5D5QA

Hcgb from methanocaldococcus jannaschii with the pyridinol derived from fegp cofactor of [fe]-hydrogenase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
VMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards artificial methanogenesis: biosynthesis of the [Fe]-hydrogenase cofactor and characterization of the semi-synthetic hydrogenase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Uncharacterized protein MJ0488, Guanylyltransferase
total genus 51
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5d5qA01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 5d5qA02
1DIOB 5D5QA 1EGVB 1T5EA 4DK1A 2D0OB 1EEXB 3AUJB 3WB2A 5D5PA 2F1MA 1NBWB 5JJJB 3LNNA 3BRCA 5JJNB 4DK0A 1EGMB 2F95B 1MMFB 1UC5B 2V4DA 1IWBB 5JJEB 4GYCB 1VF7A 3WB1A 1UC4B 1IWPB 1RSOA 1H2SB 2D0PB 3WB0A 2F93B 4L8JA
chains in the Genus database with same CATH superfamily
3G1UA 2Q6AA 1Z5VA 5H3LA 2BTQA 2SKDA 3G02A 5IC5A 1VJCA 3L74H 3T7EA 3TJRA 3L7LA 2AOUA 2IYNA 4QDUA 3B1JA 3PI6A 5JO9A 3ZDCA 1CETA 3LU1A 4DMFA 3R3ZA 1CDOA 3NHAA 3V2HA 5DNEA 4DV1B 1VQ8V 2CFOA 3FTPA 1TCUA 3KCXA 2BFPA 2N9UA 4P36A 4S1TA 4U63A 5E1BA 3SOPA 3DP7A 3ADOA 1E3EA 1MX9A 5TARA 3WOVA 2XDAA 2GBIA 3H65A 3KVRA 2QT1A 3IP8A 3IO5A 1CF4A 1FNSA 5FTNA 2ZP1A 1B04A 1JQ0A 1WA8A 3BA6A 3N2GA 4L8LA 3RC2A 5MN4A 1PI3A 1ZI9A 4P58A 4TMVA 1NW5A 3UH0A 1PR4A 2GERA 2AFHB 1G4YB 2DY0A 3KOZA 4K03A 2GVDC 1D09A 5AJUA 1RQXA 4RKFA 3G2OA 4IJMA 1JI0A 1Z0AA 1BHQ1 3FXAA 2D6FA 5KTPA 5KX5B 1R9NA 2OV6A 3ID6C 4KMRA 1VHTA 1X7XB 4Q37A 3DNMA 4GCZA 2EZPA 3ENNA 2FDXA 3FTDA 2WLIA 3C6ZA 1YCGA 1NMYA 2H65A 3HGQA 3HLTA 1LEHA 3LUDA 4R6WA 3U62A 4G5OA 4IQ4A 2Q5CA 3HUDA 3RV3A 1DWOA 5FI1B 2J0QA 2VDNB 4KQWA 2WU3A 4QA9A 3ZWNA 3BWMA 3CMAV 4LGYA 3ZCSA 5DW3A 3LQKA 4PANA 1ILWA 2VUIB 1A96A 1W0JD 3OPMA 3UXHA 4AY5A 2E5LB 1RBYA 4JELA 3LC1O 2HHHO 1FSFA 1E59A 2IHUA 3HVHA 3IBSA 3C8DA 5BO5A 4JWTA 4P2BA 3USCS 1ECGA 4R7ZA 4PBRA 4HZUA 4KLAA 2F1MA 1XI2A 1IBMO 3ZHUA 2FYTA 3EVBA 3GQVA 1ZJ6A 2ORVA 4WLUA 5DNCA 2GHYA 5HKOA 5KYXB 4CLOB 3ABKB 3EFBA 5EMLA 3ZIAA 2XODA 5LU9A 5CM9C 2R1ZA 5CGZA 4YY3B 1FFHA 1P7CA 1SVIA 1RBQA 3L41A 4WSOA 4ZEXA 3K0KA 5I45A 3HSKA 4FK5C 1U3UA 2GBLA 2R60A 4Q9IA 1XEFA 5F77A 5A7GA 2VXYA 4YI3A 4PIMA 3TQTA 3ZX4A 4CR8A 3UZUA 4QGHA 2JAUA 4AZ3B 3I1YA 1J7KA 1LDNA 5IBRA 5ARBA 5JVDB 1JQBA 3A0RA 3BE6A 1NT2A 1TQ8A 2A3NA 1CQIA 1I36A 1X1TA 1Y8QB 2HFKA 2HPVA 2NYVA 1BGVA 1VTKA 4KDRA 5ED0A 1BQ3A 5FUXA 1T6XA 3FG9A 4DJ5X 3L8EA 3OKPA 4PG7A 1ZU5A 1SC9A 5LHIA 2GZDA 2HWKA 5F3DA 4QJIA 3DB1A 3E8FA 1G4UR 3UGQA 4ARAA 1EJBA 2NV0A 3GFPA 4XQ9A 4IT5A 5GONB 1BYIA 1BU5A 2PQMA 3A1UA 3KVOA 4O4JA 1ZZEA 1T91A 2ET6A 1V7QA 5CB4B 1XEXB 3D2BA 3KLBA 2EL9A 4KFTA 4UUOA 1SXQA 1XCOA 2QLBA 3JYHA 5KKAA 4AY6A 3FE2A 4DV1O 1KAHA 4P93A 2GAIA 1IN6A 3IQHX 4O4LF 2D7DA 1POXA 1XD9A 3DHWC 2DECA 4MJ3A 3FMFA 3L4JA 2ZVDA 5J2TF 1G21B 2Q7XA 4Z2WA 1WZIA 1JJ2U 1E4OA 4KP4A 2Z5VA 1N1GA 4DLRA 2XQJA 2GD1O 3MRSA 1M1UA 4V3BA 4DWVA 2D5CA 4JJFA 4XTRA 3M5PA 4UXIA 1IJBA 1N5RA 1AJNA 1KMCA 3KZMA 3GJTA 1JDPA 3VQYA 3ICPA 2X8WA 5HE8A 5AYVA 5LQMA 3JPWA 5LMUO 2WAOA 1YZ3A 3LP6A 5GAJA 3DFIA 3WP0A 3FJYA 4LDPA 2GA9A 1QE3A 4MWTA 2RKBA 1N78A 2QTAA 3FHLA 3ZHRA 2PV0A 4BP3A 2W7TA 5K0EA 1BT8A 3KYBA 3OPXA 1GPDG 4TS4A 4AO7A 3K94A 3OPNA 2CXTA 2ZIZA 1GL3A 5JHHB 1OFUA 4I55B 4QE3A 5LKAA 2OC4A 3AFHA 1JU9A 4R8CA 2XE8A 3QLUA 1MUUA 1W46A 1L5FA 1GO3F 4U3JA 2WJ3A 2GNOA 2WJGA 4MLZA 1JAXA 1V8DA 5J9PC 3IUJA 4HXYA 3WADA 4D6YA 1RJ9B 5C8ZA 5CXXA 1ECPA 1P1HA 4XD7A 4RKYA 3QP9A 1QOZA 4L7VA 4MDHA 2J3HA 1RHRA 2WJIA 3IAS6 1VXRA 3SPJA 2AJDA 2I33A 3H5NA 5FWAA 4S2UA 1H9AA 4ZREA 4C0QC 3FOWA 4L2IA 3ONNA 3O8DA 5A4AA 3D6NB 2WE8A 1EFVB 3MS4A 3QKSB 1MSDA 1GV0A 2G8LA 2JARA 3KE8A 3ZIDA 5C5DA 4AF8A 2H9YA 2MT9A 5GJBA 2I6QA 4OBEA 4YWJA 3D6VA 4YI5A 1DWQA 2PKYX 3WGUA 1XL4A 4UHBA 3HJGA 4QVIA 2PA3A 2PIAA 3MTAA 1BA2A 3IHTA 4LCBA 4XM2A 5CXUA 5JD4A 3HCRA 4Q4LA 1SUEA 1XQXA 3L8HA 4G1MB 5KNCH 2HA0A 2H06A 2Q8PA 2WSBA 4B32A 4DKXA 1LQTA 4MVCA 5HDQA 3TD6A 2FPPB 1HRKA 4EB3A 4QUDA 4D81A 1QKIA 3UKOA 1UKEA 2DQ4A 5EC1C 2PZ8A 3WLNA 2Q27A 1HL3A 1GFSA 2E49A 3MERA 3DD1A 2CW5A 1SUPA 3G7SA 3O1IC 4FYWA 4FX5A 4NFYA 3W4KA 1NY6A 1MB0A 2QJFA 4OLHA 2PUFA 3B9RA 3KOMA 3D0QA 3BRCA 3J80N 1D04A 1TO6A 2EQBA 2ZSKA 3DHNA 3ZCCA 5DPMA 4DHEA 3B8EA 2C9DA 1M5RA 5GZ3A 1NR1A 2PVCA 2J31A 4FYYA 5EZ6B 5CYGA 4DUZO 4FI3F 2NYUA 2Y69C 1S8FA 4ADSG 2GZSA 4CM7A 3T1HB 5J59A 1UAAA 3MJEA 3HZRA 2D1RA 3IMKA 3OFNA 3D1LA 4K6FA 3PFWO 1XPUA 2VATA 3FLMA 3AONB 2H4XA 3GA7A 5LJLA 4DK1A 2B7BA 5T4HA 3TPZA 3PUJA 4C0LA 2IA5A 1DL5A 2FDRA 1TYEB 2W5UA 3M5WA 4HDNB 1GKFA 1VRVA 4DN6A 4UE6A 4IVRA 1A8UA 3NGLA 4Y9UA 4DARA 1JF8A 1QHEA 2GBGA 3G6KA 2IGTA 3GEIA 1UOEA 2CNKA 4QIWF 3ZMZA 4LCJA 5A3SA 2Q2OA 3EVCA 5HTKA 4JITA 2R9VA 4OH1A 2C03A 1W5BA 4N0EA 3PNBA 3CWBH 1DOHA 5ISMA 5EPOA 4F2PA 4I6GA 2KG7B 4DR7B 3I5YA 1YQQA 2VJKA 3WDKA 3IALA 3A3OA 4EECA 2UZAA 3DONA 3KETA 5L3BA 1QTRA 2PDAA 3OP4A 1F4MA 5KYYA 1SRQA 4CKZA 3FKSD 5CT4A 3APOA 1EZJA 3QWFA 2QMZA 2A5YB 3C1UA 4JL8A 4MTXA 4YGXB 3NT2A 1EWYA 2X2FA 3AFNA 2GM5A 4B8YA 2R7AA 3IB3A 1RXVA 4EF6A 1OXXK 1K2VN 2VUUA 1DEAA 4KAFA 1UZAA 1QCYA 3WWEA 4F9TA 2ICAA 2XZLA 1I3MA 3ZDEA 1RBZA 1D03A 2CXSA 2YV4A 5COBA 2H2FA 1ZHFA 2VRCA 4ESVA 2MINA 2IJHA 2A9KA 4TMWA 3WKDA 4U00A 1JVBA 4L72A 2O1EA 1J2JA 4LIPD 2HN9A 2IYQA 3DGEC 1YR2A 3HYLA 1ZOIA 4G5XA 4WK6A 3T41A 3FSEA 4OJTA 1RXUA 1RM5A 1T36A 4HKTA 4XIJA 4G09A 1E77A 5B6JA 2EULA 4FVMA 1TUGA 1RAHA 1ZIYA 1FP4B 1GY8A 3FNEA 4BNHA 4YJ3B 3LRTA 5CDTA 1YS7A 1FXUA 3DVQX 1VMIA 3I34X 3GP8A 3RFRA 3K0AB 5KHKA 2HYIC 1OXUA 4YAEA 3LSUA 1TC2A 4Y2QA 1KKDA 1Q15A 1QP8A 3SNKA 3TTYA 5FWXB 3ODPA 2Y76A 3LY7A 3HZZA 1FJHA 2Q6VA 3ZNQA 1FBTA 1G8KA 2ZWPA 1WPXA 1XJ5A 3NT4A 4PX2A 4QUJA 4CM6A 4YPOA 1EFRA 5L3CA 3IAM6 1Z7EA 5B53A 2XYVA 4XXHA 4EFDA 1E2KA 2G09A 1AQYA 4IHJA 3IVGA 4FU0A 4RW0A 4BJ6A 4HQFA 4FJCC 4KDFA 5AXAA 4EW6A 1KJNA 2AKYA 2PZBA 2Z3WA 1BRTA 4JKYA 4TLMB 3X1JA 4TYYA 2OFWA 1IBKB 2ILVA 2QMQA 3AM4A 1RHJA 2RHDA 3PR2B 2LKDA 3RHSA 2C2YA 2V4ZA 1QHHB 1P33A 5BV2P 5GJVC 3STYA 1X9IA 2WNHA 2XJ4A 1QHFA 4NENA 4B7UA 4MVJH 1S8NA 5A5GA 2HO5A 1AA6A 1DE0A 4K9OA 1VKHA 1VSUA 3AERB 2WKRA 2UXXA 1OIVA 2APJA 3U09A 2J5KA 1VI6A 2XRZA 4WDQA 5IHXA 3CVYA 4R7TA 121PA 4HFRA 4L15A 3H1IH 3ND6A 4ED9A 3H6HA 3EPLA 1J8VA 4RGVA 4DB2A 3WGKA 1NVDA 3DPUA 3HDGA 2VP6A 1JDTA 2HQ1A 3L2OB 1WXEA 3RWOA 3SKXA 4F6RA 4BO3A 3K6SA 3W8NA 3DAPA 4C4XA 1FYJA 5FTWA 3IQWA 1MZEA 2O57A 3F6EX 5AD1A 3WGYA 4J1QA 1DDIA 1VJDA 1KU9A 2XMCA 4Q1CA 1NV9A 4GNKA 3WGGA 2Z9DA 3P9PA 4Y7DA 3WO1A 4YR9A 4D98A 4D9KA 3KU1A 3MXOA 3DXYA 3KQWA 4UHKA 4E7OA 2EINB 1RFGE 1N2GA 2AEFA 3KS9A 4IO1A 4UHJA 4B80A 5A4KA 1E1CA 3S2GA 3I5AA 1BGWA 3CGGA 4DV7O 2POCA 3MB5A 1OXMA 2W93A 3FUCA 2FHSA 4IIHA 1M8PA 5D1NA 3O38A 3P9KA 2XZPA 3PEVA 1WXGA 4G0MA 2PTHA 3C87A 1Q82W 1LBTA 4JBWA 2FW0A 3P2YA 3FSGD 4E11A 2BEWA 1WZUA 4G1CA 5BWBA 1S1MA 1YR3A 1HQYE 2B5VA 3C48A 3HPRA 4RIFA 2EHJA 4YP9A 1H1LB 3K6JA 4KWHA 1JUDA 4JQZA 2JJQA 2UXDO 1BVRA 3FWZA 4TT3G 3PYMA 2WJPA 1MX1A 4MKZA 2Z6QA 4OEHA 3TBHA 3VKUA 3RW9A 1SXJD 3LD9A 4J1TC 3MMZA 4RETA 2IDKA 5KDDA 4W5TA 3J7AC 3KJQA 4V0LA 2XE6A 3KJEA 4LKRA 5D3ZA 1SRRA 2UYOA 3BHNA 5DM70 1G1MA 1Y7PA 2DSNA 4NL4H 3ABOB 1RBMA 3OQJA 5REQA 4CXMA 1OVMA 3HSYA 1M76A 5A9GA 2CBZA 2QEQA 1O8BA 3NB0A 1RJEA 2VNSA 4B3TO 2PQ0A 1AKVA 1G8AA 2JIPA 3D7MA 2QB5A 4FMDF 2CK3G 2G1JA 2D54A 2QR4A 1Y8RA 1Z07A 5DIFA 1DO0A 3DLAA 1MORA 1D8TA 2HYDA 2Y2UA 5ECYA 4I81A 3EGEA 3HP1A 4PN3A 3W2IA 4WAUA 3WE7A 5CDHA 1QUEA 1T4MA 3H2HA 3D36C 1NURA 1AKYA 1PWHA 2AFIA 2C98A 2DY1A 3HRHA 3NKVA 1IN5A 1DIAA 4HGOA 4N40A 4Y2RA 4DA0A 5CYPA 5BOSA 3PIIA 2GBOA 3HN7A 4HH3C 3AEQA 5IABA 4OPHA 4C7BA 1Q0PA 2J46A 3B40A 1UP6A 3HY3A 3LPNA 1QH9A 9GPBA 1Y3AA 3RRFA 5D3MA 1EFDN 4ABYA 3LK7A 1IHUA 2Y93A 3KV3O 5WRFA 3ORYA 4PLFA 1OZ0A 3NPAA 5JH7B 2JBHA 2PLNA 4U8GA 3RF7A 3SC2A 2BMWA 2QQ0A 6ADHA 2Q0OC 4HPWA 4E03A 4F11A 2A6PA 1OT3A 1X7ZA 3OT1A 1L7XA 4H35A 4XYBA 5LN1A 5IF9A 1K4KA 3NWPA 2WDPA 4L28A 5CH3A 5D7BA 2QENA 1YBFA 4RGBA 5CPFA 5DYIA 5HKKD 2O8CA 2QR3A 3QEOA 3IKTA 1JEOA 1BQ0A 3RVKA 3T3GA 1TTHA 3GVCA 2H6EA 4C01A 4PE5B 5CX1B 4RV4A 2HEPA 2ZKIA 3M1LA 1TO2E 3I1JA 1WF3A 5JSKA 1CY2A 5CVTA 3HCFA 4TSRA 4TMYA 3RK4A 4MUJA 2ZZKA 4LF8B 4ALNA 4LWZA 4G85A 1Q7RA 1LLQA 3DL4A 2CY0A 3B13B 1T5IA 3PJDA 4DR6B 3U4IA 4J0CA 4WOJA 4ZQEA 3VYSB 4GX0A 2WMDA 4Y3UA 3KSDO 2BHSA 2MSKA 5DM1A 4BGUA 4B3HA 2BMJA 1QVRA 2JGMA 2Y1XA 1SZJG 2WLHA 4KN8A 5FLKA 5K8VA 3NR7A 2RBGA 3TOSA 1Y76B 1EIWA 1OWOA 1RRMA 4B6GA 3AEIA 1Q92A 1Z15A 1IK4A 4OPAA 3E15A 1YI1A 3ZIAD 1KJWA 1RP1A 2BFFB 3AM1A 2O3QA 3VPCA 5FR2A 5DASA 1XCGB 5DI9A 2OFFA 4MVJE 4BWGA 1BXGB 1HORA 2F64A 2W9XA 1TGVA 1Z8NA 5E1DA 1P9RA 1BS9A 2BFCA 3NX4A 4U6SA 2J5RA 3H0CA 5KUMA 1ADJA 3QX9A 4ZV9A 3KLOA 3T9CA 1VLZA 1QZXA 4XB2A 4KXLA 1L3IA 1KK0A 1E7QA 3CNEA 2NU6A 4DM7A 3A4NA 3VU8A 5AVYA 3IPLA 5IUJC 1SO8A 2X6QA 5D6NA 3ZEIA 1JEEA 3Q0IA 5FPRA 4HNAA 2JRCA 4BL5A 2R00A 1S77D 1YA4A 2K6GA 1B26A 4B46A 4Q7QA 2GKOA 2OQVA 3OUZA 2P1ZA 4C2BA 2BFNA 4BWFB 3GGCA 2E5LO 2WM9B 2QAIA 4NYIQ 3FVQA 2C82A 3OCJA 1TF5A 3U0VA 5F33A 2BCJQ 3VR4H 1FU8A 2CD7A 5FOWA 4YJ3A 3SJQC 1M1NA 1MC4A 2N47A 3RVMA 3CXCU 4AJPA 4QGSA 4UVEA 1AI7A 4RUKA 1C8KA 1XZMA 4AUEA 2AIRA 3KXDA 4G5HA 4UHHA 3I0NA 4REQB 4JHXA 3FNFA 3AFOA 1DAMA 3AEQB 4IJUA 1BHSA 3GH1A 4BAYA 2HAEA 1ENVA 5LQSA 2W71A 1L4NA 2ZJ1A 4ABTA 2V3CC 4BP8A 1L4EA 2VOJA 4NOMA 3CLUD 5BNZA 2VPPA 1WUKS 4JBYA 4M38A 1TJNA 1XEAA 2XUIA 5A9TA 3ZYZA 4QG3A 1C3JA 4FR5A 2RHTA 2GHTA 1AB3A 4MUGA 3QEAZ 2BM9A 3D2AA 3M9XA 4DXDA 2D1FA 3YASA 3DZJA 2PEYA 1DWPA 1HOTA 2W22A 5B64A 1CUCA 2P4QA 2R96A 1PR3A 3CRRA 1KH3A 4EELA 1QHXA 3KK0A 4C3VA 3T35A 1B6SA 1F2UA 3W7UA 1ONBA 3KC2A 4X92A 3Q3EA 5IMBA 1NVGA 5K0NA 4LMPA 3L8MA 4I1UA 1HA3A 4N39A 4ZCMA 4P33A 4HEA1 1SKUA 4GG1A 2Q5HA 4DG5A 3U40A 2WW8A 4EHBA 4PG8A 1PJSA 1VPWA 4HVAA 4KGZA 5BN5A 4OHYA 4P80A 3TLXA 1MKYA 1AMOA 3VH2A 1YZTA 1OMOA 1XDGA 1PJZA 3CZRA 4DCUA 3HDTA 3OLVA 3G49A 3H11B 4GYWA 2FHPA 1Y5LA 3CLKA 4NZMA 4WKBA 4X90A 4DUPA 4EHIA 1EBFA 1R15A 4NOLA 4AVYA 4F6RB 1UK6A 1VB5A 2G5TA 4WI1A 5L3SA 3IQZA 3COZA 3EMBA 1JU4A 4YASA 4H1VA 4IL5A 1NZDA 1WXWA 5ARDA 1ONNA 1BJRE 1MR3F 2JG3A 1VL1A 3OEHG 3CR3C 3OCVA 3U3ZA 3WBKA 5EJ9A 1GCOA 3FNIA 1ORQC 3DOUA 3UQYS 4XYEA 1G21A 4RK0A 2O6LA 3PGVA 1NTMH 2IEZA 2P4EA 5BY2A 2CV0A 5JWHA 3A2KA 5AK4A 3B2NA 3UW1A 2N1BA 2G80A 2GVNA 5CT6A 3QNMA 1TVCA 4HQNA 4J0EA 4P9NA 3SDLA 3NAQA 4GGOA 3SR4A 2B61A 1O95A 2FCRA 2HT6A 1PJQA 3INRA 4GMXA 4OQEA 4J80A 3E6AA 1Z34A 3R76A 5ECDA 4D82A 1LZKA 1XKQA 1GAXA 4OH7A 3PC6A 4P8RA 1QVGU 2BUCA 2O50A 4EWLA 4PG6A 2WWVD 3EG5A 2G3YA 1ZSPA 1YTFB 1YO6A 2GF9A 3FWYA 3LHKA 4WOKA 4YJ2F 3FIUA 1DPGA 3GFQA 1DLJA 1MV5A 1NVUQ 1SC3A 3M5CA 1RMYA 3Q8WA 4ZICA 3AEYA 1TJYA 2X0NA 1DQZA 1N0UA 2ROQA 3JQ8A 3L6OO 1H2XA 4QAJA 2QLFA 3EYAA 2AG6A 5BN3A 4N0PA 1GVNB 1GGHA 1Z4KA 1MC1A 3HA3A 3SXPA 4RHCA 1M6EX 4I55A 2FWJA 4QX6A 1DKMA 2VXOA 3PNSA 4F5ZA 4QGPA 1PPJH 1IG3A 2ESRA 2RAFA 3UQZA 1S89A 3A9VA 1XZHA 1MAAA 2PS3A 1J0DA 4WZ6A 4E6EA 1FW6A 1K68A 1R6TA 3T54A 4YACA 3DL0A 4FPXA 4R05A 3KZCA 1PJBA 4YS6A 1LZLA 2J3JA 4MQ4A 5FUVA 3QEBZ 3EZ6A 3VX4A 4WLEA 1Z73A 2I34A 3PG5A 4XASA 4YK7A 4Z49A 3GLGE 5JTUA 1A04A 3AIKA 3QU9A 2FEOA 4Q4DA 1SD5A 3FDXA 4DLSA 2A79B 1ZR4A 1JEYB 2YIMA 3RTEA 3NWEA 3N87A 1DARA 1EU1A 4U9UA 1NYQA 3PFGA 3F6PA 4CV2A 1PX2A 2C84A 4F4IA 4UFNA 2YIAA 1ZCAA 2WLMA 4Z4EA 1IVNA 1J22A 3WB0A 2FKNA 4DR4O 4U02A 1U7HA 2O2CA 1JKJA 5JS7A 3UMJA 2C0QA 2HU8A 3PL1A 3WP1B 1K5GA 3OLWA 4KSYA 1IHOA 5ENZA 1GZSA 2IHTA 1LXCA 1CEXA 3GXOA 3U61B 2O1XA 4QVKA 4UATA 3R7LA 1ZHOA 1FRZA 2GN0A 3I4LA 2RK3A 3DFMA 5EMKA 5JZSA 3FCXA 3GZNB 3KXKA 4MV6A 4DABA 3B82A 3BYZA 1E20A 1EZZA 1TYZA 3M6FA 1R0CA 4L7QA 4CKBB 1T4CB 4DQXA 1UPTA 4LJLA 5TVKA 1Z75A 3QTTA 3TBKA 3G71V 5FEMA 3TMKA 1KI6A 2YUTA 3BD8A 3B8NA 4WJKB 5TE9A 2YCBA 4AKTA 4ACBA 4FNMA 2DUNA 3KQQA 2VPYA 1HT1E 4TT8A 3DZHA 1ZK4A 3C7KA 4QU0A 3RM3A 4R1SA 1WMEA 3ROZA 1WAMA 4P2GA 3DT9A 3P2JA 5BMVA 2EP8A 5I5EA 4ZCLA 3V5NA 4CUKA 3AEUB 4CIBA 3ZGYA 1TZKA 2AQHA 2ZVJA 2VN8A 3GLHB 3GP5A 4M0UA 3FJ1A 3PEWA 4Q9HA 3D54D 4EX7A 3HKEA 2DFDA 3TLYA 2ZUVA 4KQJA 1OB2A 4NBTA 1FB5A 4DQVA 3AVYA 3OY7A 1QYDA 2Y8EA 4X1KA 4FFKA 4DM3A 4LTNA 3ECSA 3ZCXA 3AZOA 3HGTA 1I13A 4MTFA 2GF0A 4CMEC 2DPLA 5BWLA 5A3RA 4FOTA 2FVYA 3U26A 3AOEC 1K8ZB 2P68A 5E6RA 4BJ1A 1SBHA 1X1RA 4ZPXA 4ND6A 3OOSA 1OCEA 4R98A 4ALIA 3WQHA 1BE3H 3CCFA 2ES4A 2H11A 3FB4A 3WLQA 5KQSA 1D6SA 2B5WA 5CRIA 4IYRA 3NNDA 3ONVA 1JDNA 4I5EA 4PZLA 4RIGA 4TMXA 3RVPA 2PQ6A 2RNBA 2ZM6B 2VDVE 4ID9A 4KTTE 3WFVA 2DUWA 3CBQA 2QKCA 2CHQA 4MR9B 1U2GA 2HQOA 4QATA 3N27A 4PV1B 3VC3A 1VL6A 5HE9A 4PPNA 3RS7A 2J3KA 1EUCB 1Z26A 4DLNA 4LBVA 4FMBB 4XSGA 3CLHA 5KTTA 3FGOA 3O65A 2ALJA 1AH2A 2OA0A 3S28A 3E7DA 1DAFA 1Q21A 4PFSA 2ACKA 1RWWA 2RH8A 1DLIA 3WNQA 1UBHS 1V41E 2A7QA 2V9PA 3JYPA 2ONKA 1JHPA 3EXIB 3LGSA 3MT9A 3NYQA 3HJCA 4AMYA 1BDMA 1A9ZA 4B3CA 4REMA 1EVJA 3P2OA 4C08A 4IJKA 4RS4A 4HWPA 4RVGA 3Q2IA 1EXVA 3F7NA 3M1AA 2I78A 3RU3A 3VJMA 2H1VA 2RBKA 2R5FA 2ZUDA 3B3JA 3BIJA 3IDFA 3A58B 4JVOA 3DA8A 5DTEA 4E5PA 1L7OA 5TRTA 4L9AA 3LO8A 2X5XA 2I54A 1V6AA 1U7ZA 2FPKA 5F2VO 3T52A 3VVBA 2FSFA 2O2YA 3CQ9A 4EUFA 1IG0A 4F71A 1Z6TA 2ST1A 5CITA 4WCVA 4TV9B 3HVJA 4JLOA 2YXLA 3L6RA 4RIHA 5IXYA 4O5OA 3JWGA 3HKDB 1UXOA 1VQKV 3LHFA 4G23A 3NFRA 4R69A 5BR8B 4GSYA 2A1TR 4I14A 3ISTA 2HCBA 3PYLA 5JE8A 4DR2O 1P7VA 2ZSAA 3KO8A 4C7XA 3U44A 3QPUA 2YFKA 4C1BA 4CCSA 5BN1A 5CIWA 1KB9F 3H83A 2FWMX 2BZSA 2K2QB 2WPNA 4H0CA 4I5IA 4I19A 5TS3A 4K8ZA 4F8EA 2ZAOA 1RPTA 2P2YA 3T34A 5LOVB 1EGAA 3ZI0A 5FHQA 3T0FA 2M6LA 5AO9A 1EFUA 3H97A 3N6RA 2RMKB 1NYTA 4IIJB 2OOSA 4H08A 2W2XA 1X3LA 4IGIA 3ZRWA 3E5NA 3QE2A 4MVJA 5E6SB 3SZRA 3A05A 3MS7A 3JZMA 1RAEA 3K5NA 4TGLA 1V11A 1QBKC 3LK6A 4JZYA 5K99A 4I0XB 4K81B 3DTNA 2ZROA 3OHSX 2GSMB 1GGNA 3HKCA 1DJLA 2OL4A 5EJ7A 3EJWA 4ZARA 5G40A 1D2AA 1UBRS 4YMHA 2PGAA 4FFPA 2I5PO 2REQA 2B6HA 2F1JA 1I5YA 1L7MA 2V59A 1STOA 2YXHA 1N6OA 1E5DA 1KMMA 3V3TA 4BX8A 5JMWA 3CC8A 3DWFA 5BY1A 1YF2A 4WDRA 4AB1A 4ASUA 2W6OA 4W9NA 4B82A 5AG2A 4C6HA 1SZTA 1B06A 2V6FA 2RHWA 4L16A 4YONB 3GAAA 2GCPA 4QT0A 3I01M 1JU3A 3C98A 5EFZA 2WUEA 4PSAA 2BBWA 1BA3A 3EAFA 3GROA 3NV9A 4L9SA 4H3KB 3UCSC 4LDNA 1J0EA 2QTHA 1E1QD 2VNHA 4INOA 3ZDFA 4BUZA 4HNVA 4UVAA 2O59A 1BO6A 3ADPA 3MMPA 4U7GA 1AR1B 1JECA 1QZ3A 4QGBA 5C37A 4G26A 2WT4A 2A35A 2ZB8A 3GPDG 1SVLA 4FGJA 4I1RA 2YR0A 3NIDB 4JXZA 1C50A 4KC0A 2JGDA 2B3TA 5GM2A 1M90W 2AMYA 3WRVA 3KZ1E 5I7SA 3AETB 3BB3A 4EYKA 5LMCA 1NNSA 5TS2A 2LDBA 2H4YA 4X54A 5TB5A 5BNFA 2ID4A 1SNYA 4GC9A 1ZR2A 1QH1B 4Z6KA 1YIDA 3UB4A 4OA8A 4AZ0A 4FFVA 1ZD9A 3VYTB 5F51A 5ADHA 1Z0DA 2D59A 2VLIA 1TK9A 4J16A 1M2EA 1GU7A 4OQFA 3TAXA 5BUZA 4I4TF 1PZNA 2JFHA 1T6NA 5FB3A 3RTDA 3EA5A 1B6QA 1NBMG 1R64A 2LO1A 1A5BB 2GF2A 2NG1A 3DO6A 3OIWA 5EZYB 2Q62A 2XA2A 3BXFA 1G21E 1HDRA 2OC9A 2XNDD 3B7WA 4K1XA 3HUEA 4LF7B 1O94A 2OSBA 4GF5A 3BZUA 4A8JB 5DISB 3GGJA 3VGJA 3G9XA 3Q5EA 3JQBA 3IOMA 2HDWA 4QGFA 4TQUS 4OQDA 4JJ7A 4ZVOA 4MWGA 2Y1EA 2UXNA 3ZVNA 4X6UA 2W6ZA 1XTQA 1QHSA 4H6WA 4I0WB 1T3TA 2VTKA 4RD3A 5ARCA 1SCNE 2I22A 2DMRA 3ONWA 4OB7A 4JODA 2EARA 3GJRA 1ADFA 5CIQA 2REXB 1R74A 5ERYA 1KI1A 4L4ZA 1UJWB 1NG1A 5TT0A 4DF3A 1TE2A 3STWA 1JH8A 5KU1A 4CKWB 2DRIA 1FDUA 3BFJA 3GFSA 2VAVA 4ZIBA 4E0BA 3U4QA 3U81A 4I0XA 2EX3A 1D5WA 2OCPA 3ETLA 2GPYA 3K15A 4P5EA 2VXCA 3OY2A 4WZBB 1YB6A 4C5BA 2LKCA 4P7BA 1BMQA 3NM6B 3L84A 4MW8A 1SHLA 1JDVA 2QIOA 3IO3A 1RRGA 4ETMA 3ORFA 5FBQB 1AQUA 1JG2A 4L9WA 3NCHA 2IEAA 4IFTA 3WKEA 1S2MA 1O5OA 4E4YA 2M9MA 2WWWA 3AVWA 4EGSA 2E2WA 3HP7A 1Q77A 3NH9A 2OO5C 4G5YA 3EDCA 5E6UB 5INTA 3IAEA 1TGOA 4FEYA 4E33A 5IKEA 2QJWA 4O4JB 1XP5A 3GGOA 5AJHA 3L1JA 1I1HA 1YCIA 4EPVA 4M1OA 1W85B 4UCSA 5EXSA 1JSRA 3BIXA 2GJAA 5DM0A 5KC9A 2B25A 2JNWA 3OE7G 4MP6A 2NO7A 3TEFA 3O9OA 4AYWA 1LUWA 1GZVA 4GE3A 3AR2A 2HP8A 3QFTA 4KXWA 1S3JA 3JVIA 3FCEA 1OC2A 3VYVA 1CZLA 3BMNA 1F4PA 4YUVA 2O3RA 1TA0A 4JI3B 3EGDB 3HG7A 1F2TA 4JC4A 4F56A 1DFIA 1KJJA 3KQYA 4C14A 3WNCA 4TKUB 1H2MA 1T13A 5GY7A 3THWB 1B2RA 1T2CA 4MYTA 4KQ6A 2DQ3A 4BQQA 1F3LA 2J4DA 4CR6A 1BW9B 2G76A 3MHTA 2CYAA 3I1IA 3VHXA 1JH9A 2OZEA 1PNRA 3IJ5A 3FTFA 2AHYA 4CH3A 4LF9B 4NZ9A 3DMFA 2KBEA 4AKIA 4NJEB 3O95A 1CJVC 4U7PB 4DAOA 4KLZA 1DTOA 2EZUA 4NBUA 1O2DA 2GBFA 2KWIA 3BILA 4B43A 4BQPA 4Z7QB 1HETA 4R84A 4QYWA 4DNOA 4D7TA 1WNFA 2BP7A 4A10A 1DQSA 3S1SA 2IPNA 3FWNA 4LF7O 4MVJF 1Y6FA 2AK2A 1U2RA 1FCJA 4QGGA 3KWJA 1C4KA 2EFHB 3BM5A 4CEIB 1NVBA 3IC7A 1AGNA 1Q1BA 1JR9A 2P9ZA 5AH0A 1FP7A 1NJ2A 1ENOA 4ALMA 1FXWA 2XEDA 2IKQA 4K6HA 2Z0MA 3K09A 4OHWA 5LD2C 1QTIA 1XT6A 4Q03A 5IE9A 1Z6PA 4LOAA 4G8CA 4CS4A 3L18A 4P4GA 4V0SA 2BBOA 3MMXA 3PLRA 3RC3A 3SDBA 4EFEA 1Y8AA 1N1EA 2BI8A 4IUDS 4N8EA 3NATA 3TWOA 4BLOA 5GVSA 4JJIA 2D2IA 4A15A 4IG9A 2YMPA 1O3YA 3OLQA 4D56A 4XDGA 4M99A 3IA7A 2D3OW 3MFQA 1XRNA 4OGGA 1WHTA 4RIIA 4HXFB 5AXDA 2YH2A 3KKEA 2H4ZA 5LNK6 4DG9A 1CQWA 3NTUA 4TMTA 4MW2A 4H3VA 1NBOA 2LFRA 5K03A 1T1RA 3ILXA 4OB6A 2FWAA 1I6KA 3IJEB 3N2GB 1O97C 2XWPA 4ROSA 3SFVA 2CD9A 4RD1A 4B6QA 4E2ZA 2P90A 1J1IA 2J0EA 4ZD6A 2X0EA 5IBPA 5LLSA 3O2NA 4I36A 3EZ2A 3TX6A 1M1ZA 1WSWA 5FI3A 4LF5B 3IL2A 2I2AA 3KXLA 5BNTA 4O2AA 2QJTA 4ENQA 3ELYA 5EKUA 2WLIB 2YVQA 3M4YA 3L77A 3QOXA 3S2FA 3H04A 3M5DA 3OC6A 2PH5A 3QTCA 4H33A 4RF2A 4ME6A 3BRSA 3OAAD 4OL9A 3WDMA 2IZ0A 3BBPA 1HE5A 4EZEA 3C3XA 2F6RA 2HMUA 2O8CB 4GPBA 2XNKA 1PHRA 2J9XB 5A2QA 1YRHA 3X3HA 1BTOA 4JENA 2RAPA 5KHLB 3FWKA 4WCDA 2IUSA 4BVKA 5GGXA 1JDZA 4TSKA 4PDRA 3TZ6A 1HDEA 1WPGA 2I8LA 2QMOA 3LCRA 4FLMA 1MRNA 4WRRA 2YZ2A 3UUGA 3WK4A 3RRYA 1IVSA 1WQ3A 2J30A 1HNZO 2CV2A 1PTJA 4DWOA 2WICA 3EHEA 4F91B 1N2XA 2QLTA 5AJTA 3LGAA 1CJUC 2XCLA 5CDYA 1MQ8B 1QH0A 3H4TA 2XDQB 3A14A 3MT8A 1AP5A 1AUVA 1G2QA 2LV8A 3NKFA 2AXNA 4PFKA 2VPIA 4WADA 1D2GA 1XDDA 1ZMXA 1CPYA 3LQFA 4HDSA 5EC2C 1T5SA 4W7HA 3KDAA 2BFFA 2YXEA 3QNUA 2RJZA 5A4FS 2F55A 3HFRA 5BRNA 4RJLA 1FFXB 1CQXA 1VQ5V 2AE2A 4QHYA 2IIVA 5C81A 2HOQA 3E89A 2J3LA 5LB2A 4OMFG 3I92A 2HK8A 1QRUA 1EEXB 2ATVA 2IEIA 5F9MA 3ES9A 4MUAA 5JZMA 1YCFA 2CNLA 1QNLA 4N8DA 2GAAA 1UBEA 3PVSA 3TXQA 4C7OB 3SPGA 2YNMC 2H2IA 4W1PA 1E4EB 5DLEA 4D0SA 4RVSA 5JOQA 1MZFA 3BGVA 4GBJA 3HUFA 1N3BA 3CONA 2HTEA 3WWPA 2KX7A 1JJOA 4BXOA 4R2HA 1P73A 1L0NH 2XIJA 1AN0A 4HEA6 4JGGA 1E2NA 2JAHA 1EDDA 2X77A 4FJ0A 3KWLA 1XMOO 1IQ0A 2EZOA 1P7BA 1NOIA 3ZWVA 1P31A 1XVVA 1KQGA 1KC8W 1WM1A 2Z1MA 4X8LA 3GJ8A 1IH8A 1OILA 3D4LA 1WB8A 4NYJQ 4B7XA 3PKZA 4REQA 1ELOA 1BDIA 5FBZA 3HNPA 4D0LB 1J0BA 1PFYA 3QU5A 2ZTMA 4DYLA 3ZBQA 1KHTA 2DCMA 3TKYA 4JZGA 2K2WA 4DPKA 3KB6A 4HLCA 4UCWA 4UHDA 5EHZA 3NPMA 4INJA 4Y6PA 1E9AA 3HA5A 5H4HA 1YIOA 2PYLA 1M34E 5T67A 1U0TA 4JP8A 1FQWA 1A97A 3PLAE 5A4JA 4MVOA 3C3CA 1X2BA 3WLSA 1TEVA 1YDHA 1TA4A 1JG4A 2GD0A 3CJRA 2UUBB 3GUCA 3HEAA 3IKLA 1RQPA 3LI2A 4PHTA 4ROTA 1EVIA 2PM8A 2I6GA 3R75A 5KNDA 4MT8A 4K46A 3GAMA 1L7BA 2YV2A 4NU5A 5IBQA 4BEVA 3FCYA 1N5JA 2A9QA 1G3MA 2BAGA 5FBHA 3DULA 4IZHA 1W1IA 3M3DA 1OZFA 1OROA 4BRSA 2GAFA 3OIUA 3K9GA 1EVKA 2QUKA 4Z7NB 5E7JA 2HRZA 5BN5B 1XWIA 4NBNA 1P18A 5JCZA 2Q6TA 3MCTA 3WTBA 2GZ2A 3P7MA 4WN9B 5I7UA 1G5TA 2NZYA 1VE3A 4H7HA 4JLNA 4RF5A 3R7WB 2HCJB 1Q1NA 1RJGA 3ZD9A 5A7FA 4IJQA 1C3VA 3T3EA 3TLAA 1J1ZA 4J91A 4WT7A 3V1MA 1WBBA 5JSZB 3DSQA 1V9PA 4YJGA 4R71A 1GYPA 1SCUB 4O5AA 5LIRA 2W8ZA 2BD0A 1HNNA 1N6IA 4RTMA 2DPHA 4NEHB 4QARA 1JQDA 1NL3A 4XQCA 4D9JA 3CCSV 1U8CB 4ZV4A 3ZLJA 4FYPA 2XHZA 1E2MA 4P32A 4XYGA 2RB5A 3ASOC 3RVSA 4OLJA 1CV2A 5IS2A 4ALLA 1Y9ZA 2ISQA 3PC4A 1HLGA 1SCDA 5CNMA 2DQKA 4NCHA 4JI0B 1U7WA 2GB4A 1SQ5A 1ZVMA 1HZZA 1RPRA 2OUIA 5CFLA 1U0OC 3V7YA 1U6KA 2V0CA 2UZ4A 1U0BB 2XMGA 2QRQA 1W44A 3GFFA 5J23A 1FLNA 5JAMA 3IXMA 1WO8A 2FB9A 4ICIA 2BSKB 1IQPA 1MTZA 1RKQA 4KMSA 2HIHA 2BSAA 2JCVA 4FGSA 4KLNA 3CPSA 3QKIA 1PR5A 3HV0A 3V1TC 4ZAVA 2QBYB 2UAGA 1B0ZA 5TMDA 1O89A 1P60A 2BFDA 2JIZG 1Q20A 1ZOOA 2PD4A 4M8IA 2NUAB 2IRWA 3SD7A 4YRBA 5KDOA 2L82A 2Y1CA 4RBNA 3STUA 1PZMA 1FUIA 1RSOA 3QXGA 1KKLA 3KSUA 3M3PA 1WMSA 4EGFA 2DC1A 2DHRA 2VWPA 5E4JA 2OVBA 3WY9A 4CEJB 3ISVA 1J6UA 4F4UA 4CL8A 2ZS9A 1KPGA 1U9IC 4G37A 4NBKA 4UHCA 3TSWA 5ITWA 3LQ2A 1CJTC 3F49S 5JATA 4XTCS 1DRVA 1R1BA 3AU8A 1X59A 2UUCO 1SKYB 1O0SA 1DAHA 1QG0A 1QVZA 1ULSA 2FEKA 4FBGA 4KO3S 3T15A 3VSEA 5DEOA 1M2OB 2LTAA 1W6UA 2YWEA 2YWBA 3U80A 4ASUD 1PL7A 2JJYA 4IZOA 2QI9F 4C4ZA 2ZDIC 4DV3O 1EE1A 1NE7A 1Y8RB 4TKMA 4YCNA 3ICCA 3HR8A 1R7RA 3W5HA 3OJEA 3NHJA 2BLLA 2Z2KA 1EVYA 1YD7A 4GBMA 4GSKA 1GTMA 1XHLA 5AWFC 2CCJA 1R6NA 3ZBHA 1T1JA 1MGPA 4ZANA 4FHGA 4FUQA 4YUZA 3QYJA 4DR3O 3T4DA 1NN3A 2HV9A 5HFMA 2ORYA 1SZDA 3A9CA 1A7JA 5EJMA 1T10A 1U0NA 1FEZA 2QTTA 4LVOA 1G20A 5FBKA 4CETA 1NQWA 2JRLA 3RTBA 3ILSA 1GT91 1ZIPA 2PX8A 3AT1A 4R9RA 5E79Z 2DTDA 1SKYE 1NNI1 3GJZA 2DBYA 1XCBA 2GN4A 2L42A 2OWOA 2QLMA 2W2QA 4AIIA 4TTRA 4QBFA 2MWMA 1MD9A 2XCQA 3BQ9A 3NRJA 3QOFA 1C9YA 1TMGE 3EOBI 2OCCC 2WA4A 1A88A 2Z8YA 1T25A 4LJ9A 2WABA 3SS7X 1LSUA 5TQ2A 3VH1A 4DV5O 2YKGA 2BR4A 4HO1X 1QRSA 1L4YA 3M6XA 1K7FB 9ATCA 5F4BA 5C8YA 3LO5A 1RP3B 1XZLA 2GTSA 3GT7A 1GRQA 1Q1GA 4NX2A 1CP2A 3VZRA 1K3FA 3N2YA 1FDRA 2X0JA 4UPVA 3RYFA 3W0LB 5L4NA 4FLYA 2O48X 2OE2A 1LDYA 3OPQA 4ZXPA 1XQWA 4KIUA 4NE9A 4DC1A 2BFWA 3AX6A 4GOJA 4AMUA 1O58A 4DMRA 4QJ3A 2I03A 5B1EA 1XD2A 1J97A 3K6KA 1V1MA 3UCFA 1FYEA 1XQ1A 3LV8A 1KK2A 3PXEA 4WV3A 3BJEA 4BP1A 3A06A 4XSHA 3OT5A 4DV6B 1IYZA 1PT5A 2CMFA 4BLRA 4OHBA 4E7PA 1F8YA 1P1IA 1TFRA 1TVKA 3SR2C 3GB7C 1L5WA 1L0LH 1URPA 1YCHA 1K8XB 2W6NA 1T8RA 4JDUA 4ND3A 2X6AA 1Z4IA 4HSGA 3W2TA 4CN8A 3SSOA 3VNAA 5IHPA 3LIIA 1JDBC 1AUPA 1EWVA 3MTQA 3TN7A 5IZCA 1OV4A 2VOEA 4IFIA 3W1VA 2H4FA 1Q7GA 5KAMA 3WO0A 2ZYDA 2V7EA 4D92A 1FJXA 3RADC 4CKYA 2WUFA 4DCOA 4XDLA 3CZ5A 4DV0O 1D0VA 1XLTA 2WLLB 1VI2A 4J3FA 3AETA 4JEHA 4A6EA 4A5SA 5C4IA 1Z2EA 2GGSA 1W5EA 2PMFA 1XCJA 3E9YA 3G7NA 1T1IA 2VPQA 3RFXA 2EIMC 2Q8QA 4XEUA 3IAS1 5D00A 5ALUA 4F3NA 2YZMA 1ND6A 3TQFA 4DQKA 4MA5A 2H3OA 3I8OA 4O8ZA 4JVSB 3VTZA 2C5LA 2VAXA 4R4JA 5KNBA 2JANA 2QTWB 1BMFD 2ETVA 1DAEA 4Y18A 1ZGAA 4AF7A 2RDCA 5K45A 3OUFA 1OCOB 1KDOA 3HVIA 3AVVA 1P91A 1NLYA 1NOKA 1QYIA 2FSHA 3I45A 4ZO7A 3NMUF 2PR2A 3GU3A 4L8GA 1ZQ9A 3PEEA 1MGOA 3E48A 3OTOB 2BRUA 2JGKA 2PXXA 5EZYF 3NS7A 1U90A 5C32A 3FM9A 4NF2A 1T2DA 1SVWA 3E2PA 1F4NA 2H8PC 4WUTA 2BE7A 4DJJA 2YZ7A 2FPUA 3UV7A 3QBDA 2NUPB 4ETNA 2C1ZA 4OD0A 5F12A 3TLGB 1NJ1A 2QV0A 3U4AA 3ZW8A 2EAUA 4CQNA 3FD8A 3MWDA 2O5RA 3ZDQA 1L8DA 2ZE5A 1G5FA 3WSVA 2WA3A 2AYYA 2XOKG 4N9WA 4EQ6B 1LSSA 4ER3A 3IDOA 3LPAA 2A3QA 1OYVA 2GYYA 2VWGA 2Q7HA 3P9YA 2DEUA 2QRZA 3DYVA 3LW8A 3CX8A 5AW1A 2ZJ0A 3ZWQA 1DC6A 1NIJA 4BWYA 7MDHA 3PGA1 4KYVA 4EMSA 2B35A 2WINI 4UOZA 3G3EA 3EQ2A 3HQ4O 4YJ2A 3W4JA 3ZGOA 3VDMA 4XR9A 4EI2A 3WK8A 1LJLA 2QTGA 1RFYA 4BZQA 5EHQA 4CLXA 2FMLA 5B58T 1UDWA 4QQFA 1F7VA 4CT5A 1NQUA 1PJ2A 2WLNA 1NUSA 1RWXA 1BE8A 1S3FA 2XASA 2HA6A 2J3MA 1I1QB 2JCXA 2YIJA 1SQPH 2ZBGA 3F3YA 2M7WA 2NU9A 4DIOA 3T5PA 2BEUB 3TB4A 2VUTA 3D3EA 1RLJA 3I5UA 1VF6C 4GAEA 3GVXA 4ENSA 3MCUA 3RGWS 5CFZA 4KACA 1KY4A 4ARUA 1MB2A 1UMDB 5DLDA 4LP8A 1T34A 1VCHA 1XXHE 3SZUA 2X8LA 1CVLA 3TNYA 4CGZA 3VOAA 1R8JA 3H9VA 1D2DA 1E1YA 2ZJAA 1CEQA 3EGVA 4BQEA 3R41A 4EQZA 5BPFA 3E8MA 5D01A 1MNAA 1NTRA 2HPZA 2V7GA 3OX2A 1R5BA 1ISSA 1MAHA 2HY7A 3SBOA 4EVIA 1JTVA 4F7DA 2IYEA 3CPJB 3KB2A 4O59O 2R7LA 4K7JA 1XZBA 2B9VA 1VBNA 5FUYA 1GTRA 2R3SA 2WMYA 3E3MA 3O8OB 4MWEA 2EW1A 1K34A 1DXQA 4O2RA 1GRVA 1RYEA 4NMLA 4P53A 3RHZA 4FR2A 1FVOA 3KZNA 4D0RA 4XQ0A 4BO0A 1PZGA 2ZXWB 3X2EA 1K06A 2PWBA 3K2QA 4MX8A 3DF9A 3L3BA 3ZLBA 3KR9A 1AHPA 1LPBB 2ZIXA 5FJJA 4CTKA 3OWHA 4YRPA 2P6NA 5LYJB 1JDSA 1I7NA 3O84A 2IW3A 2ZYUX 1EA5A 2ZYVX 2ZYTX 4O3FA 4J7CA 2HMAA 3ZGNA 4TYWA 2ILMA 1HSZA 2G71A 2RBEA 1PU2A 1NVVR 1OOEA 1XPRA 2PMKA 4L8VA 4TXMA 2RGYA 4LF5O 3MM4A 4I7EA 2IT1A 3A25A 3R3SA 3SE0A 2BKXA 3NYWA 4CFSA 1J1UA 3MRVA 1Z2NX 4N7JA 4FFRA 4M8KA 4I3GA 4F38A 2XNCA 2C1EA 2PZFA 3DZ8A 1NFQA 5JC1A 3BGOS 3NM4A 3BTSA 2AN1A 4PV7A 3ZW7A 2ZT8A 2A0YA 1KDRA 2C9MA 3Q85A 4KE6A 4LOJA 3VVLA 2Z6AA 3A1TA 1GAEO 3PZRA 2BEUA 3DV0B 1KOLA 5E4YA 2UXDB 2VIIA 2EZ4A 2DH6A 1TM2A 4FYVA 3RIGA 3RYIA 4ZIRA 3QPCA 1GYRA 3HPLC 1L1FA 2RG1A 4FFWA 3SYPA 2WFMA 3ORSA 3N07A 1ZK3A 2QAGA 1QIKA 2QXYA 3DMPA 4MSWC 3EIOA 1RM1B 1M1KW 3I28A 3R40A 4WBNA 3A1FA 1HC7A 3DDCA 3LP5A 4NP6A 1Q2UA 1UC9A 3QENA 1MO5A 3QXXA 3PVZA 4UXHA 4QSHA 3AV0B 2AT1A 5CVVA 3CCJV 3P0IA 3U2QA 4C0XA 3JD0A 3MTEA 3RYHA 2QSAA 3NQ41 4Q66C 1L3BA 4D41A 3G85A 4IF6A 3I39X 4I1PA 4UVGA 3RVOA 3THYB 1P9OA 5M29A 3U0ZA 1PGNA 1XDZA 2RCVA 1S5PA 2H7XA 1EB8A 1H23A 2HWWA 3QMWA 5BT8A 3OE7D 4A26A 3AG2C 2YXYA 3BXOA 5BURA 3T3DA 4CH6A 1AKUA 2HLPA 3GW8A 4KQKA 5HKLA 3U49A 1SUWA 4BMOB 3MELA 1BCCH 4ITRC 3HCBA 5H70A 4JLWA 3NUZA 5C7YA 1W8IA 5JNRA 5DM2A 3L8DA 2NO1A 4GS5A 4I3FA 4IDDA 5CK5A 5TIIA 3LVRE 1JMYA 1T8WA 4MLCA 5JHGB 4L27A 4E5NA 1CNFA 3OH8A 1EVZA 1L0BA 3Q0TA 3QKTA 1G66A 4QFCA 4U7NA 1CQPA 1XRQA 1NE2A 3KZVA 3WHKA 2Q21A 2QJ1A 2JFPA 3A70A 3NNSA 2WZCA 1P8AA 1QAMA 1UOOA 1X9HA 2XNDA 3E81A 3O2QB 1TKCA 1EVEA 3O4GA 4TUYA 3G0GA 5LD2B 2FZ5A 1ORHA 2R7KA 1T4DA 2AFHA 1QGDA 4RPLA 4EY3A 1XMVA 3LCMA 3TAHA 5DYNA 4XPIB 2R47A 3C7TA 4IOMA 2E3CA 2VJMB 5TXGA 1CU1A 2ZIFA 3DHYA 1HP8A 2RGDA 4X1IA 1II0A 3L4BC 4E2LA 3B2EA 2BI7A 3CGWA 1VHDA 4IH9A 4OFBA 1BFUA 3T3IA 3MJFA 4HLUA 2PGDA 3K32A 3TW8A 2HT1A 1Z08A 2I91A 3AHDA 1K5QA 1NR7A 2WKSA 2G67A 2OO3A 2QRNA 1RAFA 2VF2A 3FCCA 2PGXA 2ZXWC 1ULBA 1GH6A 3MJCA 4W5OA 3C5HA 3ESBA 5ES3A 3B4SA 4Q7JB 1KMIY 1PL6A 4DB4A 2NACA 3ED1A 5CH5A 3EVDA 2O3UA 2JHAA 4J76A 4A8PA 4EB6A 1GCGA 4GI7A 3UY4A 5J2TA 1R0SA 1U3WA 4KXXA 3ROEA 1Z5NA 4D3DA 4ZDIA 2FSPA 1KARA 2RGAA 3GP3A 4QNRA 1BQ4A 4C0JA 1U80A 3TZBA 3CRMA 1U7XA 2Q3LA 5UKDA 4IFBA 4LGCA 3SYCA 4HRXA 4PVCA 3GLFE 3JD1A 4OO3A 3NBKA 4HZUB 3PX7A 4DREA 1FF9A 4M54A 1L5GB 3T61A 5KINB 2W42A 1QC5B 4A03A 1ZOSA 1RWMA 2Q5QA 3T7JA 3RBZA 3F7VC 4CL2A 1NVAA 2NVBA 1MO4A 2DLCX 4KPEC 5TPWB 1AQ6A 1W4CA 5DNWA 5J58A 2RHCA 2ZNIA 4MZXA 3UANA 5IYBO 1W9HA 3LLSA 2GK7A 3SM3A 3EVGA 4EA9A 1VI5A 1QFZA 4K86A 5EUQB 4YA6A 3AESA 1PVOA 3PJFA 1NKDA 4V1CA 3TECE 1G8GA 1H0KA 3I4CA 3KP1A 1R0ZA 4HRVA 3IAFA 5BORA 4D25A 3P94A 4WKGA 5EVJA 4RZQA 1U4SA 5T6BA 1H0HA 5DLYA 4BNKA 5BQ3A 4KMOA 4K9PA 3RABA 1C7ZA 2LP7A 1N8KA 3HC7A 3HL4A 2H2DA 4NJMA 4UM8B 1RVV1 5CCXA 3MWJA 4B0OA 5EJ8A 3ZHCA 1JKIA 3PU6A 3JZFA 3SPCA 3TYXA 1KMQA 2D2VA 2VZ9A 1CLUA 4R0MA 3VAZA 2QKSA 3Q4HA 4Y9RA 2E7ZA 3UFXB 1YFKA 4CIAA 4FMCF 4BJ3A 2CE7A 3O5AA 4PONA 3RRNA 1WW3A 4AURA 4F3CA 3OKCA 1DC7A 3BREA 3D6JA 5A06A 2W0XA 3K04A 1E1RD 1VHLA 2DT8A 2PEZA 2VDMB 3GJ5A 3IUSA 3WMEA 3ZHXA 4EKIA 3PUXA 4HV4A 3KL2A 4V03A 1CF9A 4JR1A 4E09A 1L4KA 4M2LA 3DHVA 3F9IA 3GB9A 3CXRA 4H4EA 2GCOB 1PGOA 3PUIA 4JI5B 4FMTA 5KHJA 1EUZA 1HE4A 2YFYA 3FPJA 2IV7A 1M2JA 3CW2A 3G82C 1FQOA 1Y1LA 2VTDA 3KFVA 4QJ4A 2VPXA 4F6LA 2B1QA 2AS0A 4YP0A 5EINA 4HT3B 5DYGA 3ITDA 2BI4A 1G38A 2QPTA 4N0DA 4DIEA 4LZJA 1CCWA 3CBGA 2X2EA 4IH1A 1BZKA 1G41A 1HBJA 1MAWA 1RTKA 2FUG6 2H0AA 1X1SA 1NTZH 2BN4A 2OGUA 3OFKA 4OV6B 1JN0A 1W5TA 1M6VA 5D5HA 1ML4A 5IZ4A 3LVFO 4EF4A 2YYZA 3FUXA 1YEWA 2XUHA 3GJ4A 1K66A 4GH5A 2QEXV 1TRHA 2KE5A 4K2AA 4US0R 1Z4MA 2CAZC 1EFLA 5TGZA 1UC4B 4MJLA 1FLDA 1OFHA 3L7YA 4UUNA 2RE8A 2QGNA 2JAXA 3KZXA 4EMTA 3BDAA 1XNGA 1PVDA 2YV5A 3D6FA 2HJ9A 4YUYA 5FF9A 3GV0A 4WJZA 4ZVSA 1ZKDA 3X2QC 4W6ZA 4M37A 1I2BA 5H5JA 3ZGLA 4XDKA 3E0XA 2HF2A 1LBEA 2IYWA 2XECA 3N0XA 4NV3A 1IXSB 2JFZA 3WGMA 3WK5A 5DP1A 1FVXA 3PD0A 3LWDA 4AYXA 1DFGA 3D2CA 4I8DA 3M4NA 2YW2A 3N53A 4N5DA 1S7CA 4OTZA 2A9HA 4DV2O 4GPAA 3SZ3A 4LYJA 5TQJA 2O5CA 3DUFA 5E3JA 5HGXA 4F2WA 5BN4A 3C1TA 4B7KA 2Y3IA 3GARA 3HB9A 1MA0A 2R5NA 3N8HA 4GUNA 5JWOA 3AG5A 4M36A 4BNZA 5EIWA 2JKZA 3HR0A 3EH2A 4ZOEA 4EBBA 2COEA 4BJ5A 3OQ1A 4PAQA 4YQYA 2HVKC 2ZIWB 4NATA 5GTDA 5HYVA 4GKJB 2AC4A 1WP7A 3WDLA 1XAGA 1V2HE 4EJSA 4UOQA 1PGQA 3ZX5A 4BFYA 3VKWA 2V55B 1TMOA 1K8RA 3QQPA 4G5SA 4XUGB 1R6XA 2XGSA 3SJUA 3KT0A 3OGCC 5H0IA 1D7OA 2QSJA 2YJGA 1WX1A 1ACJA 1K7CA 1M2HA 2WD7B 3AJEA 2WP8J 4CMKA 3WJ7A 2ZRHA 4ID3A 1P2BA 4QXMA 3U3MA 4OAPA 3MFYA 5BSTA 4H7JA 1QGUA 2OKGA 3EE6A 2SCUB 3L4EA 3MLBA 2B8WA 5KSZA 2JGUA 3K2IA 3NBQA 1YRLA 4JYAO 2GSDA 1C2TA 4TXNA 1UUFA 2ECOA 1E6EA 1YMUA 4OXKA 1N2IA 2XUZA 1H2LA 4S1VA 4U2FA 1TQ6A 4B6OA 4E1VA 2R6HA 3COJA 5JXWA 1MVLA 4OPMA 5DBFA 3HU1A 1RQNA 1J95A 3W8RA 4HGQA 2BFEA 3QVLA 4Q1AA 3ZWKA 2WR8A 3NETA 4FC7A 3WL6A 3CHXA 2VHWA 2FWIA 2ZCUA 1OCCB 2ZJ3A 3C24A 1VM6A 3HXTA 2KJQA 2RHBA 4PLZA 4MQEA 1PV0A 1KIAA 1QDUA 2G9VA 3KYDB 3AKDA 2IY8A 3B5JA 3KSZO 3LHSA 3TE7A 1UMBB 5CTAA 3KJHA 1NIPA 1V9LA 1VE5A 1X7GA 3G8DA 3PQ3A 2VI5A 2W43A 4HQ0A 3U16A 1Y0BA 5JJNB 2Y27A 1GPWB 1N3YA 2QVYX 2WHPB 1GLVA 3DBRB 4HBGA 4WVLA 4XA8A 2WTUA 1QIHA 1VJRA 2ACVA 3FX2A 1QHYA 4D80A 4EI9A 3RSLA 3C2QA 2O3TA 2YOHA 4UCRA 3PT5A 4TWKA 4L0DA 4LG1A 4RDHA 3TINA 3OKAA 4W9RA 5JSZA 3PEUA 2F2TA 2BUAA 5LQAA 1VIDA 3QNWA 4ATNA 5E4TA 2QL5A 3PCTA 1PT9A 2N04A 1VYUA 4IMRA 1I08A 2DAPA 4HJXA 1P29A 4MGIR 2YJ5A 5EHXA 4RVDA 4TVKA 4K9LA 3OE5A 3L92A 2Q49A 2W2KB 2XGGA 4BRWA 3OQNA 3FR8A 3TIVA 4LMRA 1SQXH 2CZQA 3DDWA 3EX7C 2DWCA 2JH9A 4QUHA 4BVFA 4IG4A 4LPKA 3O92A 1P4RA 5JWRA 5BSHA 2ZNJA 1TB4A 4URWR 4CV3A 2OM6A 2AF3C 4IXNA 4B3SB 4PCUA 5DBOA 3WYAA 1O0BA 2GK6A 2FPGA 2IZ1A 2C9OA 2EJCA 3BFPA 3IKVA 1LR1A 4CHTA 3THYA 1N2BA 1PEDA 2G9NA 3QUQA 3T7CA 1SU4A 3PNKA 1YJNV 4NKRA 4Z1MG 1XO1A 5MF6A 2ZWMA 3SKYA 4D9BA 3AEKB 1EJ2A 2XV1A 3EBLA 4RABA 1ZCJA 3CG4A 2IYXA 2Q1UA 1M1NB 3ZXSA 2CE4A 1QZZA 2EIJB 3FUUA 5J1TB 3U37A 3H7IA 2C5BA 4UTXA 3SF8A 4PWZA 3I2HA 4UNIA 3VVMA 3MILA 1K92A 2EBOA 2VTVA 3EGIA 5FHRA 3K3WA 3SSAA 5CDSA 3RO7A 4B6EA 3M6WA 2WQZA 3C4JA 3ON5A 1Z4JA 3LDCA 4MLPA 3LZDA 4F46A 1V3VA 2WU8A 3DV0A 3KYDA 3OSZA 5BQXA 4YDHB 1Y4DE 1W581 1A98A 3F6BX 4TKUA 2AX4A 2P9BA 2YWFA 3RK0A 3WIVA 1UC5B 2V4DA 3R1IA 4JPRA 5T7BA 3CRAA 3CIFA 2UVQA 1RLUA 5GJCA 1VKRA 1RQGA 3PDHA 1EHIA 2CHFA 3LXMA 3RTCA 4F96A 2O8VA 3AKEA 3FTCA 4PF1A 1WCIA 2FB5A 2R8OA 3GFVA 2G4VA 4H15A 2X0LA 3RU2A 3KSMA 3PXXA 4B6PA 4HGZA 1JFFB 3GLGA 3CX5F 5ALQA 4LJKA 1D4OA 2P30A 2P3OA 3DTYA 4M8LA 4O4IF 1TTTA 3IV9A 4X7PA 4F4LA 5DIZA 2V5AA 2VNIA 1AO3A 1KVRA 3I0ZA 5CLQA 2GJKA 4UUAA 1OBHA 1THMA 1S0UA 3V9AA 7REQB 3G5TA 1GKLA 2QP3A 3L4SO 1PT6A 2C3OA 1CE8A 4GLOA 3RG8A 4KYIB 1QU2A 2DWEC 4NBVA 4YQEA 3EXIA 5JYDA 4IILA 1NDQA 2IYLD 1QF9A 4UPDA 5K3AA 1OU0A 1UDRA 3DBLA 3U5TA 1UT8A 2CFSA 3EH1A 1L5KA 4YHHB 1AS2A 2PSSA 1GTSA 2HNBA 3D4BA 3EG9A 4I2VA 5BR7A 1RJFA 4O4LA 1JX9A 1PWYE 1V16A 3NEYA 2HK9A 1BEEA 1TU0A 4JTDB 3MCZA 3J81N 2DM6A 4JIGA 2BTEA 3Q9UA 3GT0A 3RAFC 5TPWA 5HFNA 5TJHA 1VE1A 2QKAA 2PF4E 1KEWA 1WBJB 1CERA 3W06A 1FKAO 1SZCA 1HY3A 1VQ1A 1AMUA 1JB9A 1SD1A 1ND5A 3D3QA 1B16A 1N5DA 2WNIA 4H7EA 4KQGA 1S8OA 1KS9A 4V0MA 4BVEA 1H6DA 3OTOO 3NNNA 3BK7A 1VQ7V 3P0JA 4UNNA 4XFDA 3UBMA 1LV7A 3UTDA 2C7PA 1KDYA 2QK4A 3E0QA 3AF5A 2DUJA 2Z2JA 3K1AA 2C59A 4LK3A 3UHFA 1QRDA 1U99A 3FCOA 3CCQV 1Z39A 2MU1A 1GDHA 5KYYB 5F9FA 1CQIB 1GADO 1QFXA 1Y8QA 2WYVA 3IGFA 3KB8A 4FKBA 1F0KA 2XCIA 1S4MA 2QX6A 1LLDA 2BCEA 4HBNA 4K9NA 4L4YA 5BN4B 4DSOA 3PDCA 2PJUA 5AVKA 5EXPA 1MC5A 2L69A 3TL3A 2GASA 2NQTA 4BTVA 4GR9A 4F2GA 3WR5A 4ARIA 2EVWX 4YIOA 1VHJA 4IJ6A 4JNKA 2ADMA 2Q4RA 4HQKA 1W34A 1A8PA 4ZT3A 4UMFA 4WEQA 4EL0A 1YTLA 4K28A 3PA6A 1GTL1 1I5EA 4DR1O 1S96A 2LE0A 1YFZA 2AG8A 2R7NA 1N0VC 4FP9A 2H18A 1PD3A 1GG8A 3NLLA 4HGRA 4TSFA 5D2CA 4MS3B 3CZCA 3K5OA 4EUHA 1OAKA 1TK3A 3V32A 1UPCA 5K3DA 3THRA 3VO1A 2BMVA 1IE3A 4EIWA 5L51A 4Z4IA 4YAOA 2YVUA 4MV0A 1M3SA 4MUBA 4JZKA 2X2PA 1PWEA 2M1XA 3BERA 1Y66A 3F5WC 1RZ3A 5FPPA 3QVGA 2YVKA 2IZOA 3V6MA 5I4IA 4N76A 3ANXA 1M2WA 1M6HA 3V4SA 2IS2A 3ASNB 3RJMA 2O1SA 3PD1A 3QLJA 3EQ6A 3WYGA 3KCQA 4BLTA 2E1PA 5HXAA 1NC1A 1N7JA 4TTIA 4TTJA 1IHXA 1PFKA 2RGGA 3VC2A 4D7AA 1B23P 1UK7A 3C7DB 1GNPA 2A78A 2QM4A 1VCOA 2ZR0A 4R8RA 3D36A 5EMMA 1M34B 1M1XB 2HIAA 3KM0A 4OG2A 4X00A 3RS3A 1D1SA 2AMVA 4RO0A 1JR2A 1YTFD 1Z0UA 2H5JA 4LX8A 3VKVA 4EY6A 2W0SA 2W6QA 1HNWO 5KVSA 1UDCA 4JR0A 4B34A 1YKGA 4GLLA 5LP6F 1ICEA 3QYFA 2ZQMA 5BSRA 3KWMA 4HX5A 1BGXT 1EDBA 1L7NA 1NZJA 1YS1X 2PD6A 4R1TA 4ZWNA 3KQNA 2EKPA 1K0UA 3BCCH 3ND8A 4HX9A 2FGJA 2C61A 3RQSA 1NGSA 1YL6A 4NBSA 4RLQA 4QXOA 1G6Q1 1ESMA 2FEMA 3GPCA 3G8YA 3PCRB 4D99A 3AERA 4ZGBA 4WD3A 3UUEA 1A77A 2ZVQX 3UWOA 1W0KA 5ALRA 3ODGA 1TM5E 1R6KA 4MB0A 5HPYB 3ROTA 1YA8A 2E9SA 4KP7A 1RPAA 1PJ4A 1BMDA 4MR8B 4CM9A 2ZT5A 1XLVA 3I73A 4L3WA 4N6GA 3J81A 4XWTA 4BO8A 4IDHA 4WFFA 3EODA 3NBYC 4HEHA 1KWGA 1JIIA 5FAXA 3SMVA 4RCYA 1ZA2A 2PYJA 3TPFA 1FMCA 2OHHA 4CIDA 1SOVA 2HCFA 2D2CB 2X8AA 3ADCA 1XAIA 1D2HA 2CK3A 1MQSA 4BKPA 3LIPA 3QWHA 4YRQA 5EQDA 5LA6B 4U2EA 2AEEA 3U9LA 3P2KA 2PT6A 1EFAA 1TQ4A 1TT5B 3GG2A 4Q18A 3CU5A 2WIJA 2OPHA 4RORA 1G9SA 4FDVA 1E7RA 1BDJA 4P3PA 2V45A 4REOA 3VR6D 2YS7A 3GCZA 3TSCA 1I24A 2VDLB 2VHYA 1V7CA 1VKNA 4FNOA 2R6GA 3TZQA 4CT0A 3KZIZ 3KOOA 1Z5PA 1RZVA 4U8HA 4J9YB 1J9ZA 1ID1A 2CGEA 1RE1A 2BPOA 2XITA 3F4KA 4JL6A 1B8NA 1ZSYA 3U10A 2B4YA 3BB4A 5E0OA 2AN5A 3ILVA 3ORRA 3T5TA 4XM1A 2CNBA 2IJIA 2D74A 1DQPA 4ZQCB 5J3JA 1UANA 4TV8F 3MHHC 4Q1VA 4RELA 2V65A 4YWHA 3RAJA 1CVRA 2CSUA 1PIWA 4WFIA 1OAAA 1E5QA 3VV2A 5A9RA 3IUNA 4OK5A 2WWXA 4V3CA 3WK7A 4RCZA 2BOBC 1CRPA 1EAYA 1QR6A 4UAVA 4QM6A 1VBMA 4TKVA 1SUFA 1GU1A 3AUAA 3NZEA 4EH1A 3GDGA 4PZPA 1P2DA 1TYDE 4L8FA 1SBTA 2CXOA 4ND2A 3NAZA 3HKCB 2WFAA 3SR3A 2H16A 3AEZA 5AKZA 1E9EA 4MR7B 1Z2GA 3DE2X 3ZTWA 1K89A 2KLHA 1B0AA 3EJ6A 2G04A 1TZCA 2FU5C 3BF7A 3OA0A 4MCHA 4AJNA 2AW9A 5HIKA 1RM3A 4V2IA 1CZNA 3VO9A 4DLWA 3VYRB 3RYIB 4DXAA 1TJPB 2R11A 5A5DA 3U7QA 1ZXBA 4CM3A 4MOWA 2XTMA 1SJ9A 2JIZD 5DBHX 1R6VA 3CVOA 3D6AA 4ZFNA 2A92A 1FTSA 2D0OB 1Q3KA 2JFUA 5FTKA 2FMHA 1NXXA 1X74A 1I6WA 4GSLA 1GN8A 3AUJB 3GVIA 2G82A 3ND5A 3OJWA 5DH9A 2JHGA 3VDNB 3L0OA 4MICA 4PTZA 1RWKA 2H57A 5BP7A 1U7TA 1RAIA 3CMMA 4LHEA 1CZKA 5DCYA 5JSYA 1R50A 1BDHA 3KHSA 2YDEA 4KWIA 3SFZA 1EESA 1YS4A 3S2EA 1N7GA 5J2UB 5IM4A 2PYIA 2KQUA 2OBBA 3EG9B 3UMCA 1KJYA 4BO1A 3R5TA 2YIBD 3HK2A 1BVYF 2VHCA 1LK7A 2VQ6A 4G65A 2I76A 5DW0A 4FMCB 3RLIA 1UJ2A 4Q15A 3BMQA 2WYWA 3OM0A 2KW5A 5EUCA 1K0FA 1I3LA 5T8KA 5I6DA 4J1NA 2EF1A 1CHNA 4AS2A 4BLUA 1PFQA 2YQ4A 3EMVA 3TLMA 1QFJA 3HS3A 1IB6A 1QHIA 4OIFA 1KZ6A 3NOOA 5A4IS 3ZE2B 1LW7A 2QXUA 3RVZA 1PZEA 2CKDA 2FGKA 3FYUC 1E79A 2VUSA 4OHRA 1V55B 1BC5A 1TA9A 2BMDA 4I5GA 5C1IA 2V5VA 1C9KA 3VMFA 4TZ6A 1N2EA 1NRIA 3PUKA 5CR9A 2DPYA 2JFQA 1CUYA 2EW2A 2JFFA 3VNUA 1Y5IA 4JI4B 1X4TA 1DHTA 2B4QA 1OXBB 2O2DA 4JVMA 2CFRA 3WMWA 2GWRA 5C5EA 1SCBA 4G67A 1CUDA 4KGXA 4PCVA 3UT6A 1CULC 1HE1C 4EP1A 4I5FA 3TVTA 1QLJA 1XCLA 1OGYA 5EJAA 1DEKA 2H1SA 2WYOA 1BS3A 1UBOS 5DU2A 4KKVA 1HMYA 1T2NA 1UEIA 4W5RA 5AOCA 2V1UA 5JCOA 1YZKA 4B3JA 2WZDA 1WA5A 2UXBB 1KC1A 1NJFA 4FJ2A 1UZMA 4V02A 4EPRA 4WK4B 3ORQA 3H2JA 2HH9A 2FR1A 1TCCA 4I5DA 1Q0LA 3NBFA 4WGFA 4WFBV 2XKKA 4OGFA 1OIXA 1Z35A 4ZJPA 4AKHA 1NSTA 3TEJA 1JXQA 1GO2A 2XQFA 5EEHA 1MFZA 4MYUA 5AHWA 5F23A 3SPXA 5JNUA 1G8JA 3MNFA 4LY9A 3IA2A 3NC0C 3BC1A 3LDHA 3MAAC 4EHKA 2QV7A 3QK7A 1V1JA 2CTRA 2IYRA 3U4DA 4HCJA 2AV6A 2CDCA 2EJTA 5F2OA 3SYRA 4Z9FA 3JU3A 4S12A 3ZXXA 1ZH2A 4IGKA 1L4LA 4Q3AA 4N18A 3T9BA 5HJ7A 1LRLA 5JCXA 1N2JA 2QRPA 3GLIA 3K4HA 1ONOA 5FOXA 5KSWB 4OLAA 1FX1A 2B7LA 4A9AA 4B0PA 3PJSK 3WLHA 4J8PA 3ZIAG 1LNZA 3F90A 3U7FB 3UB3A 5KMGA 3BDIA 1CY6A 4AKSA 3E8SA 1HYEA 1SHTX 1WP9A 2O2JA 2DTXA 4YMUA 1GN3A 1TDJA 1E63A 4W1RA 3T4EA 1SKMA 4MUYA 4HJRA 1JXAA 3TTXA 3MUNA 3OFVA 1ONSA 4N3GA 4WGGA 3BFRA 2C2ZA 2R1VA 3QXSA 4TWIA 4D0NA 2HKIA 4COOA 4W9MC 4E4EA 4PX9A 1KFCB 1U8EA 2JCSA 3ML1A 2FY8A 2CMHA 4TWAA 1IUPA 1DAOA 1UBJS 2FOXA 4BVJA 3LXXA 2NZWA 3SDZA 1QQBA 2JL1A 4R3UC 4RDCA 3C8HA 4GXQA 4LC9A 1XILA 2WPDG 4JT2A 3DCJA 1CQZA 3NASA 4K6MA 4DYDA 3G6EV 2ON6A 3WFJA 1GKIA 2C9CA 4QU9A 5CDUA 3HVKA 3I04M 1N2CB 3TK1A 1GG2A 1L4FA 2YBDA 4UM5A 4YR7A 3BE5A 5GADl 3BUSA 3F5FA 4PLHA 3ASNC 1YI0A 5L6LB 3P1JA 4HLNA 2ZAIA 2EW8A 3ZDAA 4AULA 2R79A 4RVNA 2Y1FA 3R5KA 4AXBA 4GI2A 1ZRSA 2C57A 1EX7A 4D9GA 4LE0A 1E94E 4G97A 4Z2AA 4P82A 1EM8B 3SJBA 4GE0A 1UFQA 4U2BA 2GEJA 4W63A 4DC9A 3O8CA 2XAFA 1KNQA 1HDOA 2A5JA 4KNVA 1F2UB 4K3AA 5FL7G 1XXHB 2WG2A 3CR8A 3B1YA 3NKLA 3OJCA 5K20A 1C0IA 4XX0A 4RYDA 2ZI4A 4R2JA 2CN1A 3H1KH 1T4GA 3RGGA 5LWHA 3LC0A 4RFLA 3LNTA 4A1OA 4PDLA 3NHLA 3ZCVA 2E3JA 5IZCC 5KJ1A 2FUG1 1KH1A 5J1SB 5KHIA 3LC2O 5BYAA 4OI1A 2V7TA 3D3NA 4RHUA 5H9CA 1GAQA 3CR7A 3F98A 3S3WA 1X19A 2OCLA 2D5IA 1USWA 2X2OA 3CWQA 4F7WA 4V0OA 4IGGA 4YEDA 1EK2A 2LP4Y 5D3MB 4Y67A 4L4SA 2QDOA 2FRDA 5A4DA 5H2FZ 3OCZA 1F8FA 4RGYA 1W4AA 2OPBA 3U1TA 3UHOA 3ZD6A 5F2NA 5CB8A 1BWPA 2NXNA 3ZD8A 3NHUA 1ZC4A 3T1HO 4ND7A 2CXNA 4IEFB 3EIXA 3IOYA 3R4VA 4EYGA 2KB1A 5FPOA 3OCYA 3C3EA 1OTYA 2FFAA 1I30A 1K1EA 5KKCA 1SS3A 1ESDA 5B1HA 5CFMA 4JZ2A 3LVBA 1ECCA 1Y9DA 4ZU6X 1WZEA 1GWNA 3V9PA 1VIBA 4NQRA 3KD3A 2JGLA 3H86A 3DDHA 2ZCEA 4ZZIA 1SH7A 5F7ZA 2G5CA 3CEJA 1JDUA 1OXVA 3OEHD 2VJOA 3SICE 2IU4A 1UQUA 4G89A 3P97A 4TV9A 1XD2B 4YCBA 5K0LA 2MTBA 5CBHA 3AU9A 2Z1NA 1G7RA 4LYDA 4YUAA 4I9WA 1DNPA 4MB6A 1WEKA 3TQHA 3L0PA 3TVDA 3G5LA 3ENWA 3C39A 4EFBA 1S2OA 3QVGB 2GTHA 3N8KA 4DR5B 1O57A 1OJ7A 1Y3DE 3BSSA 3DWEX 3OZCA 3WIOA 2ZU0C 1ZM2A 3Q8KA 1OF1A 5FXMA 3R8FA 1WXHA 5U4XA 1CG6A 1T6ZA 3TR5A 2UDPA 1BXKA 2I9PA 2ZS8A 4F93B 4O4LB 1BQEA 1ZGCA 1Y74B 2FVXA 2Z2XA 4KDEA 4R16A 5ER9A 3RJ5A 3VZCA 4OX9Y 4NV1A 2IYZA 3FAZA 1EHCA 4WCFB 4V1CB 4YRAA 3MXTA 1EUYA 4WN3A 1GZ4A 3FZYA 3IAAA 2GLUA 4LSWA 1ID8A 5JJJB 4JV5B 2W0MA 1Z2OX 2WJHA 2WUDA 2FAXA 3IDQA 1NKVA 1ODTC 4W8HA 3PDUA 4BNFA 3EXEA 3SHWA 4I4TA 1KYXA 1S3GA 1UM9B 2VF7A 3GD5A 2VDKB 3KJNA 4PLYA 4HPXB 4LZAA 1FOEB 3SP1A 1J4AA 4K05A 3RJ9A 3ZE1B 5B4VA 1ISJA 3CCBA 1HFEL 1P5JA 4TS1A 1ZJJA 4WFQA 3RFTA 1Q7EA 1WRBA 2G63A 2ZRIA 1I4TD 4PLGA 5AM4A 3TRIA 2WHRA 3WRWA 3C3KA 2F93B 3M99B 2BT4A 4IDEA 4D6TH 1OZGA 2C0CA 3M1IA 5ANRB 6REQB 2PXCA 3OPVA 5KCMA 5KOHB 2WJZB 3CT4A 5EGSA 2ZKLA 1EFPB 1H2GA 1I1OA 3V48A 5CB0A 2AJBA 4EM6A 1YZNA 2WA2A 1IURA 3VAYA 1D2RA 1Z45A 3CNLA 1VL2A 1MP0A 2Q68A 3NC1C 3DPSA 4QO8A 4ZEMA 3GEHA 3TJTA 2VDRB 2XH8A 2PGOA 2ZRNA 5LQCA 4KPYA 1YE3A 2C2WA 4BNGA 5BOSB 1R1DA 1C30A 1PR0A 1ZC3A 3DF7A 4Z1MD 4E6PA 4LSGA 1PN3A 2ETXA 2H4HA 2LIPA 4D2IA 5D3QA 3IBGA 2JLUA 3O4IA 4MB2A 3R24A 4P08A 2IUYA 5LP1A 2ZBRA 4S3MA 3ZJ4A 5C80A 3KJIA 4BR6A 3R7DA 3B1FA 2ZE8A 1U28A 2VP3A 5AKYA 2W6MA 2ZTSA 3R5SA 3JAWA 3LSQA 1AX9A 3GNTA 3ML0A 3ESAA 1P7WA 2JS7A 5EQJB 2P9YA 4CLHA 1YR6A 3E4CA 3B1VA 3TI7A 1T9GS 4F97A 1X7WA 3TXYA 1PFWA 3F5QA 3JQDA 4HK4A 2ZPUA 3BL6A 3AVUA 1RQ7A 2XB6A 1RQLA 4AECA 3FPFA 1PQYA 4GZMA 4C22A 1HX7A 3BJMA 3DWGA 3P4UA 2CMDA 4FDTA 1SERA 4HDRB 2JAWA 1Z2AA 3ZUGA 2QX8A 3F74A 4UAJA 1FRVA 4R68A 4KRGA 3SMQA 3KE9A 1YHNA 4C4RA 3WAGA 3R3XA 5JZ9A 5AK0A 2DYRC 2ZPAA 4GOLD 4MS3A 5LWQA 1JX6A 1HEYA 4L51A 2IWHA 1T8PA 2FSIA 4X0EA 3OFND 2CJYA 9ABPA 4JOBA 4IXWA 1JFSA 1PL0A 4N12A 1PLKA 3K31A 1XJWA 3I0MA 5AIAA 2PZEA 3TFOA 3EEOA 2CTWA 4G24A 2C92A 2XDWA 3T7IA 4MPTA 6PFKA 2WWTA 7ADHA 3RSGA 1XDSA 5LZ9A 5IN4A 1CFZA 3DH0A 2Z3VA 5BYBA 4EARA 1XHZA 1EUDA 2GZMA 3UKDA 2C4MA 2ZUUA 3GRZA 2O8EA 5BNWA 3AJAA 1YCDA 3AP2A 2NXWA 1R00A 2C3UA 3AHCA 1QG4A 2CJFA 1SOUA 4TM8A 4L8JA 3G80A 5AM0A 4A0HA 1U0JA 4LRSB 1KR2A 4B45A 5LSAA 5GIPE 2NU8A 3DEKA 3PE3A 4IDNA 4MWOA 2JCBA 3ETGA 5IJ9B 2VT7A 2BC9A 1KRWA 3ACDA 3MBOA 4YUXA 1N75A 4HNSA 5I7FA 1COWA 1QCCA 1SIWA 3WZ2A 2A58A 1ZYUA 2OIGA 3BK1A 1E0KA 2ONCA 3OU6A 1G42A 3QFCA 3V8NA 4E5VA 1AGXA 2BWJA 4JDPA 3FB7C 5CMLA 1COWG 4QEKA 3U11A 1UIRA 1VA4A 2CUZA 2GHQA 2JIOA 3OT1B 4NBWA 4CMHA 2CHEA 3TF5A 1EWQA 1EE9A 4R1NA 5BRJA 5IVKA 2SBTA 3OTHA 2HNKA 5JNLA 3PT9A 5BWNA 1UDXA 2Z8ZA 2C8VA 1MW9X 1ZH6A 3CX7A 1SMKA 1YAHA 3I37X 4FYIA 2VAMA 3ZXUB 2FLVA 4G9EA 4I46A 4O1MA 4X24A 5FWYA 3CNBA 5HWSA 2WTNA 4CM8A 4XWWA 2UVPA 5MN6A 3A1DA 2Q1YA 3C3DA 4MVUA 2QYSA 4DV6O 1EDOA 1M10A 1T43A 3GCXA 4MPDA 2SECE 4RK7A 2VH5R 3GZJA 2E18A 4IR7A 5D7NA 3L1UA 3NHZA 4XLLA 3GMTA 3DB2A 4FCCA 1PNLA 2EHDA 3WYEA 4W9NC 3AVQA 1IQUA 1A9RA 3KX2A 4JQYA 1IN8A 4JAAA 1T0JB 2DQSA 1LKZA 2OZPA 1PWZA 2R4QA 2XMSA 3IKJA 5CXSA 5HP4A 2RN9A 1JAZA 3HZHA 4H7IA 5L45A 3HO8A 2ZM5A 2D7JA 2WZQA 2EBHX 4FDUA 4Y6OA 4AJ1A 4H6PA 1QH1A 3T99A 2DWDC 3E9NA 3FHTA 1RYYA 1D9XA 2QZJA 1NATA 1G19A 3NV7A 2DXIA 4ZMBA 3TCKA 4ZVPA 1B15A 1GN2A 3KR0A 5ALMA 2IU0A 1J33A 2WFLA 2Q5LA 3AK3A 4MVJD 1RHMA 1VSQA 4IHAA 3PUWA 4RFVA 1KI3A 3LNNA 1J7JA 1FDOA 4YMWA 2BEJA 3ZJ5A 4JXXA 4L6IA 2YHUA 4QECA 4R1LA 2XUMA 5FR1A 1PYOA 3OGIB 3K0CC 2XR1A 4MVRA 5E7MA 1USIA 2DP4E 2RH5A 1LK5A 1U1CA 3OPYA 2CSXA 3GOHA 4NRDA 4E51A 1XWFA 1P77A 2WKPA 2PGLA 1RMQA 2CXQA 3OOHA 3G8BA 1PHPA 1KI4A 4K1LA 4BBZA 4KHPB 1FFYA 1KQSU 4F5WA 3QPBA 3BEHA 2QTVB 3M6LA 3E8HA 1XYYA 3H4VA 1ORVA 1NP3A 5DRTA 5GTHZ 1MXFA 2Q6IA 3W8FA 2ZYAA 5JBNA 3EW9A 3MJHA 4FGKA 4MQ5A 4R31A 4DCNA 4LDRA 3PRYA 3CLRC 2MMCA 3E4DA 1E5LA 3HP4A 4OXYA 5AHXA 4IEEA 3CC4V 3IEMA 4BRZA 4X8AA 1N36B 2HG5C 1HR0O 5IXJA 4MUKA 4IIVA 4BLVA 3QNEA 2M32A 1NXPA 4HDKB 2ZULA 4MW5A 4O29A 4A3SA 4EFKA 2IU3A 3DWIA 4P54A 4XGRA 2H85A 1JHVA 4YYEA 1AKMA 1DG9A 1RWPA 4INPA 4MI6A 3VQTA 4IIJA 2I80A 3FN4A 4RVHA 1BU8A 3ITKA 5JJLA 3VR2D 1IK6A 1XMXA 5LOVF 4HB4A 3NO4A 2GM3A 1Z28A 4MINA 4RY8A 4IUCS 4Q1EA 1WDWB 3TLCA 2JDIG 4ZOCA 2JCGA 2OAQ1 1GAJA 2PZLA 2VSXA 3GAFA 5ESDA 4EO7A 1T9ZA 3M49A 4GP6A