5D5QA

Hcgb from methanocaldococcus jannaschii with the pyridinol derived from fegp cofactor of [fe]-hydrogenase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
VMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0488, Guanylyltransferase
publication title Towards artificial methanogenesis: biosynthesis of the [Fe]-hydrogenase cofactor and characterization of the semi-synthetic hydrogenase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 51
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5d5qA01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 5d5qA02
3WB0A 1EGMB 4DK1A 5JJNB 1UC4B 3LNNA 3WB2A 2F1MA 2F95B 3BRCA 5D5PA 3WB1A 1EGVB 5D5QA 5JJEB 1MMFB 4L8JA 1IWBB 3AUJB 2V4DA 1VF7A 1DIOB 4GYCB 2D0OB 4DK0A 1H2SB 5JJJB 1RSOA 1EEXB 1T5EA 1UC5B 2D0PB 1IWPB 1NBWB 2F93B
chains in the Genus database with same CATH superfamily
4ML3A 2GESA 4HKTA 1C14A 5HCNA 2WAMA 5K3FA 1OR8A 4MICA 3RV4A 1KKUA 1YF3A 3A05A 3JQ7A 2VLIA 1F4MA 3DH0A 4JJGA 3N2IA 2Y1LA 3P0JA 4C0BA 4R7ZA 1JI3A 2GAAA 2XV1A 2J59A 1E1QG 3S55A 3O93A 3IMGA 4TX1A 4KE9A 1U0GA 2OCCB 2IVFA 2HHAA 4XX0A 3X2EA 2QP3A 3Q5GA 4PA9A 4P9PA 4YJ3A 2KMLA 4DQ0A 2Q3MA 3DC5A 3BWBA 3I45A 4BNNA 2JD1A 1SXPA 1DDIA 1JKMA 1R0XA 3VX4A 3F2VA 1MOSA 3WNBA 2VPZA 2ZI7A 5LMCA 2YXBA 1GRNA 3MS2A 2HR3A 4XWGA 3RRJA 3OQIA 2ZWVA 3CVXA 4HNAB 4A73A 3C41J 3FVQA 1JLSA 1SVIA 1EESA 2J3EA 1JQLB 4HJXA 2KW5A 4UOEA 1CUSA 4AZ3B 3IP6A 3TIFA 4AT1A 4QOJA 1GZUA 3LSUA 3ZWOA 1FSSA 2G1PA 1AV7A 4OM8A 1HYQA 4KIUA 3C7TA 1KMIY 4DJTA 1ZN7A 2ZI3A 3A2NA 3B2QA 4GUDA 1EWYA 4J0JA 3WMEA 3N75A 3N2KA 1EWVA 3AR7A 3C1TA 3OQPA 3OWHA 1DQZA 1GGHA 3OR7C 4J7CA 3G5MA 3WNVA 4D4LA 1RXCA 5GOZA 4LRUA 5JYBA 3IAHA 3IA2A 3IMKA 3MVEA 1U8ZA 3LXRA 4EI8A 5BSKA 1N0VC 4DIFA 4Q48A 4M0MA 4AI6A 4F0JA 1BXGB 5EVJA 1PGNA 1M6HA 2AN1A 3GMSA 4QE9A 3EY4A 3LUAA 3M49A 3HB0A 4LNAA 3DCIA 2K1EA 1A9RA 1ORRA 2HSWA 1Z28A 4IJUA 1VB5A 2BKVA 2YBDA 2ZYHA 1QOPB 3UHFA 4YCAA 4KQJA 3ZXSA 1FFCA 3DZIA 3EOZA 4WOCA 2PU7A 4RTKA 1LFAA 1E6KA 4UPEA 3GH1A 4UHFA 1GSIA 1C9KA 1JMKC 3LDGA 4N18A 3PDUA 4QGAA 4QC2A 2ZIWB 4IICA 2Z30A 3PLAE 1X8LA 1T8RA 4GQAA 1P5HA 4KL1A 5BW4A 4ZZIA 4X44A 2OCAA 5EJ8A 2VOEA 4QDTA 3G2MA 1CUDA 1M57B 4X1IA 4HDMA 3FOAA 5ALTA 4B09A 4II7A 2A1IA 1OJLA 3KXIA 2XQJA 4BN5A 3GJ5A 2CXPA 1F6BA 1P3Y1 3ZCTA 3L18A 5FV7A 1ZD1A 2E89A 7GPBA 1H4SA 1OCRB 4QM7A 4FUQA 2LDBA 3EDMA 4K8OA 3D0RA 5P8WA 2VLBA 1MJFA 5KOHB 1O94C 1TB4A 5LGTA 2ST1A 2RHTA 4EFKA 2QX8A 2PGOA 2Q45A 1U3UA 4NV3A 2AJLI 2NG1A 1G38A 2GI4A 4U4AA 4PTLA 2C2AA 1X87A 3KAJA 2X5OA 3QLEA 1B0PA 2QPTA 4Z1MD 4I6EA 1WMBA 5BN5A 1TLLA 4IQFA 2ZXUA 3OLYA 3TIIA 4MYCA 1RM5A 3OMLA 4TTVA 1PK9A 5EINA 1P81A 3VYTB 5FFFA 1BRMA 1AQNA 3STHA 1ZCFA 5ALFA 3JALB 1SS3A 2Z5GA 2MW2B 4ALIA 4Z9XA 4E5MA 5HF6A 1JS1X 1EFTA 4FE7A 4UXHA 1K88A 4GKVA 1U5BA 3WXMA 4TS9A 1R0CA 2OM2A 2UUBB 1RWXA 1SMKA 5B3SB 4AMVA 2AFHA 1IAQA 2EZOA 2KJQA 2AB0A 2FA9A 3G23A 5LUBA 2GXQA 1M4UA 4FX5A 3T7AA 2A79B 3HCFA 5EESA 1ZXLA 1U94A 3SIXA 2XQGA 3KRTA 1IHDA 4KHZA 4TL9A 2GJ8A 1LNSA 3KZMA 3KOZA 3NHSA 5I7HA 4URZR 2IJKA 4ZMSA 4HB0A 1IZ3A 5KQSA 5A3SA 1XUOA 4YMUA 3IKTA 2JLAA 3EGXB 1XA0A 1IZ0A 2GS9A 4HLUC 4DSAA 4M1YA 4Q93A 4V1CI 3HVIA 4BYGA 1E6EA 4BNMA 3JZFA 1F3LA 3FBTA 1JXOA 4LBZA 4RPCA 2V1XA 4X20A 4D41A 1Z17A 2YN0A 2WIKA 3OCUA 4EG5A 2KSQA 2R79A 2O6HA 4ZQCB 4EFMA 1JQAA 1UKBA 4E5YA 1DSSG 1GZ4A 3TLXA 1FP1D 5H59A 3AEIA 3WKCA 2IU3A 1DKQA 2QTZA 3CU5A 4YR7A 1D2RA 1SGWA 1TUGA 5EA2A 2FN4A 4HFMA 2QMZA 2IWRA 5F7JA 5D6NA 2HKIA 2M9MA 1T1RA 3Q72A 4EGCB 2IX9A 5A2GA 4WXPA 3KZIZ 3WYEA 2C3OA 2EINB 2RGYA 1EUDA 5KQLA 4IZHA 4ND3A 1YA8A 3TUIC 4OL9A 4B2PA 1LRJA 3WYBA 3Q7RA 1M8JA 3ZGVA 4NEHB 2JAUA 3TGPA 4EHBA 2IBMA 1MNAA 3BFJA 3ZRSA 3F5SA 4RVHA 2CJWA 1J5PA 2VUUA 2VSFA 2YICA 2BDUA 1K7SN 3NKLA 3DE6X 2QE7A 3GFQA 2VNKA 1BKDR 1TF7A 2B20A 1CJMA 4C3UA 3E48A 2JI8A 3OU7A 2I55A 1RWMA 3JZDA 4IHJA 3NWBA 4WADA 4ZTUB 3ISTA 1U3FA 1MB2A 1ZKMA 1CBUA 4TMTA 1ORQC 5I01A 3EDCA 1V41E 1T5EA 4AY3A 4RCZA 4WMLA 1U2ZA 1H1DA 1P31A 2J0SA 3G6BA 4BCBA 5FL7D 4I46A 3MPOA 3FLEA 1LJLA 3MAAC 2DYRC 4DXAA 2DUNA 2ZW9A 2XWBF 4YS6A 3EFHA 1GUYA 1NUUA 4Z2AA 5DGDA 5TGTA 1V3QE 1BGWA 2FZWA 3OOEA 2FMKA 4JOQA 2OD9A 3A1VA 2YXEA 1Q57A 4GOLD 2V97A 3CF6R 1VMEA 2A58A 3U44A 4DG5A 1FMTA 3KSMA 3NVMB 4CL8A 4IDCA 3K0KA 1UP7A 3D8CA 3OJLA 1IRXA 2QGFA 2JJ2D 3VZBA 4LYEA 2VK2A 3HEMA 4CU2A 1C2YA 3HB4X 3P4XA 1EK1A 3R7LA 1A71A 2WG2A 1GOTA 2JVDA 5FBQB 5JS1A 1RWNA 3OICA 2DMXA 1G3UA 2KG7B 3F49S 1V5GA 5GIOE 4FXPA 2I7CA 2JBAA 3IKJA 2FSIA 3H9GA 5H0IA 2O2HA 1BRTA 2WMYA 1DAEA 1TMYA 3TD6A 2BRUC 5H81A 2JCYA 5FHQA 4OAOA 1U2RA 5E6SB 5KBYA 4QG7A 4JJAA 1URPA 4FS8A 2IITA 4G8JA 1ZI8A 3HKCA 4CC5A 4KXNA 5JEDA 1FP4A 3H8WA 1U7UA 1XLTA 1IPEA 3PYXA 2CV0A 5LZ4A 4EP1A 4LIPD 1BD3A 1X3SA 4BVLA 4WINA 5KPDA 1RSZA 3ABSB 1Z63A 3IEXA 4RVCA 5KWEA 5FUXA 1EVYA 2VN8A 4IDGA 3FROA 3L84A 4Y2UA 1DOHA 1YT5A 2JJ8A 1G291 2VZEA 1YS2X 1HURA 3PRKE 5H80A 4WFEA 4G0VA 5F1OA 1CF9A 4Q4JA 1E18A 2IYZA 5DBEX 3O03A 3PK0A 3KQUA 2QLLA 4XGNA 3APQA 2J4DA 3PHIA 1T8PA 3FTEA 4K6CA 3C43A 2A9PA 2KHZA 4QEKA 3DDNA 1LK7A 3W2IA 4UTZA 2E5LB 5DYWA 5FPTA 3GP8A 4ARCA 2YS7A 1JA9A 1MAUA 2V6JA 3ABRB 2CXUA 1LI4A 2NVUA 3LYHA 3NYIA 1PJCA 2PKRA 2IELA 2A3QA 2WA1A 5DOZA 4HVCA 2PMDA 1E6CA 4IJQA 3GT4A 2HMTA 3VTAA 3P9KA 3CW2A 2EX1A 1BXRA 1X1SA 1IUPA 3K04A 2RI0A 2YSUB 3L0DA 5EZ6B 2H9IA 4OG2A 4HRAA 4B3SO 3EC1A 3VR4A 4IXNA 4BPBA 3RAPR 3CLSD 4N54A 1P1RA 1GARA 1NOIA 3NT5A 3DZBA 5KTMA 5BWMA 2CT8A 5CFQA 3ZHYA 3U7HB 1OSNA 3S3TA 3T0GA 3DL4A 2UU9O 1IG3A 4UEWA 2X3UA 4IFEA 3R4VA 4MPJA 2O2IA 2NX2A 4LFAO 2YQZA 1G5HA 3VU0A 4FK8A 3OE7D 1QG4A 2YFHA 3F5DA 1MU0A 3A6GA 4M8SA 2DWEC 4EHHA 4HNGA 4IJVA 4E4TA 1RRGA 4MP6A 1Z7YA 4BHTA 5JPIA 2WZBA 5EFZA 3HL4A 5C7OO 4QOHA 4DNQA 5IC4A 3I8XA 1Q1BA 2R8XA 1TQ4A 3OESA 5I8ZA 3ZQUA 1CJUC 3IJRA 2GTSA 2L69A 3WYGA 3DCNA 3OFVA 4PFQA 2YH2A 4MR7B 4TRRA 4NVPA 4FYPA 4H7KA 4YUVA 1W19A 2PJRA 5KYXA 2XUAA 3IH5A 1JJ2U 4CT0A 4Y2HA 1V47A 1YDGA 2LGQA 4LF6O 3IQEA 3UWPA 1N36B 4DL9A 1WE2A 4EUEA 4OV6B 2R3SA 1TVCA 2JHGA 1SQ0A 1BFUA 1K06A 4V24A 5K4HA 4BIIA 5JAUA 1V39A 3SEAA 2ZQYA 4W5OA 2Q0SA 3LDUA 4DJFC 3MGCA 5U4QA 1FTNA 1HKHA 3DYVA 2IP2A 3TOZA 3KJQA 4R0VA 5AK0A 4WLUA 2VAWA 4U2GA 2O3RA 5LKRA 4ROSA 1MXFA 1V4BA 4RHYA 3E58A 4EG0A 2WLIA 2JH3A 3P9IA 3P96A 1NGSA 2A3RA 3SK0A 1JQDA 4LJ5A 3L9DA 1Z34A 1PFUA 4NAHA 2JJQA 1WLSA 1UXIA 4G86A 2YWEA 3VOTA 4RTJA 3L9XA 1YVRA 1DHRA 1YK0A 3VTKA 5ALHA 1DAHA 3KXLA 2X8WA 3ZU5A 4DLUA 4BLRA 3Q9UA 2CAZC 1YDFA 1TCBA 1NPYA 1OREA 1K86A 2RI6A 1PL0A 3O2NA 1W88B 3OIDA 4Q1VA 5AKEA 4BDSA 5TQ0A 5CFRA 4FM0A 3T9AA 5CCXA 4N3NA 1JR3E 4WOPA 2RGBA 5DX0A 1GPKA 1B41A 3O9MA 2UUCO 3O73A 4F3TA 4A0SA 2G8NA 5F21A 4QELA 2IV2X 2P4SA 2JLRA 1UFVA 1DJOA 4Y6PA 1RJ9A 3GELA 4DR7O 3FPJA 1PWHA 3RFFA 3C6KA 3FFWA 3T52A 1NAIA 5J59A 1FD9A 3VBEA 3TTYA 2L6LA 3ZY6A 1K8XB 1E2KA 3ORYA 2ZR8A 1FXWA 5AOVA 4L4ZA 3CCVV 3A3KA 4G6ZA 4KZPA 3N2YA 2XIJA 4NR1A 2ASEA 1JX9A 4YCNA 4LFBO 1CY8A 2PKQO 4D8YA 2I7VA 2CNWA 4N5MA 2EQ5A 1PX0A 3DZCA 3QBJA 3VH4A 2DBVO 4ENSA 1PDOA 3JYLA 4OGGA 3WMGA 5AXBA 1Q2UA 2NLOA 3V7WA 3MWDA 2HOQA 3WKEA 3S2UA 1FYDA 3QXCA 3OT5A 4BMVA 3QBDA 2NUAB 2CV1A 6GPBA 3MCWA 4G27B 1YONA 3QA3E 2XGGA 2A8YA 2VDOB 1FNMA 4V1CA 1OZFA 2L18A 5DHSA 3H05A 3UAOA 5TMPA 4MRRA 3D3IA 1RJFA 4Y7DA 2VTKA 1FMFA 1WDLA 2D5BA 3Q6IA 3IEUA 1VF5B 5AMXA 2ZAYA 1XEXB 3JQDA 1XI2A 2CFRA 3O95A 3ZCPA 4GHWA 4HDKB 1LUWA 2D06A 4DIUA 2PT5A 5E7IA 4K8XA 4B47A 3P3PA 2OBNA 4HRYA 3Q3VA 4BRWA 5FFNA 1VLHA 5CIWA 1Y9AA 3VH1A 1I2BA 4KQGA 1E9FA 3OMWA 3G13A 5K4GA 3UV6A 2HC9A 1P44A 3WZ2A 2NZVG 2EZ9A 2PA3A 1YV9A 1QG0A 4WZAE 1JPUA 2GH1A 1H23A 4W5HA 1P6QA 1EUCA 1XOUA 3ROFA 1EE1A 3KSAC 5LP6C 3MJSA 4C0HA 1V37A 4IS2A 1HNZO 5CURA 2WTAA 3HN7A 1N7JA 5KYYB 3O94A 2Q73A 1H1LB 4NBKA 1JBQA 5CYFA 4EJSA 4XRRA 1TECE 2LR0A 4U6SA 4ZGBA 4B40A 3TQQA 4WBNB 4BMNA 1CP3A 1XTRA 2VJOA 3PG5A 3Q3GE 3SZLA 2C84A 3IR7A 2VBGA 3AXTA 1EPUA 1JFFB 4YIPA 3Q8WA 1QUEA 1ZMXA 2ZDIA 3EXFA 4ZYTA 1UPGA 1THMA 3GLHE 3ADKA 4K7JA 5I48A 1GEGA 4LYJA 1K4CC 3V9PA 5E38A 2FMXA 2AKYA 3PNQA 4NJEB 4LOHA 3EHEA 2FKAA 5F5NA 1L0LH 3C3PA 1D2CA 4G1VA 3GRZA 1ABFA 3TXYA 1E1RA 5A62A 2R2AA 3TSOA 4XW2A 5AKLA 1YR7A 3C98A 2I8CA 2UZ1B 3Q6NA 1QFJA 1MPXA 4JI1O 1RQ2A 3LPDA 3TZHA 2X19A 3CRQA 2B5OA 1PV4A 1Y8CA 3NEJA 1L8AA 3BSWA 4ZI7F 1PWXA 5BWBA 4KAAA 1MAAA 4BLPA 1OGJA 4CTMA 4PYOA 4FOTA 1WXEA 4Q24A 3T9EA 4B7ZA 3T6KA 4DDUA 4BAZA 1UBEA 3K58A 2NUTB 3NWOA 2E49A 1Q77A 1M7GA 4R68A 1S7GA 1FYWA 5HUHA 2JFGA 3TW6A 4Z3KA 3ZHTA 3BK1A 1XWIA 4AS3A 5GWXA 4IUDS 4P22A 2PSDA 4PINA 4FMCB 2GUWA 3AUFA 4MRMB 1RC1A 1ONNA 1TGOA 2CNBA 2OAGA 1KS9A 4KFUA 2XMGA 3NTRA 4GPIB 4C0SA 4RH0A 4ZQEA 4ZJYA 4D56A 2WR8A 2JANA 2LGWA 6REQB 3E2PA 3SX4A 2HA4A 4NTXA 2AF3C 2ZSFA 4N9QA 3DHNA 2PEZA 4RPLA 1NVAA 4KV7A 1V7QA 5ESXA 4LRWA 1CJVC 5G1NA 3LBAA 4GZLA 5E3JA 3FOCA 3KPJA 2UKDA 1I0ZA 3SYTA 2VBFA 4MKHA 4QBTA 3H5AA 3T7IA 1UPBA 2QEQA 7ADHA 5DNYB 3KB6A 3U3JA 2QRHA 3M4NA 1SELA 1YZKA 3IR6A 5EEGA 4RWEA 3LUKA 1H2MA 1Z22A 2J3KA 5LB4A 4KKVA 2OLJA 5LZ5A 4JLNA 4E3ZA 3HZZA 2K2QB 5FI3A 5CEJA 4WXRA 1W5EA 3BAAA 2IP1A 3ZNOA 2QT1A 2BE7A 2BH2A 1Z6TA 2Q68A 1SXJB 4JUIA 1VPTA 2BV3A 3BCSA 1KDZA 5H9WA 3OF5A 3BAFA 4DG8A 2QLJA 1PL4A 1X7YB 4RGYA 2PLWA 3F1KA 4F2WA 4KHPO 5KNBH 1EDZA 1S1CA 2WK1A 4KN9S 3DONA 2NU7A 2Z4TA 2GF9A 2DR0A 1NLUA 1IEXA 1B6SA 3PGJA 4KQ9A 2CLMB 3WNZA 1NSYA 1VMGA 1EM6A 5I5EA 3P9SA 2C5HA 2XB6A 4E22A 4ETNA 4DA8A 1TLTA 1QVZA 4IIHA 1RYZA 4P4LA 1FCJA 4L28A 4Y7CA 5BQ3A 5TMEA 2O3TA 4QZVA 4HZIA 1YCHA 1UJ5A 5F73A 1H0KA 2YJ6A 4NQZA 2CFOA 3CNQS 3JQGB 2P9QA 4GC5A 2ID8A 2CDCA 4K2HA 5KDDA 1Q16A 5FLEX 1QLJA 5AHKA 2DG2A 3G0BA 3F47A 1NMZA 4G41A 1YKGA 2P6JA 3LO5A 2JFPA 4U8HA 1KYOF 1N2OA 1DPFA 5LFAA 1ZUD1 3CTPA 3DL7A 1NP6A 3QJGA 4GOJA 3OCWA 5CVUA 2Y3IA 3GB7C 2P6MA 1J23A 2HBRA 3IO5A 5F4BA 2F8TA 3RTBA 1IXKA 5IVPA 4D7AA 4L3WA 3OZBA 1MH9A 3PQ5A 4Z1MA 3CNBA 3NRCA 1KC1A 1QC5A 3BBPA 5G3YA 3ONVA 2EERA 1ZW6A 1R27A 2QZPA 4HO1X 3RUIA 4I0XB 1R8JA 3LLMA 3L0CA 5K20A 2GDZA 3SC4A 2WJWA 4JYZA 2JFOA 1P1BA 5D1HA 4D25A 3E7WA 4JYAB 1NRWA 1PK7A 2QN1A 2AE2A 1GNPA 1E7WA 4KFRA 4LC1A 4HNQA 5KAMA 2IY7A 3U0VA 4J29A 3PHCA 2IW5A 1BDJA 3GQBB 2A86A 4Y0AA 4URHA 4MS4A 4DARA 1JA1A 4LC9A 4KG7A 3DE7X 3ICCA 3R6DA 2H8PC 2BM1A 1I10A 2QTSA 1NF3A 1K1EA 1S0UA 4L4UA 3IB3A 5EP2A 3ABOB 2RHWA 5LMNO 2ONKA 1SQSA 2LFRA 4ZDKA 1PV0A 1QHEA 5AJHA 3G17A 1E0SA 3LDFA 2HCJB 2FF5A 3MM4A 4IY1A 2WKWA 2Q4OA 2JK5C 1M1NA 4A16A 5ALLA 2RGEA 1JG3A 4CS2A 1HDIA 2TS1A 1G4HA 4LJ6A 5D86A 3AL2A 5HUQA 1TEHA 3QKRA 4NYKA 4GRDA 3F7OA 1JLRA 3MJFA 5EJEA 1XMJA 3E9YA 1SEVA 2XBLA 2RMKA 3ZU3A 4LYGA 5FPKA 4ALMA 4ITVA 3IAYA 2O2XA 2KBEA 2O0MA 1JQKA 4GW3A 3RSGA 4R9NA 1ZUIA 1NQTA 1V16B 1RHUA 2H4YA 5B30A 2BDEA 1I1HA 3UY4A 3GPCA 3MT0A 3WWPA 5CM8B 3EIXA 5ALIA 4NOJA 4Y9DA 3BWYA 1Q91A 4OHUA 3IXMA 2YUAA 2CB9A 3PQ4A 4ARSA 4LX8A 1S2OA 2ZATA 4UC0A 3ZWXA 3FTFA 3VTZA 4GE3A 2R5NA 3A4MA 2O14A 3KEGA 3TLBA 2W71A 2PR2A 3QVJA 4I81A 5TMDA 2LGJA 4EUHA 1B00A 4DV3B 5CCEA 1QR6A 3C15C 1U0JA 3SC3A 2WV9A 1UL1X 3U3MA 5ISMA 3G8AA 3WA7A 3RFTA 1M56B 3DE1X 4ZI3A 2H11A 4YDHB 2KI5A 1SVUA 5KYNA 1MO5A 2XIQA 3TQHA 3UH1A 4BYMA 4R3WA 3CCFA 1F5SA 1XU4A 2I6XA 4I50A 1WQ1R 3BTSA 4G67A 1EXVA 3EQ8A 3KVOA 5FL7A 1V3TA 3UUGA 5BN4A 2ZUSA 1THGA 3ZVKA 1BWSA 3LSQA 5FUQA 3ZH9B 3IC7A 1P18A 5IN4A 1L2TA 3BQ9A 3LZCA 4OX9B 4EGFA 4RZHA 1P49A 3O75A 1VBFA 4OAPA 4LJ4A 2C5FA 2IYSA 5K8TA 1GVNB 2PE5A 8ADHA 1KZ6A 5B1IA 2X9NA 1BE1A 3CIOA 3E5RA 3PUJA 1VMAA 3VZRA 2AC4A 4G56A 4MOWA 4NLLA 3TW4A 5EKDA 3ETQA 3BWMA 1WP7A 5FLKA 3HJNA 1U8CB 1HYBA 5TRTA 4F93B 1LEHA 1PJ8A 4YRAA 4EI7A 1BHSA 3G5LA 2AYZA 1UAYA 1M2JA 2Y1KA 1WMFA 4YX9A 2Q7DA 2GBCA 2DWPA 2XZPA 1QV6A 4EY7A 1RAEA 1O08A 4QOEA 2DPGA 3Q7TA 1E1KA 3PKIA 1W1UA 2BI7A 2CHFA 2AK3A 2WZCA 4CM4A 2RNBA 4GBED 1Y8ZA 2ZU6A 1YB4A 4FYMA 2ZROA 3HA3A 5AI9A 3NMUF 2JATA 1G2OA 1CJTC 5AKHA 3GB9A 3P5SA 2X13A 4LNHA 3U49A 4OMFG 3KR9A 4PNHA 4A7PA 4BNKA 1M34B 3HB5X 2ZZMA 5E8RA 4GYCB 4BVAA 5DTQA 3PNYA 3P26A 1ZNWA 4MJLA 3ROQA 4XYEA 3VQYA 5EWLA 1M66A 2SKDA 4JYCA 1JEQA 2A0FA 2DQ0A 1Z62A 5BUSA 3HKDA 5MFZA 1Y3FE 1GNTA 4Y9SA 3WX0A 5FBHA 4DMCA 4XDLA 5C7IO 4JB0A 3AF0A 4FJ0A 5I7VA 3RS2A 3R40A 1G21A 1Y74B 4JTAB 3K1AA 2O20A 2ZYGA 2PMKA 3BUSA 2XTNA 4PAGA 3K9QO 2CBXA 2WTEA 1JG4A 1VYUA 1KTIA 1A04A 3ZN2A 1LX6A 1B6TA 2W6QA 2EFJA 3DMHA 3ZE0B 3D4OA 2JI9A 1O6CA 4P58A 1CLEA 3QRWA 3G8CA 2ZCEA 4DIBA 1ZQ1A 3KPUA 4QBGB 2ZSUA 3ZV3A 4BGEA 4F7DA 1ZX1A 4JLSA 5AO9A 3F96A 1IL0A 2OC4A 2IPNA 3QEJA 1DS6A 4URYR 5D5QA 3LWZA 3PEUA 1C1XB 1HY3A 1TADA 2JZOA 1FXUA 1NQWA 1KOLA 5DXJA 3ADBA 3F5QA 5P21A 3AXSA 4PGHA 1Y7PA 4HDCA 3SHVA 2CJPA 2FYTA 2GMWA 3C97A 5K9ZA 4Y6QA 2C7OA 1PVOA 3AYZB 3U4HA 3IJ4A 1GKFA 1KC3A 1RTKA 4NBWA 3OE7A 3UKMA 2P7HA 2Z1NA 5H4HA 421PA 5C1PA 2F3SA 4DR1B 2XNDG 5JJJB 1FDTA 2HUNA 3GFFA 4C4ZA 3WQRA 3SJ7A 1XVLA 2HQ1A 4UTOA 1H2AS 3TOVA 5JWRA 3SE7A 4M6WA 3DMDA 4MQFA 4KXMA 3OWOA 1KKDA 2JASA 4MCAA 5KWJA 4KAXA 1VJ1A 2LKCA 3NEYA 2CGOA 1N6NA 3C16C 4Q0MA 1XR3A 3D81A 2DC1A 5B1YA 4FT4A 4ASUD 2PUFA 3FDZA 1RRPA 1XCBA 4J4HA 5CBPA 4S1NA 2VXOA 2J9GA 1JSXA 3KCQA 2AW9A 2DLDA 2P30A 4OI1A 5B2ZA 1NUTA 1P5RA 4LXIA 5JZ9A 4CM1A 1VMDA 1JVSA 1T9BA 1Z5OA 2ALJA 4MGKR 4CTJA 1E6LA 1OF1A 4RK7A 4C2TA 4HNRA 4JITA 5LDHA 1GD1O 3KQSA 2R751 3FCXA 4R81A 1DK1A 4G5QA 3IXLA 4D9JA 1G6HA 4TV9B 1JKIA 1LZLA 3L8HA 1EM8B 2V74B 4DDTA 2VF2A 2XOKG 2ODTX 1KAMA 4MQ5A 1HC7A 5T5QA 4DMGA 4JL5A 1XYGA 4B3HA 3IA7A 1S72V 3N2EA 4C2UA 3N87A 5HTOA 4RORA 2HJSA 2DMRA 4XJVA 3CXHF 1DCFA 1XP5A 3W79A 4ZICA 4DB4A 2H2IA 1B43A 3IQHX 3SVTA 3UKJA 1GRRA 2VTDA 3FCEA 4S0XA 4NAVA 4NV0A 4XCXA 4QQNA 1CQJA 2A84A 1H05A 4ZVLA 1OD6A 1XZQA 2FU5C 1Y76B 4ZOAA 3B3AA 3SZUA 1KPIA 4MWOA 4BU1A 1SHTX 5B1HA 1AD2A 3A7EA 3BIXA 1BE3H 3VPCA 4Y18A 2QSJA 3E7PA 5LHIA 4J16A 4JVNA 4HLUA 5IJZA 4DG9A 2G06A 2QP4A 1QS0B 4RW0A 1DLBA 3PLRA 3R3JA 5ABPA 1UK7A 2HU2A 4HN9A 1NC3A 3NX4A 1QU7A 4UUJC 4DRXA 1E1LA 2ZYAA 3JWGA 3ASVA 2WYHA 1U97A 3COYA 1DBSA 1JHMA 1DXHA 4BNJA 4IOJA 3TE7A 5JC1A 2AGVA 5DRTA 4A8JA 1NR1A 2Q8VA 2PXCA 2QM3A 1Q95A 2X9VA 4FWBA 3N2GA 2ONZA 3PU6A 3TR0A 5B53A 2ZQMA 1CUXA 1JTFA 1DTSA 5KVCA 2KB0A 4N39A 3MT9A 3RVNA 4BO0A 5HKOA 3HADA 1OX6A 3CYFA 4EGQA 1N9KA 5BV2P 3H5WA 1I5XA 1G9SA 4H77A 3TJRA 2IZ6A 1SKYE 3DE5X 4FNMA 2AHOA 3ZCUA 4KLRA 4BMDA 1D1PA 2H4FA 3GWGA 4HD8A 1DCKA 2YFKA 3I2JA 1XV5A 5CHYA 3HM9A 3LAWA 3QM1A 4MUXA 4NENA 1JJAA 221PA 2KQUA 1OU0A 3CNEA 2GTPA 2O0KA 4B6QA 4DLLA 5JV5A 5HZKA 3VRHA 2QORA 1NZDA 4RY2A 4O4LB 1QHFA 1GQYA 5HR5A 2IHKA 3EVNA 2BUAA 2BHRA 5BURA 1OWOA 5A7GA 2AQHA 2IH4A 3THWB 1AK9A 1AKRA 4B79A 2LCQA 3X1XA 1AB5A 1E1RD 3I6BA 3U4CA 3AB3A 4HEA1 1KJNA 2C8VA 3CRCA 1G6KA 3H5IA 5I8PA 5HCUA 3RABA 3I04A 1JDBB 3OZDA 1XA4A 3KTOA 3BVOA 1NPDA 3R8CA 1R6AA 2AN3A 3R75A 3WB0A 3KZXA 5EE0A 3GJXC 1FUUA 3HYNA 2ZUVA 1DTEA 4Z53A 1FNSA 4LH7A 4O08A 4EGAA 2RGNC 1Q6YA 2PG3A 1RLJA 4MAFA 5DXAA 4ZVUA 2XKJE 3NV7A 4OP2A 3GMTA 1NQOA 1X1AA 1ZRMA 4PGGA 4GRIA 2PFKA 3O1LA 1KFCB 4ZQGA 1EVLA 1EE2A 1EGQA 2X9QA 1RM4A 2OXIA 3ZEDA 4LY6A 4HF7A 3MWEA 1S77D 1I9CA 2I65A 2UXBB 2SKEA 2I22A 3W7VA 3DL2A 1IHXA 4NYJQ 3ADCA 1U1FA 3UENA 2LFSA 2HZBA 2J0VA 1Y3IA 3R5HA 3RC1A 1ANKA 4R2IA 2VP4A 2EWVA 5JZBA 1VE5A 3ZS8C 1SWWA 3IJ5A 1M1KW 4R3UC 4OGFA 2O06A 3BSSA 1S4MA 4M8LA 4NF2A 3X1ZA 3A04A 4JSTA 3AU8A 4WLFA 5CXUA 4PG4A 3FI9A 3FTNA 5CFNA 5IZCC 4IILA 2ZE8A 1PGQA 2JCSA 2FEXA 1KBOA 1QDEA 3HWWA 4CTNA 4AK9A 3I34X 4IOKA 1XHEA 1FX0B 1GGFA 1U65A 1XEQA 4UJ5A 1NBEA 2C29D 2B5WA 1R6KA 4M37A 5D84A 1Y3CE 4DYVA 4N6NA 5K01A 4ZAXA 1P7VA 4C6SA 2TRSB 4BW9A 1RXEA 3K0CA 5BUQA 3R0VA 3X1MA 4JGSA 3X3HA 4AX8A 1JZQA 5JYDA 5TE9A 1NR5A 3SOZA 3UMFA 4KQKA 1HR0O 1VTKA 5BVGA 1HDJA 4M1ZA 5TR9A 1YRBA 1CDDA 3PNSA 4ROTA 2QLTA 3PC6A 4O2BF 5TMBA 3DAOA 3CLRC 3JSLA 2QTMA 1M1ZA 5J2TB 5KNDH 3MXOA 2N04A 1X1DA 2VH5R 3GEIA 4HNUA 4BRZA 4C06A 4KDRA 4X61A 3TOSA 4OYLA 3ZCVA 4ZN6A 4GYYA 4QBIA 5IABA 4YFYA 3DEKA 1GZ7A 1HE5A 4XQEA 5KTOA 1COWG 2C9CA 5LPNA 4C7OA 4OATA 4XQCA 3UZUA 1UBHS 2VFAA 2VPQA 2MSDB 4HXEB 3V6MA 3O38A 5FEMA 2GZDA 5DHPA 2X5JO 1VRCA 2XCOA 3HV2A 4MS3B 5JOQA 3RO7A 3UXEA 1NIPA 4KFMA 4UFOA 1GL6A 2F43G 3AGPA 4M60A 1ZJZA 4CCSA 1ZQ9A 3MUOA 2QI9F 1U0EA 5BSTA 3IIJA 4PONA 4GUAA 4AKEA 3VVLA 4S1OA 4C4XA 2P9ZA 4B2IA 5TEVA 2KLHA 3TRIA 4M0DA 1X86B 4AUMA 3OFJA 4PWZA 2EX3A 1DJMA 4KUEA 5G4LA 3ICVA 3P4YA 2IEYA 4YV1A 5T41A 1QK5A 4CFSA 4DIEA 4A0HA 4X93A 3TH5A 1WCIB 2G38A 4KLNA 3EUFA 4MDYA 4CG0A 3HR4A 3WLJA 1ZGCA 3I83A 2P0EA 3ICPA 3OQHA 5H3CA 4Z3DA 1HG0A 3NALA 3HK2A 3SJUA 4R7GA 1P2VA 1WP8A 5BSMA 3SYPA 4YJ2B 4HWOA 2RBEA 2VQSA 5BQPA 2WHPB 5B55A 3ET4A 6AT1A 3PFKA 4Q34A 3QVLA 1O6ZA 2Z9CA 1SUAA 4G3XA 3BB4A 1WZ2A 3KTAA 1OCCB 4G1BA 4ETWA 2I6TA 2YRWA 1U28C 1IXRC 5FH9A 4L9AA 4AILC 1L7QA 4D3DA 1I2CA 3QLTA 3M8AA 1MX5A 3NV9A 5EEHA 3V9AA 2I4OA 1VQMV 4NH4A 3W1WA 3LLCA 2QZZA 1ICIA 3L71H 4MYRA 2ZBRA 2Y9PB 5BOSA 3L1UA 3G5AA 2IUSA 2IQIA 2Q0HA 3ZWMA 3CTMA 3N5KA 4AKTA 1GT91 5CA3A 5IYDO 3B1WA 4EYOA 3GHYA 4TWJA 4WD3A 1QH8A 1F06A 2AFVA 2CSUA 4Z3OA 2QTNA 4CV0A 4JLJA 3JPWA 1AU9A 5IKXA 5D3ZA 1GQSA 4DDWA 4BBPA 2UDPA 2HA5A 3EBPA 1RHRA 5ALMA 2BEUA 2ZUEA 4FOPA 4ZMRA 4K3UA 1SFRA 4QIHA 4BZWA 2WJZB 1TUBA 1QFXA 3IOBA 1GZ3A 1E6WA 3DMTA 3F6BX 2C99A 4JDPA 1GGJA 5AUQA 2IRWA 1AOXA 1UM9A 4WCFC 4GXTA 4E30A 3I6YA 4O02B 2WIAA 1BKYA 5JXWA 3O1HB 5AKYA 2R7MA 5K3OA 3KJIA 5JPDA 5MGNA 3H16A 4LH6A 4RKRA 5EIHA 4UB6Z 1Z2AA 3QU5A 4D97A 4EEZA 3I9LA 4V0SA 3K3PA 1K33A 1NVMB 2ZRNA 5T57A 5I7FA 4CBCA 2BJHA 2I91A 4ZV7A 1NMEA 1G0OA 1PJLA 3K70B 3E22A 4FHCA 4ZQFA 5HIMA 4JMPA 2Y1GA 4LHEA 4DIOA 3R3WA 4IVPA 1NNI1 4P33A 3F3SA 4U6QA 3DNMA 1AB3A 1MW8X 1O5OA 2R00A 1QLEB 3LUGA 1AZLA 4B34A 3EXEB 4HVAA 2X7RB 1ZK0A 4J9YB 3DLAA 5FUMA 5KU7A 2AZTA 1CPYA 4O2LA 3MAGA 1QPBA 4YP5A 4BVKA 4QT4A 4N6OA 4Y2RA 1A7KA 4G0WA 3PI6A 3J7TA 4G9EA 3S6JA 4JQOA 1SD2A 3AUYA 4B6PA 2J46A 4YH1A 3ZWAA 2CL0X 3WNQA 4QGSA 1QG6A 2PZGA 3G8DA 1PGJA 3C8UA 3OLCX 4WN9A 3L1KA 1L4HA 3JRNA 3FRHA 1RBYA 3VPDA 4G0UA 2INGX 1A2QA 1P7WA 4R1SA 2Q2VA 4LI3X 5IAOA 2QD1A 5CFMA 1HUQA 3RUAA 5BSWA 1K0UA 4Z9FA 2J0EA 1A50B 2VDRB 1Z4PX 1XZGA 2BFCA 5IDQA 1NU6A 2FEKA 3C3SA 3STYA 5JH7B 1F0KA 5SZHB 3IEKA 4H31A 3SEZA 1KAGA 1HZZC 3HKBA 2CGNA 1VG9B 3KT0A 4LF4O 3R3XA 1C8VB 1H2XA 3V1MA 5LVAA 4EO9A 4TKUA 3QTCA 1KZ4A 1YBHA 4TV9F 3M6WA 2ZR2A 3JAMA 4UE2A 2FQXA 2IJIA 1N2JA 4M1QA 2X40A 2JFHA 5KU1A 4BJ6A 4DV5O 4UUPA 4YHHO 1CR2A 4J4TA 3DTVD 1ZOOA 3N8DA 2IPXA 1W59A 4RF4A 1R5OA 2JH9A 4FZ3A 1SIBE 3TDKA 3VPXA 2XUFA 3C7AA 1X7GA 4L8YA 4FM9A 4BXOB 1RP3B 1AX9A 4AKIA 3LY5A 1YKFA 3CXUA 4UUAA 4NV1A 3FAZA 2GZSA 4JFAA 5B6PA 4MV7A 3HUDA 5E0KB 4L87A 1RE0A 4E1VA 3W5DA 1K4DC 3CZMA 1RYFA 2Y1EA 1QLWA 2FSVC 4XIGS 5CB6A 5AVJA 3C14C 1XG5A 1BE6A 2H18A 4GU5A 1Z7GA 2O5CA 2MHCA 4G0OA 3AY0A 2B34A 1UC5B 3S8YA 2QKCA 1EFVB 3K9SA 5F9FA 4U3JA 2MINB 4BX2A 3Q98A 3KUDA 5KOIA 2JGLA 1CR1A 3N8GA 1DU4A 3DVSX 3AZPA 3DAHA 4WFFA 4G5GA 4CM7A 3PIIA 2GJ4A 5CDTA 3T9FA 1EG2A 3M6LA 3VPSA 4KQWA 2X0EA 1Q3HA 4PQEA 2VDQB 3KQMA 3K4HA 4ZAWA 3UJAA 4ND2A 4BTVA 5AM2A 3OH8A 2G08A 1DPGA 1SJ9A 1OYWA 5CLJA 2OZEA 1KKLA 2GHRA 4BQSA 2XNSA 3HEAA 3BTOA 1NE7A 2NTEA 4DV1O 3MWKA 2E0IA 3CSXA 3LNTA 3LWNA 3FX2A 4U00A 3EH2A 1F17A 4LF9O 2C0QA 5A4KA 4PIVA 3IEPA 4PV7A 3H4TA 3H3FA 2YJNA 4FNOA 2Z1MA 1NIJA 2HF7A 3PV0A 1K7DA 3RF6A 1DLJA 1K5GA 4O4LF 2FW7A 3IXQA 2EGUA 4NZ9A 4OHZA 2Q4BA 1Q0UA 4Y2SA 5AI8A 4B3IA 1E3LA 3TTVA 3EZGA 3CH5A 1J1IA 1JVBA 1V4VA 1YAJA 3UAVA 3IT0A 4PLHA 4OXQA 1TF5A 1ACLA 1N6KA 3F6RA 3CLRD 2JG3A 1QH9A 5IY5B 3V8MA 3EXHA 3OU2A 4YQEA 3DT8A 5JDIC 2AFRA 2H1SA 4YPFA 4GP9A 3LUDA 3KOWA 2I29A 1C3EA 3CLUC 4B7XA 4PVCA 5C53B 5FTMA 4O0LA 1S02A 5KTNA 3OTQA 5K6AA 4YCJA 3SZGA 1C0IA 4WA7A 5KSPA 1P4GA 2BZSA 5CB0A 1O94D 3N8KA 1HKUA 2BEWB 5JNWA 1M2HA 3B5EA 1SKMA 3OMAB 1AGRA 2P79A 5J47A 2IHJA 1H42A 3OQ1A 4BO7A 4IUBS 4GF5A 3VR3D 3HP7A 1AK1A 3KE8A 4RFSB 4YRSA 4FBMA 1C4WA 1U0NA 4KE6A 3WV5A 1X38A 1MFZA 5K8IA 2P9GA 3WGLA 4ZOQI 5HKKD 3I32A 3NBQA 5KHAA 1LLQA 3CUKA 2Y69C 1Q0SA 2XH8A 4WJZA 4HTFA 1JPVA 1MO4A 4LQDA 4UUBA 1CDEA 4PAOA 5CH8A 1BVRA 2XOKD 2PL3A 1BTOA 1E4OA 1XCLA 3ZZTA 4QULA 1L7EA 1MO6A 3O6VA 4QXOA 3NBZC 1FIUA 1NYRA 1KVUA 1JA0A 2OAP1 5FPRA 4UBOA 4ASUA 3E83A 3X0DA 1JI0A 1RRMA 4PM4A 1M1XB 4HXFB 1H5UA 1IUNA 3GDWA 1RMQA 2AWNA 4RX1A 3CJHA 3TQCA 1R6BX 5B7NA 3AV0B 4HH1A 3INNA 5BNFA 3A3OA 2GFQA 2QVXX 4RLFA 1C3OA 2MR6A 1ISIA 1VPLA 1GUZA 4I6GA 1QHIA 1R0WA 3PQ3A 1G4YB 4F2HA 3OTGA 5MFPA 1VHTA 3I55V 3VHXB 4JL8A 2I87A 2W58A 2ZRGA 3QVWA 1KI3A 2ZVDA 1PJSA 1XCJA 3MGBA 4TQFA 3KJEA 4KGDA 4H60A 1VBMA 1K7YA 4PCAA 5J2TF 4KPUB 3HA5A 3MW8A 2I80A 3QPWA 4RBNA 3WYDA 4B2LA 4QFDA 3IVXA 1T3LA 1OCEA 1SQFA 1OQAA 1KMHA 4LE1A 5CTJA 5L4NA 4YT5A 1XKXA 2AKAB 3O9ZA 1T4CB 4UNRA 4GDMA 5JLJA 3D6TB 1T36B 4JBLA 3F74A 4MLCA 4LZAA 1UMCB 1OH8A 2AEMA 2XMZA 1NKVA 2JFZA 2PRIA 2Q5CA 3WYNA 1W4AA 5KDLA 4PQRA 1N32B 4YAOA 1ISSA 2WLNA 2JGIA 1IHOA 2XLCA 2Y9MB 1YJ9V 5L3QA 1ZM2A 2WPDG 3T5GA 4GI5A 1IZ8A 3M9WA 4KUGA 2ZITA 3VR5H 5CBFA 2VNAA 3P2JA 4B3FX 4M9XA 1GQQA 3THXA 3VYUB 4WN3A 3PQCA 4JI2O 3S8MA 1TYZA 3OR6C 4DNXA 4YJDA 1E1QD 3DV0A 3KLOA 3NGXA 4CC6A 1AQYA 5CFZA 1E7QA 1NL3A 4FEGA 2XGOA 1S3FA 2AC7A 5D01A 2DW4A 3PPVA 5K6TA 4G85A 1YHNA 2BHNA 2IHTA 3RYIA 4AF7A 5J5CA 1GZVA 2V6GA 1Z5NA 4NHOA 2R44A 2UVQA 1TQDA 3RT3C 1ZAKA 2NZJA 1Z74A 2EW1A 1OFUX 4WL0A 3RV3A 1RZ3A 3S5JA 3X2QB 2J30A 1PJZA 4M99A 1WHTB 2PEYA 2NV6A 5IK2D 1PL8A 4HZUA 3VDMA 4JX8A 2PA0A 2PMEA 5JY6A 3ONFA 1U0TA 4LE2A 1TK3A 2WUWE 3H42B 4OH1A 4YJ2F 6PFKA 2O3SA 4OBXA 2CD7A 3FLMA 3TN7A 2HB6A 2HSDA 1LLDA 2ZR9A 1UPTA 2Y6UA 4S1VA 3PSAA 3S4YA 3LTEA 2XW6A 4RK4A 1KECA 2PK3A 1FFDA 1YMUA 3BEDA 3KCNA 5ILGA 2CTWA 1LQTA 1E7MA 3NWJA 1Y81A 5KYGA 3AK1A 2VP2A 3FYUC 4FFVA 3WMFA 2A3NA 3SEQA 4I5IA 3M6MD 3H84A 2EW2A 4YMGA 1BN7A 2Z4RA 4IRXA 3DOJA 3KZNA 2FW0A 4CKWB 2K5UA 2XMCA 3T3GA 1FVHA 1ABEA 3ZHXA 3OZXA 1TM1E 2RH8A 3SJCC 2IU0A 1ZLZA 2REXB 4RU1A 2NT4A 3OTOO 2V55B 3VDRA 3T7CA 2M6SA 1TM3E 1CDOA 4ENUA 4BP9A 2Y05A 1ULAA 1U96A 1YK1A 1U8YA 2DHQA 4EELA 5M7EA 2ZOSA 1QF9A 4IO0A 3CJRA 3CRW1 2Q4TA 3OF3A 4QXQA 3PUKA 5ADUS 3K72B 3BRQA 2VHJA 2WSLA 4BO8A 4M55A 3FNIA 4HGOA 4MDFA 2PWAA 3AKDA 3MJDA 5EYPB 4XRGA 1WY5A 3AJDA 3QUBA 5CBKA 4J0IA 5ADWA 3UGKA 4Q1CA 1W94A 4K03A 4JZYA 3OX2A 3TNFA 3EASA 4J41A 1XVUA 4GPEA 3S3XA 3CZ5A 4PCLA 4R7TA 2YWFA 1FXVA 3F8TA 3RBVA 4UEJA 3WP1B 1Y6ZA 3QJ5A 4S1WA 3BIFA 4X84A 3W4KA 2ITDC 4I55B 2Q28A 4YMIA 4LX0A 3A0RB 4AQDA 3TRKA 1EFUA 4W82A 4QUKA 3QENA 2Q8PA 5JNLA 1QQBA 2HMVA 1KXJA 1K5QA 3AL3A 4TVOA 3LD9A 5GAJA 3D4LA 4LJ8A 3C5VA 3VYWA 2VUSA 4KLAA 1PIWA 3GGDA 4YMSA 2QROA 5J2UA 4YLYA 5ITVA 1PR1A 1FU7A 4EI2A 3DWIA 1T5BA 1FLVA 3A9UA 3U26A 4E09A 4URUR 1L4NA 1J0DA 3CRVA 1FQWA 1E0DA 3SYKA 2RHLA 2WC1A 1MJNA 3ZLJA 4CWAA 1Y7TA 3JSXA 5KA5A 4FHEA 1FFEA 4G0ZA 1COWD 1S2IA 4AG3A 2DQZA 4LY9A 4D45A 1VRWA 4KN5A 1Y8QA 4TMXA 4UU1A 2GN1A 4KMSA 2Q6OA 3L41A 3N59A 1FDOA 2WTUA 3RYHB 1NI5A 2ZXWB 1WKVA 3ZHSA 2IH5A 2EYQA 3BMOB 3SJAA 1BFDA 2WSIA 3HB1A 4OXYA 1GCGA 3ICOA 4PZ9A 3OZSA 1HI9A 3U7QB 2D0DA 4EYKA 1HF3A 1UDCA 4CT5A 1IIRA 1AI4A 1JIKA 1QG2A 1F3OA 5F35A 5EPOA 3WBFA 2WHXA 5L3CA 3PRHA 3BY6A 1WWKA 2OYCA 3TLGA 2A1UB 4QFMA 1MJHA 1Q5PA 3NO4A 2LRHA 1BG6A 1D5CA 2W70A 4CCAA 1P2UA 1NMSA 1B14A 1WX1A 2VTBA 3FFQA 2ZSJA 4UAGA 1S6YA 3E2EA 2XMBA 1JFRA 3A26A 1BEEA 1JQJC 2BGLA 4YUXA 1PR9A 2QY9A 3X2SA 2G8LA 2GASA 5DM2A 1VLMA 3BH0A 1X7HA 4YRPA 1RAFA 5L6MB 1D0VA 3I04M 3VJLA 3U1VA 2AOUA 4RPGA 2X3FA 3TZKA 3MRSA 4DABA 3EWSA 4Q4AB 4L5YA 5JAPA 5GPBA 2ZRLA 2R6FA 2VHTA 2X5XA 1A5TA 1FDSA 3WGMA 3J81k 4XI9A 1JQ5A 4DLWA 2QRZA 3W9SA 3H1AA 3HDTA 5LU9A 4D8WA 3QLUC 4RLHA 4AP6A 4UVEA 2GRUA 5IAGA 2I6SA 3RU2A 3ONEA 3CLUD 1E94E 4MKRA 4PICA 4ZQHA 3L1VA 2HWWA 2C4UA 2WTBA 3I39X 5B5SA 2GNOA 4JEHA 2GBLA 3OZCA 4Z0TA 3O8QB 4WKGA 4DDHA 1QPGA 2ISCA 2TMDA 4PW0A 3K79A 3BX1A 2JIOA 4ILKA 2Z8YA 3WL5A 3CKKA 2D13A 3JPYA 4OH7A 3RIHA 3UMMA 1XRRA 1BQEA 3F5FA 4LZJA 3PQEA 2P91A 4D7TA 3PWKA 1I7SB 2I67A 4DR2B 4DC9A 2LIVA 4O59O 1RADA 2J5BA 3T1HB 1NXOA 2COKA 1N5DA 3ORRA 1O6FA 4QDJA 4AO7A 1SQXH 3QGMA 1V5WA 1N2ZA 2G3YA 1DQSA 2V03A 3W5HA 3GJ4A 4JJKA 3P9YA 1GQ2A 2X14A 4HNHA 4RZXA 1W6RA 4EKEA 5TVKA 3ZWWA 5DYNA 4GMDA 4FLEA 2MYNA 4QQKA 1F7YA 1RWPA 2PTHA 1GADO 2BGWA 1UINA 1Z7BA 4WXYB 2IL1A 2B8TA 1QE5A 1ZLXA 5I51A 5IJ0B 1SVNA 3E0XA 3V8BA 2AK2A 1FU8A 2UXDO 2ZYRA 4DUZB 2LO1A 3E1GA 1X3LA 3MDSA 5DCUA 3FW1A 1XMVA 2Q4EA 5JROA 3RRMA 4E2XA 5AKZA 5FNVB 2O1XA 3WLPA 4Z9BA 2CYCA 1SC3A 4GLFA 1H9AA 4H44B 1J5EO 1BIFA 3QLVC 3Q2OA 4C21A 5F2OA 2RKWA 3AG5A 2FR8A 2R4UA 4IF6A 3HNOA 5KOJB 4URXR 2P9TA 4M8KA 2XF8A 3WGZA 1VJDA 1DTWA 4NESA 2FEMA 2IYAA 2H0AA 3K0AB 3KKZA 5H16A 1D0IA 1ZI9A 1W2GA 4BLSA 1CR4A 1G4AE 1DDGA 1KDRA 4LGVA 3TPZA 3NC1C 1KZGB 2ILTA 1N6OA 4X62O 3AFMA 1AHHA 3BMQA 5ALZA 1WCXA 1VKHA 4ND8B 3ZCRA 2M6RA 1VCNA 2O2GA 2D2XA 4F5ZA 3TB4A 4W5RA 5AI4A 2O19A 2UXNA 4NYIQ 1KOJA 2BE3A 2JI7A 3ZDAA 2C7QA 2B69A 2WQ7A 1P3DA 2O8FA 2D59A 4ABYA 2FRDC 2YXLA 3K6SB 4Y2JA 3HFGA 1KJJA 1ABBA 4F56A 4HOYA 2QW8A 1QHGA 1UR5A 1O87A 2REQB 4V38A 3B6ZA 1HEYA 1F2UA 4A2PA 1J8DA 1V1RB 2C3MA 4RO0A 2WTXA 3SBDA 3TKLA 5DTEA 1EM1A 1TTTA 4DANA 2A5GA 3RYCA 4O1IA 4ISBA 3HGMA 1V8BA 6NULA 1BU8A 4YRNA 4XUDA 3B77A 1EHIA 1F0NA 4INZA 1Q44A 1Z83A 3OMIB 1AO3A 3NDIA 1JALA 4UCVA 1RP1A 4UCWA 3BHPA 1DIAA 3CX5F 4R9VA 3COVA 4GSYA 1WXQA 3RM3A 3P2OA 2A5LA 4NPCA 4YLGA 2RHCA 2AUTA 1PR4A 1LUAA 3A06A 1T5DX 1Y1TA 3SS7X 2NUPA 5HVNA 4D4HA 3RRBA 4C0WA 3KZKA 1PE0A 1NW3A 5GTIZ 1JLMA 5AI5A 1XTTA 3W7UA 4I0WB 1G7SA 3MWYW 2GPAA 3SXJA 1Z4KA 5SYAA 1DT3A 4KNWA 1TK2A 2V7QG 3IL2A 3G85A 2NWQA 3FPGA 2QW0X 4XJXA 1J2UA 2P3LA 1II9A 1ZWLA 3SBEA 4DNPA 3CV3A 1II8B 1ZCZA 3G79A 3DTVA 1BDHA 4L8LA 2NZUG 3B9PA 1SH7A 4LV5B 2PCJA 3RFUA 4NBLA 1TUEB 4X1KA 3SR0A 2BR3A 1SC1A 1OXUA 2NNWB 3DO6A 4K9MA 1EVIA 3BGVA 1SWVA 4EA6A 3ZNNA 4OPHA 1Q7YW 1EDOA 4Y9RA 2IHYA 1J39A 2WAAA 1JT2A 4PLTA 5BSGA 1TM7E 2X2EA 4EKDA 1PG5A 1MAHA 1WD5A 3EGVA 4AKGA 5K0BA 3O7WA 2FG6C 4UVAA 3HUFA 2C4KA 3LJKA 2WZQA 2CLIB 1ADCA 2WWXA 3ZV5A 1AILA 3RSZA 1JR3D 1RAGA 4UTPA 3ML0A 3O8NA 1D2HA 4L57A 5GJWC 3KZ1E 5BQFA 1M5IA 1OV4A 3OUFA 3ZD6A 1GTSA 5LOVB 3N8IA 2HF8A 5FPSA 3ZNQA 1YR6A 1BQZA 3AW9A 4ESEA 3R3YA 1YZBA 4M54A 2NP6A 1AUQA 4OQQA 4YECA 3L4SO 4UPVA 1TEVA 5KMGA 5LL6Y 1KI6B 3FNQA 1Q3EA 3U5TA 3R0IA 1QOZA 1WO8A 1CXZA 4ZCTA 4HX9A 2O57A 2PL5A 5IVIA 4RDHA 2RCVA 2XRZA 3N8NA 1W30A 3GLGA 3ASOB 1K7CA 1XJCA 3ZG6A 3WLKX 3OC6A 3P9NA 1F2TB 4OU5A 3DVLA 4R01A 3MMSA 2PL9A 3KR2A 4WBNF 5LM3A 3ZBTA 5A2QA 3JQ8A 4E5KA 3RHSA 1GNRA 5KB3A 2GAJA 2ZUCA 1D6SA 4QFCA 5FOUA 2WFLA 4CF6A 1MABB 5EWMA 3QFRA 4ZEVA 2I4IA 5AHWA 3K05A 4U2KA 4RCVA 3F3YA 5A1JA 3TQIA 2GYYA 1Q0RA 1RBZA 3HJAA 4BFSA 1YZQA 5C0OE 4DT1A 2WT9A 5T4FA 4B6SA 1XPOA 1KO1A 4UDXX 1NI4A 2Q5QA 1V1JA 3TTWA 3O8OB 5G0TA 2YIBD 3AHIA 2VAMA 1ST2A 2HZ7A 2EVWX 2Z3YA 4C5CA 1Q1QA 3DD1A 2PYLA 1R9MA 2ZU0C 4A82A 5EKXA 1VQ1A 1U11A 2QN3A 5DM6V 4DFDA 1S5LZ 1KEUA 4CPDA 1JSCA 1UZNA 1RSOB 1UPFA 4Q6WA 1C3XA 2QUBA 3DEHA 1FFXB 1AKQA 1NJSA 2WJAA 3NQ41 1SUBA 4HAUA 1YIDA 3EWAA 4AQYB 1OC4A 4JT8A 1KS2A 2ZWIA 1VKNA 1V35A 4JNKA 3ER6A 1G20E 5H68A 3JZIA 1O94A 2QWPB 4I3HA 4JLVA 4JI3O 5FFMA 4JT4A 3AV3A 1VLJA 4FMCF 3D2BA 3VVMA 1V9CA 3T1VA 3PA6A 1JFSA 4ZKDA 3VR3A 2CF5A 2V0CA 1Y4UA 4G07A 5LHHA 2QRVB 4TN1A 3DTYA 3ZD7A 4L4RA 1TKBA 3AG4C 4FOLA 4YV7A 1EFCA 4J49A 2Z95A 3A2KA 4DW0A 1PNOA 5HKKA 2Q50A 5FRDA 2VR1A 1AQJA 5ER6A 4D43A 2OBXA 1GTRA 3KD2A 1P60A 3L6RA 1IFXA 5EUBA 4L16A 5DP1A 3ZRXA 5ALRA 5FTJA 2XOKA 4QTXA 3GFVA 1DIHA 1Z88A 3H17A 3A11A 3KXPA 1H9BA 1B26A 3TOCA 1CYEA 5DM4A 4PR3A 1TAHA 1OXVA 3RQSA 5C8XA 4CMHA 4CEIA 3VSCA 1TO1E 2WKRA 1UC9A 4J3JA 3EGDB 2XITA 2CUTA 2QSAA 4ATNA 5AR1A 4DCVA 4DCSA 3NHKA 3TMKA 3NANA 3GR6A 5ENDA 1DBRA 2FDXA 1Y6XA 3H5RA 3W7XA 1JDUA 3AEKB 2HNBA 2GDJA 1ZHOA 2AX4A 1R9JA 3QV1A 2GILA 2B9ZA 3W6UA 4BKMA 2IS6A 1WW3A 3RGGA 1JTVA 4H1TA 1P5JA 4I8IA 1KJ9A 3G1WA 1DV1A 4ND6A 3ZW9A 2X0RA 3P1JA 4MUMA 3OP1A 4I99A 4XIYA 4XQGA 1F4VA 4WW0A 3V4SA 4BV8A 5F23A 4JZ2A 5K8VA 1JEEA 5K0SA 1E1DA 3ZRWA 4WERA 4GMKA 2OWEA 3UXYA 3ETEA 5A4MS 1SBNE 4RIFA 1D8AA 5I3ZA 1TKRA 3NUQA 1IN5A 3GLTA 2P2NA 4KDCA 3TWOA 3N05A 4BJ5A 1N57A 1VQNV 4EAQA 2FEWB 4QU8A 3QFFA 3DLBA 1VGQA 2FW1A 3P0IA 1AP5A 5K0TA 4Q7LA 5FKJA 3IRUA 4V3CA 3CCQV 3B1XA 3LQQA 3TAHA 1OLSB 1GA6A 2BGRA 2YV5A 3OZAA 3TO5A 2BELA 3NHFA 4MI9A 2R8ZA 4P5EA 3H13A 3MUFA 1E1QA 1BEUB 2ZSHA 4CZ2A 4IIGA 5L95A 4MW1A 4EG6A 2VDNB 4C6TB 2W42A 2F8SA 1PK8A 5ALQA 4Z7OB 3OJXA 3GJ7A 1BDIA 1ZX3A 3WWEA 5DISB 2OKCA 1FK8A 3QMVA 5IK2A 1D1QA 3ETLA 4C29A 4NG4A 3MBIA 5KPJA 1SZPA 3CH7A 1AKVA 2XTZA 1UF9A 3ND9A 1Y80A 2HNKA 4UNIA 3H1TA 1XXHE 4EPVA 1DAKA 3H2KA 3EVTA 2H7XA 3CRNA 1GCIA 3IILA 1G59A 3OEWA 3U4AA 3MRXA 4CEHA 4D80A 2QSUA 3L07A 1KK2A 4J03A 3AK2A 2JARA 3QBVA 2FX2A 4GNRA 5KA6A 3T5BA 1W4RA 1HDRA 3S1SA 2F9LA 4OFZA 4C4SA 1QH1A 2C7BA 2C31A 2GM3A 4OHWA 4XX1A 2G1KA 4CCYA 1O0SA 1A7AA 4I4TA 1CUBA 3LX6A 3UQZA 3SXUA 1MC8A 2CHVA 4F6RB 2BGTA 1CKEA 2QGZA 3NWEA 1F0PA 5SY6A 1LPNA 1Z0KA 1YB7A 4DLPA 3DMNA 1VHDA 2BEVB 2GCGA 4MUIA 4DLTA 2VDWB 2I62A 3F46A 4TROA 1HZZA 1DTOA 2X8BA 3KE9A 1G98A 1I7LA 4ZZ2A 2IBZH 1BGVA 4U9IS 5ILOA 4K0KB 5FNVF 1QQ7A 4LUCA 1Y98A 1SVOA 1Q1GA 3D8BA 3WOVA 1F8XA 4LYFA 3OOHA 5FWYB 3ODGA 3SC2A 2BRUA 1C7JA 4CIVA 4UD6A 2WU0A 3LPLA 3K9GA 3I2FA 1JG7A 3BRWD 4J7AA 4X9QA 1PT5A 1UIRA 3L7MA 3PC3A 2XRMA 1M72A 4FYXA 3PVCA 1QCZA 3FR7A 1Q86W 3AKZA 3BMNB 2YWBA 4JJFA 1QGUA 2FDCA 4KIJA 3VU9B 4I8XA 4CF7A 4DLYA 3EMKA 3LOQA 1VFNA 4FNGA 4Z99A 4BVJA 4PDVA 2XA2A 2XUPA 1JECA 4LNUB 4YC7A 2Q69A 3DZ8A 4QO7A 2D8MA 4ARIA 3KFXA 4LXTA 2Y0BA 1QP8A 4P31A 2W8ZA 2OECA 5MN5A 4PPNA 1KU0A 5JARA 1Z38A 5E3IA 5KHLB 1BJTA 5FORA 3ES9A 4W5QA 3HU1A 5DHUA 1AHNA 4Q3AA 1GN6A 3HO1A 3MLBA 1PI3A 2PLRA 3CNHA 1LNQA 3ETDA 3G0OA 4X3OA 1ZK2A 2C9OA 2Z09A 1COWA 4KXWA 3MRTA 4MQEA 4HTAA 3K16A 3AP3A 5BOVA 1Z0UA 1JR9A 3R23A 2PTGA 5ELMA 3OTHA 2ZRHA 1HRDA 2HFEC 3PN1A 4DK1A 3HJRA 5HP4A 3EZ6A 5IT4A 5A3VA 4LW8A 4ERXA 4ZCPA 4LWSA 5JDCC 1CQPA 3QO7A 4YAGA 2CMGA 3RU9A 2F43A 1QOQB 3Q0EA 4WASA 3T3HA 3C0KA 4M9RA 4RQBA 1VIAA 1L7VC 2C00A 2WVGA 2ZJZA 1M2FA 3NOQA 4RPJA 2VPIA 3E8GA 3IHTA 5EJMA 5EUMA 2OP0A 5E6RB 2G9ZA 4QWWA 3WHIA 4P84A 3G89A 4MH0R 3VC3A 4ZO7A 1ZOLA 5IAAA 1MIOA 2PJUA 2B3DA 4MVCA 3AKCA 4EY5A 2PUSA 4OQ4A 3WMRA 1FRFS 2GPBA 2RHMA 1U98A 4P2BA 5BXZA 5EIAA 1H6AA 3EIHA 1OTYA 1LBSA 1Y37A 1MJGA 5C32A 1D4OA 1JE1A 1OT3A 1S8AA 1R64A 3IHWA 3FWPA 3GXBA 2P9FA 4ED9A 3C3YA 3KBOA 2IYTA 3C5WP 1XNRB 1Y7LA 2CFIA 1T5IA 4YEDA 4CEJB 3RHTA 1NRIA 2C2WA 5BSEA 3SF8A 5HWSA 1WJZA 5JFGA 4RKEA 2IEIA 3HDJA 1V8ZA 3R7WA 2GD6A 3QHPA 4A6EA 2C57A 2IZZA 3B7PA 5KNBD 1YBAA 3F0TA 3RSFA 3KKEA 5DBIA 1KY2A 3CEAA 1VB3A 1N2CE 3KQPA 4F4FA 2WWRA 3TQRA 2GHYA 3PYLA 3QU4A 3RC3A 3RHZA 5DTMA 3I09A 3A1CA 3T95A 3G9UA 1OOEA 1QHNA 3VKVA 4GI2A 2IHVA 1FFBA 3QQ5A 4DCGA 4ESVA 1SXQA 3ML1A 1T1SA 3BE5A 4NYMR 3T7TA 3WA6A 5LOVF 5AKKA 1HYEA 3A1WA 1OLOA 5KYKA 2EJUA 3AUXA 2MYPA 1C1DB 1YQGA 1HDYA 2XUZA 3H2HA 2O7NA 3FPLA 4QXMA 1Q8IA 3RHFA 1TYBE 2ZSAA 4NMMA 2D2CB 2GTAA 1AZTA 1QK3A 2IJJA 1LPOA 1DC8A 5SYMA 3KQQA 4MUEA 1U2QA 1SVLA 2QI9C 1PL6A 2EKLA 5I4IA 2RBGA 3EFEA 3OQNA 5KX5B 3SVZA 2OV4A 3HH8A 3TKYA 3USES 3IP1A 3UO3A 4TSFG 3DR3A 5EOVA 2IX3A 5CM2Z 3NAMA 3OIFA 2EILC 1ORWA 1ODCA 2QZ9A 1OTXA 2ZRCA 1Z5WA 4C0QC 1EX1A 4HGZA 4JIGA 1QTIA 4RD3A 1G8HA 1ITZA 1CE8A 1LVUA 1LXCA 3LSTA 1N0JA 3ZDCA 3FZEA 4KACA 2FSFA 3N6RA 1H3EA 2QG6A 3M89A 1EVZA 2DSNA 5JJBA 2B5UA 4NTWA 2G77B 1EN5A 3IMCA 5PNTA 3ECAA 3VNQA 3BIWA 3GBVA 3SMQA 4AU1A 3FTDA 1XQVA 5JO9A 4IV5A 2DHEA 2FPKA 2IYXA 3MT7A 1DQPA 3MF4A 2WE8A 2VPXA 1QORA 3GT3A 4YJFB 2Y93A 3M3DA 4MS1B 5KSZA 3HDHA 2FJ0A 3NHWA 1TVEA 3FVVA 2Z2XA 4EH1A 5LXTB 3NRBA 2EGGA 4Y30A 2EIXA 5TPWA 4F5YA 1TU4A 3VGJA 2J6HA 1C4OA 5TEWA 1GJRA 1XU7A 1FYFA 3LZDA 2EKBA 1N33B 1TT5B 4ZOCA 1PYDA 4QUGA 3KKQA 1DX4A 3O2QB 2GSWA 4FT2A 5IT5A 5DNEA 1BQ0A 4LBEC 3U3RA 1K9VF 3MMXA 4G4GA 2E1RA 2E85A 4UULA 1T4DA 3ZGLA 3CMMA 1X8KA 1L5HB 2BSXA 2ZSIA 3KBBA 4DR3B 3DF7A 3D4NA 1CUJA 2OIEA 3TINA 1XNGA 1GFWA 3PWSA 1W1IA 3EVFA 4PSDA 1ZN8A 4FCWA 3I2IA 2OK8A 1DGQA 3TW0A 4LSZA 2X9GA 1B42A 5DK4A 3UGQA 2ZYDA 1CZNA 1XN4A 3D0OA 4BQIA 2WJYA 1S3GA 1NS1A 3R7SA 5JS7A 1Y7HA 5GOTA 1UZAA 2VDMB 4IR7A 3RTAA 1YFZA 1Q0ZA 2BOBC 4FR5A 2IEZA 3ANNA 2NQ2C 4XWTA 3AM5A 3LDHA 1I0LA 2I1QA 1GPLA 4R2MA 5HM8A 3BKXA 1NQAO 2GZHA 4TTRA 2XWQA 4XPZA 4A2CA 4X90A 3P20A 1QIMA 4BVGA 1LUVA 2Z8YM 4R05A 1UFKA 1NTMH 3JZMA 3BJEA 4TLAA 2R5FA 1UXHA 2XGSA 3TRDA 4YR9A 5LYJB 5H9VA 2YIVX 1ZIOA 5I9NA 4YWHA 4PSVA 1DF5A 3JVUA 9LDTA 5CLGA 5LP6A 2ZYSA 2P27A 4L85A 1PGPA 4EJMA 1M5TA 1A9XB 1PKEA 2I1VB 3L3BA 1P7CA 5CD1A 2HREA 2DFNA 3B40A 3BA8A 4LJAA 1NN5A 3PX3A 4ZVMA 3BGDA 3W8DA 1ODFA 4P36A 1IMOA 2C9ZA 1TZBA 3C6XA 4NP6A 2DB3A 4P4UA 3BFKA 1P2TA 1MB3A 1R16A 1RLUA 8LDHA 2G82A 3UANA 1AO0A 3DBRB 1KOFA 2QRMA 3EJ6A 2ZBGA 2AG5A 3IURA 1HFWA 1NDHA 4ZEXA 5A4AA 4G2KA 2JGDB 1D9ZA 2ZJFA 2XVXA 4HPXB 3FYUA 2RAPA 2XUQA 3QKSB 1PBNA 2PMCA 5JVDA 5GV8A 3UWKA 3AP2A 2R8EA 4OHCA 1ZIPA 2PUEA 1SC5B 1VCIA 4NCIA 4LXUA 2L35A 4KWCA 1U0BB 1FE8A 3H2YA 2X6CA 4TLBA 5IZ4A 5I47A 2QK4A 4M7WA 1DAMA 3CPWU 3K0BA 2BFBA 1UBFA 1UKVY 3ZUGA 4POOA 1N2IA 2C4WA 3IP8A 2CMHA 1EKXA 2G88A 2HDOA 1Z7EA 5EBWC 2BKLA 3KSBC 3WLFA 4DSOA 3HXQA 2A67A 5JCZA 5EHGA 1QMPA 1WS6A 3CBGA 2QAGC 2P77A 4K86A 1B6QA 1K89A 1EFDN 3F9CA 2DFPA 1JB9A 2NU9A 4G4JA 4PFJA 1JR3A 4BNLA 1ECLA 3ZU4A 1Y8RA 3M2TA 2BHLA 2NSLA 2R6GA 4UB8Z 2AQIA 1DB3A 4F1KA 3E9MA 1AKUA 1N2XA 4Q20A 2CMDA 4H3VA 4IV8A 3C3TA 1XZEA 2W6PA 1ECPA 4IAOA 1KZ7B 3ZCXA 2QUIA 3E4DA 2XNDD 1EGAA 3FLAA 3HXTA 4KO3S 4TQDA 3NNDA 2X4DA 3CP1A 3QHAA 3ENQA 5LZ2A 4JUFA 5K0LA 1BNCA 1HDEA 2OPHA 2REOA 5A05A 1C9MA 3RTEA 2EFGA 4E1BA 5HFLA 2HWYA 2FCRA 4N5DA 1LBEA 2J85A 4NTYA 5JSZB 1ND6A 3KYDB 2BFDB 4CIWA 1NYTA 4ZRMA 3A1EA 1MQAA 1ZVJA 4BS9A 3OT1A 3BXGA 1PKXA 4A23A 1U3DA 1R15A 1KFEB 3QBTA 3SS9X 3WY9A 1E2PA 5BO5A 3JD1A 3VA7A 4ZCIA 4RJJA 1OXSC 3EZ7A 1LBQA 1TI7A 3UUWA 4ARAA 2WF5A 4BKUA 1P1CA 1RFLA 3FB8C 4W8GA 2JRCA 1DOAA 1ARZA 3OIUA 1ZM4A 2VQDA 4DSUA 4E6EA 4US2R 2J0UA 2FJUA 3T99A 5A9GA 2YIBA 5C8VA 3B7GA 4J0KA 1TYAE 1AJNA 2B0CA 4NKGB 4KW7A 1I7QB 3BK7A 5MN4A 4D4IA 3GD7A 3ERCA 2BW0A 4FPPA 1RI4A 2H1OA 4WZAA 3WICA 1PJ2A 5EQDA 3N86A 3UT5B 4BNDA 1Q15A 4CRWB 4O4HB 3IQZA 2AI3A 4CLXA 3GIWA 2ODBA 3UG7A 4GZ6A 2UYCA 2C54A 4WQMA 2DLNA 4NTZA 1R5JA 4GYKA 3ZQ6A 1U0SY 4DA6A 2PRSA 4NSNA 4WLEA 5I7RA 2O8CB 3RJMA 1JZTA 1XVTA 4QDZA 3GP3A 4BDTA 4J43A 4C0LA 1U2SA 4IQGA 5SV2A 4O3MA 1GTZA 4S1PA 3H1KH 4DN6A 2G76A 3DTNA 1ZSNA 2M6LA 3GLHA 5IWAB 3HXLA 2QJWA 1QO9A 1I3OA 3CPHA 4L74A 5LWQA 1G66A 2UVPA 3TIGA 1O9GA 5HF5A 3SLGA 4RZSA 4AKSA 1US8A 2XT0A 2M7WA 1KJWA 5EXXA 1G55A 1KMMA 1F7UA 4DLXA 3FBGA 4AWBA 4IIJB 3V6LA 3UPDA 2H2WA 2YIJA 3UCEA 1CZHA 3FUCA 4JEIA 2UUBO 4JJ6A 2F62A 2ANCA 2K4MA 4IZOA 3ZE9A 3MRVA 1E3JA 1ODTC 2Y48A 2FMFA 4REQA 5DULA 2C4VA 2OC9A 1H2YA 2IUYA 2Q7GA 3GG2A 1YQDA 1ENVA 2BWJA 4LRQA 4NCXA 5WRFA 1Q19A 1OB2A 1BDBA 1I3MA 2ZJ0A 1K3UB 4JT2A 3QZUA 1AI5A 2P8SA 2Y68A 3DOIA 3DUWA 2Y67A 1US6A 3HCOA 2QTWB 4AJIA 5TSDA 721PA 3KPYA 4F4UA 1SESA 4HDNB 3FGOA 5I7SA 2WUEA 2R9RB 2OWOA 2A0KA 3PWZA 3ZCSA 1EFHA 4ZVNA 4L02A 3LLVA 1P1KA 4CF5A 3SNKA 3MB8A 2HG5C 5KUKA 3F9RA 2OV8A 2CLDX 2YRXA 2GSMB 1KYTA 5KC9A 1EAMA 2C9MA 1BN6A 3T4UA 1J9ZA 1LDYA 3EWNA 3RR2A 4CF3A 2HSZA 2MSKA 4P83A 4F38A 3CNOA 2WNHA 5E1DA 2VHUA 3RK1A 1VE1A 3ANTA 5JZOA 1Q17A 5CVDA 5KYVA 3AR5A 4B82A 3RS0A 1C9NA 5COBA 4FDVA 3SHFA 5AYVA 1M33A 4PZAA 2HRCA 4NNPA 1WUJS 2EAUA 2QYHA 5HSGA 1ISJA 5CX4A 4HQ6A 4RLQA 1GPAA 3SEFA 2QWRB 2P0AA 2W4IA 3C70A 1S3SA 2G0AA 4JC8A 4ZRDA 1CDZA 3M5DA 4XIFA 3CNLA 3TTTA 4Y98A 3H9JA 5JXHA 3G68A 2OESA 2D4HA 1TPZA 2BUCA 4GSKA 1G16A 3DSQA 2XYHA 1NN1A 5IH7A 1NJ6A 5K5EA 1KY3A 2OFPA 4GP7A 3O82A 1U99A 2AD1A 5ENZA 3GLKA 1N5KA 1QYRA 1DO8A 4MPRA 2B4AA 4AZVA 3RN4A 2GYWA 1REQB 5AW3A 3UKOA 4A5SA 5JE8A 2DUMA 1C30B 1PT7A 5L3SA 1DEXA 1N7GA 5ICSA 5HQJA 1HNXB 1UOPA 2PZEA 4S35A 3NUGA 4QXRA 2VHCA 5IF9A 4M1KA 2QBYA 3U10A 4MEAA 1EVKA 4LN1A 3O3MB 4BX9A 1GN3A 2QNIA 2Y2VA 3GGSA 3L8ZA 2GEFA 3AG7A 3FX7A 1SKAA 1FF9A 2A30A 1U9ZA 5BMVA 1UJBA 3KHTA 2W93A 3CCLV 1EQ2A 4G0MA 4ITUA 3MJCA 1WPXA 1OX4A 5CLFA 2FFJA 4QJBA 2JJ1G 3AWIA 2RJZA 4NPHA 1ST3A 1WXIA 1N8NA 5DNWA 5LCXA 1U4OA 1D2MA 1JWAB 2ZM6B 3AEQB 3ZK8A 4FFWA 1GV1A 4GI7A 5GJVC 5ES4B 2PMWB 1ID8A 3BTVA 2QTAA 2HBQA 2GX6A 3LDCA 4PRLA 1R3UA 3RFXA 1BYIA 3S28A 5D85A 1MX3A 3EG5A 1TPYA 5DYYA 2DM6A 2W2MA 4C03A 2W2QA 3CCCA 4FMPA 4RQFA 4Z4EA 1CEYA 1Z9BA 3A6FA 4DTIA 1KRWA 1BL8A 1V25A 1IM2A 2FVXA 4GS5A 1X9IA 3PXCX 2NYRA 1H3NA 2FPRA 3YASA 3KYCA 1JHQA 1WB8A 1N2GA 5IJAA 4O5OA 1VIDA 3FYHA 4G0YA 5EP1A 3ZMTA 3MTJA 3E8BA 5B3JC 3C5CA 3DHWC 1J0EA 1B1CA 5LXTF 2W48A 4RFVA 4RQUA 1XKQA 4TUYA 1LU9A 1RFYA 3RIEA 3QI7A 5FD8A 4URWR 3W6ZA 4LEIA 5DHRA 4M7OA 2RKOA 4C2AA 3IESA 3MMNA 4C88A 1JE0A 4QYWA 2R6ZA 2DECA 3BRWA 4DVJA 1SVWA 2JCGA 4X8LA 2GCNA 4OGLA 3VZPA 4HH0A 3DBLB 1KPGA 3GEPA 3E2MA 4L8WB 1K5DA 3RKRA 3GPIA 1EJ0A 3P27A 1J42A 3IBTA 5J4LA 2B9EA 2FE4A 1JLKA 1DWUA 1ECFA 3RSCA 3PFFA 3GJ6A 5DH9A 4KQ2A 4WK4B 3Q4HA 3MA0A 4EHIA 5DJ5A 2ZBEA 2OVBA 2AG1A 4TTAA 4PXYA 2V3VA 3GVIA 1PO7A 3M3HA 3ZE8A 1J0AA 5E7JA 3UFXB 5JH7F 1YCIA 1J90A 5DE3A 5A04A 2IXBA 2PUBA 1OCZB 4EHJA 3CC7V 5REQA 1VXRA 3WL4A 4N48A 1T5TA 3G2LA 4E2FA 4BE9A 3WDMA 1R18A 1L7PA 2DJ5A 4QEZA 3HUEA 2E5LO 1I5EA 2X1HA 2Z6VA 1XDCA 2AXQA 2BP7B 1QIIA 4ZPJA 4FMDB 4KWIA 2P5TB 1RI5A 3GVCA 5CX1B 3WAKA 3GRYA 4MR8A 5LMUO 1NW7A 4I1IA 1XB2A 2XE4A 3U9SA 3H0CA 3SDLA 2BMWA 3DZGA 5DM70 3ZEIA 1MAVA 5IYZB 5DVZA 4WOKA 3PXBA 2ZT8A 1KEKA 4PD4F 3VR6H 3TI9A 4BQPA 4XD7D 5FTKA 3JQAB 5JNSA 1EZZA 3C45A 2ZCUA 3O2SB 3I9V1 4X8MA 5DW3A 1O0BA 1BA2A 3KZCA 3HVRA 3B1VA 4C7UA 3LVFO 2CY0A 1RPNA 1O4WA 1NVGA 1PTJC 3P2IA 2XUOA 3UK2A 2JIRA 4EHNA 1MG1A 1WAZA 1S5HC 2YXNA 2NADA 4U2FA 2ETVA 5KNDD 4RELA 3SF0A 3B9QA 1B1AA 1E62A 2V7BA 5K6RA 4GQBA 4RENA 4KLZA 3COJA 3PB3A 3VC7A 3MQ4A 2P67A 4OHKA 3PCTA 1RLTA 4KPGA 3WO0A 3DZHA 5BV8A 4PANA 3CM0A 2R70A 2IIQA 3KDSE 1VRVA 2FPUA 5T3UA 4RAQA 5D3KA 3KELA 1PNRA 1YFJA 1RYDA 3CMEV 1HDCA 1UMDB 3OAAG 2R96A 2IQ5A 5KNBA 4TSFD 1N36O 2ONCA 2NPFA 4QE3A 4QFBA 4YGXB 2W2OA 5EFOA 1Q2XA 4B3XA 1JDZA 1XHLA 4E4YA 4CQLA 1WR8A 5JHHB 2B37A 2YY5A 3RVPA 4RUEA 2EARA 4MLZA 5EAIA 1J70A 1LDGA 2ZJ8A 2F1JA 3WBBA 1OI3A 1LNZA 4A03A 4ZAYA 4D57A 3ASNC 3WK4A 2L0XA 3D64A 4PAWA 1U6JA 4MSWC 1CJSA 3IODA 3P94A 4K9NA 4DM3A 4RVUA 1PZNA 4TXLA 1UM8A 3JCZA 1VQLV 5TT1A 4PX9A 5EZYB 4R16A 3B2EE 3G4SV 1YEWA 1XNQO 1Q43A 3LKDA 2QL7A 2VJMA 4UCFA 2Y27A 1Z35A 2BJVA 3WB9A 1Q11A 4L3OA 1SB8A 3P71T 4AY4A 1NAHA 3E3AA 3NS7A 1ZMOA 1RPRA 3BOSA 1X19A 1EUZA 4A8TA 3FUUA 5IFLA 3S0JA 2VTVA 4MCIA 5DT2A 1JQEA 1RJWA 2EFYA 3GVMA 3QEBZ 1ZNXA 2X4GA 4Z4CA 5CGZA 1KJQA 2ZYIA 4E0BA 3ZKWB 1QAQA 3VR2D 5KLVH 3QBEA 1Z0ZA 3RG2A 2DRIA 1MX1A 3BXEA 5DHQA 1RMTA 4JIMA 1QCEA 2BJWA 4C5AA 4YCLA 1DE0A 2ZD9A 3EZ2A 5KHOC 3J80N 5DWVA 4GOKA 1Z25A 3CX4A 2J6CA 3BH6A 3I1JA 1ZH6A 3GEGA 4HY3A 1TIPA 3AOEC 1L5QA 5JO0A 2YJGA 4H4DA 4UHBA 1KU9A 5ALOA 4H18A 4OHXA 2CVHA 4OJNA 1NY5A 4UVCA 2WG1A 3ELBA 4PDLA 3K5HA 4GX1A 3JR7A 3JR3A 3PC7A 4BB0A 3B82A 1A9YA 2QWQB 1XFAA 1INLA 2NYVA 1YU9A 4FFRA 5CT9A 2RGRA 1QXSA 1ADJA 2Q9BA 2F93B 3IPCA 5DX8A 5HK8A 5HIJA 1JIJA 2FB9A 4EKYA 3AUTA 5K0JA 3D2AA 1VQ8V 1FRZA 1SUCA 2Q49A 2QX4A 2ZXEA 1EXMA 3AEXA 1MJGM 1V2GA 4DM7A 4PNEA 2ZLBA 4URVR 4YUAA 1T0UA 3ZGNA 2ZAGA 2FN7A 3FHCB 3AO0B 1E9AA 2CDYA 2B30A 3LP5A 3S2EA 1R0LA 3G2JA 5B1AB 4WNAA 3CCEV 1AR5A 4PNZA 4TWZA 5BNZA 3UB4A 3BWVA 2EIMB 1OLXA 3ZE2B 2ZR0A 4XYBA 4MV3A 4AP5A 1IY2A 5JQGB 1S76D 1N4DA 7YASA 4YI3A 2N74A 1LPAB 1GPNA 5T7BA 2Y1OA 3M7MX 1JILA 3PUXA 1EFLA 3PS9A 4BO5A 1P62B 3ZLVA 3OE4A 2V7QA 2E3CA 4UXIA 3VU3A 2DOKA 5BVHB 3F6CA 4ZI5A 2NSDA 1IZZA 2I2FA 3CX3A 3I61A 5AJTA 2EOAA 1ULBA 1WXWA 2ZB4A 3FPEA 4J76A 2YIMA 1UZUA 1LW6E 5A7FA 1XREA 1ISGA 1AZWA 3LM8A 3EEOA 2GB4A 1UC4B 5CPFA 4W1QA 3BXZA 1D2DA 2HQBA 3EA0A 2ZUFA 4D5GA 2JPDA 4Z7NB 1PDWA 3QUAA 2Q5LA 1OBOA 1JNYA 1EA5A 1HFKA 3GJQA 2I3GA 3K35A 2KS6A 3C6BA 4R5MA 3U4IA 2C97A 2CWDA 1Z6GA 5GADl 3WGQA 4B9AA 1KWKA 4X1YA 1DINA 4PLZA 4CM9D 4C6RA 1GG9A 2QJTA 5M5BA 1OIWA 2RGNA 2EG5A 5LL6P 3CVJA 1DJPA 4F04A 1TCUA 1NV8A 3QXHA 4WFAV 3ASUA 1CIJA 1GU1A 3QKIA 1JYEA 5ECGC 2V7PA 3GOHA 2HPHA 2EZPA 4S2UA 3D4IA 4OHYA 3PDJA 4NK5A 3GLUA 4H9GA 2P8JA 2NO7A 3QXGA 2E4WA 4Q19A 5GV7A 3E8SA 1L5SA 1OLUA 1A8HA 2FZEA 3AQIA 1NTKH 3I3OA 3FNFA 3K09C 1RBQA 4HC4A 3GJ0A 4ZHQA 1FVOA 3ZS8A 1DBWA 2XDQA 1SKUA 3QMPA 4LOKA 5H3LA 3NONA 2FSPA 1VPEA 6Q21A 1PQUA 4PC6A 4OQLA 4Y1FA 2OHXA 3ZHQA 4AWXA 5AT1A 3RTDA 5IZCA 4ZK2A 3QNWA 1TIKA 2C3UA 5HFAA 2P5UA 3K5OA 3VSEA 2BMEA 1LBIA 2W6JG 3B89A 4IINA 5IAKA 3I58A 2WABA 4YRTA 3GLIB 4JLDA 2WYVA 1NUQA 3GT0A 1BJKA 3R8XA 1MBZA 4F3KA 3BA6A 2HL6A 4QYIB 4KUHA 5TT0A 1PFGA 4IXTA 2Q7OE 1SQGA 3GI1A 3BWEA 4LCBA 1C0PA 2XNDA 4Z7QB 4ZO6A 1WA5A 4WEQA 5LDDC 4LOIA 3LECA 3CEJA 3VPHA 4EAAA 3QVNA 2CNDA 3EPPA 2W8BB 2FFQA 5KZMB 3DNFA 1V7ZA 4BUJA 4JASA 3RJ9A 5CLQA 3HRIA 3QEMA 5MHTA 3CRZA 2WVHA 1LTQA 1ZVKA 4RS4A 1N6RA 2J8ZA 2GN2A 1Y9EA 2FP4A 2ZYVX 3LIIA 4MUAA 4H2DA 4WFIA 2GR9A 2FR0A 4MPTA 3AHFA 4R6XA 4RIGA 1SXJE 1BWRA 4U39A 3NHMA 2PZAA 2MSWA 4HB2A 5G1OA 4O4JB 1YZYA 3CE6A 5JI3E 5JJCA 2JI6A 1H5QA 4H7FA 1O7JA 4XARA 3CISA 1WMSA 3Q2KA 3HBMA 3I3SR