1SCIA 2ZNIA 2EZ9A 1KQSU 1Y3AA 1S77D 1RU3A 2A67A 3DMFA 4MVJG 4REOA 4URFA 3PFWO 3SYKA 3JSLA 4M86A 2SNIE 1KI3A 3WWDA 4EY5A 4ER5A 5KNBD 3KQKA 4FP9A 5I8ZA 5FPSA 2P7TC 1HE4A 3ZV7A 4ANFA 4CKEA 1N32B 4O4HB 2A3RA 1U8XX 2JBAA 3P52A 4A2WA 4D4IA 4XDJA 3U1BA 4CEHB 1TVEA 1YIAA 1Z8FA 1LPOA 1CG6A 3RWRD 1L4UA 2AX4A 1OTXA 2J6CA 1UBEA 3BKXA 2IZZA 3CPHA 4Y2YA 3V4PB 3TS1A 4DUYO 5CT6A 4ZT4A 4C3ZA 4UHBA 3TRKA 3WRXA 2ODEA 1Y63A 3GBPA 3HKCA 1HFEL 1QNMA 2B0JA 5JRDS 4OX9B 1F51E 5JYEA 5K8CA 2HA0A 1R6VA 1V1RB 2PYZA 2OKGA 4BYGA 5A9SB 2XB6A 4PYLA 4Q4JA 2N47A 4M9XA 2WIBA 3KBBA 4K9SA 1XVVA 2UZAA 2ZSKA 4QE9A 4NIMA 4BNUA 1O95C 1TRKA 4YTEA 2O1XA 4GBJA 2B34A 4J1TC 4JP2A 2BUCA 4PR3A 2F95B 3FI0A 1Q22A 2BH2A 3IPAA 4Q3DA 4G4JA 2IP2A 4CM4B 1JR3D 1NXOA 2PM8A 4CXMA 1OFTA 2C9YA 4FYWA 3GRUA 1A27A 1XVUA 1QQBA 1S3IA 2UUPA 2RBGA 4X88A 1C2TA 4RX1A 5FHQA 4TXLA 2ZE7A 2E18A 4QBTA 3A3YA 1HFWA 1KJ8A 4Q7LA 1BQ0A 2BFCB 4KPGA 1XTUA 3H8VA 3TEMA 2BC9A 2P6NA 3GEEA 3W4KA 2O8CB 3HEBA 4QYIB 2DQKA 3QKRB 3AF1A 1ZH4A 1UMCB 3BJRA 4Y0VA 4CT0A 1J7JA 2WINI 3RSZA 3A1EA 4BLVA 3A9CA 4MVMA 4EFEA 4JLMA 2Z2YA 3TFQA 4R1OA 1O6FA 4NARA 3WAGA 2O8VA 3JCUZ 4KE7A 5KSPA 1ZL8A 1KZYC 3D4IA 1RYYA 4YI3A 1UXKA 3CUKA 3C48A 2BM8A 2Q3MA 2XXAB 2DPLA 3ELUA 5CA0B 2B2XA 3KOMA 1GNRA 2BBTA 3GG2A 1MNQA 3OC0A 5DHSA 5FBWB 5HE9A 3SDBA 4WCFA 3KCNA 3KYCB 4NBRA 4XM0A 4YMIA 3FAKA 4I5EA 3G2KA 4WLVA 2HGSA 1LDYA 2WAYA 4H3KB 4BX0A 5A2QN 2FPIA 4D3XA 1T3LA 4Q4CA 1RSOA 1Z75A 1VA5A 1NFQA 4LF8B 3K0GA 1AF7A 2NTJA 3D6HA 1PL8A 1E2IA 2A0KA 2HDWA 4EL5A 5AJWA 5C51B 2Q7EA 1S5HC 4G0YA 3RYHA 2ZTUA 3I52A 4JKOA 3TZLA 3OT1A 3TEFA 1LLFA 1T43A 1BKSB 2PT6A 1GGFA 1JVBA 1PG5A 4JJ4A 1X39A 1EP3B 3WQRA 1PS9A 2NU9A 2P62A 4PHZA 2QRHA 3PLNA 1XFDA 3IDSA 1KMIZ 1LPPA 4TL6A 5DBEX 3T1QA 1BMQA 4CDNA 4BP1A 4UVAA 1PNKA 5BSUA 1N2CA 1RHJA 4CTKA 3NJRA 4YP7A 1WXHA 2J5KA 1PR3A 2C4HA 5DM2A 4Q16A 1N0VC 5KA5A 1UMBA 3NHWA 1T2UA 3FYUC 1KEUA 5TISZ 3ZKWB 1KEZA 3E27A 1JQ5A 2YZMA 4YROA 4BMCA 3KZ1E 1T3GA 2EIMC 4PPNA 1C7QA 1DPFA 3DMPA 3DEJA 3FR7A 4KBGA 4KMSA 5FI1B 3JYHA 4D74A 5CFPA 2GN6A 1GKIA 1D0IA 2JASA 3DFZA 3LW7A 3I55V 1E5QA 3NAQA 3EZXA 4DBVO 4DLBA 4E09A 5IVKA 4OLHA 1ZKMA 3OQPA 4ZQIA 4DQLA 3EIHA 3OIYA 2ZWVA 4OSPA 3N8HA 5MHTA 4WKNA 5IJXA 4KIGA 3AG7A 1HNXO 1D0VA 1T0PA 1ZH6A 2J9FA 4IRXA 4L9RA 5KHGA 3JVDA 5KAMA 4NESA 2Q5JA 5IJZA 3HVHA 1VG8A 1Q0SA 2I65A 1P7BA 4WFBV 2VCYA 4FPXA 5FTKA 3JQAA 4UM9D 5EA2A 4COOA 5CEFA 2J33A 3K1YA 4NZ9A 3H1FA 3SYMA 3FB8C 1QYWA 2YQ4A 3QU5A 3HXPA 4NS1A 4CWAA 3U4MA 1G6KA 4YASA 4CMBA 4G37A 1YSCA 5BSFA 4YCSA 3SR3A 3AF5A 2WTUA 4UHHA 3CF4G 1M0WA 1HKHA 2NTEA 5TMBA 4OQPA 3S70A 4BVBA 1W9MA 3B5JA 1BXKA 4B73A 4ZI5A 4DW8A 1UJ2A 1QLWA 2JHAA 3L8DA 1IY1A 2JLUA 5IF3A 3VR5H 2IX9A 4DLSA 2Y1DA 2R8OA 3W7SA 1P3JA 2EIKB 4X8MA 2XCQA 4OGLA 1Y3BE 5EXTA 4JZGA 4LF9O 4OMCA 3VPAA 2J45A 9ATCA 3UPTA 1J1UA 2HCBA 4XIGS 2W6NA 3UT5A 1MV5A 1Y1KE 3BSFA 4WZAE 2H4XA 4CKXA 5KVAA 2GPTA 3PKIA 4TKUB 1SXIA 2ZZKA 2AZDA 2HB6A 1CQIA 2ZB4A 1B6TA 2VQSA 1AA9A 1TYAE 3DAGA 1BD3A 1M6NA 4HAMA 4RL4A 5DJ5A 3K9SA 2DAPA 4MHSA 1BS2A 2CCKA 3UT0A 1O6CA 3L8FA 3P26A 2DFKB 5DN6G 1E3IA 2PSFA 2IW3A 4MP6A 4NJMB 4R2WA 4R84A 5DGDA 2VJDA 1K4MA 3RHZA 3ZWCA 3E23A 1V7QA 3HADA 3E58A 4L2IB 3I9NA 1EXDA 1DO0A 3DTTA 1HDCA 1EIWA 4D92A 1MC8A 4KQJA 2BFCA 1EGAA 3L2OB 4LYGA 1JQLB 3U4IA 5DXJA 1QG0A 1SBQA 3ZC3A 4BNMA 1N9GA 3U80A 4KU4A 1M33A 1C8VB 1Z7GA 2WU0A 1JDZA 2FPXA 2PGDA 1YRLA 4ZEMA 5MGNA 1CF9A 1V7ZA 3DF7A 1SBZA 5KHAA 2FZWA 3KZMA 4FDAA 4LRQA 4OJMX 5G4LA 3HMQA 1Z6TA 5JTUA 1H8EG 2OCCC 4NMMA 1XYGA 2EZ4A 5FIUA 1YDGA 2F43B 1HEYA 2FK7A 4J8PA 4Q1AA 5KAIZ 2GPAA 3K71B 3BEDA 3I2YX 3JQFC 1MDBA 1KUQA 5AWFC 2CLOB 3TDMA 1PR5A 4LZPA 4OHUA 1RQ2A 2IZ0A 3S8EA 1QGED 1RLTA 3NGXA 5EIWA 5EY5B 3VO8A 4F71A 4QYSA 3EWIA 3HDJA 4WFIA 4DKXA 1N4CA 1F23A 4C03A 1HK7A 1U65A 4CM9A 3KEMA 1NBAA 4RMNA 2JJ2G 4C21A 3L1KA 4KLAA 2DQ0A 1L8AA 4E2YA 1R3JC 3MTAA 4RUEA 4XX1A 3FHTA 1MG5A 1Z5UA 4G4IA 1M1UA 4F8YA 3BZWA 2AOUB 4TTSA 2CNDA 5TQVA 3QO5A 2P4QA 3H8JA 5EJ8A 2H94A 1VHWA 3IV9A 3IXQA 1YVEI 4BOYA 2HRQA 2N1BA 4JBGA 3MJ4A 5ESRA 3WGYA 3PHCA 4JLAA 2LWIA 2B83A 4ZTBA 1RBMA 4UBKA 1ZAYA 3ZU2A 4AJPA 5EMNA 4UEOA 1IAQA 4DW1A 1WO8A 1YOVA 1AQLA 2ANBA 3KT3A 3P2IA 3Q40A 1EVJA 1TAHA 2V4ZA 4M46A 3UM7A 4QYMA 4Z1MD 5J2UF 1WBBA 2LE0A 3DVAA 3EJWA 2AJCA 2DR3A 2NZJA 4L3OA 4DIFA 4EUHA 1FX0A 2N1MA 4RELA 1IU9A 4C0SA 2I34A 4PZ9A 2J41A 4I1YA 1GRCA 1CZOA 1JT9A 2JJQA 1A8IA 2VJQA 1NNSA 1ZO8A 2H00A 3IAS1 3UNXA 4WXPA 5EIFA 4BGVA 4F5WA 1PFWA 1D5WA 3N5CA 4P3OA 5FJIA 4D4JA 3VA7A 4BNFA 1A72A 3LA6A 3KFXA 1HYBA 5C5EA 3D3IA 4MWBA 4ZVKA 2C57A 4X1YB 1RZRD 3WJ7A 2VJMB 1VJCA 1SG0A 2RC5A 1HLFA 5DWDA 3T9FA 1SFRA 3GLKA 2AYXA 4EG3A 3BCRA 3I32A 2GK6A 4J2TA 2QUBA 4W8OA 4XXHA 3GB9A 5A62A 1TM1E 4Z4HA 1UKCA 2WKRA 2YTZA 1JYSA 2YIVX 3K5IA 4FXOA 4XIIA 2P3SA 4X8AA 2ES4A 1TQHA 3FDXA 4YT5A 3AR9A 4KDEA 2EOAA 2NVUA 3DB1A 2GZHA 2FF5A 2AG1A 4BIIA 1X1AA 4II7A 2GYWA 2Q29A 3D64A 5DHRA 4FT4A 1UQRA 1VDZA 1YDHA 1E18A 3EXIB 1E2JA 1FS4A 3FKQA 3NHZA 1TC1A 2XNHA 4PYOA 1E61A 1EN6A 1QUFA 1NL3A 1UXIA 3AI3A 3BE5A 4WXRA 3IT2A 3VR2A 3WDSA 2RGBA 1IAVA 4IQ0A 3WKEA 4CU5A 5JARA 2HA3A 1BA3A 1GA1A 5EOVA 2MR6A 1CDDA 3ETGA 1P61B 1YZTA 2V45A 3U10A 3DGFC 1SIOA 4JLVA 2PMEA 2BGIA 1YBVA 4MUYA 2Z4TA 1B7GO 1R6DA 3B1KA 1NKSA 2JJ1G 4FD3A 2H1FA 1NG1A 2LKDA 2YFQA 3GW8A 4OO3A 5IM4A 4BRUA 1OX4A 1Z17A 2Z9DA 3E7XA 4HLCA 1SHTX 1VP9A 3P5BA 4M0LA 3U0VA 2OC9A 4MGYR 5A4AA 1R0BA 1FFSA 1I5OA 1JQDA 2ZBEA 4L5YA 1JTEA 5KNDD 3VDRA 4DA9A 2VHQA 4K9NA 1WEKA 4FM0A 4QPKA 2P7IA 4D41A 1M34B 1YJ8A 3TXXA 3QOYA 1VL2A 3VC2A 3D5QA 3EXFA 1Y8QB 4M0FA 4JXZA 5KQLA 2WIAA 2J7PD 4ASUD 2Q2WA 1O5IA 5JG7A 1RJ9A 4EA6A 4NXNB 1FTQA 5ENVA 2OXRA 1ODLA 1ZR4A 5TQ0A 3CCFA 5HRAA 2ZXFA 5FFNA 5TQJA 3WL6A 3WR5A 5J63A 4Z4FA 4A36A 5J2TB 2HWYA 1Q1GA 1KDTA 2GCIA 2E89A 1UKBA 3EG5A 3PZBA 2EBFX 1UZUA 1I1OA 2N46A 4AWAA 1W29A 4NPHA 4BJ3A 1Y81A 4B1FA 3V2HA 3L8YA 4OQYA 7ABPA 3ENKA 1Z68A 3KLBA 4J16C 1CUYA 1SG6A 4JHLA 1ZBDA 3KOZA 4N9QA 3V8NA 5KCMA 3V8VA 3GAFA 4EEKA 2UXCB 1GIAA 4AKIA 1NW5A 4B5KA 1NVVQ 1ULZA 4Z3OA 1IZ9A 2ZSUA 1JU4A 1JB9A 3HBJA 5DI3A 2DHRA 1I4EB 1SF9A 1HE3A 5EE5B 3ZNNA 4PY2A 2J09A 3IBGA 5T4EA 1Z16A 3UG7A 2X3FA 3EASA 4H7JA 4GM4A 2IHTA 1Z2GA 4FLTA 1KOLA 1NSYA 1PBTA 2FW7A 4JI6B 2X1HA 3EUFA 3MAJA 1WU7A 2DY0A 1RLOA 2YFKA 4MW8A 5BQXA 4CS2A 3L1VA 3FPSA 1ZRHA 1DXQA 1FUEA 3JYNA 3TUZC 1CCWA 3PUYA 1ECCA 1LF0A 3C85A 1GPNA 3OT1B 2Y77A 2X6TA 2RH9B 5CTAA 5TGTA 2IGBA 3UQYS 4ECAA 4LV6A 4DLTA 2WAMA 5KQMA 2QLTA 4PLTA 4UV8A 1XBLA 5JROA 4YRTA 3ZE2B 5T41A 3VR1A 5LA6A 5DGTA 5IS2A 2WTAA 1R9NA 2H57A 2P3OA 5C8YF 3CCMV 1S2NA 2B7BA 5D6OA 2D1SA 2WYIA 4QODA 4QA9A 4CTJA 2IHVA 1WR8A 3MFYA 1COWA 5AUQA 4ML3A 1ZD9A 1WB6A 4YT2A 2YS8A 1NNI1 2BR4A 3OQIA 3OX2A 2WBLC 4R51A 5AVWA 4FINA 4OHXA 1PTKA 1MLDA 4O2BA 2JFFA 3DOUA 4AP6A 2DSNA 3TW6A 1X87A 3HA2A 4ZVTA 3WGMA 1DBPA 3AR5A 4E4EA 2Y0BA 3UMBA 3IQHX 4N8DA 4D9MA 1N9ZA 2Y1WA 5CFMA 4N5HX 5EJ7A 2B9ZA 1NU6A 1Q7GA 3IP3A 1KSHA 3MW8A 3QXXA 1Q86W 1BC5A 1XNQB 4NR0A 1AQJA 3GWKC 3LT4A 9LDBA 4PSAA 4RKEA 1DK1A 1X80A 3OZIA 2PQ0A 2JA2A 3PHGA 5EXXA 2PKQO 4P5EA 2GHQA 3NEJA 3TBHA 2CF5A 4EY4A 1NJIW 1XD2B 1RS0A 4HTFA 4U2EA 2PIAA 4U2FA 1FNCA 3VMMA 1ESCA 3IAYA 2XASA 1DEAA 2V54A 3VBBA 3OHPA 3NWJA 1IPEA 4NJEA 3HLYA 1WXIA 4AURA 3DZHA 3CGGA 2PZBA 3IHWA 1CUZA 1NKVA 2PAAA 3GI1A 1KYWA 1XREA 1B15A 3GRCA 1C41A 4QGAA 3RNLA 3BD8A 2TMYA 5IXSA 5IZCA 3D6JA 4CEIA 2GBCA 3BKWA 1EQAA 1AXGA 3QYAA 4KQIA 3IEIA 1NW4A 4HAVA 1SVKA 1WPBA 2IXAA 4M83A 2PXCA 2PYLA 1CZRA 3L77A 5B7GA 2WB2A 1UBTS 3H16A 2JD1A 4Q7MB 3T1HO 3HFJA 3KL2A 4QWMA 1GH6A 1U0TA 5DULA 3C1UA 6ABPA 1PFYA 3VPSA 2RJOA 2GBFA 3W2HA 1KMCA 1V16B 4KN6A 4NI5A 2BGTA 2P67A 5EERA 5F1OA 1FMTA 4TL9A 5B1EA 5JBIA 2QU8A 5C5IA 3F5FA 4LVCA 2JLCA 4F1JA 4RTPA 1YVWA 4M1WA 5H82A 5JMPA 1BQ4A 4U7DA 1GXSB 1J8MF 5DW0A 4YJ2A 4OYHA 2OFOA 2EF0A 3FHCB 3AKDA 1CZNA 1RHMA 4AJIA 1BJTA 4I9HA 4AO7A 5LSAA 1NF9A 2G4LA 1DBWA 3TOXA 1X7ZA 4LI0A 1O57A 1N6NA 1AJPA 1T24A 3DXRB 4CF5A 4DJDC 4P9NA 3WGNA 3G23A 1X3SA 3DFMA 3QTBA 5D3MA 3COZA 1NJGA 2XMPA 4WZAA 4XVHA 3ZZMA 1JV2B 1L5SA 3BB3A 4JI2O 2FWJA 3Q6IA 4PZDA 2KJQA 4IIGA 2BOBC 3P27A 5H6RA 3LSQA 1W75A 2QTTA 5F9MA 1TEVA 1U2EA 1IM2A 3NG1A 3SR4A 3FYTA 4LZOA 3K73O 4RPKA 3ZDXB 3BDVA 1Y48E 2RB5A 4PHCA 2ZE8A 1DXYA 2JFYA 4MULA 5C4GB 2XADA 4OK6A 3AM3A 1L4YA 1S3GA 4INOA 2RE8A 4BDTA 1ORDA 2X8LA 2Y2VA 4RETA 4BP8A 4IVRA 2VJYA 4XSVA 3AEQA 4TX1A 3SHQA 3AVYA 3O75A 2KI5A 1X2BA 2XCUA 5CBPB 3I39X 3JQ6A 5K51A 4ZDKA 5TLSA 5DM70 2D13A 4MUEA 2NP6A 3IBCA 3JPYA 4AI8A 4FIDA 4TV8F 3ZDYB 3ZOKA 3OTFA 4UD6A 2AGAA 2OQRA 1TVKB 1TE2A 2XAAA 3ZLTA 4NK5A 4TWJA 2BKAA 3CISA 5CTJA 5EESA 2CFTA 3W1WA 1MZEA 1U8CB 4ZIRB 4P0QB 1U6IA 4BO4A 1B6RA 4IHJF 2XE8A 2TSYB 3A06A 5B36A 2JVDA 4WFGA 3FKSG 1BIFA 3W5DA 3R8FA 5M2QA 1V2HE 5IKOA 3N7AA 3SLKA 1FKAO 1QIJA 5JAIA 2HX1A 2BE9A 3KELA 3K6SB 4RFLA 1QYRA 1HT3A 3MUEA 3WRYA 3LDEA 4L8JA 1VCIA 4L8YA 3UCFA 1A97A 1JEEA 3VH2A 1OH8A 4GRDA 4IDPA 1G3RA 4OB7A 3QVMA 1JKXA 2UZ1A 5K0ZA 4P4NA 4FX2A 4K9OA 2GTAA 3D4PA 2FCAA 3OY2A 4MPPA 1T35A 1Z39A 5EMJA 5JAHA 3A36A 3C43A 3HN2A 2HF7A 2H9YA 3GUZA 3TI7A 1QE3A 4C05A 1CRPA 2AZXA 4FOTA 3R8CA 1XV5A 5GGXA 3MNFA 2DTEA 1K86A 3EDRA 2YWRA 3KT8A 4OAPA 4S0XA 1TTTA 1UBGA 3ECSA 3U17A 4QJIA 4IXDA 2GBLC 2IYVA 2H7CA 1TA4A 2JAXA 4CKEB 2GD6A 2JLAA 2PHZA 1PI3A 3ZUPA 4P35A 4OG2A 2R86A 1KK2A 3KVRA 5JO0A 4J10A 3EW9A 4DFDA 2FW9A 5HCIA 3L7MA 4I9UA 2FRVA 3Q15C 1YQEA 4KJXA 1VBKA 4D9NA 1ZMTA 1RMTA 1NI4B 3WIOA 4IUYA 3RROA 1ZITA 2ZTLA 4S35A 5B3KA 2JIDA 3UJDA 4R4JA 4HNSA 2H1CA 5IXJA 2QK4A 1U0HC 3KKPA 1Q0QA 3C6KA 4NENB 1VP7A 1KK3A 1UANA 2QEXV 1U28A 5JY1A 4JC0A 3JR7A 1U9CA 4RLQA 5LNK6 1PU2A 2GUZA 2DBZA 2WYUA 1MPTA 1F3LA 1Y8RB 3WLFA 1R3LC 4RULA 2VA9A 3FTCA 4PR0A 1UT8A 1TLFA 4RTKA 2NZXA 1CERA 1Q57A 2A1TR 2F62A 1W0JG 4FFBB 2Q3BA 2EWMA 4PYMA 4XAQA 2AQKA 3G2IA 4IVPA 1RE0A 2QXTA 5J2UB 2QE6A 4TKZA 5IAJA 1HFJA 4ENSA 3CRVA 2UZ4A 1EBFA 2QAIA 1CNEA 1RYDA 2BCJQ 4NE9A 1FVFA 2HW8A 2VQ3A 2IODA 1BS1A 4NCNA 1XVTA 1SC5B 2OBYA 3C3KA 4MUFA 1X7XA 2KW5A 4B85A 1MC4A 3PQ5A 2C31A 2FN3A 4CQMB 2DETA 821PA 1VHJA 2Y1CA 1AKWA 2FP4B 1IHOA 2Q3EA 1FXWF 4Y30A 5K3OA 3N86A 1CP9A 4EBFA 1N8KA 1RRMA 1ZOOA 1F7YA 2P5YA 1DS6A 1KOFA 4JP3A 4RJLA 3W06A 5B5SA 4K35A 3EVTA 1ZI8A 2XI4A 3KOUA 4P4TA 1NNEA 1KECA 1VPLA 4AKSA 1LPMA 3R1IA 4D81A 3QUCA 1N78A 1Z62A 3AYXB 1RXWA 2OCBA 2BRUA 4KH0A 1GGJA 1KF0A 2ORIA 1SXJD 4MWSA 3R7DA 2VRBA 3T41A 4N0PA 4CU2A 4EUNA 5HRCA 1TMKA 1UK8A 4CM6A 1G8HA 5DTEA 5FWXB 1CSEE 4G67A 2IWRA 4CS3A 4N3NA 3ROGA 1XX6A 3VJMA 1AM4D 1NJ8A 5C7YA 4MEJA 1LLCA 3MJCA 4I5FA 1QONA 4K7JA 3UOGA 2NUPA 2AWOA 5EINA 1FZQA 2BOVA 3QTTA 3CLVA 5EWLA 3OD5A 1BO6A 1NPDA 4LYDA 3W6ZA 3EAFA 2H5EA 2A14A 4U0JA 4TT3G 1S02A 3DXFA 2CNNA 3MA0A 4OQLA 4WAUA 3CUWA 5ETJA 3WK8A 4E88A 2PRIA 4B87A 2BCGY 4O33A 1QRRA 2WDZA 4H1UA 4HRYA 3HXOA 1E89A 1ZU5A 2PSDA 1U3GA 1RAAA 2YKGA 3V4SA 1TUGA 3K72B 4J29A 4WK4B 1KVSA 3AYZB 4DMUB 1Z3IX 3TQFA 3HB0A 3KWFA 4RM3A 3H9QA 4O2RA 4AKEA 4FVMA 5B4VA 2ZBQA 1RWXA 2FQXA 1AHIA 1LB1B 1QU7A 1PEKE 4X64O 3OLVA 4HDSB 5I4IA 4GYKA 2NZ8A 4FGSA 1VQPV 1UUFA 4J91A 4PO9A 3V8QA 5SZHB 4EO7A 1K3TA 1SCJA 3P0JA 1RZVA 4F3RA 4Y2HA 1XL0A 2XCTB 4BGIA 1E5XA 4JU8A 4OCZA 2Z5UA 3AG1B 4L72A 4EF4A 4I08A 4F9TA 5JFOA 4ZHQF 1H94A 1CJTC 5BY1A 4QLAA 2QRJA 1JDSA 4DSAA 3AV3A 4LZLA 3LHDA 2O3QA 4FYIA 3AKCA 3JAMN 3D8RA 3GRVA 2AX3A 1Z6GA 2OC4A 3MBKA 3QP9A 4FFSA 3TLEA 3GLTA 5C8DA 3O0DA 3OOSA 4Q48A 5KNDA 1QC5A 3HXQA 3K6SA 3ZDBA 1ESEA 1ZG3A 1FJGO 2RMKA 4RIHA 2FE1A 4DQVA 1JF8A 3VSDA 1A96A 3DMRA 3QO8A 4NS4A 5C46F 3NOXA 3EC7A 2VA8A 5D3ZA 2P22C 4PELA 1JPNA 5FEMA 2DY1A 1EFTA 3T3EA 5DTMA 3OBBA 2E82A 5I7RA 1KZ7B 1L5RA 1MVOA 2MSWA 3ZCRA 4KPYA 1XZ8A 1NI3A 4OMUA 2Z04A 2YYSA 2LGJA 1P62B 4COKA 3LUBA 1NDUA 4M3NA 1WS6A 2FSFA 3O93A 3FPGA 1J70A 3TL2A 2NUPB 3EQ7A 1L5KA 3DDOA 3UGJA 3IUBA 5CFNA 3HBAA 1R6UA 3WBKA 1ADBA 1EUDB 1KXJA 1BMFG 4FFRA 2HRCA 1TJNA 2O7NA 4XPIB 4TRNA 4L15A 2JH3A 3AI1A 3UICA 3V7NA 5LQJA 1QORA 2JCSA 4JTCB 2FPRA 1M5TA 3CH6A 1QVAA 2Z5LA 1IHDA 4PHTA 4DZTA 1E1RA 4B8WA 1NT2B 1DKNA 3TLZA 3USZA 4BJ6A 1KH2A 3T4DA 2WC1A 2XH8A 4FHDA 1ZCJA 4LYHA 5KOHA 1N5KA 1YCHA 4FJ2A 2FN8A 3ECCA 3QFFA 4GZMA 3UC5A 1X19A 2DUNA 3W7TA 2FKAA 2ADFA 1NX6A 3K06A 1MMFB 2H92A 4X3OA 5DMXA 3WKAA 4JB2A 2WLHA 3QE2A 4Y0NA 1CR1A 1Z6PA 2WA4A 3DA8A 1YFJA 4JENA 3ABTA 2IT1A 3QBDA 2O14A 1EJ0A 1TUBA 4UXNA 2G6BA 3V2UA 4ALJA 3FPLA 4CMAA 3L84A 3OF3A 3WTBA 4PG8A 4H60A 5J4LA 4NV0A 3TFWA 3TSYA 5A2GA 4Q4HA 1PK9A 2FMTA 5LXTF 3LYHA 1DCFA 5JHHB 1M54A 4QGBA 4B3SB 1A1SA 2SKDA 3FFAA 5HKBA 2WUGA 3OU6A 4OA5A 3TUJC 5KSWB 1T0BA 3I01A 2GUZB 3IMFA 2VTBA 2OSVA 1DLBA 5ANRB 3ISJA 4Y1GA 5IYZB 2ADQB 1X14A 1G5HA 1F2UB 2F8MA 4L6IA 3DKKA 3C7KA 1CJBA 2CYAA 5AOBA 5EJ2A 3W2TA 4CIYA 4YJ3F 4IPTA 2FZ5A 1KU9A 2XT0A 1USIA 3AI2A 3ZV5A 3A0RB 4M7WA 4E5YA 5H16A 5E0KB 4LFBB 3WNDA 4BFXA 1FFGA 4OBEA 4OQ4A 2FSHA 5BW6B 4B8ZA 3OO1A 3AILA 2IRWA 2QAGA 3DE6X 3K9NA 2HADA 4Y1RA 1OLOA 4EPVA 3KQMA 4ZYYA 3FOZA 1U0BB 1N3YA 2HJSA 4BRWA 4A0RA 2VNHA 3LBHA 4EFLA 3ZDFA 3CZ5A 1IZZA 2VDVE 5L6LB 4C7XA 2P9BA 1P2VA 1KQOA 5THXA 3VR6A 1JVMA 2Q3LA 1Y80A 4BVLA 2BEUB 4TLDA 4CMHA 1IATA 1UQUA 3U3XA 4KXWA 2W8BA 4L78A 3WMWA 3G6EV 5FOQA 1I5YA 4BP3A 2PI5A 3CNBA 3GCWA 3MWFA 3R3SA 4WN3A 3INYA 4B3TO 1DIRA 1K92A 3F8TA 4ERXA 1RXIA 3I4FA 1JWAB 2IP4A 4OA8A 4PSKA 4H1WA 1DLIA 4ZI3A 2HJRA 3GFVA 4C14A 5A2QA 1IUPA 1WPGA 4F3KA 4G8CA 3AF0A 2F3SA 3S3XA 3COYA 4HEJA 4L3VA 1MABA 4OJQA 5C1DA 3EFBA 4RPHA 4B4WA 1IY9A 4Q66C 2QLLA 1N2JA 2QMYA 4LKRA 1E1MA 4V0LA 4ZD6A 4YP6A 4RTRA 1YRYE 3PWZA 2FV8A 2AXEA 1L6IA 2RHTA 1BFUA 4IIEA 5K3AA 4B8YA 1HYGA 1DIAA 4KXRA 3OCWA 2I7DA 5ECYA 2X4LA 5B58T 4C20A 1F0YA 3TGPA 3ZGXA 5DASA 1NXPA 5IKMA 1KD1W 4D4MA 4OHRA 2R8BA 3G6WA 5C1PA 2P2LA 5ITVA 4P4UA 5HJ2A 4JI5B 2IVFA 1RWQA 3NALA 4RYLA 4J0KA 5FWAA 4H59A 1C29B 4XVUA 3BTOA 5FA8A 1DKPA 2X7XA 3H83A 3HJNA 5TB5A 3W7VA 4AU1A 4DDTA 4MHTA 2ZIXB 4P54A 4BB0A 4FQ8A 2K5UA 3PUXA 1NMQA 1RLMA 1V4NA 2Z95A 3RODA 4TYNA 1VP3A 5L4NA 4ESOA 4DV1O 2JF0A 2C07A 3L7DA 2DGDA 3BBLA 3K31A 1B1CA 3L1IA 4PIPA 4GKJO 3D0OA 1F5NA 3IUSA 5KJEA 1R73A 4R6XA 4LTNA 2GVNA 1TD9A 4H7PA 1XKQA 1AS0A 5EC8A 2V7BA 1GG5A 3ZHYA 1ZH8A 1WZCA 1RC0A 1TCAA 1C8KA 2PSHA 4LWPA 4K87A 5CITA 1GRVA 3WAJA 2Y4UA 3LF2A 3R3UA 4EGSA 3TX6A 2FY8A 3OICA 3RPEA 4B4KA 1W2HA 1S2MA 1QE5A 4NB5A 1Y74B 1DAIA 1SVOA 4F5YA 1CEYA 5J4VA 2IE0A 3DJFA 4M9QA 5THQA 2GHYA 1SBYA 2ZVJA 2D6FA 1WXWA 1BJKA 2YFHA 1B2LA 3PF9A 4GU5A 3S2ZA 3ZX5A 4HJRA 5ITZB 1MA3A 5I9IA 1OPRA 4B3TB 3DMNA 4RTOA 4OHVA 1DTEA 3M1YA 2NXWA 5FT9A 5C8ZA 2CN1A 1WKBA 3TKYA 3BMCB 5AOCA 3BGVA 5JOQA 1QQ7A 4QJ4A 1N2XA 5HIKA 5FQOA 3L7AA 3ZKAA 2PO5A 4H33A 3CMMA 3PDUA 3UB2A 1KEEA 1QQCA 2VJKA 3EZNA 1HLGA 1CY2A 1JU9A 2VP0A 1EUCA 3AG5A 3B2QA 3EFFK 2EFCB 2IFTA 3CX8A 2OLKA 1IN7A 1DAMA 2GHRA 1PQPA 2VT3A 1SQGA 1A5AB 3F6YA 4N49A 2DFTA 4XFDA 1C9JA 3ICXA 1EP9A 2BKLA 2EZTA 2RJ3A 3CVJA 3ENQA 3I12A 4HXFB 2ZRDA 2IYUA 4QUIA 4EX6A 4KQMA 4YCNA 1ZR2A 5CDYA 1JE1A 2WU3A 4O0LA 4WQMA 3CXUA 2Y8EA 10MHA 4M36A 3JQEA 3T54A 2NU6B 2FSSA 2ZXEA 1ULBA 5TS3A 4GM1A 2ZUTA 1O9GA 3TD6A 3QMPA 1Q16A 2DHCA 3TX2A 2PZMA 4OTZA 3GO4A 3I04M 2NXEA 4RTLA 5GQSA 2JKVA 2G1JA 3IAS6 2ZBVA 4DIMA 1CKEA 2ZIWB 5JS6A 1AKRA 4XYGA 3BYZA 3CMAV 3RS7A 3M34A 2XMSA 1L4LA 3OTQA 4MWZA 3W6NA 4BLSA 1NAIA 1N75A 1AKNA 3COSA 4EABA 5H0IA 1JLLB 3ND9A 4O0MA 5LMCA 3GLIB 5AKIA 5AIBA 5I4CA 5A4DA 2F7SA 4OL9A 5J2TF 4BV8A 1H2MA 1X6VA 2XKJE 1XUQA 2OXCA 5IMSA 3WLAA 3PQDA 3VVLA 3H5TA 2QTAA 4WJLA 4JYAB 3UV3A 4OMFG 1JFVA 5B1AB 4ZZIA 2YWXA 3FH0A 1PNOA 4O1MA 4E31A 1FMFA 3USES 1JIQA 2RGRA 1QFMA 4E5SA 3REQB 1KAMA 2XMQA 3L7LA 4UOQA 3D6AA 1ZICA 2VAPA 4JOCA 3SSOA 3NIFB 3NDJA 1NONA 3C24A 3QVVA 3O4FA 4X6YA 3FGZA 4BMPB 3FYEB 4MRMA 1SC9A 4I4TA 3UANA 3O74A 5LKRA 4D8VA 4UHEA 3LF1A 3VQWA 1GPJA 2PSEA 3SYPA 4OKSA 4ZC8A 1OKKD 4UCWA 1QIKA 2C5LA 5KYYB 2JK1A 1EHCA 3HC7A 3R6TA 1QWOA 1P7YA 2ZUBA 4I1PA 3Q72A 5F98A 4PPFA 3UZUA 2J5QA 1AROP 1HE2A 4FC6A 4TN1A 4LJ4A 2QTGA 2UYOA 1ZVKA 2AL7A 1GVHA 3NBFA 2A0WA 5K4HA 1WVGA 5B3JA 3O82A 4R3UC 2QKYA 2SKCA 4TTPA 1POWA 1KERA 3D6FA 3DZBA 5JAUA 1OFUX 1ZGBA 5HUJA 5M29A 2C1ZA 2EJBA 1YCDA 1NULA 2IZ6A 2XLCA 4CTNA 3D5TA 3O26A 1OKKA 2E5WA 1AVTA 4HJXA 2HZ7A 2NU8A 3S2UA 4BFWA 3RM3A 1SQ5A 3ELBA 3VV2A 3K2IA 1V6CA 2PT5A 1QNFA 3ABUA 3C8DA 3DBVO 1C1XA 3GEBA 4QFDA 4XJTA 4WACA 4GMFA 3CE2A 2GTPA 5BW8A 1MT3A 1IY0A 3BIJA 4OQZA 3H6KA 5B7NA 4QULA 2LTAA 5KUTA 3ICEA 4TV9A 2PD4A 1N0NA 3SPHA 4KWCA 1EEXB 4MKIA 4LCUC 3GJ7A 2Z08A 5GV7A 3GLHA 4BCCA 4CDMA 3THWA 2FEPA 4ZI7B 3TLCA 1GU0A 3G7NA 3UKMA 3WADA 1BHO1 2JIBA 3FNFA 5CDGA 1E69A 5DLDA 3WWEA 3QYFA 4JH0A 2CNLA 3ZN2A 2OB1A 3KPYA 2HK7A 4TVSA 1RWPA 3PHJA 2PYJA 4EA7A 1PQ4A 3FPAA 1F1BA 1FLNA 1XNHA 4OXNA 3D6TB 3H5IA 1E32A 5CGZA 3NEAA 3BXEA 3B12A 1XWWA 3CT4A 1Y6FA 3UB4A 2H0AA 1IUNA 2HRRA 5DT2A 2GDZA 1R5OA 1T9CA 1U4OA 3DYBA 5EHNA 1P4SA 3O3MB 4ER0A 4FZ1A 1WPRA 3KDSE 4ZV4A 3A4TA 3RG8A 4I4IA 4WBNB 2FPLA 4EVIA 1I4OA 3FB1A 3CZAA 2VF8A 4HDAA 5CR9A 1XHLA 4Z2WA 2AC2A 2Q5IA 2QR2A 3DW3X 3H3JA 1JQ3A 2JIZD 2ON6A 3CHXA 1OW3B 3EZ2A 5FPYA 4QHSA 3QVOA 1J2YA 4O4HA 2JBAB 2VQEB 1S96A 1XPJA 1W2GA 4N5LA 4MUBA 4CMIA 2J0UB 1F2VA 1QE0A 2QGFA 1E77A 3LWBA 3NX4A 4DCJA 4DEYA 4JR0A 2J6IA 5IAKA 3VTAA 1EHYA 3UJNA 3DM5A 5JE8A 4GVLA 5F3RA 1VJ0A 5J3JA 1KKUA 1OOEA 3C3AA 2MSKA 5GIOE 2V1XA 1CQJA 1RWMA 1Q0ZA 3B9PA 5B66Z 1A04A 3CX7A 1CE8A 1JB1A 1YZQA 2VLIA 3KJNA 4PPYA 4QD3A 1SCUB 1B8OA 1SVMA 3E61A 3IDZA 3LDUA 1C0PA 1QHFA 3DSRA 4MW2A 2C8VA 4BMVA 3AONB 3M8KA 1AF4A 1JPXA 1YT5A 3P9CA 4QDJA 1P4GA 1UPFA 2CD9A 3VXKA 2W2XA 1J00A 4JJKA 2UZ0A 3BWMA 2ZS9A 3MCAA 4TM7A 5JWRA 5K3EA 3IEKA 3I5MA 3HCCA 5FWDA 1EFLA 4UBJA 4F6RB 1WU8A 3LPDA 3MOSA 4I5IA 4XTCS 1VQMV 2QVYX 3M83A 1RZ3A 5GVRA 3IODA 2FPWA 3W8EA 1DC8A 4ESHA 1UJNA 1W85A 2CNWD 2B92A 2IHUA 1OI7A 2KPOA 2HSJA 2QIPA 3KXDA 1PWYE 2GKOA 1MORA 5F77A 3MJSA 2DU8A 2WT9A 3AZOA 2PZSA 2EZPA 1QHGA 4EGCB 1NYTA 4Q82A 4DQUA 4BDSA 4V24A 2NN4A 1Q1EA 5U4QA 5DHAA 4JJIA 4XWTA 2ASVA 3FX2A 1ZVMA 2IV2X 5IJAA 3ZI0A 4TWIA 4GL4A 5JH7B 3FCUB 1ZPDA 3SSMA 2Y0CA 2ZKIA 4O25A 2W2NA 5B1IA 1SKMA 1E96A 2BFAA 2CFIA 2UUBB 5F2KA 4FWIB 1YR7A 5HZMA 1KDOA 1ABFA 3GP5A 4FNAA 4QTTB 4H0NA 3AI7A 4C5CA 1L0NH 1UBNA 4JV5O 5AVUA 3HJCA 5JZ9A 1O0SA 4YX9A 3WFZA 4AXXA 3JVEA 4TV8B 5DWQA 3QEMB 3MJHA 1YCFA 2ZFUA 3ZOZA 3G8BA 5J23A 5HFNA 2HL6A 5LPNA 4CGZA 1Z73A 5JDCA 4XQGA 2DR0A 4IX1A 5H3LA 5JQGA 2COEA 2YN2A 1SIBE 3FSJX 3ON5A 1N2GA 2GCGA 2XEXA 4YO8A 5AI0A 2NAPA 3AEUA 4HT3B 3O38A 5LWQA 5HS4A 4B17A 1Z7BA 2WHPA 4X9XA 3T7DA 1TM2A 2XF2A 5AR1A 2DWDC 3K5OA 2C5EA 1ML3A 2XYRA 2VJOA 1U5CA 3EE6A 3CG0A 3GQVA 3KLNA 3L6DA 3M0EA 3UQZA 2WOJA 3DPSA 1W52X 2C5AA 1Y5NA 2HCFA 2NO5A 2J48A 3GVHA 3I1IA 3MJDA 4GECA 4AJNA 1NW3A 1P7VA 1SXJB 4GMGA 2XUMA 2Q1XA 5FFFA 5E4FA 1GM8A 4CKWA 3O8QA 1GUYA 3DCYA 4AX8A 3JAWA 3IP5A 2OQVA 3DWFA 4D6TH 3VR0A 1UC9A 3R65A 5BOSA 3HK2A 4TLMB 2JRCA 4P30A 5L8VA 2H7XA 3TQIA 2BM1A 2QTNA 1E64A 5F7ZA 3DOHA 1QF9A 3V42A 4B7XA 4Y9DA 1C4OA 3BQMB 3P2KA 3I0MA 2ZKLA 2YZ7A 2CC2A 4UTOA 4Y2RA 5CXXA 4CPDA 4FNGA 5A06A 3AVTA 2YVAA 1WQ4A 5ADWA 2BGWA 1RPZA 5HVNA 1P2BA 1XMIA 4OH7A 2AGVA 4IGKA 1KC1A 2PA0A 4WOPA 1PHRA 3RUHA 1QCZA 1U94A 1VYHA 4U9HS 4YGXB 5C5CA 1E2BA 4BNNA 2JAHA 5D01A 2IIQA 3PEEA 3GRRA 1WF3A 3DEYX 1OCOB 4FSDA 3HYLA 3BGWA 4JI7O 3MCWA 4YP1A 5DRTA 5H9VA 1Z0KA 4HUQA 4OFXA 1XRSB 2EDCA 3I3SR 3ABMB 3IUMA 3WTCA 4FLWA 3GUVA 3PRYA 1XZBA 4JEUA 1A8PA 4RK1A 1C1DA 4FGUA 3VHXA 3HJUA 3QU2A 3MERA 4XLLA 2J8ZA 4BMXA 5TDHA 3E8SA 4DR7B 3TLYA 5FPOA 1Q7BA 1GKYA 2OCAA 1I13A 1MJGA 2X8JA 3E7FA 3RRBA 1YQWA 4YMHA 2XWQA 1EVKA 1R1BA 2R751 4Y2VA 3E48A 3F0TA 4BKRA 4MJ3A 1DUVG 1TMOA 3S1LA 3U9SA 4DIUA 5I7HA 3ZJ5A 1I6MA 1E59A 3DH0A 3ZIAA 2EIJC 4Q18A 4YAJA 5F23A 2R7LA 3BXZA 2O0JA 1QWSA 3Q8XB 5FO0A 1N7JA 1LK7A 4JGGA 1GLGA 3ADOA 4JZ2A 5JVDB 2GETA 5ALNA 4G5SA 2Z8ZA 1WF6A 3BGSA 3QOFA 3V3TA 2V65A 1IN6A 3KOWA 2Y0IA 1YR8A 2DFNA 4Y2JA 2P2DA 1U9YA 1Q2UA 5WRFA 2XB4A 1K33A 1HKUA 5KS2A 3HWSA 3Q3IA 2V7WA 1RAFA 2EFDB 5MDHA 2WHXA 2BEKA 4A27A 4I8DA 4WX2B 5EIOA 5HFJA 3H1HH 4IUDS 3WRWA 3MBOA 4TLEA 2OFWA 2ONYA 1YGPA 2MSDB 4XH9B 2QE7G 4RV5A 4LIPD 4M9RA 2ZTVA 3RIXA 3UTCA 1GILA 5BW4A 4S1OA 1R4ZA 4QOFA 4WK2B 4JBLA 2ZU0C 1R4AA 3Q10A 4QX6A 1DI0A 1VHLA 3DO8A 2HSZA 4R8MA 2HRBA 4L08A 1I7FA 4XRRA 4I1UA 4AC9A 4AN4A 4S04A 1ANKA 1FSPA 3JRNA 1T29A 2Y4TA 2Q6OA 2PX3A 3NWPA 3MUOA 4KJZA 2M6LA 4MPRA 4JAUA 1EB9A 2O3JA 3K5WA 4UB8Z 1EDZA 1G7RA 3L05A 4UMDA 4JD5A 4W1QA 1YF2A 1L4KA 3GGCA 1N2SA 3IA7A 3IALA 1U1EA 1U7TA 2Y27A 3RYIA 4OUDB 2GPJA 3C3JA 1RR6A 2ABWA 3WKCA 3DDNA 2C4VA 2P41A 3DOFA 4A8JA 5LIPA 1K06A 3KR0A 3MCZA 2AFIB 4UVEA 1I1QB 4YJDA 3T0IA 1E62A 2H1OA 2Q6LA 3WMFA 4IIXA 1VJDA 4ZMBA 2XUQA 1V71A 1JDJA 1RPOA 4LOJA 1QIFA 1X0VA 3MB5A 3TGUH 2YR0A 4B7UA 1QC5B 3GLHE 5E6SB 1YS4A 4YONB 5JH7A 2NQ2C 3NHJA 4E33A 4HDSA 3RQSA 2ZE6A 4NTYA 1ZN2A 2YS6A 4LE2A 4YCMA 4KQFA 1ZBQA 3LZCA 4TZKA 1UDBA 1DDOA 4IJUA 2B2NA 1F17A 1M83A 1VLHA 2P3LA 2XXJA 1MV8A 3EFOA 4NEQA 2NVOA 3IOBA 3OI7A 3RT9A 3GLFA 4AB1A 1BMTA 2UKDA 1UT6A 1V3TA 2ZJFA 5DNCA 5EIAA 4C1NA 2VYQA 4DR7O 1JP7A 4EY7A 4G27B 4X20A 3CA8A 5K1PA 2WMOB 4UBLA 4EJ0A 1M2NA 3DEIA 2R1TB 4O4IB 1MN6A 3DUWA 1XA0A 3NVMB 5HF8A 2P2NA 5LGNA 3CLRD 1U8UA 2YHAA 4FDLA 3K2BA 3OESA 5FUBA 2OESA 3RAPR 3OLYA 5IT0A 4O6VA 1EM8B 1L7BA 4FK8A 1A9PA 4JELA 2G9QA 3CTMA 1VYUA 3G85A 3OE7D 4MYHA 3KYBA 4P4SB 4MUXA 5FULA 3FAVA 4AZWA 3NVAA 4F45A 1GV1A 3RVNA 4GS5A 4EL0A 3RYCB 1N6PA 3LVRE 2H18A 1P4AA 1YE3A 3PDHA 4QASA 2AMVA 3VVBA 3EZYA 1XEXA 1IEXA 4JXJA 2A5YB 4Z5XA 1T2VA 3B6ZA 4HD8A 4O2LA 3P0EA 5FUMA 1C9YA 4LRXA 3ZE8A 4RFVA 4CHTA 4I9GA 1YITV 1N2BA 3IP1A 4LR3A 2QMOA 3UXMA 3RREA 4OB8A 3ZJZA 1VHQA 1L3IA 5KTTA 1Z6AA 4Q4AB 2UYHA 3GOHA 1SOUA 4LX8A 3TSCA 3F4BA 5AW6A 1T9DA 3H86A 4DILA 1EM6A 3ZHVA 4KR6A 3VI3B 4BIMA 4WGGA 3KQQA 4CIAA 1AGPA 1XRMA 4JR2A 2ZT5A 1EBUA 3EDCA 3ILHA 1WPXA 3C5WP 3G2LA 3BCSA 2O07A 1WZNA 2DUUA 4NYIQ 5HJ7A 4CMKA 3T5BA 5KREA 4BN4A 4FS3A 3FFTA 5JNRA 1QP4A 1ADYA 4AO6A 3MINA 1V8FA 2C20A 7GPBA 2RMKB 1P2GA 1JJVA 1CY7A 3I58A 2NN3C 1YZUA 3IDAA 1E98A 1YE5A 1AN9A 4JC5A 4PA9A 4X63A 3U7JA 4BX8A 1AQIA 4OB6A 4QDUA 3SQNA 1Z29A 4BX2A 4KGDA 3FTDA 3K05A 1N5MA 2BLNA 3K0FB 3TW4A 2ODAA 3JD4A 2V6FA 5ESWA 1CZHA 4WI1A 3WYFA 1GM9A 3BIFA 1A8QA 5KLVH 4RVDA 4E5UA 4O4LA 1XKTA 1P9WA 1YB6A 3PDIB 4P9OA 1I94O 2IYRA 4GCZA 2QR3A 1VLJA 1SURA 3C1TA 1M0EA 2QMZA 2O8EA 4J3JA 4S2EA 2R79A 1Z35A 3KB6A 4U4AA 4E7PA 3SIWA 3LCJA 4AMBA 1G21B 3CE9A 1B73A 4QDOA 5JAOA 5JZSA 3U5TA 1ULSA 2V7QA 2IHZA 4R2HA 4DPMA 3TLGB 2LCFA 1N5DA 2FPKA 4R1PA 3ZQ6A 5DCYA 3CM0A 4P36A 3NV9A 1U1FA 4Q47A 5CVEA 3S7TA 3X1WA 4U5QA 4ZCQA 2F1JA 2JJMA 5KTSA 2JFVA 1NLFA 1PK8A 2GF2A 3UF0A 4TYWA 3FSGA 4QEZA 1MP0A 3PXXA 3ZHTA 2Z83A 2ACEA 1G17A 4N5DA 1ZXLA 4X1OA 4BEVA 1LDMA 1TFUA 1D07A 1K8YB 2FZEA 3R7BA 3WP0A 2JLZA 1TAUA 3PWTA 4AD8A 3N27A 2SECE 2OV2A 4RF3A 1DELA 1X94A 2OYSA 5FPTA 2ZINA 4CC6A 1PJLA 3D3WB 3FUVA 4ITVA 4K46A 4LZZA 1R6KA 3T7CA 1KHHA 4B45A 1QQ6A 5IE9A 4J1SA 2I91A 2YDYA 2WABA 1PFGA 1VF5B 5DBGA 3GCGA 3FAZA 2UV8A 3HUUA 3W8FA 3G88A 1TAQA 1Y1PA 1M2HA 5I7VA 3CN7A 3DTVA 3TL6A 5D5QA 3WKBA 3TAXA 2MSLA 5ALHA 1EQ2A 4O29A 3VSEA 3EBPA 4MUIA 3DXZA 3RRZA 3WFJA 2ZRPA 2EG9A 1CUIA 4Z8XA 5E6UB 4EY6A 1WM1A 1R9GA 5IN5A 4WESB 1G1AA 4PFSA 2CVFA 5CAEB 3VPCA 4KO2S 1W7AA 5CNIA 3RE1A 1KC8W 3T5AA 1NN1A 2GR9A 3DEAA 1V37A 3QELA 4UMEA 3SPXA 3UJ6A 1ABBA 2C2GA 2FZ4A 1C0LA 3M9LA 3MCVA 3KTOA 3I09A 3CSSA 3L6CA 1IOWA 4RWUA 3CWCA 3N2IA 2OFFA 4J90A 4UAGA 3UTDA 4K03A 1SWVA 1YZBA 1BD4A 1CQPA 1XJWA 2J32A 1M2VB 1KI4A 2WOOA 2ZB7A 3CLUC 3EHDA 2ZIFA 3NPAA 4POAA 2QIOA 3OA2A 5DTRA 5G1NA 3U3DA 3WG9A 2AN4A 3MRTA 2V0GA 4R2IA 2E3CA 2HHCA 3N05A 3IUPA 4DCCA 3L0SA 1VDMA 1YKGA 2O2ZA 2GOYA 3DEHA 3F3MA 1KYVA 2XKBA 1P2FA 3N53A 1I7NA 4YBRA 3RHTA 4CHGA 3R9XB 3SAJA 5KYKA 5H81A 4PVDA 1QR9A 5K3SA 1DJQA 1YQTA 1DQPA 1JHVA 1IEQA 4JF3A 3B5IA 3ZXIA 1E63A 3I30X 3IQDB 4BZZA 2NAFA 2RGCA 2QTVB 1SR8A 2HUNA 1KDYA 2WD9A 2PMDA 3PL5A 3B3AA 4RF2A 5DPMA 2X0JA 1ODSA 3SOZA 2OIGA 4O4JB 2GJKA 5HCNA 3K32A 3UGTA 4MEAA 5AVYA 2BISA 2AJBA 2BHTA 5CT4A 2NW6A 4ZGWA 2OG2A 3JSXA 5I3ZA 2HEPA 3CNEA 1OASA 2CTQA 3GPDG 4MGEA 2I8AA 5CFQA 1YMQA 3IO3A 4CV3A 4AY6A 1KKDA 2WQZA 2WLNA 4EG8A 4R68A 2BSAA 2KB0A 3AR7A 4QXOA 1U0FA 4Z4EA 5BR4A 1I7DA 3STYA 1EUCB 3KG2A 5K0BA 5A0VA 4FWBA 5CMLA 1CF4A 1LD3A 5PNTA 1P0FA 2H3HA 1JHPA 2FPOA 2XQKA 5BWBA 2FPPA 2JJ8A 3LCVB 4FU0A 5D3MB 3RYIB 1JWBB 4EP1A 2CW5A 1U1CA 3FSGD 1TNDA 4NZNA 2G1PA 2V96A 3ACCA 4DXAA 3LIIA 4RGBA 5L3SB 2AW9A 4ZOEA 1NUQA 4QAJA 2FGJA 5FH9A 1R8XA 4HFJA 1NFRA 4S3MA 4RSRA 5J5CA 4CR8A 3H4IA 4K5QA 1W93A 4ARSA 2PGXA 3SF0A 5B3SC 2MOKA 2V74B 2B5UA 3G6KA 4YFYA 1KBZA 2D7DA 1YASA 4TZTA 2C00A 3ZMVA 1NVAA 1DOHA 2QRNA 3F74A 1XU4A 3U3ZA 3UHJA 2QUJA 2AKEA 5DNDA 2DJIA 3DC2A 1ZAUA 4UB6Z 1CBUA 1DUIA 1J9EA 3FZYA 3G3EA 3AQIA 2ODQA 4LAFA 1Q11A 1IN8A 2G67A 3SS9X 5DYGA 4XDZA 4EG6A 1DZ3A 2PRKA 4RFSB 2P9HA 3E70C 5FTJA 3WL5A 4IJ6A 1Y3DE 1YC2A 2R96A 2PWZA 4L4YA 1L7AA 3C74A 5CVJA 1QG2A 4Q1VA 1XD2A 5FOSA 1NY5A 1DAGA 1TIKA 2J4FA 2ZREA 9LDTA 5JS1A 1LNZA 5G1OA 4AN0A 3VH4A 1XCMA 5JEEA 1CT9A 1ZZEA 1M67A 3NTXA 4DDKA 3SFZA 1M1YB 4H16A 3DOJA 1AUOA 1JIIA 2EDAA 3O2NA 4N76A 3KR1A 1O8BA 1GQOA 4YJGA 5FOTA 4IL5A 1HNZB 4BEBA 4TUYA 1N5OX 2CLLB 3GL9A 4JVLA 1N1DA 3BFPA 5CLLA 3DZ8A 3ZCXA 4GQIA 4U3FH 1Y4MA 3HJAA 4HAWA 1UC4B 4RS4A 5A0TA 1PW7A 4B47A 2PMFA 4IDQA 1J06A 4MP8A 3OZFA 4ZOAA 2B36A 4RH1A 2AZTA 3P9RA 4AWBA 1Z6XA 2OCDA 1C0IA 3GAZA 1JVNA 1TFRA 1U2PA 4LHSA 4TM8A 5AM5A 3OCCA 3ZE9A 1I7QB 1JHXA 3HZZA 4X8LA 1HG0A 5I8WA 1G8AA 2PGOA 1G64A 3FB6C 3CC7V 3MD0A 1YULA 1B6QA 2XCOA 4BFTA 3HR0A 3BCUA 3IOYA 4X3PA 2PR7A 1QHHB 2QUIA 1OGYA 3D43A 3QLEA 3AP2A 4M1TA 5DFAA 1C7RA 1C3EA 4MV9A 1MRZA 1Q3KA 4QU8A 2FZLA 1MABG 1J0XO 3NC0C 1YTLA 5DHFA 3I6ZA 3KBOA 3L6EA 3AT1A 4KP7A 1J25A 3E9RA 2IH3C 2RGDA 1QAOA 1X9GA 3KM0A 4DJFC 4RY9A 4EHNA 1Q0PA 4L6AA 2BEUA 1O6BA 4HK4A 3CX6A 1TDJA 2A8YA 3NTRA 1L7RA 1T91A 2W6ZA 1E9BA 2VHCA 3B09A 4LQCA 1O3YA 1I51A 4YIPA 1YI8A 4KFTA 1L2TA 1G1MA 1SXJE 5CK5A 4JASA 1KMNA 2XUJA 1IJEA 3KRTA 4GLFA 4H4EA 4UU8A 3T1OA 3B8EA 3T38A 1M5UA 4G89A 3DMYA 3V34A 4FLVA 5FWNA 3UT6A 2FWRA 3V48A 4ACAA 2BRUC 2WLKA 3ONNA 5J9FA 2B1IA 1IXBA 5AM3A 1ZVQA 5JAQA 5BMVF 1NF2A 1J2TA 1Z4KA 4NEHB 2QGNA 1YH3A 2XTZA 4ZFNA 5G0VA 5EAIA 1FXKA 3A7DA 1J42A 1OLSB 2WA1A 3SYTA 3K9AA 4GI5A 1M8KA 3UK6A 5TPWA 4UTXA 1AGXA 1NRJB 3N0RA 3DLTA 4I8XA 4DT1A 3GT0A 4LGYA 4G0MA 5BN3B 4ESVA 2ZM6O 4MV4A 1NW6A 2RDCA 1VFPA 2A9QA 2CXRA 2ILTA 2YJ4A 3HHPA 2OD2A 3WB2A 4RLFA 3N75A 1UKVY 2AFIE 4L4UA 5K9ZA 1NUSA 3OCUA 4KFSA 3G0DA 5DXFA 3G6BA 4UJ5A 2JAOA 1XLVA 2PLRA 1I6KA 2WLIA 2ZW9A 3C16C 1LI7A 2CXUA 3KZVA 3PDJA 5JXHA 1ZI9A 4L51A 5KYWA 3Q8MA 3GVPA 2XLBA 3ZPXA 3GP3A 4JSYA 4XB6B 1AUQA 5CB0A 2H2AA 2RKWA 2XV1A 5MN6A 1K7EB 2VPYA 3FGPA 3K9QO 5EUCA 3EPHA 4NHOA 4V0RA 4ZODA 3RS9A 5AVVA 1F6BA 4U7PB 2A06H 3QF7A 1KY2A 3FLAA 2GFQA 1WSWA 4RQUA 4BB5A 3AO0B 3RVBA 1YNSA 5AJHA 1ZOLA 3M89A 1QM5A 1K3UB 4L16A 3F1KA 4V0OA 5DSXA 4JVSB 2X7HA 2JLXA 1IH8A 3CF0A 4C2AA 2IHJA 1FXSA 3EH2A 1P9NA 3A26A 1AOXA 2WK1A 3OIUA 4BGDA 4KREA 4ZMSA 4E1VA 2HY7A 4ZYZA 1DXOA 2RJNA 4ZU1X 4C4AA 4E4YA 3WX0A 2WF6A 1DIBA 3FYSA 2W58A 4AF8A 1NQOA 1KR5A 3TO5A 3E1SA 2HWKA 4H7IA 1JSLA 4IQ8A 4CIBA 4RESA 1PLLA 4MJXA 4R01A 1SJ9A 5HILA 5CAEA 2V3VA 1Z7YA 3OJCA 3L06A 3ZWNA 1HZZC 3A28A 2P9JA 3KHUA 4QXPA 3MJEA 4EZIA 3U60B 4AUEA 3A31A 3V97A 2OPHA 2O0KA 3TJRA 3CLKA 1RM5A 4HH0A 5LQCA 2Q5EA 2G04A 3KKEA 3KUUA 3Q0EA 1OXMA 3QWFA 3AEIA 1Z74A 1KYZA 4H3SA 5CCDA 1MAWA 1WDMA 4W7IA 1V55C 2VOJA 4ZO7A 4EGQA 2H8GA 4DC1A 3NMUF 1O97C 1YHNA 2NM0A 1TYDE 4NCBA 4EWLA 4MUMA 5E4TA 3UAWA 3FKSD 4ARCA 1YXMA 3R40A 2JI7A 2GBOA 4CUZA 3MS7A 4R2MA 2BZ0A 4EYSA 2EW2A 3NDPA 2EV9A 1O94A 5KSZA 4MS3B 3V4VB 2R9RB 2ZBFA 5KQRA 2CUKA 1V9LA 5A05A 5KJCA 1DCKA 1R8JA 2DTXA 4ZPXA 3CBQA 3CPWU 5JQWA 3VFDA 2PUDA 2XOXA 1HUQA 1H0HA 1M10A 1RMQA 4KXVA 1KK1A 2ONKA 2PX5A 1BXGA 3U4AA 4Z49A 5EGSA 3BIWA 5I7SA 1Q82W 5LWHA 5AVZA 5JEDA 1LX6A 5BSKA 1WZIA 4GXTA 2QTOA 2D5LA 2V1DA 1PYGA 1R15A 1WMAA 2HCJB 2B5OA 3BWXA 4PQGA 1JA9A 2HIMA 2WNSA 3R5FA 3KB1A 2IJJA 3I8XA 3QW2A 2IU3A 1BXRA 1P5JA 4TMZA 3HDHA 4NV1A 3KUXA 4H7DA 3WSWA 3QWHA 4B4DA 2WFZA 2FOLA 3EXHC 3HV0A 5B3SB 4F6EA 1JSXA 2EZ8A 3PUHA 4PS0A 3ZCSA 3I0ZA 1MQAA 4JU9A 4LI3X 2B30A 4FMTA 2OZPA 3AP3A 3EVZA 3AK2A 3NANA 3B6KA 2DP4E 3PI6A 4LXYA 5AVKA 4CL0A 5A5FA 1QP0A 3GROA 4RJKA 3KTAA 4EPTA 4EYQA 4YNBA 4Q19A 3T6KA 1K6JA 1FK8A 3T3MB 1XQ6A 4UHDA 3O7WA 3CP1A 3GXBA 3EGXA 3H9GA 3IP8A 3J7TA 4PA4A 3E5NA 1PVVA 2GGSA 1V54C 2GZ1A 4WBSA 1H8ED 1D4OA 3N2GB 2GVZC 3A6DA 2XJ4A 3BX1A 4HFRA 3SYQA 2QN8A 2ZI4A 4YCBA 2HLPA 2ERCA 4HXEB 1N2OA 2PSJA 3SFTA 5KHJA 3UXEA 2A0YA 3WOVA 2O50A 3W2FA 2GQ0A 3N6RA 2R9AA 4L4SA 2CNKA 2FPGB 2YBEA 4AG5A 4P3KA 1M6VA 4G9GA 4YECA 3E82A 1YU9A 3QY9A 5D1HA 3SLGA 4EOGA 3B2EA 4YCDA 3SCZA 5JAMA 3OZ7A 3KKLA 3NH6A 3NIDB 2BL4A 1NA5A 4WEOA 1NM5A 3LQ2A 1MO4A 2J9ZB 2D3OW 2IEYA 1UPAA 1FUYB 1JG4A 1DFIA 1MW9X 1TT7A 1YZ3A 1NQTA 1MZFA 3C3CA 1NTZH 3CW2A 2VWJA 5TJHA 4E15A 4EGFA 4GI3A 1N36O 4OP1A 1EK2A 5D51S 5ALGA 3LUTB 3BRSA 2QROA 2WJPA 4FW9A 4BJ5A 3CRAA 4W9RA 4Q12A 5DM4A 5EFZA 1K66A 4DLXA 2R5NA 2A9PA 1HI9A 2YIAA 2K87A 4PE5B 3OEED 1ZHFA 2D0PB 3PYXA 2JFGA 4X54A 5KNDH 4DR2O 1ESMA 2GESA 1Q81W 4XX0B 3IQIX 1U63A 2QRPA 2IOFA 2IS1A 3SXPA 2FLVA 2PL3A 2PGNA 3E9YA 3VU8A 3APQA 1LJLA 4IUCS 2A6PA 4KO3S 4RZUA 4P3XA 4FEYA 2HPHA 5F76A 1E7YA 2D0OB 4PG4A 3FF1A 1GR1A 1D6SA 4UUAA 2O2CA 1AKQA 3UATA 2PCLA 4KNYA 1T4GA 2FRDC 3JASA 1GYQA 2W98A 3GG9A 3L1JA 4FIZA 1H2XA 2EBWA 1E7RA 3AM1A 1YO6A 2ECQA 4PN7A 1IQ0A 1FX1A 1FEZA 2WSBA 3RC3A 1EU1A 4DTCA 3FPEA 2FPUA 1X7YB 2H4FA 3OCYA 4DMHA 2YZGA 4CZ2A 4V02A 3NBKA 3G5AA 5E6SA 2ADMA 1Y1RA 2H7YA 1XAJA 2VJNA 2RARA 2YY7A 1S1MA 3LUJA 3QF4A 3T7KA 3DS8A 1RP1A 1OFIA 2HBRA 3HBLA 5D84A 1VQ5V 1M6VB 1E9SA 2QTWB 4O3FA 1ZQ1A 5K45A 1KMHA 2RJZA 2C94A 2Y0EA 2VDPB 16PKA 1X1EA 2H4ZA 2IYOA 3AY6A 2PNFA 4I50B 2DQYA 3QA3E 4GRAA 3JAKA 2HF2A 3RVDA 4UPEA 5IF9A 3AF4A 2LW1A 2V6GA 1A3CA 2VR1A 4XPIA 3QQ5A 3VJLA 1ISGA 1UIMA 2WJYA 3UKJA 4DQ0A 2WM2A 1EFAA 4HDMB 4U8GA 5LQDA 3G2NA 4DHEA 2HJ9A 4J49A 4H18A 2Q45A 3GJRA 2G83A 4EMSA 4HNTA 3W78A 3H5WA 5HK8A 3P9ZA 2Q4DA 4PA6A 2ERYA 4NRDA 3E03A 2ZRCA 4DNQA 2FW8A 4F3YA 3IMCA 3NOQA 1QKJA 2ZIMA 3W8RA 1VZ2A 1XZJA 3K0AA 1UQTA 3GARA 3KX2A 1Z4QA 2MJLA 1FNNA 3OEHD 4H15A 4WVFA 2IH5A 3K70B 4YY3B 1R0SA 3EUAA 4CN8A 4LGCA 2H48A 4UCOA 2QL9A 4TXMA 5H02A 5BMVA 1L7VC 1UWKA 3B3QA 4TTTS 4URWR 2XVZA 4WEQA 4HDOB 4I50F 3EAGA 4TWZA 4EYGA 1HTWA 1DT3A 3F3YA 3MEQA 5C31A 1O6ZA 4C6HA 1UMBB 1FUKA 1UBFA 1VIMA 1M4UA 3C98A 2R65A 5CNMA 1OAOA 2SCUB 3QKUA 5EIBD 721PA 4GX1A 1T0UA 5LVAA 1EUQA 4CH5A 1FDWA 1UBHS 2ZUWA 5BV7A 1L8XA 4PQRA 4BO9A 3DPIA 3G9ZA 2CZGA 3L74H 1YJCA 1A8UA 4IDOA 1SKYB 1L0LH 1P60A 4LXIA 4D45A 3GLRA 1LZKA 1EX9A 1H2WA 1NZFA 5H83A 1DJNA 2YWBA 3H1KH 2EZOA 4NJOA 5CG2A 4HGNA 4LTDA 4FOLA 3ZS8C 5L7WA 2YC0A 2J9GA 3TLBA 1BCSA 4LF8O 1X7DA 4CM5A 4EFNA 1REQB 5HWSA 1RC8A 3EB9A 1RSOB 3T4UA 3VO2A 4W5QA 5F4BA 5FYQA 3EVGA 1PKXA 2L19A 1Q2XA 3PFNA 3HJTA 1H9BA 3UGKA 2X7RB 2G80A 4R1QA 4YLEA 1NUPA 4S1NA 3FJOA 4TYMA 4ADSG 1QRTA 1MB0A 1YE8A 2WILA 3ZR4B 5HDBB 4E0BA 3AL2A 5AM1A 4WZAB 2NP7A 2BMJA 3VQVA 1SBCA 2H5LA 3FUWA 1XCPA 1UJ5A 3DBLB 1SU8A 2P8JA 2YVQA 1N6RA 2LIPA 3BS4A 1WTAA 1UBCA 4IR7A 4NCIA 3U9LA 1IZYA 3QSYA 2XVYA 3HYSA 3PWKA 3VDNB 1L5YA 2QX4A 4IMPA 3U1VA 5K0EA 5BQOA 2G8LA 3AEXA 4QO8A 1XLWA 1JDUA 4K9QA 3FM9A 1VL6A 2V6MA 1T9AA 3NHFA 1XLTA 4UCQA 5F2NA 2AYYA 2WIJA 3NBZC 4ALMA 4BLPA 3C3TA 5KYTA 2DCMA 4NTZA 2DOSA 1S2LA 1ZOPA 4TKMA 5GINE 1SCKA 1OT3A 5CP8A 4EW2A 2C83A 2HYIC 1L8LA 1YB4A 3IBSA 1LRLA 2VH5R 4M0PA 5ALSA 1ECJA 5E1MA 1JJ7A 5I01A 4Q6GA 2WICA 3KQPA 3LNMB 2QLBA 3IXLA 2KLBA 2VPWA 4Q3KA 3PR3A 1CUCA 2I55A 4YUWA 3G2JA 3L1UA 2EILB 1Z0ZA 3BE6A 3ZQUA 4CCYB 3D59A 1RPAA 2PUEA 3HHEA 2XECA 2R87A 5FNVB 3A3NA 1TO6A 3OU2A 3ZV3A 4XQEA 2P2GA 3HCNA 4MJLA 3JYLA 1FU8A 4MQFB 1L9XA 3G8YA 3ILSA 4ZWNA 4I19A 2II6A 2ORED 3D4BA 4J9UE 1FFDA 4XARA 1M5RA 4KQEA 2FW0A 1NVEA 1W0KD 3D8CA 3U3JA 3TB4A 2HV8A 5FWYA 1HGXA 5LMUO 2G5PA 3GLHB 3RRYA 5EXEA 2J3HA 1S5LZ 1NKDA 1YZYA 2PU7A 5KWIA 2QG9A 3TCKA 2ZAMA 3SBDA 3LL7A 3TQRA 1ZNWA 1URFA 2DYSC 2HVKC 3GZJA 3SEFA 5DBFA 3TTTA 3WLOA 4II2A 5HFLA 2ZJ0A 1NN3A 3HCWA 4C43A 2WF8A 3DMGA 3M5PA 3O83A 5EPEA 5ALRA 3A3OA 3GT3A 4R8VA 1EDOA 2A2ZA 3JASB 4EDHA 1XEAA 4DXDA 1Z37A 1Y3IA 3DD1A 1DEOA 1FFWA 4L8FA 5LDGA 2EWWA 1EP1B 3BD9A 5FAKA 3B70A 5ENZA 1VJTA 1MB2A 2GI4A 1MO3A 4HQLA 4YRIA 3B1XA 5ABPA 3Q0IA 2FJ0A 4JNKA 5K09A 3GJ3A 8GPBA 1HLDA 4ETNA 2JGFA 3EWSA 4FSHA 4HEA6 1DQSA 1EK0A 3NRBA 4OF4A 4RDHA 5FBLB 2FUG6 1JG3A 1VHTA 1OTYA 1EFHA 2F6RA 2NSHA 2CDYA 1G0OA 2DHQA 2PRZA 1I9CA 1S8AA 2FMFA 3K16A 1KKMA 3GZNB 1JX9A 3B36A 4CF4A 4FI3C 4BMDA 3FCCA 3TFOA 1FP4B 2GERA 2W2LD 4K6OA 4RGQA 4Z4CA 3DF9A 2YMMA 2EW1A 1E4YA 3OP1A 4CCAA 1SQPH 2GEDA 1KEEB 3CNLA 2IYPA 3TF5A 2UUBO 3I3OA 2A33A 2FWAA 3O1JC 3MTJA 2GSMB 4ZVLA 4L50A 4HYQA 1NP3A 1P5HA 2FSUA 4YRQA 5BSVA 2GPWA 3KTDA 3ZHOA 1NBMA 1TYEB 1KDPA 1TO2E 4E14A 3VPDA 5JC8A 2P6JA 2QLMA 4RXUA 2FRXA 4XKJA 4DV4O 3IMEA 4DRYA 3REFA 1IBMB 1WOYA 2FI1A 4QXQA 1KHTA 3P1JA 3K9BA 3RU7A 1SVWA 3AHEA 1HEIA 4ENUA 3I42A 4FGWA 1T1SA 1UWVA 5EGNA 5MGBA 2BP7A 5KQPA 3EHBB 4BXOA 4PTZA 3CRZA 5B58C 1Q7TA 5KC8A 2RCYA 3IEPA 1N4DA 1R3DA 2R66A 1EXMA 3OZSA 4IVNA 2BJHA 1L7EA 3TJTA 1LQTA 1OC2A 3CLUD 3HUEA 1QHEA 2HA2A 3DAPA 2HMSA 4LVUA 1A4UA 3DHNA 1M9NA 4RHXA 1ODTC 2WF5A 4EH1A 4RQEA 2Q9UA 2GLUA 1K8QA 2YDXA 5EYPA 2ILMA 4RA9B 1R5BA 2XZLA 3I28A 4E70A 1XL4A 2EWVA 1RM0A 1J95A 4MRAA 4C7OB 4OQFA 5JWHA 1XTBA 2POQX 1G21E 2CDNA 2A9JA 2C3OA 4XGKA 3VU3A 1ZVJA 1TUEB 4B6SA 4F7WA 1D7AA 4HVCA 5JR3A 2YINC 3VKGA 4M7PA 5G1PA 3D4LA 2VDOB 2LNDA 2WJ6A 1PX0A 3AU8A 3KWLA 3LPAA 4AJ9A 3ZBPA 1M8PA 3IAXA 1G7SA 2JLSA 3H2HA 1WVIA 3N1UA 4MKFA 1NNUA 3GGGA 4B34A 5I7FA 4YMGA 2IZ5A 5E1BA 2PZEA 4IQFA 1JXQA 3HO8A 4PFKA 4D99A 1FFEA 4QQFA 2PY6A 4WY5A 3RVRA 3RWOA 3UWPA 4BKPA 4PNEA 2YC2C 4FZ3A 3ZWPA 3RU2A 4R5HA 3NCTA 1EGMB 2GPBA 2Q41A 4U02A 5TE9A 4OJTA 2C9DA 3GJZA 1JEAA 1EN5A 3IIIA 4ZVRA 3K4QA 2NU9B 4WBNF 1RW4A 2W71A 6REQA 1N1GA 3BPZA 2P1RA 1UM9B 3ILXA 3LBNA 4MIOA 4AM8A 4Z99A 2BE3A 3DFUA 3N0XA 4H9GA 1O58A 1NVFA 1SXJC 2OVBA 4U2DA 4KR2A 4KG7A 4B6PA 1QVRA 4DV2B 1RZRA 3PUIA 4ND8B 3CR7A 3R23A 1F12A 1QBKC 1Q6IA 4MYUA 3ZHUA 1YQUA 3B8NA 2VF2A 4ZXFA 2L82A 1HL3A 2C4UA 1BE1A 2EBHX 1Z6YA 4M9UA 4TSFA 2W48A 3S2SA 2VS0A 1CP3A 2OUKA 3JQ9A 3BXOA 3VYRB 1UK7A 2GEUA 4C01A 5EUQB 1ZX1A 1PZXA 2JLRA 1D2NA 2CH7A 1JBKA 2RHBA 1W48A 4GP6A 2C92A 1K75A 4ZEXA 5I7EA 1X9HA 1KO4A 1P7WA 3AR4A 3PE6A 3W04A 4CR7A 2F59A 5IJ9B 1BVRA 1FQKA 3LQQA 3PCTA 3OLXA 1G8PA 1HPLA 2WDPA 5BWOA 3U9TA 4IV8A 4ISBA 2XNKA 4KN5A 2OL4A 4CBVA 1SKVA 5LZ7A 3CPEA 4IJVA 2E4XA 3HVIA 3LSUA 1Q0UA 4J7KA 2GXQA 1QHYA 3LKBA 4IIFA 4BO3A 2XT6A 5CM8B 5FR1A 5KI6A 3ZI4A 2PUBA 1IQPA 5E9AA 1NBHA 5JJIA 5EJ5A 4KIUA 1T34A 2WPDA 5K4AA 3W2IA 2M1ZA 4KPFC 3RBVA 1AT1A 1HC7A 1I5XA 4AHCA 2YJ3A 3JAMA 2FOIA 4JI0O 4LHWA 1N8NA 1FQJA 2P68A 4ZC1A 4E51A 1T2CA 4UHFA 4JJGA 4YCLA 1K3EA 2JGRA 2A59A 4LVOA 2J3MA 2Y1EA 1CUAA 7ADHA 2KS6A 4XQ9A 3HNRA 3C3EA 1E6EA 2IUEA 3F73A 3EWNA 1L5GB 1OLXA 2ZWMA 3NHBA 3GLFE 1P1HA 1UBLS 3PC6A 1WE2A 3T5GA 1ZIDA 5BR8B 2JIRA 3GGSA 3OZXA 4FE3A 4QJ5A 4ZVPA 1QZUA 5TT0A 4K9DA 3PYLA 5DCLA 4HEQA 1H8HD 2B8NA 3R66A 4HZ3A 3CXRA 1QHTA 1XNGA 4MCIA 4X6XA 1SC3A 2C0PA 4ZZ0A 1AQUA 2AEJA 3BJIC 3QXCA 1SMKA 5JI2E 3FFBA 4LHXA 3GD7A 1R0YA 3COPA 4HB4A 1ISRA 1FDIA 2ZQYA 4I0WB 3R2JA 2Q7OE 2XDQA 3VZPA 1NJ2A 3QUBA 1XPRA 5K2MA 1NN5A 3PD7A 2IUFA 5F7JA 1WB9A 2W6JG 4P4SA 4GM0A 4WLUA 3LDHA 5GOTA 5J4YA 3F4KA 3HM9A 1QTRA 1ATIA 3AR6A 4JP1A 2LDBA 1KBQA 3RS5A 4V03A 1HYHA 2FUKA 4CEHA 2CL6X 1T36A 4KH1A 1EN4A 3F90A 3KLPX 1GSHA 1XF9A 4S0ZA 2OR3A 1FJGB 3I72A 3PEFA 4FKZA 4IIUA 4JL6A 1ZUQA 3K9GA 1ENZA 1OYOA 3UWSA 5JQGF 1TGOA 3TTWA 3V6MA 1B2RA 4URYR 3U3RA 3ZVLA 3JD1A 1DBVO 1GNVA 3QHAA 2G1KA 4I2NA 2WM9B 4L4RA 1SQSA 4UE6A 1IDN1 1T8WA 4M21A 1G20B 1UZMA 1DBQA 5EWJA 5FNZA 1CUWA 1USWA 3CX5F 1YHYA 2VWGA 3VNQA 1L7OA 4KSYA 5IKPA 4IGIA 2E9SA 4D9HA 4W5HA 5BR7A 2JIZA 2IELA 5B55A 2XKKA 3DP7A 3SVTA 1PNTA 3PXAA 5C8YA 1WDLA 4Q0MA 3GUHA 1MSDA 2LBPA 2QY9A 4TMXA 3K5MA 3LXMA 4E3WA 2X86A 1QGOA 3G2MA 1WXFA 1QHHA 5DO9A 1AI6A 2QSYA 3EG9B 3FNIA 2EIMB 4L85A 4LN1A 5C9ZA 3QIAA 5KX5F 3DUFB 5D87A 3WHLA 1YXBA 2HJDA 4DR5B 2DH5A 3K0FA 4RY8A 4XWWA 1U5AA 2BMDA 3E8GA 4E5KA 5K5EA 2VTBB 1CUXA 1BOFA 1UMDB 2XAJA 1IWOA 4U3JA 3MTEA 4RACA 5BXZA 5I7AA 4WOCA 2VT2A 5KMGA 3LRTA 2JFWA 3LRXA 3RIEA 4TLLB 1CULC 3Q11A 4KL1A 3O84A 3PNVA 4IKEA 4RPLA 4REQA 1NW9B 1CDEA 5LBQA 2O0MA 1JHUA 2V59A 3I6IA 4PI2A 4M2LA 1YR6A 1R66A 3UJAA 2PKCA 3HCOA 2H9IA 3PU6A 3SC6A 4HB3A 3OM0A 3WLNA 5KIAA 5KWSA 3OD1A 3WWZA 4BNWA 2O7RA 3S1AA 4HGYA 1GARA 5LC1A 5BN1A 2DKOA 4I4CA 8AT1A 1SAYA 2JGDB 2A7WA 3B77A 1NX9A 1R4NB 4MKRA 5FA5A 3BVOA 4XGIA 2J5BA 3THYB 2H54A 4JI7B 4IH4A 1JJOA 2HTEA 4Q9DA 5CH3A 1M6YA 4R2KA 2DR2A 3SNHA 2NLOA 3HKEB 4YIOA 2FG5A 2RAVA 4ENTA 3UAXA 3GWZA 4YQZA 1R3KC 2FMLA 3QVTA 4K0KB 5JECA 2CMKA 4CFYA 3DXYA 1N2CE 3ZQKA 3CEIA 1W5FA 2Q3CA 3FHLA 4XDHA 3PFHA 1SHJA 2B0CA 1XAIA 4NR1A 2AN3A 2I4NA 2P78A 1HDGO 3W5VA 1W88B 4BU0A 2BFDA 2O6HA 3N74A 5JH7F 2G7MC 3O4GA 3P3PA 3LKDA 4HATA 3WY9A 1AHNA 3TR5A 3O73A 1ZA2A 2WWFA 2PSSA 3PDCA 5JCJA 2Z8YA 3M6FA 3HO1A 3I53A 4GR9A 1CXZB 1LVHA 1ZWKA 4DG9A 4CW7A 1ZUNB 2AUTA 5K3FA 1T2FA 1FFHA 3LO5A 4F92B 2FJPA 4D2IA 4PNZA 3FTEA 3MN1A 4DYLA 4J0GA 2IWHA 5BQ3A 5DT9A 4XDKA 1BWQA 2B6HA 4HB2A 4KXUA 4RVHA 3W9YA 1MQSA 2HLDG 2VDJA 3A1SA 3EDQA 5KINB 4GQAA 1N8RW 1G60A 1UOQA 2QLJA 4H31A 4UUQA 5JZOA 1WETA 4JSRA 2OV4A 3ANSA 1TM4E 1GR0A 1R1DA 4PGHA 4CG3A 2E4AA 2CDCA 3AK1A 4HLUC 5K0LA 3IJ5A 4R2LA 3WA6A 4JI5O 4HRVA 3VM6A 2K1EA 5I7OA 2OIEA 4CTMA 2Y1GA 3LP6A 5JDIA 4RIEA 1QCCA 3IESA 1R5JA 4R9NA 2AI3A 2NSLA 2X4IA 3QFRA 3WISA 4PLCA 5LYYA 2PJUA 4BNLA 4PX2A 1KI9A 2CFRA 1RI1A 3KPVA 4C76A 4DN6A 1ZN9A 2ISSD 2QWNB 2AVDA 5F21A 4R1LA 4FONA 1YACA 2BM9A 4ZOLA 4J0IA 2XOKG 3E2PA 1YOVB 4NMLA 3CZRA 1XZDA 4RQBA 3P19A 2E87A 4UVDA 2O8EB 1N33B 3VKUA 1TAEA 1JBEA 2HGZA 4MKZA 2X13A 2QTLA 3OZRA 2GASA 3K9WA 4IDHA 5EE9A 3SU8A 3I9V6 3O8RA 2FPIB 1PJBA 2WFMA 2IH4A 1T36B 2P75A 3PCRB 4I55A 5IYZF 4Q7KA 1JQAA 3FOFC 2EX3A 1P2UA 2XRFA 2REQB 1YVPA 3A6FA 3E0XA 1VIDA 3M8AA 3HLTA 2CVQA 1H6DA 4CLOB 5CG1A 4M9ZA 1EJ6A 2X8AA 5BVHA 2M9MA 1FRFS 5LLSA 3UAYA 4YRFA 1MAUA 4DBLE 3NIWA 3RUDA 2HO5A 2X8BA 2E21A 4AX4A 2JI9A 2LCIA 3WIVA 2H2WA 4R3NA 4DDVA 2VT7A 3ICWA 2BVNA 4IHKA 3SC3A 1Q84A 3EULA 4CKYA 1WD5A 3T1YB 3V8RA 1B3RA 3CZCA 3ZK9A 1BGYH 3F6RA 3LGSA 2BH9A 3KS9A 2OBXA 5FBRB 2J3LA 1U9IC 4PBRA 1M0TA 2P4UA 4J43A 2H7VA 1U0GA 5J5VA 5I3CA 3IQFA 3TPFA 2Q07A 1SOAA 1R4MA 3HVKA 4E46A 2QV7A 1SKBA 2C2WA 1OF1A 4JPRA 2R4UA 5HOQA 4J6EA 4YALA 2BGUA 4ALIA 4AUMA 3SZMA 4CL3A 1RNLA 3TI9A 1KVRA 1Q3HA 1U0LA 1J20A 1I2ZA 3QX9A 2JCVA 1CUGA 2FF7A 3CIFA 4BFCA 2NO0A 1GSAA 2WWGA 2VDLB 3FMVA 3L6BA 4V38A 4LQDA 5DYIA 4EARA 3HWRA 5JI3E 1SQ6A 1ST2A 4CETA 1VE9A 2F9FA 3PFCA 2CHGA 4L9SA 2OECA 3OPXA 4FFBA 2NV0A 3CTPA 5HPYB 5L45A 2NT3A 1N6KA 2XOEA 1OYVA 2ZR9A 4DM3A 1LU9A 3RVZA 2ATEA 1THTA 4PONA 4JI8O 4YQEA 3RN4A 5IABA 1VI6A 2C61A 4GLJA 4FE4A 2X0EA 3ZWDA 2VP9A 1D5AA 5EXDA 4LV5B 3FFQA 2Q5HA 3K9CA 3ZE6A 3FD8A 5JSUA 4G4SP 4EPRA 1K27A 4NBSA 4M0DA 3TBFA 3W5SA 1PT7A 3LY8A 2H1IA 2QWPB 3ML1A 3H8WA 1IB0A 3TLMA 4PCUA 4ZYWA 4U63A 5LYJB 4JMLA 2IPXA 3B1JA 1XQWA 5ARDA 4LJSA 4PLFA 2XCIA 2ZBRA 3GVIA 3TINA 3QKSA 3T1VA 3A9RA 3E7PA 1W581 2ODWA 2QW8A 3AZPA 5DVZA 5JNWA 2IYQA 1CIPA 2ZJ2A 1BE3H 2PLWA 3LUFA 1JJIA 2GTIA 2DW4A 1N4AA 3W1EA 2HP8A 1KP2A 5E7JA 3TZCA 4F2DA 4YV2A 3BMXA 2P69A 2CMHA 4BVKA 1IONA 3OOJA 3SQDA 1KY5A 3GMDA 2I99A 2UUAB 2WHYA 3I1YA 2B1QA 4B75A 1YEWA 3VC7A 3PRJA 3IC9A 1N2HA 1O95D 1AG9A 1XHXA 4HF7A 1RQPA 3DAFA 4K9LA 1W4LA 3EY9A 4BYMA 1UBUS 5FCDA 2PK3A 1KU0A 1V35A 3R3HA 2E5LO 2RIPA 1NOIA 5IY5C 2WLLB 3COVA 3MWGA 1HDXA 2BFDB 4A0QA 2O8DA 2DKFA 5EK0A 1SC1A 2JFPA 2UYGA 1WCYA 2A7XA 4QRHA 2X0DA 1SOMA 1MX9A 2DTDA 4MV1A 1Z15A 1UBKS 3L93A 5TY0A 2VDWB 1ZJ5A 1DKUA 1U11A 3CR3C 3NONA 5AIAA 5ENDA 3SN6A 3USCS 1QRUA 4MVJA 5ALDA 2HEIA 1BZYA 2QOEA 1XF1A 2ZDQA 1I36A 3PFKA 1TZJA 3V7FA 2CHEA 4G01B 4D5GA 3FI9A 1NNLA 2QZ9A 1NJ6A