5D5QA

Hcgb from methanocaldococcus jannaschii with the pyridinol derived from fegp cofactor of [fe]-hydrogenase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
VMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards artificial methanogenesis: biosynthesis of the [Fe]-hydrogenase cofactor and characterization of the semi-synthetic hydrogenase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Uncharacterized protein MJ0488, Guanylyltransferase
total genus 51
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5d5qA01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 5d5qA02
3WB1A 4GYCB 3WB0A 1NBWB 1RSOA 3BRCA 1MMFB 4L8JA 5D5PA 1UC4B 1H2SB 5JJJB 3WB2A 3LNNA 1EGVB 1EGMB 2F95B 1UC5B 1DIOB 5JJEB 3AUJB 1T5EA 1VF7A 4DK0A 2D0PB 1IWPB 2V4DA 2F93B 4DK1A 2F1MA 1EEXB 5JJNB 1IWBB 2D0OB 5D5QA
chains in the Genus database with same CATH superfamily
1X9IA 2IYOA 2FEOA 2FZKA 4FZJA 4ZZ2A 1KEVA 5IJ9B 3MGGA 1W8IA 1TT5B 2HYIC 3DLBA 1IU9A 1CY8A 1QZTA 2CFSA 5EJ9A 4I55F 4PSUA 1TL7C 1Z5PA 3C1OA 3IDSA 4QIHA 3MAJA 1M57B 3HWRA 4KPUA 2W11A 2WTXA 3OT1A 4MUMA 1ORTA 3B6IA 4NENA 4URYR 2CSUA 4E6EA 5L7TA 3CPWU 4IJVA 1G4YB 2PYLA 3TTUA 4OBXA 1UH5A 3BMCB 3QVOA 1T5OA 4E07A 1XN4A 4I8DA 3EXEB 5E3IA 5B7PA 5BV2P 2EQAA 4TS9A 5KSYA 3THWB 1DWUA 1PWEA 2EINB 4D7SA 1B8VA 2FX5A 1PGQA 3KTOA 4Q34A 5IMBA 4PAOA 3NDBB 2C0QA 3T5MA 2OIEA 2WG1A 3CNOA 1ORDA 2BI4A 3FCSB 1N2OA 2B4RO 3QEAZ 3L4SO 2PUCA 3RROA 4CCAA 3QU2A 1N25A 3AJEA 1Z2DA 2B2NA 2R7KA 4IDOA 4HADA 4CMEA 4IP0A 3F5DA 2W6ID 4OGGA 4MVQA 1MU0A 1RZRA 4YJDA 4HWRA 3LQ4A 4UDXX 1JYEA 3AU9A 4PCUA 4JFAA 1Y8RA 4TQAA 1N2JA 1H85A 5F1YA 1PD1A 3QA3E 3D2LA 2GS9A 2XUZA 4H0LB 4NULA 2LXNA 1EZJA 4V0SA 4UCOA 3EMDA 2H4WA 1T6BY 3CEHA 3L4KA 1RAEA 2F62A 2AXEA 1UP6A 1E9VA 1D07A 2O0JA 2YCLA 1II8A 1P2GA 4HZIA 4K0RA 1VBMA 2JFNA 4MUFA 2WLNA 3DCNA 4HQNA 4G0ZA 1IPHA 4L2IB 2OBNA 4ETNA 4AP6A 1N75A 1Z35A 5C1PA 1GYPA 4GOOD 4H3KB 1UPCA 3AGQA 3DDWA 2JHCA 4NZNA 1GTOA 3ZMUA 3IT1A 4URUR 2OWOA 3EUWA 4FK8A 1Z5ZA 1CUJA 4NR1A 4LJYA 4P5DA 4RA9A 1Q0TA 1G9TA 4RO0A 4EMBA 1GNRA 3SEFA 1AN9A 3KR1A 4P1ZA 2CCGA 3LCRA 2A92A 1TZMA 3ENNA 3FCCA 2CFIA 4QAJA 2OCDA 3W2TA 4KK3A 2XMBA 1BOFA 4UHFA 1EG7A 3VR4H 2GBOA 1FRQA 1JS1X 1MLDA 3SQMA 1VF5B 4N23A 1N5LA 2H00A 1F8FA 3OBBA 5CFRA 3G23A 1IE3A 3IVGA 3MSXA 1XMOO 4G9BA 2OZKA 2YN2A 3CY6A 4AS3A 2JIBA 5TIIA 1L5LA 2BAGA 4TXNA 4J94A 2V6GA 3CZQA 3E58A 1RI4A 2G5GX 4EM6A 3WFZA 1FDTA 3DE6X 1H0SA 2D2EA 4DCJA 1OFIA 1RJDA 3ZH9B 2BR4A 3JASA 3REGA 1DC7A 2P9FA 2VK2A 1ZH2A 3TI7A 2I8AA 4DCPA 3PQ8A 2SHKA 1G4AE 3PUWA 3ADKA 1CYEA 2QRLA 4M1TA 4KUHA 1KQPA 3H3XA 3DOEA 3KYIB 2YRXA 3RKSA 2HHLA 3DTVB 4X8MA 3U7IA 3AHIA 1S1MA 1CK4A 1E5QA 3DE5X 3M8KA 4GI5A 5K45A 2RGEA 3O82A 1I30A 1RD4A 1FXUA 1O6BA 2GHIA 1C3JA 3K16A 4IAOA 3AXTA 3BCRA 4P31A 4WZZA 2AOWA 5L53A 1VZ2A 3GRZA 1LQ2A 3QUSA 5JE8A 1P1KA 1TJPB 2WLMA 1B2LA 1LPAB 2ICAA 2RBKA 4KFTA 4NJMA 4TWAA 3QITA 1KE2A 3W8NA 2F1KA 5JTTA 1R18A 4HEA1 1JG4A 2AH5A 3SGIA 5B5EZ 3N5KA 1D2DA 3QH4A 2Y2VA 4HWOA 4MV0A 2INGX 1WXQA 2XGMA 1GTZA 4PONA 5A4AA 2X6AA 4RSMA 3BL5A 5T67A 3S1AA 1TOAA 2KX7A 4DYVA 3TR0A 3K9SA 2QTTA 3AUFA 4Z54A 3DR3A 2O2ZA 3QWIA 2WJJA 1BWPA 1QO0D 4ZCRA 1U4OA 3HU5A 5CDUA 4C43A 2CB9A 2WZCA 2QZJA 2Q5HA 2G40A 4F5YA 3VYUB 2DEUA 1F48A 1YZQA 2SBTA 2X5NA 3PXCX 3K9CA 4PDRA 2GZRA 2Z8YA 4GWGA 2FSVA 3E18A 4OOEA 1KZ7B 4AULA 2HL6A 2PGXA 3AO0B 1GL6A 1L4FA 5P8WA 1NP7A 1RE1A 3ZJTA 1CQPA 2XDAA 4AS1A 1A9SA 1L5FA 5E6SA 1Q15A 2I7CA 5J5CA 3UATA 5IT9N 3BFRA 3R5HA 3EDMA 3DQZA 5ALWA 5LQSA 1ZGHA 2PT6A 4UUMA 1RLOA 4AUMA 4EKWA 3JQ8A 2CLSA 5LYYA 2BKVA 4AJKA 4IIVA 1SC9A 2C5AA 3ZWBA 5GGYA 1T9GR 1UF9A 3QEOA 5TPZA 3ZNQA 4ZGWA 2IRWA 1SKAA 4Z4CA 3N2KB 3VJRA 2DAPA 1HP8A 1J7JA 1IHYA 1WX1A 1DXYA 2QRJA 3F1LA 3JU3A 1TPZA 1HG0A 2A84A 2V1DA 2B3DA 1XQ8A 4MQ6A 3FPCA 3FVWA 2IHJA 5DXFA 1YCDA 4EHJA 1NQVA 2Z1MA 2OLJA 4D4MA 1E1DA 1UBNA 4DQKA 4GYYA 3ICCA 5CPBA 1BMQA 1M33A 1JG3A 2E4VA 2Q1SA 3LSYA 4IT5A 1UMCB 1PPJH 3L8HA 1MC1A 1DWQA 4UNIA 4YASA 3G8DA 5JO9A 2NXWA 3FF1A 1XPUA 3JWGA 4TXHA 1Q3EA 3AESA 5EWLA 1P61B 4LMRA 1Z06A 3A1FA 1TZKA 2R85A 3OQNA 2PO5A 1O9GA 4UEKA 3QVNA 3SBEA 1JDPA 3Q7IA 3SX4A 1GPMA 1F2TA 4KVGA 4NX2A 5JAMA 2UVQA 3OCJA 3CFYA 4HS4A 3LMKA 3L0PA 3WU2Z 4CL3A 1RXCA 4OUDA 2PYDA 3R6TA 1V8OA 1IXMA 3D81A 4INZA 2VHJA 4PSAA 1YTFD 4UE2A 1VRWA 1BDMA 2Y68A 4FMCF 4HAUA 1P5FA 4I3HA 4DOMA 3B5JA 3DAFA 1IH8A 1TF2A 1M2JA 2HFEC 3IE2A 3GUCA 1SBIA 1NRXA 2C2ZA 2JJ8A 1R0SA 2NU8A 1LDGA 1ORIA 3Q9SA 3I9FA 3S2EA 4CF6A 4CMIA 5I8PA 2BE7A 5BN5A 4KIGA 1BXGA 4XGRA 2C4NA 2HK6A 5B53A 4D42A 2M6SA 5DPMA 5BY2A 4GQAA 1ND6A 1QH1A 1X1CA 4DSOA 5A3RA 2VJLA 3W0LB 4CIAA 1IOLA 4HFJA 5EZYF 2J7KA 4N8SA 4QJIA 1UADA 1DFIA 2AEEA 5C4MA 5T6BA 3GPLA 5JS1A 3G4SV 3L1VA 1P77A 1YR9A 1OLUB 1ZNXA 5LZ2A 2BGMA 2PI4A 3SNHA 5E1OA 4WD3A 3I9OA 4B2PA 3UB3A 2X2FA 3OE7D 1FL9A 5FO1A 5JSHA 4ZHQB 4PTZA 2DVMA 3W9BA 3EWAA 3MGKA 2H1FA 2WJPA 2VS0A 2ZP1A 3P32A 3NCTA 3QVGB 1THMA 3F47A 2VWHA 5JYDA 5K2OA 1UAAA 2HRZA 3TQQA 3I0ZA 1Q92A 1G0OA 3OMNB 1DB3A 3PNMA 4CM4A 4O1MA 1DCKA 3HDGA 3DL2A 1RRMA 4B6OA 4W5WA 2NP6A 5D2CA 1DLIA 1NUPA 1KMMA 1U1IA 3LP6A 4MWEA 3ETNA 4FIZA 1Z4OA 2D2FA 3M3HA 4NYJQ 2O2JA 3UB4A 3VR2D 4LF9B 3VPGA 1GA1A 4UUNA 4PHGA 3HJCA 2OAP1 4M8KA 4XA8A 5GGXA 4CKWA 3L1HA 2JA1A 4L4RA 2BFWA 4DYLA 2D3WA 1UZUA 4RD6A 2VP9A 3GNLA 2EG9A 2W0SA 2WU0A 2R8BA 3ZGXA 1TAHA 1HRKA 2JLBA 3ND5A 2JGUA 3FSJX 2GTAA 3BRQA 1KY4A 3H3FA 5FPHA 3UICA 4B9EA 1L5KA 2X4IA 5KINB 3JQGA 1THTA 2XUHA 2W6IA 2FN8A 2AZTA 4DW1A 3EGDA 3AINA 1ZD9A 4ZVPA 2RDCA 4RXMA 3TD6A 3QE3A 1NV9A 3PVZA 5KVQA 4RPKA 1DQZA 1L9XA 3PQ2A 4FMDF 4TLMB 1JRLA 1CRWG 2XCLA 1Z88A 2J32A 2OCCC 4HYTA 1R0WA 4B31A 2Z0AA 4QXPA 2DUMA 1U65A 4R1TA 2O8DA 2FUEA 1OPXA 2I76A 5JS2A 2V96A 1CP2A 2DYRC 2X86A 3W3ZB 1NAHA 3SIWA 1VE7A 1IQUA 1E61A 1U0HC 2VDUE 2VZ8A 3HZOA 3NEJA 4MAAA 5HCNA 5L3RA 3O8QA 1G20B 5ADHA 5EJ5A 3EZYA 3W5UA 5H4GA 3COWA 3M4XA 3GLVA 1JFSA 1R4MB 4TMTA 5IXSA 1WXXA 3GEMA 4HNUA 2JCYA 3WLLA 2QBYB 1C4XA 1YTLA 4N49A 2QHXA 4YJHA 1RZVA 1CUIA 4IILA 3U44A 5A2QA 1F1BA 1SD2A 3TLZA 3SQLA 1V7PC 3LOUA 3U44B 4IINA 3UK2A 8OHMA 2Q0XA 1CR4A 1VGRA 2OG1A 3NKLA 1E7WA 1GWNA 1TMOA 4JP2A 1GCGA 1VP3A 1BNCA 3WDMA 1D2MA 3P9RA 1E0AA 1ZCAA 4GLJA 1E2KA 3CCQV 1VKNA 5EI5A 2NSDA 1T34A 2JLAA 1AQNA 4EPRA 4QT0A 2XDQB 3HB1A 3FCYA 4BWFB 1T35A 3E8SA 3IV9A 1KI2A 3DAHA 4D9MA 1YE8A 2YFQA 3AVOA 1JDNA 5DYWA 4DLAA 1EFPA 1XROA 3L0OA 3KQHA 2J4FA 1XKQA 2IXEA 2P1RA 4Y1RB 4DM3A 3ANNA 1A27A 4BY9E 1VMGA 1H6CA 3ZR4B 5J4HA 4CCYA 4DDWA 1E4VA 1SKMA 3ONWA 1JT9A 3QM1A 2ZUDA 5ALYA 2LJ2A 3I3SR 2YJGA 3KCQA 4YRFA 3ZYCA 1NVPD 2AG0A 1Y3FE 2DHDA 3H5VA 5LDHA 2A3RA 4BU0A 1W88B 2Y3IA 3CV3A 2ZDHA 2VC2B 4HTFA 1ONOA 4NK4A 4OD0A 2I2XB 3SNKA 3RTEA 3FB1A 4G4JA 4XR4A 4L0CA 1Y9AA 2BLNA 1QQTA 2XTAA 1N92A 3FJYA 1DRKA 2FL4A 3SYMA 4AS2A 2C8KA 1OTXA 2VYQA 5EUQB 1NDUA 4FVTA 5DK4A 2PHZA 1JPVA 3JWPA 3KU4A 4LNUB 5AKJA 1ONSA 2EP8A 4O2BA 1EE2A 1RJGA 4IKEA 1SERA 1WZNA 3SZ3A 4A91A 3LY9A 4BCDA 1NKDA 1S0UA 3EF0A 3M6WA 3OE7A 4NYIR 5AVOA 1BQ3A 3INNA 1XHEA 1XI1A 1ENZA 3JPYA 1JUDA 1K06A 2PKYX 3PCRB 2B7LA 1M7BA 2QTWB 3QHAA 3QFFA 3D8TA 4LK3A 5JNVA 1C1HA 3CJHA 4RQFA 1IHOA 3ZHZA 1KBOA 3KVVA 5TX7A 4F4FA 3NAQA 1VQNV 3MZ0A 1KJIA 3GNQA 1P7GA 3WHKA 4KSYA 3TSWA 3URKA 2Q8NA 1LSUA 2B5WA 4IG9A 3V4SA 5IDXA 5FV7A 2HPHA 4DJ5X 3LV8A 1GFSA 2VTVA 5A7GA 2WTMA 2HIMA 1I3MA 5ALXA 2E87A 3VYWA 4WDRA 3PF8A 2YYZA 3DJYA 1JIKA 1B04A 3ZHTA 2JIRA 4XVHA 4UOEA 2VRBA 2QTRA 1N2GA 1PLLA 3HXTA 3NVDA 4KXFB 4WLOA 2ODBA 5NULA 3INRA 4DR2B 2XT0A 4IIYA 1V54C 3G3EA 2ZUBA 2GWHA 3VJKA 5EYPB 3Q40A 1JP7A 3ZHRA 1DOHA 3O9OA 1SURA 5AW7A 4EVSA 1QQCA 2P5SA 4N3AA 4WGGA 2AUNA 4C6TB 3P4XA 2KS6A 3SDZA 4Z7NB 1Z0IA 3T5AA 3C97A 3M3DA 1QYRA 2AW5A 1K7XB 4M8IA 2HT1A 4ZU3A 1LTQA 1IB6A 1KPIA 2XUJA 3N2GB 3RGGA 4ECEA 3NIBA 4JGGA 4R1OA 3VTAA 3BVOA 2F3RA 2ZVPX 1KKUA 1OXVA 3BCSA 4FX5A 1E92A 2UDPA 4PDVA 3WB2A 4ZJZA 1DO8A 3SVTA 3GLFA 1YA8A 4KZPA 1OYWA 2GUZB 4QPKA 2Y05A 3J7TA 1KR5A 3U3OA 3G0CA 5JRZA 4GZMA 1H93A 4I1YA 1FLAA 2I6QA 1WPXA 2PMWB 5JOQA 3RHTA 2IEDA 5JAIA 3ZW7A 3IV6A 3GMIA 1WF3A 2IF2A 1PZNA 1G5PA 1KIMA 1W0JD 4PI0A 2VWQA 3GBPA 4CGYA 4ZT2A 4E21A 2FPLA 4HGOA 4C0XA 3LOPA 1GZSA 5JCJA 1VDZA 1SY7A 3KQYA 5K4GA 4TS4A 4XEUA 1MH1A 2R9AA 1FVOA 2VPZA 1QG0A 3WLHA 3AP3A 1LZLA 1OFGA 1YZVA 4WZAA 4AN1A 1H5QA 3BK2A 3FDZB 4ND3A 3VTFA 5IDYA 1VJGA 1M1XB 2ZRNA 2X4LA 1J09A 2IHTA 1BRTA 2CZCA 2JAQA 2NQ2C 1B8UA 2OMEA 2QZPA 3ACCA 3LUKA 4OA8A 2ZXEA 1PSWA 1M34E 1YI8A 2WNIA 2TRSB 3CZ9A 3BMQB 4MKGA 1Z5UA 1NSFA 2W5UA 4TLCA 1NLZA 5FX2A 5KEIA 3QUAA 2YZNA 4PPQA 4E30A 3T7SA 3RWRD 2DG2A 2WPDD 2WU1A 3MPUA 2I3DA 2W0XA 2YI8A 1RCUA 2QM3A 4MWZA 2OQIA 3C7CB 4ZCMA 1Q82W 1Q0UA 2I87A 2AI1A 2LNDA 2Y93A 3GP5A 3RC3A 1NMSA 3UC5A 2DHRA 1FNSA 1RJFA 3LYUA 4BQNA 5HKBA 2X0IA 4WL0A 1FXKC 3HJGA 2JIPA 5TPWA 1ZKMA 1RKXA 1N6KA 4WA7A 3EVKA 1FP7A 2GTSA 3NHPA 5FO0A 4AQYB 2WW8A 2QP9X 1NJ2A 4IVPA 3WJAA 1MX3A 2QD5A 4FN4A 4BFUA 4EUEA 1B06A 3CT6A 3KXKA 3KQTA 3KUCA 1FTWA 4EY4A 3A10A 5CBFA 1YB5A 3JATA 5KOYA 3JX9A 3ZBUA 4LXHA 1F6DA 4WNYA 1N33B 2OO7A 5BR7A 1U1FA 3K94A 4KSBA 1HQKA 5ICGA 1FFCA 1ZGAA 3D6TB 1IXKA 1H22A 1XMOB 4JQZA 4W8OA 1RKBA 5ECGC 1WZEA 2IS6A 1GZVA 3VYSB 3DVQX 3QUCA 4LK2A 3NAGA 5G1PA 2ZJ8A 4I1OA 3PEYA 1V11B 1VHQA 1IBCA 3O1LA 2DWPA 2V9PA 3R3HA 3B4SA 3JD3A 1T9ZA 2GYVA 4MB6A 1JILA 1XRRA 1NQXA 1A3CA 3ORQA 5FFFA 4IGGA 3VTZA 4TRNA 4A5OA 4BLQA 1A9XB 2AG1A 2OVFA 1PZXA 3PFFA 3QU7A 3ABMC 5T5QA 1H2YA 3WOHA 4HMOA 3IQXA 5B5SA 1AJNA 1KEPA 3NHBA 2GEDA 3VR6H 2Z6QA 3PEWA 2R9VA 4XXHA 5DGHA 2AFHE 3PEFA 5LOVB 3WLRA 5EHQA 4UU0A 3EDRA 5COAA 1Q86W 2H11A 5B6PA 1Q1BA 4XDYA 2LTAA 3PT5A 4Y6RA 3IBGA 3PFHA 3QP9A 4GT1A 2VPIA 4C4SA 1NONA 2B8NA 3IAEA 3ZBQA 4ALIA 1A7JA 3W9UA 2V9ZA 5CDFA 4KVAA 1P74A 4A6XA 5AW6A 4E5PA 2R25B 3H1IH 1U9ZA 2VJBA 3L7MA 2WPDG 4R0VA 3WDKA 1T10A 1KQSU 3FI0A 3H86A 1K8QA 2CDYA 1SZPA 2QWXA 3WBKA 3T5TA 3CLRC 4JAVA 1QDEA 4GKKB 2J07A 1NXSA 3BWYA 4MRMA 3GH1A 2QD4A 4NAVA 4EEKA 3RU7A 4UHKA 1ZAUA 1LRKA 1SF9A 5CBHA 1Y4AE 2BHTA 3MERA 3TQCA 3DVAB 2NNUA 3S2GA 3ZU4A 1X80A 4PJ0Z 4RC9A 1Z56C 2EERA 3FWZA 5CDGA 3CSDA 3HMQA 3E8FA 3GJ5A 4UMFA 4BTLA 1ZCFA 1XDUA 4KIWA 3IP5A 2VYVD 4J7KA 3ESYA 4E4EA 1QS0B 3U39A 2J30A 3KT0A 3VAYA 2I3AA 1E2JA 1G64A 3U10A 1JR3A 3KTFA 1U81A 2PXCA 1T9HA 3JAWA 4V0MA 5CX4A 3ZGNA 3ETDA 1GN9A 4NEHB 5JVDA 1R37A 1ESMA 1K63A 2ZK7A 2Q9UA 2B1JA 4PWZA 5DGDA 4U3JA 4B3HA 2FPRA 3CUEF 4RTOA 2NXJA 3LNCA 3K20A 4FFSA 4WAUA 5ANRB 3JQDA 3LLCA 3P71T 4UVCA 2F3PA 4BNKA 1NMYA 2OUKA 1TZJA 2ZAYA 1Y8QB 3TLEA 4BZXA 2GTPA 2WKWA 3IUPA 3NNDA 4I1UA 1XD2B 5BRAA 2JA2A 2V6FA 4L7QA 3WIOA 5LYJA 3T41A 2AZ4A 3BGOS 2V7EA 2IEIA 3DNFA 4RE6A 1RE0A 4CQNA 1GZ5A 2QQFA 4RAIA 2H2IA 3A9CA 3H1FA 1DQRA 3M4ZA 3P97A 4K9KA 1WNSA 3CTPA 3SIXA 2F55A 2JBHA 4KU4A 3VU9B 2ORYA 2X42A 3UXMA 3F5SA 1RP1A 2BGIA 4ARBA 4BGUA 3DFKA 2JAUA 1UEJA 3QY9A 3AG2B 3ICPA 4G65A 4EPVA 3DV0B 3N87A 1MFPA 2AOVA 2R6DA 1EINA 3GB9A 4II7A 1NZFA 5JASA 1Z9BA 4JLDA 3UCEA 3PUJA 3SE0A 4CQMB 1L3CA 2H9IA 3V8VA 3ADDA 4OUDB 3KWLA 2J9RA 2E1RA 1E9BA 4H6VA 7MDHA 5BOSB 4TZ0A 1CF4A 2P9ZA 3EAGA 3HACA 4EB8A 1UEXC 4UU7A 3EGVA 1WA8B 4EELA 5CDHA 1L5ZA 5HOQA 1I3LA 4JYBA 1NY6A 1X87A 3IELA 4WBNB 4KPFC 4C0WA 2RAFA 3H9BA 5AKIA 3SKVA 1O95D 1OASA 2DFLA 4MZXA 3IC9A 4YP0A 2ID7A 3WADA 2Y1FA 1OHHD 3HB0A 5I8WA 3GLIE 2BPOA 1VOTA 2ODQA 2DMXA 5CP8A 3C6BA 3OFNA 5DBEX 3QPWA 1Z6TA 3G2QA 2XRMA 5BWCA 2MU1A 4X1YA 3ICWA 4IXWA 4J7JA 4PBSA 3GYGA 2DHQA 1G7SA 1IHDA 2WP8J 4LWPA 4HQKA 5HMMA 2H8PC 5K8IA 4G67A 4BLWA 3CW9A 5LGNA 4DARA 1X7YA 4PSVA 5A62A 3GFQA 3LI2A 3LUPA 9MHTA 1STOA 1T8PA 3V4ZA 1TRKA 2ZJOA 5ERGB 2GHRA 4XWGA 1C7JA 3MTQA 2DT8A 3ETLA 4RHYA 1KFJB 5EIWA 1KP3A 4NPHA 4OO3A 1UK7A 3R9KA 2AN5A 4ZDJA 2Y1DA 3E3OA 4C4AA 4DV3B 2GJAA 2KE5A 3I12A 1Z63A 4NMWA 2IV3A 1LRLA 4NYMR 1I7FA 2Y1OA 3ENQA 4I9NA 1J8FA 3GVIA 4DA9A 4N8DA 1H4QA 1JTVA 4O4JF 3W4JA 2WWXA 4RH3A 5HIAA 5AK6A 1W7AA 4KQXA 1QYCA 3ND7A 1J97A 2JJ2A 4J7AA 3K1AB 1E79G 3ONDA 4BMOB 2M7WA 1E4EB 4CT4B 2QLJA 1CUAA 1KO5A 2QENA 4E94A 1B16A 1ZA1A 3P3PA 2JFYA 5GJBA 1V43A 4UPEA 4BFLA 4EUKA 4RJTA 5F7XA 2LW7A 2XYVA 4WXPA 5AK0A 5BVHA 1QX3A 3F6SA 1BFDA 1CETA 5H6QA 1LBSA 1KFEB 2GRUA 1PL4A 3ENVA 3OHSX 4GE0A 5DCUA 3H2HA 3MNFA 4DIUA 4E4YA 1K5DA 2YWHA 5KUKA 3LRPA 4D1YA 2ZT9B 1T4CB 5ILQA 2QMHA 1KNXA 3GVXA 4JC4A 5EZ6B 2VRZA 2GUGA 3QOWA 3AB8A 3CXHF 1X7ZB 4K9NA 1G1XB 4MJ7A 2VQFO 4X41A 1YJNV 2GN6A 3RIXA 2C57A 3ZV6A 2GXSA 4L0DA 3MDSA 3STLC 2EARA 2WAYA 5BURA 5TF4A 5CXQA 4DV6O 3C74A 3FMVA 2R96A 4QXMA 3AG1B 1EDOA 1ZO8A 4NG5A 1RM1C 3NHWA 4CC6A 5D3MA 1EWRA 2ZTVA 1PSDA 1EXDA 1P39A 1SG6A 1QBZA 3M6MD 3W4IA 4Q7KA 4G4IA 5HE8A 1DC5A 3W5DA 2YL2A 1A2KC 3TQTA 3U49A 5TT0A 3G7UA 4GOKA 1XCJA 1QQ5A 3X2QB 3IXLA 2WTEA 4WOPA 3WQQA 2CSXA 4OGKA 3BABA 1USIA 4FFBA 1UINA 2GEFA 3EXIA 3IDFA 4HWPA 3ZWNA 3G2KA 2J45A 3G17A 4OHOA 3T3GA 1DX9A 4A82A 4TYNA 1ZFNA 2KYRA 3D0QA 1L4LA 3OCXA 1CXZB 5DM6V 1PR9A 2VQSA 1MABB 3NRJA 4DMFA 2X9NA 3EXFB 3IUYA 3VH2A 1KAEA 4BEVA 5LQUA 3HR4A 1BH2A 3LM8A 2RC5A 1DCFA 1HDGO 1MP0A 3IOYA 3OT5A 3WNZA 2HFKA 1EG2A 2MSCB 5BUQA 5IULC 4TVSA 2QKAA 3HCNA 5KHIA 1FQJA 2CZQA 1I1QB 5EIHA 1NSTA 4PO8A 2NNWB 4BNDA 2B8TA 5F7OA 4B6QA 1I7SB 1CJBA 2ZI5A 1B4DA 3BSSA 3T7TA 4X63A 5HUQA 5KREA 1OAOA 3NX4A 4F5ZA 1LPPA 1CQXA 5DVZA 3KJFA 3I30X 1XTTA 2ZRIA 3NT5A 2LCFA 2LFSA 2AC4A 4YIOA 1MX1A 3AEQB 3JQQA 3NHJA 3R3SA 4HNSA 4IHJA 3LHDA 1G5FA 2Q3FA 4P6VF 1X42A 4DUGD 2CDNA 4UVBA 1AKYA 2RHCA 2V54A 4HRVA 3LHKA 4OXXA 1GPKA 4WBXC 1AKWA 1PL8A 2PD3A 4K3VA 3UHJA 3ETQA 3H01A 2HADA 4TROA 1DTSA 3EOBI 4ARSA 3QJYA 2BD0A 2UVPA 1H94A 3ZKWB 4RMGA 5A6VA 1UBRS 4FB4A 3K1ZA 4NATA 1B26A 4G09A 5KLVH 2L2QA 3B20A 3BSFA 1USVA 1ICIA 3ACDA 3HDHA 3ITEA 3TEMA 3EQZA 4L0MA 1ORRA 3I34X 2P0YA 2Q5JA 3GGOA 4MMZB 1MVNA 2QLNA 2Q0AA 4BE7B 3V4RA 3OFNG 2GH1A 3OE7G 4O25A 4RVOA 2QN2A 4ED9A 4KO2S 4WOCA 2X3UA 2FP4A 3JD2A 1ZHHA 5JPCA 5HJ7A 3CLSD 3OTHA 4D8UA 1TZBA 3AIKA 1UJWB 3D4IA 1R7RA 2AUTA 1G21E 3G6EV 3KPYA 3NHFA 4G0OA 3FHLA 1PHPA 1CLUA 1E20A 3DVRX 4JODA 1KWGA 3DH0A 1UDRA 3CEAA 1LQUA 2B61A 5KPJA 1IRIA 4FLZA 5FTWA 2ODPA 4J80A 3VC3A 1EVYA 1WB8A 1U7OA 2HHHB 5H6RA 2UZ1B 4D0RA 5KQPA 1GFZA 3CVVA 1M54A 3OX4A 1EX1A 2J33A 3DKIA 5KVCA 2ZIXB 2XW6A 4DNQA 2E0IA 5CVDA 4EKEA 2QRZA 3VO1A 2EKZA 3VSEA 5IWAB 4W4KA 4GPAA 4GPTA 4IIFA 3H87A 4MS4A 2VTEA 4TMWA 2I03A 4U2CA 3RI3A 1LQTA 3AFIA 4GICA 5DF1A 5BQ3A 3F6CA 4PYOA 3ZCVA 3AWIA 4EBBA 1T0PA 1JQ0A 1BO6A 2DQ0A 2FSGA 2IU0A 1N36O 1UZLA 2WJIA 3DE2X 2F3QA 1NG9A 1MB4A 1DCTA 3FB4A 1GTL1 2AR0A 2BOVA 2GBIA 4KR2A 3QVLA 4YMWA 4FJ0A 3L18A 3N53A 1YS7A 2JVKA 1TC2A 1XWFA 4P35A 3HA3A 3RUDA 1EQAA 3MOSA 2NQ8A 1WOMA 2DOKA 1I2BA 3I55V 4YJGB 3LHFA 2O2CA 1FKAO 4D96A 4O4HA 5C5CA 5B3JC 1P9RA 3D6UA 3IVAA 1WCIA 2C2OA 2XYPA 3F5QA 1P4HA 4DV3O 1GO2A 1MRSA 2IUSA 2OO5C 3O8BA 3QHPA 5F23A 4GYWA 4RE5A 3DHNA 1KAHA 2Q4EA 1OI4A 5CFZA 2R1VA 4YHHB 2E3JA 4C0SA 4D0LB 3OQJA 1RLUA 1YQXA 2AJDA 5M2QA 2YHAA 3BD6A 4BFYA 3E5NA 4M7OA 1KMHA 2I6FA 3JVVA 3TNDA 3LQFA 3K58A 1JL3A 2VTKA 4OUKX 1RWQA 2PR2A 5JIBA 1FLVA 3C3TA 2Q6OA 4MKXA 1RYNA 2FETA 2V7BA 1VHWA 3DT6A 1E6EA 1K2WA 1A5ZA 3N7TA 4GL4A 4V0OA 5DYTA 1AKTA 5ESDA 3DKVA 4E5YA 1VPWA 4B6EA 3UMMA 3AG6A 3R4CA 3QE0A 4QNMA 1CKEA 3I8OA 1YTFB 1JHUA 5BYJA 3SC4A 2FE4A 3EIWA 4IKOA 4FGLA 5ALJA 3ZV3A 1PZHA 1HOTA 3JCZA 4O4JA 1Z39A 2ZULA 3N9IA 3UO3A 5A4KA 3OICA 3B53X 2Q5FA 4ZAFA 5JLAA 1T2VA 1ZXXA 4FEGA 4CR7A 5BW4A 1T4GA 2ZAGA 3EDYA 4U39A 4U7OA 3ZOKA 4MLCA 3T1HO 1DRWA 3FKSG 1Z2PX 2Y6VA 2NACA 1T6XA 3GJQA 3HB4X 2BJWA 13PKA 5PGMA 3BF8A 3FCUB 4MV7A 5CGZA 2XCRB 5LD2B 3UK0A 4CEJB 4V03A 3VU3A 2CDBA 2D2XA 5KX5B 1ZRHA 4AJ1A 1QLEC 1YR3A 3JALA 2PWAA 3H84A 1ADGA 4WIAA 4IUCS 1OZ0A 1DC3A 1WWKA 4ARZA 4F1KA 1P7PA 4Q3CA 4EB0A 5LJLA 2E82A 1ZVKA 4EJ2A 2UZAA 1VJ5A 3JQRA 5ECDA 1U0SY 3W2HA 3DMPA 1ZOSA 3KSDO 5HPYB 4V24A 3SC2B 2D3OW 5CDSA 3L7AA 3HY3A 4B80A 4F4IA 4P9OA 4PV7A 4R3WA 4XYMA 3HB5X 2HQ1A 1L5MA 4W5QA 2RCVA 1GKYA 2I33A 3B6ZA 4QEZA 2QGZA 4KQWA 1SXJC 3DWEX 1NG1A 3MJ4A 3NATA 4TTSA 5DTEA 5BOSA 2HO4A 1AGNA 4UJ5A 3AR6A 3T3PB 4JC8A 1U0RA 3STUA 4H1VA 2X3YA 2CHFA 3UJBA 2OCXA 3I45A 5D51S 5GTHZ 1NZJA 2BFFB 2IS4A 2VSYA 3QVKA 3DM5A 4GVLA 2BONA 3Q3VA 4G8DA 2YFHA 3ND9A 5ER9A 4CCSA 1T91A 3BA9A 4DV5B 4AZVA 1TZCA 3RFFA 1O1YA 1XTVA 4B9AA 3WR5A 2GKOA 4D4IA 4C3UA 1J24A 4E3ZA 2PKQO 2ZKIA 1Z6XA 1VLJA 4PYKA 3Q7PA 4TL7A 5JXGA 4W5RA 3I04A 2WJ6A 4WFQA 4CMIB 5JZVA 1LNZA 1NHWA 2EQBA 2NO6A 3JQAB 3QE4A 3M7MX 3QBJA 4JC0A 4DN6A 2O59A 3MCWA 4Q7EA 4BC1A 4R2HA 1YJBA 4PXAA 4ZANA 3VR1A 3EQ7A 3B1YA 3AKEA 2CGNA 3SDBA 3T7IA 2VI5A 2WA4A 2CXOA 3RF6A 2ZTMA 5ITSA 4IDGA 4Z4FA 3GWKC 2WJAA 2D7JA 3DTVD 3NT4A 4QOFA 3TW0A 2WWHA 2Q1XA 1TCUA 4B3JA 1Q0HA 2HA3A 2AFHB 5BQOA 2WYHA 1A9QA 3LNTA 2CAZC 4F4UA 1XCGB 5HNKA 1U1CA 2CL5A 1ULTA 2V7PA 4WZAB 2VP2A 1WPQA 1TVMA 2VHXA 1V4NA 1KAMA 4HDSA 4KE8A 3PC8A 4KXVA 4N5IX 5GM1A 3KOMA 4Z3DA 4UOZA 1Z7GA 1SKQA 5HCIA 5C5IA 3RS7A 2UV8A 3QRWA 4LN1A 4ZVRA 4ZOCA 4Q4HB 1M4UA 1YKFA 2PD4A 3CNHA 1XZLA 5AW1A 5ED4A 1ST2A 4IMRA 4BFZA 5BVGA 2NSJA 1R0KA 1KQFA 2FMLA 5ICFA 4CMCA 3E9ZA 2RE8A 1BA3A 3Q4HB 2OILA 2PSEA 1V55B 3ZCUA 3N6RA 2AXQA 2IH3C 4XIGS 4D2IA 5FHQA 2XAGA 4HAYA 4IGAA 4PE5B 1EVIA 2YUIA 3K5HA 2QIOA 3IT3A 1XYGA 3EZ2A 4BO4A 4QFMA 3G13A 3GFGA 2PX8A 4GRDA 5EUBA 3RRZA 4P92A 2HHJA 2OPBA 5C80A 1TT7A 5DT2A 3FTEA 4JGBA 3CGGA 1XRNA 1Y5NA 1QANA 2ISSD 3U4AA 1S8NA 1NGSA 1QK3A 2POQX 1VG9B 4XIFA 1SXGA 1QORA 2C9BA 4U02A 2ZDQA 2PUTA 4IZHA 4PGMA 3C3WA 3AK1A 4D8TA 1V8DA 2FDRA 1Q43A 3LXRA 3Q3EA 4G8CA 5TEWA 1DQNA 4C22A 2OBXA 4RENA 3TGPA 1FP2A 4OPHA 2Q4OA 4EG8A 1A9XA 3D3EA 1NA5A 3Q3IA 4HAOA 2EZ8A 1WUYA 1E2NA 4ZOAA 5DM0A 3W9SA 4EPYA 1HR0O 3NT2A 1U28C 4G1UC 2W8BB 3SS7X 1SQFA 1ACMA 1VE6A 4D9CA 1E3SA 2P3LA 4H7KA 5FLYA 2IF0A 3H17A 3NI2A 4BNZA 1T1GA 3OZTA 1ZL8A 2WVGA 4UVIA 5IKOA 3TTYA 4B3FX 3R0XA 4UCWA 3OQ1A 3HJFA 1Q7CA 3M3PA 4PC1A 1YHYA 4WI1A 1FZTA 4ETIA 5BMVF 2G8LA 4OSEA 1PEDA 1Q57A 4NEGA 4RTNA 1QH9A 5BN3A 5DNUA 5ILOA 1UJNA 1R50A 2O8CB 1W47A 2PZAA 4OM8A 2JH8A 1VFNA 4LMBA 4PM4A 4YV1A 2NO5A 3EVEA 5BSGA 5ESXA 5DECA 5LXTB 1DPGA 1HI9A 5T4EA 1DVRA 3GPBA 3SEAA 4RCYA 5A0VA 4UBLA 1JDBC 4KXWA 4TRMA 3WO1A 4EAQA 1U3CA 3BFVA 4HDKB 5FAKA 2DP4E 4IDNA 4RD1A 3OPMA 3K9AA 3L72H 2LKDA 2UU9B 4HAWA 4GPBA 5EMLA 1E3JA 3A1TA 5BP7A 1QM5A 4PA9A 2QT0A 3S3XA 3BK7A 5AJWA 3E5HA 2QD2A 3OSZA 2MT9A 4E51A 3WQRA 3EEIA 5AKZA 4B6RA 2QTSA 2EZTA 4A27A 3RYCB 5DLDA 3UWPA 2JJ1G 3UOAB 1H2LA 2ZR0A 2HV9A 1CUXA 3D59A 4TTJA 3I8SA 3SR3A 3WIVA 3OF5A 1XMIA 4JMPA 2F2TA 4GWKA 4ZHSA 1U8XX 3P2JA 2ZSBA 2Z1DA 3EFHA 4TXJA 4E7OA 5DO9A 4F6EA 2JCGA 3FPEA 4Y2HA 4ZQCB 4O2RA 4BHTA 4UTRA 2FFBA 4GYKA 5EGNA 1RAAA 2PIDA 2UUAO 2B0JA 3C3PA 2JCVA 4CI9A 4DLSA 1XQXA 1YCGA 2BDUA 3WMEA 2CYBA 3ZQJA 5BVHB 5AOCA 1KYWA 1FRFS 1O97C 5LLDA 4RANA 3P20A 3FPGA 2C4TA 3Q6MA 1U7UA 2GZMA 3R9XB 1HNWO 2GNPA 3FYUA 2FHPA 1DGQA 4DLPA 5AKEA 4LSWA 1Y7LA 1E59A 3R7DA 2XNDG 4EUNA 1RLMA 3PC6A 4V0RA 1AB5A 5JR3A 3BJRA 1TF5A 1F2UA 1M2VB 1PDWA 3CSUA 3V00A 6REQA 2FSHA 2QSYA 3H97A 3U5TA 1C14A 1OGIA 4KO8A 4OGFA 4ZVNA 5I7UA 3OZBA 3QYJA 3SSOA 1HDEA 1JFFA 1OZGA 4M7RA 3AR7A 5DEIA 4E5SA 3DHYA 1N34O 3DFZA 5I01A 4KQ9A 3WL4A 4L5AA 3VDRA 4AMUA 1T6NA 2FSUA 1NMEA 2VHYA 3B3AA 1PZFA 2FF7A 5I9LA 2WJ3A 4Y1GA 1E99A 5FKJA 4BRSA 2HVJC 3FYIB 3TSCA 1V8ZA 3JSNA 1HW7A 1KEEA 3MXTA 3JTMA 3LC1O 3I1JA 1UZAA 3IRVA 4OEHA 3YASA 3L73H 3C6MA 4MGEA 1LBTA 4JP5A 5HFJA 3EK2A 2OY0A 4CKEB 2J3DA 1VIBA 2ZJYA 3GDOA 3MYYA 3O4FA 2NYVA 2ZPTX 4QUDA 4DWVA 3FB8C 2R8ZA 3HUDA 4BAZA 3AOEA 2YEVA 1K3FA 3DGFC 2HWYA 4R9SA 3K05A 3TLJA 4II2A 1SUDA 3F71A 2ZINA 3PT9A 5H70A 3UOWA 3Q7TA 5E0KB 4FLYA 4TKLA 4H0NA 2EZPA 2RGYA 3HKEA 4UHBA 5F2OA 3D2CA 1YIAA 3L7IA 1YBAA 4J16C 4Y1FA 2X0LA 1L4NA 2O5RA 1JQ5A 3DCJA 2WLLB 1T3GA 3G6WA 1NBMA 3EEBA 2FR8C 1UDWA 1XELA 2ZQ5A 3GAFA 3OFSA 4L75A 1XFDA 1EK5A 4M6WB 4JENA 4QLOA 1QWOA 2JGJA 4DRXB 3O1HB 3R76A 1DXHA 3GZNB 4N9QA 2YDEA 4NQRA 2GRJA 2Q3CA 1Q3HA 4BO8A 3WIEA 1YQWA 2Y48A 1TK2A 3TOCA 5JAZA 3COJA 1J99A 4D56A 1C9YA 1RIIA 4KXRA 1YE5A 2CJFA 2EFYA 4DR3B 3E2PA 3HXLA 3R44A 1QE3A 4FNMA 4OGLA 3NEPX 1QTQA 2YHUA 3G2OA 3LPDA 4OATA 1P4RA 1E0SA 2A14A 1DRUA 1N6IA 1SVIA 3DO8A 4M55A 1ZMRA 3U9SA 2Q9CA 2IIPA 3MCZA 5FI1B 5HZHA 5E8RA 3MHPA 3MUEA 1MT0A 4PG5A 5F7JA 4DHEA 5EIEA 1AX9A 3L8YA 1BGWA 3P0EA 2RHJA 2IGBA 5K8UA 4LF6O 5J2TB 1YZLA 2EFCB 2F8LA 1U3VA 1M1YB 1KDTA 4CHTA 4DAOA 1OTHA 1UKZA 1UM8A 2X8WA 4OU5A 5CDTA 5IBCA 1DAFA 3ER9A 1OD6A 1C0IA 3RRJA 1LKZA 4CHGA 2BKXA 2OP0A 1AE1A 2BLLA 4LWSA 2IH4A 1FDRA 3RVLA 1RQPA 1E2PA 2RGNC 1KAOA 3AHDA 4Q9LA 4XM0A 5FJIA 3J7AU 1VBKA 1IWBB 3AC0A 5HJ5A 2MMGA 3H42B 3N8IA 3OTQA 2XCQA 4TSFA 4WUTA 5H83A 3NVAA 2Y69C 2RAVA 2VDKB 4DIKA 4KPEC 1T9AA 1BXZA 1KZGB 3CVUA 1R5BA 3ZWDA 1E5DA 3M5PA 3VSBA 5EEGA 3HYRA 1XPOA 1GNTA 1QR8A 3FDXA 4KGXA 4M89A 1G21B 1U6IA 3UGQA 3L7NA 1GZHB 2PJUA 1NQAO 3D4OA 3OF2A 4RK7A 1B8NA 2P1DA 2XIJA 4TMXA 1CP3A 1DAGA 2O2EA 3V8RA 4ZGGA 2AJTA 5FNZA 2QAGA 3ZNPA 3CHXA 2VRNA 1BN6A 2IQIA 2QRGA 2AFIA 2G76A 3LDAA 4FQ8A 4LC9A 3MWLA 2IVZA 4D80A 1SUPA 3CUWA 1BWQA 5ALMA 1M3SA 3TXYA 2Y77A 2HJSA 1U8FO 3KB6A 3BHPA 1X8JA 4GRAA 4NNPA 3CD6V 1GT6A 1NW4A 3C5CA 3MSCA 4D79A 4F8EA 5B1OA 4ZYYA 3KD2A 1PDOA 4ATNA 4EB6A 1PUXA 1X7WA 3QNEA 3IQEA 1BXGB 2VF2A 4NBUA 1OH7A 4JLVA 4BQQA 5EWMB 4CG1A 2P9BA 4I3GA 2J46A 3EIQA 1EFUA 1H2HA 1AKVA 2H1HA 2IITA 3DE3X 1CY0A 1GSIA 3IUBA 3VH4A 5IK2D 2YRWA 5IY5B 1MIOB 1T0IA 2EIJC 1L4HA 2XB9A 4UE6A 4XD7D 2J3IA 1QTIA 4DV7O 2WAMA 5IJ0B 1JQAA 2E4AA 3KU1A 2BGWA 4PA6A 1Z4JA 1AH2A 2NXEA 2JBAA 1GN4A 3F8WA 1PFQA 3T1QA 5L4NA 5FUYA 1A71A 4KN6A 4EGSA 1T9KA 2VK8A 3DJFA 4OK5A 4TV9A 3LC2O 4AXXA 3KL2A 1N2SA 5EHXA 4I4CA 3IOCA 4FR2A 2Z43A 1UMCA 2PSHA 1ORHA 4K28A 1SBHA 2AMLA 5FIUA 4RTSA 2A1UB 2HR1A 1RDFA 4J2HA 3LG2A 3T38A 3GUYA 5CD1A 2C2AA 3BL8A 3QPCA 3VVCA 2X8BA 1MV5A 3EZ6A 1E1KA 4Y3UA 3Q4GA 3TSOA 4GM4A 3U3XA 2GWRA 3KTDA 4M46A 4OQEA 1G8GA 1K7EB 2NLOA 2ORVA 3GRAA 2P1ZA 1QZ3A 5B1IA 2QU7A 4UMEA 1PRYA 1UBJS 1DC4A 2YNMA 2XECA 2WLKA 3HCRA 5E3JA 2HK8A 2X8AA 1ULHA 3CVYA 1C9DB 1V7QA 4FYIA 2FPGA 2ZM6O 4ENWA 1IAQA 3AJRA 1OI2A 1R4NB 2NGRA 3D8HA 4LUCA 4Q24A 4CLXA 1MV8A 3ZY5A 4RZ3A 2C7OA 4PX9A 1IQ0A 3QU4A 1NJSA 1O2DA 3ZTYA 4UZEA 3CEIA 1KI9A 2DPYA 2CL7X 3UY4A 3D5EA 1H23A 2XQKA 4ZCSA 4QE7A 1WPRA 2XAUA 5DDIP 3VAAA 1U3FA 3Q2KA 4RMIA 3P30A 2R7NA 4XVCA 1YJ8A 2JIZA 2WA1A 4JI5O 2AN9A 3OX3A 4N6GA 2EILB 1MOSA 3AMVA 2ODWA 5FL7D 4F85A 1NP6A 2GCEA 2IVFA 4X3OA 4EUSA 3P0FA 2HF8A 2GEVA 3ULKA 5HP4A 1L6RA 3OJFA 1IYZA 2ZI7A 1UFKA 2VNHA 1P62B 4XB2A 1REQB 3F3YA 3MWDA 1DINA 3RBAA 4WXHA 3PCXA 1UPGA 4LMPA 4KFUA 1N6LA 4L27A 2HU8A 4KC0A 4HVTA 1COWD 5EEHA 4BMNA 2J4CA 2XJ9A 1B6RA 4LJ8A 3TTWA 4JASA 1JEEA 2HC9A 4D0GA 4KWCA 4IQ8A 4HOYA 4BEBA 1WAZA 5CJ2A 3UJ9A 5FWXA 4PGGA 3LPNA 4QVIA 3RIHA 2QAJA 2Y4OA 3A31A 2N3ZA 2ILVA 3LT4A 1N5MA 3RJ5A 2GN8A 1L4UA 1R8SA 2BCGY 1R9JA 2CBZA 4F6RB 1SCQA 1T4DA 4RSRA 4Y2RA 4ARVA 2BTEA 3FYUB 4X89A 2OFOA 2O0LA 4QBHA 3V1TC 5I47A 3DUFA 2HQSA 2H1LA 3IMEA 2NO0A 1H0KA 1E3IA 2FXVA 3KXLA 4YAJA 5DLYA 3C45A 4KN9S 4EA9A 3ZHVA 2RIPA 5KYWA 4YHBA 1X70A 2GNOA 3TZ6A 3BJMA 4FC6A 4WKCA 2RK4A 1C30A 2M98A 3VR4A 2H4HA 1HMPA 1E96A 5CIYA 1NT2B 2XQGA 1RACA 3KUXA 3NFRA 4ENSA 1PNTA 1QRAA 1QV7A 3A6LA 4B4WA 3SPXA 3AL2A 4R8VA 4QDOA 2BJHA 3T9DA 3KCXA 3I39X 3M82A 2X0FA 1EFTA 2OKGA 4WRRA 3UTDA 3ZDFA 2Y76A 4BN0A 2JJ1A 5FOQA 2ORIA 4V2UA 3CH4B 4WDQA 1TU0A 1MW9X 4MULA 1I94B 4PF1A 4FHCA 2GSDA 4S3MA 3TZEA 2PFGA 3ZZ0A 1GQOA 3M70A 1PNMA 2IYSA 5JHHB 3AT1A 1E3WB 1ONNA 1KEUA 1BCSB 2ZROA 3LYAA 5T57A 3WRVA 4MVOA 5JMWA 2DQZA 3DMYA 5HCUA 1SQ6A 5DULA 4J9YB 1CEXA 1WDTA 3ZD6A 1NBMG 2XT6A 1KH1A 3QBEA 3SQWA 1ZSYA 4MW1A 1QE5A 4JUFA 1QDLB 2YY6A 4O5OA 4EPXA 4CIYA 2K1EA 3OFVA 1NHGA 3KEOA 4OJKA 2OL4A 3P9QA 1R88A 4K8ZA 3AUXA 2O50A 2ZXWB 3P8ZA 2P2DA 4G5YA 4NOJA 1JIQA 1JKIA 3PF9A 3F96A 5AJYA 5CVUA 5IC5A 3W5IA 4ZYVA 1W2HA 2FUG1 2PUGA 3L1IA 1HQYE 1O95A 2Q3LA 3LLVA 4KUGA 4MQEA 3QMVA 4ARIA 4C7OB 3K96A 2N46A 1R8QA 2V7QA 3KHKA 2DW4A 3E8GA 5FI5A 3E5RA 2COEA 4OIFA 1WU8A 1JFVA 2C82A 3UJ3X 5M5BA 1RSZA 4NEQA 5JTUA 3TW8A 4IHKA 2P68A 1UXHA 5H1YA 4X1YB 1YRHA 4W5TA 3I09A 5K0BA 1Q1GA 2PMFA 3PD0A 3O31A 4FU0A 4K2HA 4BNGA 4A15A 2C9MA 4BKRA 1OWMA 2KM1A 1Y1KE 1TE2A 4LSZA 2VJDA 3WGJA 3FN4A 4BP3A 3BWXA 4BZZA 3DZCA 1NQTA 3GZJA 5C1DA 5DM1A 3Q3CA 3VNSA 2OD2A 3EN0A 2NSHA 5LHGA 1PGOA 4RQBA 2WFMA 1F0PA 4RCVA 3R3WA 2XZOA 1WLEA 4KHPB 2BEWA 2E3CA 2FNAA 4C1NA 1RP7A 1CV2A 4I0XB 4FILA 4XGNA 2J31A 3R8FA 1YCHA 4BXOB 5BSVA 2Z08A 5BXYA 1HC7A 1NTOA 3AP2A 2AHRA 5FTKA 2AF3C 4LAFA 4NR0A 5E6UB 4DJEC 2J0EA 1NM5A 3QBTA 3CU5A 4Q1CA 1S4MA 3D1LA 3HI6A 5HYVA 4IO0A 1I5OA 5LPNA 2F8SA 1TUBB 2PTHA 1ZZEA 5JMOA 1J56A 4DR4O 4WFGA 4TL9A 3NIDB 3PNOA 4ZT7A 3ZDCA 1DLBA 1XNRO 1BD4A 3GA0A 4JH0A 3OBIA 5CXSA 3AM5A 4O33A 5KMGB 4ZHQF 2ZBFA 2ZZKA 4V0LA 5TY0A 4D5EA 3HM2A 2A9KA 3MWJA 4HSGA 1K7SN 1T29A 3HFGA 3DVLA 1VZ3A 1NPYA 2FRDC 3FTDA 3HLYA 4J0IA 2Q7EA 3AYZB 3HI4A 4A36A 1DQPA 1UPUA 2IY7A 2IXTA 2XZTA 4KQFA 4C0QC 5TMDA 2A7XA 4YMLA 3AEYA 3E9RA 2OV1A 1IL0A 3FE2A 3SYAA 5JY6A 2B25A 1IG0A 3RFCA 2XI4A 5TGDA 3JYNA 2DPXA 4BE4A 1VJDA 1XCLA 4XWWA 4PLHA 4BRUA 1B23P 3E7XA 1AD2A 1QSGA 2GHYA 1E7MA 1G9XA 2W8ZA 3MEQA 1GZ4A 2IP4A 2VXBA 4GI2A 4MUYA 1L0NH 4MMXB 4O3MA 1XMSA 2VPPA 1TDJA 4BLSA 4TSKA 4JYYA 3AXSA 3O5AA 1P0QA 4NNOA 4UMVA 1QNMA 2EZ9A 5LMUO 1QVVA 1L7QA 4FW9A 1Y1TA 2I4RA 1F0NA 2J3LA 2IYAA 3F8SA 2GYUA 3FPAA 4PA7A 2FWAA 3JQBA 4TV8F 3OPXA 4WLUA 5FFNA 1ML4A 3CCBA 1MAHA 5CNIA 3WB0A 2FW8A 1EFPB 1XQ6A 2D8MA 4PBTA 3H5IA 4REQA 4DA0A 5BMOA 3E27A 3RVBA 4DBLE 4KLAA 4REQB 4TKZA 1K0FA 4RH1A 2P9EA 5EAIA 3WMWA 3MWEA 4Q7QA 2FQXA 2O6LA 4FD2A 2PZFA 2PRKA 5IS2A 3TXSA 2ZSFA 3OIVA 4P33A 3UCSC 3FYHA 2DCUA 1P3DA 3MJDA 3ENKA 1SCAA 4HH4A 3VC7A 1E1QD 1YIDA 2P4HX 3MUOA 3IIIA 3R20A 3C3JA 5A9SB 3H04A 2ZZNA 2DJVA 2BMDA 1L7XA 1R0BA 4IX9A 1X7YB 4TV8B 1BMFA 1SIWA 2VRCA 3PQ3A 2F1MA 4EA8A 2H2GA 2NU6A 1B2RA 3L4BC 3WK5A 5KQSA 5BN4B 1FB5A 2YJZA 1I01A 2PV7A 2I65A 2H3EA 2ONYA 4HDNA 2CLHB 4R1QA 3QA9A 4K8OA 4DWWA 2HJ9A 4KKXB 4BRWA 3HYNA 2ZJ2A 3NV7A 3CW8X 2CH7B 1WP9A 1Q12A 4OH7A 4R1SA 3O3MB 4N41A 4H0FA 3HA7A 1WMBA 2Y9MB 2J7PA 4IOKA 1P33A 4ND1A 2YQZA 3NBUA 1AOXA 4FNOA 4OV6B 3HB7A 2FMFA 4QOIA 3VR2A 3HADA 2P6OA 2QN3A 2H9AA 4QUBA 3DSQA 2DXIA 2BELA 3B2QA 4O0LA 5GV7A 4FZ1A 2HJVA 2BFDB 1N32O 4DCOA 1VG1A 1ROPA 3A6KA 3IAXA 4TN1A 4YRSA 2C03A 2FK8A 4Y6GB 1RWWA 5C4GB 4ZMBA 3L0DA 2P2SA 4IIBA 1EN5A 3LQRA 1XE3A 4HAIA 3RARA 4GH5A 3HSKA 3VU8A 3ZGLA 4C7KA 3DC5A 1LSOA 4CBCA 3LBYA 3DMFA 2JH3A 3BXGA 4MYTA 1Q6IA 3I04M 1A8QA 2OUIA 3E3NA 3D7LA 3NCHA 4MEBA 5EE0A 1PKXA 4IPTA 3LECA 3WSWA 5F2EA 1SXHA 1VXOA 1JCHA 1Z16A 3KG2A 3AUUA 1CUDA 2C07A 1MC4A 1QYXA 5AK5A 5K0FA 5KOHB 3RR2A 2QWQB 1Q7YW 5IJ9A 3DLTA 1OWNA 3KETA 1VMAA 5KB3A 3OKFA 4HNRA 4URZR 1VYTA 1EB9A 3TRDA 1NSYA 3NTRA 3FAVB 2CL6X 4F2HA 1NXPA 1BROA 3SOZA 1XLTA 2Q45A 2QTFA 1IN8A 3RJZA 1DNPA 3ZY6A 4Q1BA 4P7BA 5EYPA 1ZM2A 3L82B 3BCCH 1QGDA 1EXVA 3LT1A 3ZKWA 5CK5A 1O58A 1O6CA 3ZU5A 4XPIB 2JS3A 3EZXA 2VEOA 1EGHA 4BAYA 1C41A 1KJYA 2OBFA 1T4MA 3WYEA 3J80A 3VUFA 2B21A 1FXKA 3DMRA 4R3NA 1NUSA 1UQUA 4LF5O 4HDRB 5CIQA 4E2WA 1GXSB 3TIGA 3PIRA 1US6A 3M49A 1MKYA 2VT3A 2XWJI 3I6IA 4ZKIA 1E6KA 5E9WA 4BYGA 1ECFA 2P4KA 1YDGA 3A9SA 4PD4F 4X65O 1OC4A 4WNCA 1N0JA 3X1MA 1JLLB 2W37A 1YB6A 1XZCA 2EIHA 5CB4A 1OBFO 2R5WA 2HBRA 4MUHA 3N39C 1WHTB 1XU4A 2X58A 1TM4E 4CYMA 3ORHA 1USWA 3A11A 3CJTA 1XRMA 5LWQA 4JX9A 3LFUA 2XD9A 3O21A 3A8TA 3DZ8A 1TAQA 4KDRA 2RHTA 2A78A 4JV5O 2JD2A 3HS3A 4Q9AA 1P17A 4YALA 5E1BA 4UAVA 2E5WA 4P36A 3UC9A 3K5LA 2A0FA 2DUJA 3EHBB 4JJZA 3G6KA 4QICA 4F5WA 3M6IA 4V0ME 1UFOA 2CVHA 3LKVA 3SY8A 4OYHA 3S8YA 1ODJA 4N0DA 4OI4A 1BCSA 2WSLA 3VX4A 4XM1A 4EI8A 1D5WA 4GUAA 3MMXA 2BFCB 1JTEA 3L0SA 4LF6B 1GGKA 2GVDC 3C3CA 2ZYRA 3K0EA 1ZN2A 3PI6A 4RV5A 2GDSA 4CIVA 3IRUA 2XV1A 4UFPA 4XYLA 2GJ8A 2LBPA 3WK6A 3ABLC 4DCMA 2FDCA 2FG6C 3BPSA 4YUZA 2A3NA 1EVZA 1Y7TA 1YRYE 1ZLXA 1J8YF 2ECFA 2IZ1A 2NYUA 2YOHA 4MGHA 2FN3A 4F3NA 4C2AA 5A06A 3R5JA 2FFAA 5FPYA 2L35A 5E1MA 2VQEB 1GAQA 3QLVC 1EX7A 4BVGA 3F4LA 3ASOC 3R7SA 3U7FB 2GAAA 1ZW1A 2QRPA 4PSKA 3DZHA 1KBHA 1YQ9A 3U4MA 3TQSA 1HURA 1S2LA 1Y6XA 1SC5B 1XJ5A 2V4UA 1Z0DA 3HDYA 3DBLB 5D3MB 4YXWG 3Q8KA 1Y7PA 3AI1A 2Q9LA 2DLNA 2PS1A 2G06A 4DLWA 3L77A 3BJZA 2RGCA 3PJGA 2XUPA 3S6JA 2J8ZA 3CZ5A 1M6WA 1GCIA 5I9SA 3OX1A 4HGYA 2A9QA 1KPHA 5AHXA 2B8JA 1CUHA 1HYQA 2H63A 4X62B 2HTEA 3BX1A 4JA0A 4B3CA 1U3GA 1HBJA 1VF7A 2JLCA 1M5IA 1E62A 1V3UA 1ZBQA 1Q3KA 4RM3A 4DCCA 4FB5A 2QVGA 4JASB 5HZMA 3JD4A 4AKGA 4IGIA 4V2IA 1JEAA 1PJTA 4C05A 3HBAA 5DHPA 4PNPA 5K3AA 1I24A 1ZINA 2ZSJA 3RH0A 3WL5A 3I4FA 1GOTA 1YBMA 5AM1A 4FPPA 1CS0A 2ZQYA 4LRUA 1NV8A 4BKUA 1MF7A 3O4JA 5EJGA 4EECA 3BS4A 3H19A 4DJTA 2QTOA 2HJHA 5I7EA 1QLHA 3PPWA 3VSDA 3WLPA 5BSEA 3PJDA 1CDEA 3MB8A 4DLNA 1LC0A 4M0EA 2BR5A 4AQYO 2DWDC 2P06A 3L8ZA 3U11A 1L5GB 4EABA 1C3EA 1OREA 2PF4E 1FMTA 3H1GA 3SM3A 5KNDD 3FLAA 1W29A 3NM6B 5FBKA 2YHIA 4PQYA 4CMHA 2I34A 3BAZA 1I7DA 1IATA 1J8VA 1KMIY 2VBCA 2H2DA 4X84A 5AFSA 1ZESA 1O0BA 4L5IA 3P2EA 3W3AH 3A4VA 5CCXA 2J59A 2QVBA 3DXFA 3PC4A 5JHGB 3EE6A 3FVQA 4EKNB 2J85A 1UPAA 3CR3C 4BQFA 2OXTA 5ES3A 2B7CA 3REQA 1YACA 1T43A 5E7IA 1U2ZA 1HRDA 1QXSA 1HETA 4OJQA 1IM2A 1R0CA 5C7OO 4DA6A 1WBBA 3V8QA 5L6LB 2O19A 2IJIA 1IJKA 3O94A 1M8KA 1RHUA 4IXMA 4YDSA 4TSFD 1Q5OA 2RHBA 1MPTA 4FBGA 3GPIA 3UAVA 5GINE 2MSNA 1VPDA 3RHZA 4QU8A 4FWIB 2CFRA 1L5RA 4PZYA 1T2NA 1BVHA 1WCV1 2NSYA 5F64A 2W6PA 3KEFA 4AZTA 2XUIA 4PZCA 4TYPA 3H7IA 1LSJA 2EX4A 2IEZA 2XXJA 5IVKA 5IDJA 1MQ9A 3KSMA 3GLHB 3VHXA 4H6WA 1T4CA 2AOUA 2C29D 4JLAA 2JI9A 2ZIZA 4JQYA 4M36A 4RHEA 4UNSA 1E9CA 5AM5A 4MDEA 4CEJA 3F7VC 3OFND 2C92A 3E05A 3IESA 3CUUA 2BGUA 2ZRBA 3WB1A 3N8KA 4C20A 5JDCA 4KVFA 1F7YA 2L42A 4DMLA 3A06A 4G2TA 3EFOA 3P3NA 3IMFA 3IT2A 4J0DA 3JARA 4JL6A 2D5BA 1TQ2A 3I6QA 5DGXA 1LVGA 1JDTA 3BK1A 3GFRA 3P94A 1U5BA 4TLEA 3O4VA 2Z6VA 4EG5A 1V5GA 5F9HA 3EXAA 3L04A 4RXTA 3V8BA 1O0CA 1IN4A 3OQBA 2Q6IA 4MW9A 1XAGA 4LWQA 1ZMBA 2P4EA 2W2MA 2IZ0A 1K4DC 3P2IA 2BL4A 1HDYA 1XMPA 3UK6A 2XGOA 4OKNA 4XCXA 1NLUA 1OLOA 3GMSA 1O5IA 2B4KA 2REXB 4PY2A 4A8HA 1AMUA 1VL6A 1UDCA 3CLSC 2JFZA 2JHPA 2JI7A 4HAXA 1YE3A 2C99A 4QXQA 2FMKA 4YT4A 3RUPA 5HGJA 1OZFA 3DEYX 3BRWD 2IUEA 1CDOA 3HQ4O 4UUAA 5AOBA 5GPBA 4XVQA 2DSNA 4I50F 4WADA 6YASA 3HHEA 3RVNA 2P8SA 4WCDA 4NF2A 1FNMA 2UZIR 2V7WA 4X65B 3ABQB 3X44A 2YWEA 5KJCA 4GQIA 4R1UA 5CNKA 1YL5A 1U9IC 4KNWA 4YTEA 4OMCA 1EFRA 4NXNB 4L76A 3HG7A 1F3OA 2IHVA 1Q1NA 4DLBA 1J0DA 3EXHC 2B99A 5IYBO 5ESRA 4BLRA 7MHTA 2WIKA 3A28A 1YMUA 1DF4A 2RGNA 4O4HF 2AG8A 2ZRKA 3R0IA 3G85A 3PA8A 5CMLA 3ZD9A 5JSQA 4KFCA 2X9QA 1C0LA 4YUXA 3K08A 2HO5A 3FAVA 4KXNA 2PZJA 2ZKLA 1WTCA 3K71B 1VG8A 4JUCA 1KI8A 1ZKDA 1Z47A 3B7PA 2EGHA 2HPVA 1QH8A 3CGWA 1ZWLA 2D1QA 4JHLA 4M8LA 3WK8A 4G81A 4HUQA 1T8TA 3LCJA 4EFDA 4BV3A 5IJZA 3RUIA 5A4MS 2H9YA 2PUVA 3BG5A 1YV9A 4Q93A 2BHNA 1PT6A 3R8CA 3V1YA 5K4AA 1OB2A 1UK6A 1X2BA 1C3OA 3O9ZA 4EEZA 1NATA 2IX3A 4LOHA 3H2KA 3IBCA 2JJQA 3ZE7A 3BILA 4HYQA 1DEAA 4OQQA 2PWBA 2C2MA 1XHXA 3UT5B 3NANA 3AHGA 4LZLA 4ALNA 4BFVA 3SHTA 2PO7A 4L9WA 4KQKA 3BRSA 1GUYA 4EFMA 2O2SA 3TN7A 4YQFA 4ZZ3A 1I7LA 4YNBA 3GWOA 3SZRA 4RF3A 3JYOA 4PVCA 1XTQA 2PV0A 3DPSA 3CUKA 3IAHA 2C54A 4FZVA 1ZR4A 5DN9A 5A71A 5MN4A 3SF0A 2QE6A 1AQJA 3RVKA 2F66C 4MGIR 4RQTA 3B1WA 2P41A 1XHZA 3K0KA 3W6UA 4MVJE 2ON6A 3AERA 4DA4A 2OO3A 1CERA 1IBLO 3EOAI 1M0SA 3NO4A 3B1ZA 4Q6BA 4TRRA 1A7AA 3M6XA 5JJIA 2RONA 4J0GA 4QARA 2ZWPA 3B8MA 5I9MA 3EVDA 2Q99A 2XOKG 1BEEA 1JQJC 1YJXA 4ALJA 2FW6A 2GN0A 4D6XA 1N32B 3DZGA 2ZVDA 3V7NA 2FQQA 3A32A 4BCCA 5IBRA 4CDNA 5LUAA 3N7AA 1EEXB 4XASA 4NSNA 3G5TA 2CL0X 4WKGA 2JCSA 3KJXA 4AO8A 4TZ6A 1SHTX 3H5RA 4LGVA 2PZ8A 3HVIA 4MUNA 3MA0A 4WECA 1PWXA 4YRJA 2H8GA 3GUUA 4KMRA 1E0KA 2YBDA 4UULA 2XASA 5AJTA 5G3YA 4AWBA 5FEUA 1E3MA 3L8GA 1FDUA 2ZR7A 4L6AA 3CCRV 3SZLA 3WLOA 4RF4A 1VE1A 1RPAA 4FOLA 4KGZA 2VZ0A 3TQHA 3F1KA 1INLA 3RC9A 4RZHA 1MHTA 1H1TA 1ZPDA 2C2YA 3FYSA 4LOKA 1P8AA 5EE9A 3IAFA 4JKYA 1AO0A 4D74A 1OUMA 4EPTA 3PUHA 1P4GA 4ROSA 4O2AA 5LC1A 3RRYA 5JD6A 1EP9A 1YJ9V 1JSLA 4D46A 1DBWA 1RJWA 1UMKA 2JAXA 2OBBA 3QVWA 3CH6A 4GGOA 5AXDA 4JBIA 2M6LA 4HNHA 4NBRA 5TPZD 5FI3A 2Q2QA 5BSWA 1Q21A 1T5BA 3EEYA 3UAXA 4RKRA 3UJCA 4EHLA 5HZKA 3CXUA 5LQDA 1WB5A 4A10A 2EFEB 1S3IA 2A33A 2VJPA 2PA0A 1EK2A 2B4AA 2OGUA 3DE4X 3ML1A 3OIDA 2OOKA 3OLXA 4K9RA 5JG7A 3WK7A 2R8XA 4A1OA 2KBEA 4CQJA 3CLUD 1U3UA 4S1WA 2IT1A 2RKBA 2V7XA 3AX6A 3HPRA 4OJTA 1SQQH 1T15A 1GRVA 4MA4A 2AOXA 2QTLA 1K75A 5E6SB 1KDZA 2E5LO 1FVXA 3ZE2B 3R9XA 1K9VF 4NTXA 1FMCA 1M7HA 1ZNQO 4MW5A 3ROTA 1TUIA 3NXSA 5KHHA 1NZ6A 2BJVA 2D8AA 2DHEA 3L8CA 3NASA 1JSCA 4DSAA 5KYVA 1IOVA 3SZGA 2BSAA 5I4IA 2BGLA 3KRTA 1JZTA 3UMRA 2O8FB 1MAUA 3ER6A 5EJMA 3SEQA 2UXNA 1JU9A 2UYHA 4PYJA 4URVR 3SR2C 2YJNA 3R6DA 4NG4A 1LPBB 2H2AA 1ESNA 3DULA 1T3HA 5C18A 4GI3A 4NQZA 3M1IA 5KQLA 3K70B 1VPVA 3QKUA 4G3XA 4BECA 1Z8NA 1NWCA 4CG0A 1QLEB 3PDWA 1VJ1A 4W5JA 4BN5A 4WJLA 3JZDA 1EPUA 2XMQA 3DGEA 2XUFA 3GQVA 1P4AA 4FGKA 4FHZA 3Q3JB 4KQHA 2W6IG 1UP7A 4RF2A 2ZQZA 1UODA 3AY6A 5GONA 3MYRA 1Z6GA 4BNIA 2ATKC 2HU2A 4ZIRB 5KS2A 3WG9A 1YZKA 2O5CA 1KK3A 4DR6O 3JSLA 3OCVA 1TW3A 2G9ZA 2GSWA 4ZQFA 2QNRA 4LJ4A 4FYPA 1W75A 2HSZA 3VX3A 3PQEA 4JQSA 4KN8A 1G4UR 2OXEA 1GN8A 2CJWA 2GZSA 2HDHA 3BIFA 4YP6A 5EE3A 3WNDA 1PQUA 3K30A 1VJTA 1RS0A 5FF9A 4QX6A 3D31A 4XDHA 2G1PA 2MW2B 4U2KA 1S5PA 3CCCA 5EJIA 4MQMA 3EG9A 1UT8A 2BKLA 1GPUA 3W05A 3AVXA 4HBZA 1WRBA 1AA6A 1E1YA 1CUVA 3H2ZA 1B43A 4ZD6A 4EY3A 2QLBA 2WG2A 3GFOA 2V0GA 2W8BA 1Y9ZA 4F4LA 5LP6C 1VBFA 1EFVB 5E2AA 4K9OA 4YY3B 1S3GA 3RYFA 3DTYA 2RHWA 4QUJA 1WUKS 4TMVA 2CTPA 3RV4A 1PR3A 1ZK3A 3E7FA 4M9CA 4QE3A 1JVBA 2VPXA 4G89A 4K9QA 4C7VA 3MJEA 1A9RA 2E89A 2X8JA 1U98A 4IH9A 4P58A 1OMOA 2CBGA 1CW2B 2P30A 1RBZA 5E6RA 5THXA 4W1RA 4NFYA 3VKWA 3NFYA 5AM4A 5FQOA 3THXA 3W90A 1E8DA 3LQQA 4RJIA 3QLVA 3K5MA 1U7DA 3VQWA 1OCCC 5DMHA 1PN3A 1TC1A 1XDDA 1HZJA 4HH1A 4OSOA 4PW0A 4E1VA 1NBWB 3P9KA 5BT8A 2P4UA 3D54D 3QEJA 4L5JA 4OMDA 3UPTA 3H1EA 4UM8B 5DHUA 1G2QA 1I3OA 2G0TA 1A88A 3A05A 3TE7A 5KQMA 2GN2A 3O8RA 4JI4B 1LJ8A 2GZHA 3SXUA 2QTMA 4LC1A 5SYMA 2P2ZA 4X7BA 1WA8A 1AZSC 3QFHA 5CT4A 4F93B 5K8LA 1TAEA 2UXCO 1K8ZB 2LVBA 4TXMA 3PC8C 1S3JA 4Z1OA 3UJNA 2WSMA 2YJTD 4LVCA 3ASVA 4R16A 3GP8A 2EJBA 2IDMA 2NU7B 2WZBA 4J3NA 3LY5A 3NBXX 1UKVY 2W2LD 2ZBRA 3A1UA 3FM9A 4ITRC 1V4BA 3DXXA 1FK8A 4J7UA 4S12A 5EHIA 2GB4A 1BCRB 3A6DA 3QNMA 4WASA 3G80A 5DYNA 2DE0X 3OTFA 4EDHA 4INPA 1YVPA 1U96A 1I08A 3LTEA 3K3WA 3TJZA 3FOFC 4MT8A 2H0AA 1N0WA 5FBZA 3V48A 4F56A 1QBGA 3OA2A 4ER5A 5E1DA 5IKMA 2N9UA 4I4TA 3GJRA 4YDQA 5JMPA 5HM8A 3EG9B 4WKOA 4UCQA 1NNI1 1R3IC 1FMJA 1GPLA 1S02A 1N2ZA 2ZVQX 3KZ1E 5E6RB 5JC8A 1GKUB 2VCYA 3JQ9C 1GXSA 1XZKA 4IX1A 2RGGA 4K2AA 1C9NA 3TIIA 3RT3C 1JSRA 3VO9A 1GQQA 4TYMA 4Q39A 3ELDA 2ZJ7A 5JNLA 1LI4A 2H7CA 2Y71A 4H4CA 1YR2A 3RFRA 2NVUA 1GN2A 2NU9A 1BGYH 4C08A 2VT2A 3TIVA 3TOXA 3TZBA 1X7DA 1TF7A 3PFBA 1UBTS 2HNKA 3PDHA 2J3JA 3IIMA 2Q6LA 4JP1A 2VNKA 5LYJF 3U4QA 2JEOA 2V6JA 1QVAA 1UT6A 1CD5A 1ODLA 2WSBA 1AKQA 3WRWA 5JNWA 4XQEA 3L1KA 4MUBA 2HR3A 2JZCA 4IDHA 2W0FC 1U2RA 4QDTA 4PX5A 2CXPA 2YS8A 1IEQA 4RORA 2OQRA 3I42A 1GRCA 1ZWIC 4YJFA 5HK9A 5JXJA 5KNCD 1XVTA 3ZDQA 5B1EA 1X80B 2IYXA 1TQ4A 3AUJB 1C0EA 1EP1B 3E3LA 1MZEA 3B36A 1IN7A 4WOJA 5LHHA 4AROA 4AX4A 1YFJA 2ATIA 2R4TA 3GROA 2BZ1A 4RETA 5AVRA 3SJQC 4LFAO 4CMJA 1D7AA 1B76A 3GFBA 3W2EA 2IBTA 2QR4A 2BUAA 5J59A 1UPFA 1F9AA 1LGYA 1POWA 4AG5A 3H1BA 4QRHA 5FUBA 2J0VA 4X1OA 3ISVA 3UGKA 3NNNA 3ZXUB 1NNSA 5CUQA 3OJXA 1W0JG 3G8AA 4OXIA 3T5CA 1U8EA 5A5EA 4CIBA 4O2AF 1APBA 5JU6A 3TDNA 4D8XA 1Q74A 3NRCA 3I6ZA 3Q9LA 4HDNB 1ZGGA 1HNZB 4MW0A 1QP4A 2VP3A 5EOVA 3NKVA 5COQA 3E8MA 4J0EA 3PENA 3EASA 2WSSG 3U4IA 3UXHA 4QLAA 3LPAA 2QP4A 4PRKA 1DDOA 2A9OA 4BU1A 3SJAC 1SD1A 2PEZA 3QIVA 2ZIVB 1W0KD 4YPVA 5C46F 1IWPB 4J9UE 3OEHG 1OV4A 3WAKA 2A06H 2A2ZA 4R54A 3WFJA 5IU6A 4GI1A 3VMFA 1M1KW 3KQVA 1A2QA 1E0JA 1SG9A 5EXTA 4TQDA 1KKDA 1KAGA 2EWVA 3OSUA 1J9GA 1KEEB 3P0RA 2NPOA 4BWVA 5BQPA 1Y8CA 1QYDA 2HSEA 4GEGA 1XEWX 3AF4A 1G1AA 4FLTA 3FWYA 5AUQA 1PT7A 4IJKA 4JSRA 1DE0A 4Y0VA 4R31A 2A86A 4DQUA 2J41A 4RVCA 4YRZA 4W5OA 5KHOC 3UKMA 1P5HA 3A6GA 3HRHA 1JQLB 4FHGA 4FI3C 4P9NA 3MQFA 4LGYA 5ALPA 1OTYA 3GLHE 1KYVA 4U2DA 2J9XB 5G4KB 2W6JD 3SJBC 5DRYA 2ZTSA 1JDVA 3BQNB 4JLNA 4JZGA 1CUGA 4EGQA 2AJ8A 5BSMA 3FUUA 1XAJA 2K7ZA 2YYYA 4NOMA 5FI0B 5IKXA 1PFVA 2GMWA 4CJXA 4ISCA 4Z53A 3GUVA 4PNHA 1G4HA 1U2PA 2V9CA 5LZ4A 1E1RA 3A0RA 4NS4A 3KFLA 4JK3A 5ARCA 4MA5A 3KKNA 1ZC4A 3FOEC 2AQKA 1P6QA 2FN4A 2ZE5A 4I5FA 3ZTWA 2JLVA 4Q7JB 3ZWXA 2HTFA 1O94D 2O3SA 5A6SA 5JI2E 1PFYA 1FPQA 5KYKA 3DXRB 2ASVA 1A1SA 3W2FA 2QD1A 5E2IA 1EUDA 2PX3A 1R4AA 1IIRA 2XUAA 2YWXA 5BN5B 2W70A 4X8LA 3WMGA 3KZIZ 3BTVA 3MIZA 3SM9A 3W5SA 2XHZA 1NOJA 3K0FB 4IIGA 5HF8A 3ZWQA 5JD5A 2GZ3A 2HDWA 4WCFB 5TQ2A 2CEAA 1KJZA 2G71A 4K35A 1M6VA 1OWOA 1QHGA 5F2VO 1WY5A 4D3ZA 1NJ1A 3CISA 1O96B 2JAHA 2VCEA 1TB4A 1VPEA 2A9HA 2CGOA 2C9ZA 3CZAA 4R69A 3L2OB 2H85A 1GFIA 2WT8A 2QTGA 3T3DA 2WKRA 4B09A 1JDSA 5FH9A 2IIVA 3ZRWB 4M9RA 4R2JA 1AQIA 2H08A 2C0PA 1JVMA 2JLRA 4UD6A 2WYWA 4BATA 3FYCA 3KZCA 5KC9A 2BKAA 5JW6A 4O08A 5EKTA 5A1JA 1D4FA 1C1XA 2JFPA 4B4KA 2RAUA 4ND2A 1DQSA 2AN4A 1ML3A 1GRJA 2LDXA 2NM0A 1U7XA 1I2DA 1NBAA 3LHSA 3RTCA 3DCYA 3ZVNA 4RLFA 3UV3A 4B3RO 4A8PA 2Z3YA 1YVWA 2WYOA 4MQFA 2WD7B 3Q0TA 4X8OA 5HKLA 5C5EA 3EXG2 3KWMA 5KYYB 1T5IA 1ZGJA 5BT9A 1G41A 4IRMA 5C3UA 4TTAA 1EXMA 4A5UB 4UXHA 2R8PA 2ZBEA 5J4LA 1NNLA 2PLNA 2ZREA 2ODMA 2NXNA 4L9AA 2QNBA 4ZDIA 1O95C 1JQEA 2JAWA 3BGVA 4LI3X 1C0KA 4G1MB 1N6OA 4P81A 5AI5A 2IL1A 1PDVA 4J3FA 2M32A 5F77A 4XPZA 3VDMA 1QVFU 1AJEA 3OZWA 1B93A 4KR0A 3U5ZB 1LDEA 3DO6A 3WNCA 1RYBA 1E8MA 3K5PA 4PG7A 4B5KA 4Q9KA 3OY7A 1HY3A 1EHCA 1UJBA 4DSUA 4F2WA 4HZUA 4I1SA 2HXYA 1N8TA 1DBPA 1LI5A 4I1RA 2ZYDA 4BNXA 2XMZA 5DP1A 3MHTA 2BMFA 3KKKA 4BIOA 2ZWIA 3CEJA 1YS2X 4J2OA 3UWMA 4TT3D 5MF6A 3K5NA 4UM9D 4NARA 4DV2O 4CIXA 4NFSA 3ZE8A 2A79B 3MBOA 3QXGA 4MGYR 3W5HA 4MO2A 1WV0A 3QXXA 3QLUC 1HTBA 4YRQA 5EJAA 2VAWA 1FNNA 1HTWA 3IULA 5DTMA 5F98A 1SWWA 2D1TA 4JT4A 1N6RA 2PX4A 4UPDA 5J5AA 3ZS9A 5KTKA 4UHDA 2W98A 4MPDA 4RPLA 2RKWA 1L7DA 2FR1A 2XB2A 4PZEA 2D00A 4KI7A 1YZFA 2R5NA 3C85A 4MQFB 3I83A 3P2YA 3R74A 2AOUB 2R8RA 3H18A 2I62A 3N0VA 5JYCA 1KZ9A 3I53A 1JHRA 1KJWA 3OY2A 3R3JA 3UMVA 4DCGA 3G0IA 3FTQA 3V1KA 1BU5A 2FSPA 1NR7A 3EA5A 5TNXA 1FS5A 3SYCA 3CQ9A 1ANKA 4MYCA 4ZI3A 1OIVA 1JLSA 1DAHA 4C3VA 2QG4A 5KC8A 2JJ2G 2H3OA 4LX0A 4DSTA 1PR6A 3T3NA 3JQPA 1BKSB 2QJTA 1YS6A 3IQIX 4D41A 3AB3A 1PGNA 4N6OA 4C07A 5KOIA 1B6QA 4C6HA 1M83A 1Z5NA 2QN1A 3KELA 1FYWA 3AG4C 1YZHA 1ZS9A 2IKSA 2VH5R 4N65A 1UJ6A 5T4BA 3WBFA 1N1GA 2HA2A 4C0BA 3PLAE 2IYRA 5LA6B 5CBPB 1HNZO 4QRIA 3W2GA 2D6FA 2N74A 3Q88A 3PEVA 1PG2A 3REQB 1C9EA 1Y3CE 3EIFA 5J40A 5JCZA 2AHZA 2JANA 2XA1A 1E6MA 1N8SA 2AMJA 3GHHA 5LKRA 2HM7A 2JGKA 1BOOA 3NTQA 4Q9HA 4PG4A 2BDEA 3GD5A 3UW1A 2EL9A 3K3PA 4X6YA 3Q8MA 4AKHA 2XGGA 3H11A 3O8CA 1QP8A 1O03A 3CWZA 1FQOA 1U1EA 1J5EB 1XEFA 3VU0A 1E1RG 4QGGA 4XSHA 4YAIA 5B30A 1IHUA 1N7IA 5IF3A 1K5GA 1JAZA 3HL4A 1XZIA 5ALGA 4DUPA 1V6SA 2WC1A 4TQFA 3TZKA 4RA6B 1X1EA 3TF5A 1VDMA 3EC2A 3NR2A 1TVKB 1MJGA 3ONNA 1U1GA 3MWFA 2AZMA 1WPBA 5CM2Z 3TE6A 2EBFX 4MRNA 2G3YA 5AVJA 1B1CA 4YECA 5EVCA 4A8JA 4DFDA 1Q1QA 1RYDA 2FCAA 2P7TC 3P19A 4RESA 2QB5A 1ESDA 4NFHA 2OZLB 3QTBA 4UQOA 3T6KA 1T5SA 3OIFA 4CF3A 5I7RA 5JI3E 1E9RA 3JWIA 2CB0A 1ZSNA 2L0XA 5IRCD 4GUNA 2CJYA 5KOJA 1V3TA 1YVRA 2HN9A 3DKKA 3ONVA 1MNAA 2X7RB 1OAKA 2QS9A 1FNCA 4JVNA 5EP3A 1ZVVA 1F7UA 1XGKA 4TVBA 1RLIA 1K8YB 1ZRMA 1N33O 4X6XA 1KBZA 2CLCX 4HP8A 4YUYA 5F4BA 3C8MA 5E38A 3STZC 3V1LA 3KJHA 2KB1A 4PNEA 4XRGA 1EDBA 3JAMA 1PYOA 5CMUA 2E76B 3JYHA 1YOVA 3LVRE 4ZO8A 3PNSA 4BMDA 4AZ3A 1O77A 3T99A 3B85A 4FIPC 4QDKA 1JR3D 4C29A 2IXGA 1SKBA 4BL5A 1WB7A 3V4FA 2JC3A 2PD6A 3VBEA 2JRCA 3KK0A 3O4HA 4QFCA 3ZWAA 2Q3JA 4KUEA 1XNGA 5HR5A 1MBZA 3NS7A 4ETWA 4I46A 3RYHB 3I0MA 5D3ZA 4BMYA 5JUWA 1FUIA 2ZR3A 4RU1A 1IBKB 1V8FA 2Q6AA 3KL4A 1SU6A 3MTDA 1FXWA 4GOXA 5AKYA 4MHTA 5L40A 3O4GA 2AX4A 3LVQE 3BAAA 3G02A 1L5OA 1S2MA 1M34A 3ESRA 3H2GA 3ME5A 3OF3A 5KWSA 4DREA 1JSXA 4I4NA 1SZDA 4HLUC 3R8XA 4RQAA 1V2HE 4W7HA 1GEGA 2J1LA 1E1QA 1SVOA 5K4HA 5FUWA 2DX7A 2WINI 4HYYA 3HJAA 4C0AC 1TK3A 3C39A 1FPOA 1HZZC 2C00A 1JVSA 2W48A 3L5OA 2C31A 1Y89A 3AHEA 3L7BA 1I33A 3CEMA 1KEZA 1R4ZA 5HKOA 1AGYA 2XVXA 1HKUA 1EE1A 3Q9NA 1HK7A 1WD7A 2JZNA 4TZTA 2FWRA 1EAYA 3OAAG 4WQMA 1WDMA 4MVJG 3D8UA 4EFNA 3SK0A 2ES4A 3IUMA 4GLOA 2CXXA 4HVAA 4TV9F 4D02A 3TMYA 2AWNA 5TT1A 1GUFA 2EATA 2VSXA 2WWRA 4OB7A 3D4NA 3D1JA 1ZOOA 4U6NA 1U2GA 1QQ7A 3SE7A 4EGAA 5I7VA 2X9LA 4XJTA 1BHO1 1GPH1 2GESA 4C87A 4D4KA 3CXCU 2AKAB 2BFOA 2AFRA 4ER0A 4RLHA 1RAHA 5FXMA 1D3AA 4O2LA 1QKIA 1ZLZA 1M0WA 2HPAA 3P2KA 2YXNA 3UJHA 4FDVA 5DASA 3ASNB 3RO7A 1EFAA 5FV4A 1V45E 3ANMA 1X74A 1YU6A 2X6CA 4G41A 4MV5A 4OLAA 4HZUB 4BEJA 4Z7QB 3DVSX 1GTMA 4EF5A 3GDGA 2OHVA 3MTJA 1T9DA 3T9EA 3S8MA 1J8DA 2G88A 3C5VA 1JEOA 1PJ2A 3CMMA 4C7MA 4CCWA 2DHCA 2F8TA 2FUNB 3O83A 4WNAB 4Z3KA 1XU7A 3HNPA 2PGGA 4RFLA 4BWYA 4BEWA 3MUFA 4DK0A 3TR6A 4KO4S 1R9GA 2C3UA 3FD8A 3LS2A 3B89A 3S29A