5D5QA

Hcgb from methanocaldococcus jannaschii with the pyridinol derived from fegp cofactor of [fe]-hydrogenase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
b'VMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0488, Guanylyltransferase
publication title Towards artificial methanogenesis: biosynthesis of the [Fe]-hydrogenase cofactor and characterization of the semi-synthetic hydrogenase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 51
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5d5qA01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 5d5qA02
3BRCA 2D0OB 1T5EA 2D0PB 2F1MA 3WB0A 2V4DA 1IWBB 1EEXB 1VF7A 1EGMB 1H2SB 5JJEB 1UC5B 1UC4B 1NBWB 1RSOA 4DK1A 4DK0A 1MMFB 3WB2A 4L8JA 2F95B 3LNNA 5D5QA 5D5PA 1DIOB 2F93B 4GYCB 3WB1A 5JJNB 1IWPB 3AUJB 5JJJB 1EGVB
chains in the Genus database with same CATH superfamily
5HUHA 4MYTA 3HU2A 1C1XB 3FCEA 1R6XA 3F4BA 2HTEA 4FLTA 2FSHA 4OBXA 3G8AA 4JR1A 1AF4A 2W2NA 3DAGA 3WFVA 4BXOB 1XD8A 1WNSA 3PEUA 5TRTA 1DIGA 2JLQA 2UYOA 1D1SA 1DQZA 2PJRA 5DM6V 3B40A 2HY7A 3QVNA 2CJFA 1F8GA 4EG7A 3DBIA 2Z3WA 3ANYB 3IVCA 4B3GA 2P9BA 1CY4A 4H6PA 1SQBH 1P17A 3FKJA 3KUKA 4YI3A 1MZPA 2AHOA 2HSGA 1GU7A 4RIFA 3OLZA 4NS4A 4EPRA 3R5SA 3BIOA 3M83A 1OCRC 5IN5A 1WMDA 3NBKA 4IFBA 2YWBA 1H05A 1NN1A 2R5NA 4ZDKA 2YY5A 4OY3A 4KQKA 5IKEA 5IK2D 1G41A 3L6EA 1Y4UA 4C2AA 3W8NA 2PSHA 1FEZA 5C8ZA 5LB2A 3VOAA 3U7JA 4EENA 1S2DA 2Q4OA 1ORWA 2D2EA 1Q19A 3AW8A 1ZEJA 5K6TA 1ISJA 5I3ZA 4LBVA 3R0JA 3PHIA 4Y1RA 4Q5IA 2YVLA 2BTOA 1OQAA 3AEKA 1NFFA 3GA5A 3Q7TA 5TPZD 3HKBA 3I52A 2EARA 3NBAA 5BMOA 5FAXA 2YOHA 1COWG 1WHSA 1OFUA 1G5RA 4KFUA 2CMHA 3G88A 5J43A 3RANA 2K1EA 4A0HA 4WZBB 1OFVA 3O0DA 4ZDJA 1MA0A 1C9DB 4YRJA 2BEJA 2W7TA 3K0AA 4WXPA 1GCGA 1KJQA 3O4HA 4R1MA 3MAAC 3ZU4A 1MLDA 1NAHA 1W73A 2CTWA 3RVPA 3MS4A 1ZUIA 3LXMA 1VSVA 5K51A 2VTEA 2LW7A 1B93A 4XPZA 2BGNA 3LP8A 3IX7A 2Z5GA 2J3LA 2AOXA 3IR6A 5J59A 5KTRA 4NYJR 1EK0A 4RULA 5DBIA 2X77A 4P4NA 13PKA 3LPAA 5GADl 3GB7C 3C8ZA 1HEYA 2UUPA 3BHIA 1A9XA 2OV6A 4PE5B 5JW6A 3F5TA 1C29B 5D51S 3OQPA 1Y5MA 4BFVA 5IJ9A 1EX9A 3D6MA 2LD4A 3WBJA 4E09A 1YB7A 1Q74A 2FWBA 2K5UA 1J2JA 1GU1A 2XVYA 1VLHA 4O4IB 1WB9A 3O21A 1E63A 3Q10A 3DXYA 2AF4C 4LGCA 2FQYA 2CXXA 3I01A 5H82A 4HNUA 4EDFA 3IKTA 3TPFA 4QNRA 3CBGA 2Y2VA 3IHTA 4WDRA 3IAFA 3T7DA 2W48A 4QPDA 1J2TA 4TTVA 1JWBB 5JAQA 3CD6V 1WW3A 3KXKA 2ZATA 4BP9A 4PNEA 2WFLB 3ABQB 4XIJA 3EXEB 4I9QA 4HYEA 5D3MB 1I80A 1NSTA 4MSWC 3IT1A 2Q6LA 4RH3A 4YV2A 3TZLA 4S1PA 4ZI2A 2BM9A 4YCDA 1KFEB 3KE8A 3SJUA 2H06A 1O96B 1IFXA 4TT3A 3BF7A 1DRKA 3L6OO 1VJGA 5IDWA 1BH6A 4QVKA 1T2UA 3W6UA 821PA 1BCRB 4K1XA 2ZB8A 5IMBA 2H1CA 4WJKB 4AZ3B 3IBGA 4UBLA 4ARSA 2C31A 5EP3A 2PXXA 4ZYXA 1N57A 1SUCA 1TIBA 4NBTA 2OCAA 4CLOA 4CFSA 2PV0A 3KT3A 1P2FA 3PJRA 1IBCA 1ZN8A 1XLVA 1ZH6A 2RFLA 5HIJA 1VJ5A 5A5FA 5DSZA 1CJTC 3HP1A 1FDIA 3GLUA 4EVRA 1AQLA 1GTSA 4ISCA 2YJTD 4RD4A 4ZZ0A 2B9EA 1Z0FA 1ZUHA 3KG2A 2GWHA 2GPWA 1AS2A 2EZ8A 4G25A 3LBIA 4DR6O 1HLFA 5EHIA 4YMWA 3CCQV 6NULA 2LUOA 4DO2A 4ZK2A 1PWXA 1Z4KA 1XWFA 2WLSA 2QUJA 4WF9V 1H2FA 3TL6A 1XAIA 3OIFA 1NI4A 3LXRA 1SOMA 3URMA 3FNEA 5IHPA 4IEFB 4I5GA 4RE6A 3IA2A 3MUOA 1MHTA 5I9IA 4X3CA 3E6AA 2RKOA 2QLBA 1SPXA 4MW5A 5JS1A 4W5TA 2GZSA 4FR0A 1X39A 2X19A 1B43A 3FBWA 4I1UA 4E5UA 5KPDA 4OM7A 2CSXA 1ENOA 1F1JA 4DCGA 1XIVA 2GM4A 2X4IA 1RZVA 3KWLA 2ZCEA 3VNBA 5ALGA 2WLKA 4XWGA 3HN6A 3HZRA 4MEBA 2WSSG 1QRAA 2Q5FA 4L27A 4Q4AB 3WGQA 5EBMC 3GLFB 1M1NB 4CV2A 4FFMA 5CIYA 1C1DA 2DVMA 4YMHA 4ABYA 2R8EA 2OLKA 1V39A 5KU7A 2VIIA 3DZFA 4QKQA 3BWBA 1XJQA 4M4SA 4UZEA 2Z5LA 3SAJA 1B6QA 3PNVA 4RIEA 1H9AA 1JS1X 2H1LA 3UO3A 3NBZC 4UOQA 1B00A 4ESOA 4J1SA 1PR9A 2F8LA 3ZV5A 1WDMA 1FRQA 2R1TA 1TVCA 1F0YA 4FKMA 1MEOA 1MC5A 2IPXA 3NV7A 2CF6A 1XYYA 2OCPA 1KQ3A 4DS3A 3Q98A 2XQGA 2P9EA 1W76A 1F6BA 1W47A 3MPOA 2CLKB 2PKWA 2RHRA 3HEMA 1R9JA 3CCRV 3LUTB 1OX4B 1ES9A 1CDZA 3KYDB 4PLFA 5CT6A 1JFTA 2Y69B 1Z56C 4QDZA 3SS8A 1CZRA 3W2TA 3SHWA 1Z5OA 2HWYA 4PQEA 4UB6Z 3T1YB 1DOAA 1M0SA 2QM0A 3LIPA 4XPIA 3RGGA 1FLVA 1ZQ1A 3REFA 1AZLA 1A04A 4B2IA 2H1OA 1CETA 3L7AA 3JYPA 4TWBA 1FTQA 1AR5A 2FX5A 2B7LA 5GWXA 3FNIA 5HFJA 3W7SA 3QF4A 4HO1X 3G2LA 2JIBA 4R8KA 1Z45A 3KD2A 1KJ8A 2LW1A 4BC1A 5CH5A 5CEEA 1OB2A 4INZA 3RC3A 4NENB 2JFGA 5BR7A 1H5NA 4BVKA 1D0SA 1SVLA 1GPDG 4M0PA 4K6GA 1ZM4A 3UUEA 1CNEA 2VWGA 3FH0A 2DWQA 4X63A 2IRWA 1OPRA 1RLJA 3OEHD 3KR2A 2IYTA 4UKDA 1SBYA 3TSAA 4X1KA 4C4AA 3KCQA 1KAOA 3AEYA 5L4NA 3P9PA 5CW2A 4CEJA 3DGFC 2Q5ZA 3B8EA 4CCSA 1W8IA 3LVBA 1DOHA 1FU7A 3UJCA 2ODBA 1FFXB 1QK3A 4UOZA 3QVMA 2OZPA 2VWJA 5BSRA 2J41A 4ZARA 1ODKA 1WBDA 4NHOA 4JEMA 2PO5A 3C3SA 1KFKB 2CGEA 3CX8A 3HVJA 3ORSA 4R2HA 3D3EA 1UBUS 2EP5A 1Z35A 2FPKA 1FLAA 3DUFB 3TE6A 4XD7A 2NVBA 1U8AA 4YLYA 2VAPA 3U3ZA 5H2FZ 3PXDA 4IUYA 4NXNO 4FFBB 1RAFA 3K6SA 2JAHA 1HQDA 2FPWA 5K3SA 4C6RA 4CMGA 1SUBA 3UUFA 3ASOC 2OO5A 4JZYA 3SC3A 1XQ8A 1SKVA 3WMRA 3C70A 3DMRA 3FFBA 4C4PA 4EYKA 4F93B 5CA1A 1V3UA 1ONNA 2FFHA 2IV3A 3AIMA 2XJ4A 2AI3A 4IQGA 3JX9A 3C24A 1PDVA 1IY2A 3TS1A 1M1ZA 2P4QA 2CFTA 3A10A 2D1RA 3KSUA 3QLTA 4DXDA 1RQPA 1R8SA 1X74A 1GGNA 1NONA 4RTNA 4JVNA 5ERXA 1BN7A 1WBBA 2PGGA 4XVHA 2VHVA 4HC4A 7MDHA 3B82A 1H22A 3ILSA 4H44B 4FMCB 1EVKA 2V96A 2O5RA 5TMPA 4OUDA 2RG1A 2ZWOA 1JJOA 4ZK6A 1QJ4A 3X2QB 3HG7A 4QM7A 2JIQA 1OHHD 3STUA 4KPGA 2BH9A 1I94B 2JZOA 4CQLB 4D2IA 3DDWA 3A4VA 5JT1A 4PYJA 5KHGA 5CGQB 3VR4D 3CE9A 3EMBA 4LRSB 4G28B 2QVBA 2B2XA 2X23A 1KEVA 5FT9A 1KFBB 3AWDA 2IXFA 2QLTA 3PF8A 4GSKA 3E82A 3ERCA 5B7PA 3AJDA 1O0SA 2ZE8A 1E77A 1XZCA 2EDAA 5F2VO 2J7PD 4CKBA 4PTZA 3QFSA 1VIMA 2BKUA 3RQIA 5DI3B 3GLRA 4A4DA 2FWNA 1J5EB 4X89A 2FEKA 4ES6A 1R3IC 4TN5A 2ZYRA 2GDJA 3L7NA 2HHHO 1RAHA 3MWYW 5A4MS 2BGLA 1B6TA 5BUSA 4JFAA 4IJUA 1LBHA 2NUAA 5ALPA 2XTAA 3CNHA 2ZRAA 4OFZA 1CCWA 3FOFC 1ODIA 5HVNA 5EP4A 2QXYA 3L6BA 4EZBA 4YRNA 1I14A 1F6WA 1Q7YW 3OZSA 4EHHA 5IZCA 4MH0R 3AF5A 3U49A 5AW3A 3AEXA 3W2HA 4CMEC 1Q3KA 3UAZA 2H8GA 4K28A 1UJ6A 5EJ4A 5JSZB 1Z82A 2FN7A 4BY9E 2AH5A 2RDCA 3D2CA 4QG3A 4CQMA 3T7CA 5J4LA 5I5EA 4N3BA 4B3HA 4Y0NA 4Q16A 2NXEA 2Y1OA 3V00A 4EB0A 4EO7A 5AHOA 3T9BA 3TIXB 1T13A 4U7TB 3AF1A 1KZ7B 1GZ4A 1PG0A 4JLPA 4CM8A 3NHMA 2O6HA 2RHJA 1NUAA 4Q19A 4F5YA 2EINB 4L75A 3FWKA 1PK8A 1NVTA 2J9GA 3AU8A 3C3CA 3TNDA 2B36A 2PUTA 3C3YA 4LOKA 4JVLA 3FSRA 3IR7A 1E6MA 1XEXB 1V3QE 1YULA 1ZG3A 3EEFA 1GFZA 1MO5A 5G2OA 3HDVA 5EN4A 3CCBA 1D5CA 2C4UA 1A97A 3ONFA 4YV1A 3ILYA 4U5XA 4BLQA 4IJ6A 1DMRA 1JA8A 4CEIB 5FHRA 4XFDA 1R0YA 3DYBA 3KAQA 1EXDA 5A3SA 1ZK0A 3KPVA 3ODGA 3R9KA 2CJWA 2WW8A 3NWOA 2F1JA 1RU3A 4BN0A 4I7EA 2FW6A 4JLAA 1Q43A 3X43A 1NRIA 2WJAA 4X54A 3RB8A 4ENQA 4JI8O 1JIJA 3LDAA 5LLTA 4D3ZA 3NJ8A 4KQEA 1LCIA 1VI6A 4FK8A 4YMIA 1PR6A 3CA8A 3EA0A 1DUIA 5LOVF 1V11A 4BKPA 4MYUA 4KPYA 1UBTS 2ADOA 4ARCA 1M2KA 1CJKC 3H9JA 5KYVA 1WTAA 2XI4A 4GMHA 1NVWQ 5CIQA 1C7IA 3IC9A 1UC9A 4G1VA 4HJXA 3WB1A 4Y6LA 2VTBB 3KTFA 4JP3A 3VH2A 4LMBA 3ILXA 2FWPA 2G3YA 1UP6A 1G5IA 3UFBA 1VLVA 4J0HA 3HR7A 3C8HA 2NUTA 5FOUA 2F64A 3W77A 3C43A 4Z7QB 2JEUA 2HU5A 2QYOA 3RRNA 1O97C 2CUNA 2PZEA 3I62A 1UEXC 2PKYX 2W2LA 2WILA 3SX0A 4TQDA 3IPXA 4DIOA 5EVCA 4HNTA 3G5UA 2VBFA 5CX4A 1IQPA 3HJGA 1TEZA 1U28A 3E9CA 2IYNA 1MQSA 4ON9A 1FYJA 5B4TA 2LCFA 4MGHA 5IDXA 2O7QA 3C3DA 5H9WA 2OXRA 2H00A 3K1AA 1E2QA 3FIUA 3OCUA 1QYWA 2JIZD 1XK7A 4WMLA 4QPJC 4UNQA 1GUYA 2FG5A 1Q0RA 4JSRA 3SCZA 2JCVA 2OM2A 4WCFB 4DMLA 3TZKA 1TK9A 3BMCB 4H3SA 4MVMA 2IPOA 3KQMA 2ILMA 4M36A 3PR1A 1P4HA 4K6HA 1ZL8B 4P9NA 2XGOA 2F1OA 2I2XB 2M1XA 3ZWOA 3MSXA 1PTKA 4R2MA 1GFSA 1SZCA 4E14A 5HQ3A 5LXTB 2D59A 3BWDD 2XYVA 2QE7D 3PGA1 4R05A 1NY6A 3O38A 2AEJA 4Q21A 1T3SA 1XDUA 1NTMH 2HEPA 1Z29A 1WXHA 3K5MA 4BNVA 2VK8A 4ER7A 3VR6H 3VTFA 3FTCA 4Q39A 4P38A 2CXOA 1LKZA 3HBJA 1YB6A 3IT0A 3K2BA 2SNIE 2G1UA 3GDGA 2KSDA 1LSSA 3IFXA 3NHRA 1COWD 2CLDX 1U98A 1GILA 2OECA 1H23A 2B34A 2JDIG 4JJFA 1KC8W 1E69A 3QHAA 2XUAA 4L4SA 1K8XB 5CRIA 4YDSA 4QATA 3LT4A 4EQZA 3FHOA 4AJNA 3SU8A 1BSMA 2BR4A 5BYJA 2YY7A 2EFGA 3PENA 1F8XA 3TAXA 5CP8A 3FYCA 1WHTB 2NVOA 3RIEA 2QV0A 5B2EA 3WV4A 3IKLA 4BLUA 1D2GA 4OK3A 3Q88A 1P18A 4NU0A 4IHJF 2QRMA 2EINC 1GCOA 1T8YA 5JZSA 1XNQB 3TKAA 3L8GA 1VQ5V 4W1SA 5EP2A 1SQQH 2NAFA 2PZAA 3HJFA 2V6GA 3HKEA 1F51E 2DUNA 2WJGA 3LZCA 5K8TA 3OJOA 1SMKA 3E9RA 4PRZA 2CJXA 2JRLA 3KUXA 5GJBA 1YJBA 4FFPA 4Q7EA 4JIGA 2LKCA 2H57A 2W4IA 1L3IA 2D2CB 1A71A 1Y5RA 1EM8B 2A9VA 4V2UA 1G0OA 1LS6A 1F2UB 1EQ2A 4AMYA 3RBXA 2JC3A 2DQZA 3DPSA 4BX3A 4B71A 4RJLA 1ZD9A 2VEOA 4IGEA 3H99A 4H7EA 2CAZC 3DNPA 3P0EA 4RTJA 5IH7A 1KECA 1XTVA 3A1EA 2QX4A 3B1WA 4U6QA 2GKSA 2KJQA 1QQTA 5CW1A 3KJFA 5JHGB 4HT3B 1OH7A 1GDHA 5KOIA 1LBQA 1TFRA 1IY8A 4BTLA 4HDMA 4ALNA 4JKOA 3OQVA 3X1XA 3HKDB 4RVOA 2RK3A 4GR9A 3VX4A 2AG6A 2QMOA 1BG6A 3DM5A 1TVKA 4CEHA 5FFMA 1Q90D 1JG3A 1U8FO 2YXBA 3VR3A 4PO9A 2ZIGA 4OI0A 5HIAA 1YITV 3PX3A 4QFMA 1QU2A 3MRTA 3SQOA 3PIIA 4L5IA 5FUYA 1P1IA 2A5LA 3KB8A 3L4BC 3C45A 4MQ5A 3AF6A 1JVSA 4KMRA 1P9RA 2HR3A 4YJ3A 2G38A 4E2XA 1RBYA 4TMTA 1AJQA 2J3DA 1RLTA 1UMBA 5C4IA 4J2HA 2FKNA 1DXYA 4DC1A 3W8DA 4EKYA 1P7YA 4DCVA 5EBLC 3GIWA 3RRMA 1SZXA 3U1TA 3UJDA 4G97A 3TLAA 1ONSA 5EWJA 2CKDA 4R4JA 1E0JA 2JVIA 1A7UA 3K72B 3KJXA 1AQ6A 4ZA2A 2J4FA 3N1UA 2FSSA 2ZJ1A 3LNMB 4WCFC 5KX5F 3LY7A 1ODCA 3OTQA 2AQHA 1MORA 4X66B 1U2SA 3BDVA 4JC8A 4EVQA 1WQ3A 4TV8B 3GP8A 2QVGA 4DW0A 5KHJA 2VUSA 1TM2A 5AJVB 2R4UA 2Y66A 1FTNA 3IJPA 3FI9A 4ZJZA 1PQUA 2H52A 4YP7A 4GCZA 1WPBA 4E30A 3NVDA 3JPYA 3RWRD 4R1NA 2R66A 3L0ZA 3ACCA 3FVRA 2BFFA 3BSYA 3BORA 1LK0A 3OT1A 3R44A 3G0OA 2UAGA 4XSGA 3MMSA 1OV9A 1K6EA 5CPFA 4ZVVA 3NOVA 2B9ZA 5EWLB 2E18A 3CVUA 4IM7A 4AMBA 3OECA 1XYGA 4MKIA 4ZCLA 3O3MB 2WM9B 3QFTA 2GXSA 4ZI5A 5LYJA 4N49A 2ODTX 3I6MA 4UM5A 1KDYA 5TQVA 3RYHA 2BHSA 4PHTA 4W5RA 2J3EA 2PVCA 4JUIA 4K0KB 2X7JA 1SB8A 4B4WA 2Y0IA 4DYLA 2QW8A 4K6OA 3NOXA 5A0TA 1M3SA 1P45A 4WESB 5BSTA 4PCLA 3SZRA 3TBFA 1A77A 3ZWAA 3GZNB 4MT8A 5CFNA 1FFEA 1DTEA 1KUQA 1U4OA 3DHEA 3B2EA 5E4YA 3K08A 4WOKA 3ICXA 4WZ6A 2N1BA 4ZGBA 3T9AA 1T43A 3RKSA 4BFXA 1N6LA 3WKAA 5JTTA 3SYLA 3KKZA 3PC2A 2CD7A 1ZH0A 4R1PA 1M6HA 2AVNA 5TQ2B 5C80A 5CLGA 1FJXA 2QWRB 1HE3A 4FYKA 3A06A 2M6LA 3LUJA 3VR2D 1QB8A 3RUHA 4AF8A 2GTHA 4WKNA 2JKYA 4HBZA 1G6OA 4X8OA 4CCYA 1VFPA 4AXXA 1IL0A 4XM1A 2M98A 4ALKA 1U0FA 1JR9A 2RC5A 2PPLA 1ZWKA 2PT7A 2Q0QA 1ZIOA 3G2KA 3ODPA 4OHBA 1S2IA 2O8NA 5EMMA 1CUGA 4AX4A 2UU9B 3WWPA 3WYEA 1XZFA 1U3UA 4HAIA 1UJ2A 3SOZA 4ZHSA 5IXYA 4KQ9A 3HYNA 3F8WA 2KB0A 3ZDZB 3UAYA 3GT4A 4MMXB 5ALQA 1GEGA 4D98A 1E3SA 2I8AA 4LXHA 1R4MB 1GN9A 2WYOA 2PH5A 3RGWS 1X15A 4PYMA 3V2UA 1N33O 1TM1E 1IHUA 2R1UA 5JWHA 4C0BA 3S2GA 3GFBA 1QZTA 3R9XA 5DBHX 1Z4MA 3LUKA 1C2YA 1SCDA 3J7AC 4O63O 3ROPA 4DNOA 4IO1A 5C7YA 4YY3O 2GPSA 4LFBO 5TB5A 1AKWA 3B53X 1C8LA 5TLSA 1BWPA 2R751 2NT4A 3TPZA 1AKVA 4JODA 3U7RA 1CQIB 1TO6A 4KPFC 4UVAA 1F0PA 3LL7A 4B6QA 4MQMA 3E22B 1G1AA 1QZUA 4ZT5A 2A35A 1G2IA 1R2QA 3ZTWA 5EXTA 1H2GA 1E1NA 1W85B 4K9SA 5DIFA 3JYHA 3LBNA 2D3OW 2NPFA 5IYDO 4AU1A 3QU2A 5H9CA 3ZCQA 3DBHB 3OAAA 4HTFB 2PUBA 1XCGB 5BSMA 3H5TA 5KYGA 3UG7A 4UBJA 1XEWX 1MOPA 3NHKA 4DYDA 1QGZA 3WMFA 2ZR0A 3IOEA 2X40A 4UU1A 2WF6A 3CLSC 3UK0A 4CIAA 3IL2A 5JY6A 4CNBA 3CRAA 2IHNA 2YSUB 4QGPA 1DRJA 4I36A 5ARDA 3AINA 2B21A 3W2EA 3HCPA 3BA1A 2L2QA 2ZU0C 4L72A 1TJ4A 9ABPA 4WW0A 1ZL0A 1NBOA 1K27A 4OMUA 5C18A 3WQSB 2NUPA 2QYSA 1YQXA 1W49A 4TV9F 2PS3A 3EQ2A 2C54A 3BDIA 3QX7A 3BS4A 3D1JA 4ZV7A 4B3IA 2M1ZA 5HS6A 4CTNA 1HLPA 4A36A 5FFFA 2IHBA 4HBGA 1JQ3A 3EGDA 3N6XA 4H7FA 3UCFA 2HWXA 4ZICA 3H1LH 3AWIA 5ICMA 2Q6KA 5FI5A 2IODA 2W2QA 5K7SA 3HBMA 3GCGA 2CH7B 2FLWA 3X2FA 4KAJA 3KK0A 5KBYA 3TLBA 2W93A 3A6ZA 1U2GC 2XT0A 1HMYA 2VZ8A 3KT0A 5J9PC 2HD4A 4L9AA 4NCBA 1KO4A 3UMSA 4IYRA 2WIBA 3EF1A 2SCUB 5HCNA 1XOIA 4AMVA 2JGKA 3ITNA 4MVJE 1K2WA 1SY7A 3H2KA 1ISPA 2E89A 3U13A 1Y7IA 4LE0A 3CNEA 4GKBA 1JSXA 4FW8A 1XVUA 3NASA 5EYPA 4MUNA 3F1LA 3VUEA 4LISA 1XXHE 1G8SA 2DCMA 2CHQA 1D1TA 2NLJC 1SVNA 2OMKA 1SIBE 2J33A 2VT7A 1SEVA 5K0FA 4L9RA 1DT3A 3W4IA 5I7RA 5DMXA 1BKYA 3TM5A 4RA6A 4O6VA 2X13A 4EF5A 5I48A 1YO6A 5EBWC 3I5YA 1VKNA 2L18A 2W2OA 2VQEB 2QJOA 1NN5A 3ZWNA 1OIVA 4KXLA 1ZCZA 1LF0A 1Q1ZA 3EBOA 3V1KA 4E1VA 3CTMA 3NIDB 4F5ZA 1GR0A 3HB1A 3BG5A 1GYPA 1YC5A 2R3SA 5LKAA 1X1AA 4A1FA 1Q0QA 4JLVA 4O4JA 2IZ0A 1UL1X 1D1PA 5B2ZA 4KQIA 3AKZA 2P2YA 3GHYA 1IVSA 3SHVA 3EPJA 1CE8B 5HQJA 5I8PA 3IQHX 4EA7A 5CURA 1LLDA 4ESHA 1EVZA 3NWJA 4XARA 3CF4A 1EN6A 3VC3A 5DM0A 1ZTEA 3K5LA 1H66A 3L77A 4M87A 1Z0KA 2RH5A 5CXSA 3TOXA 4X85A 3RSOA 1EEXB 3DZHA 2ZRKA 4HNAA 1HTTA 5CLIA 3D3NA 2VSFA 5F4BA 3N5KA 2GYYA 3ADDA 3OE1A 1XPJA 2YL2A 4BJ3A 4FOLA 4ENUA 3UT0A 4IV0A 3L46A 4F2HA 1I3KA 4EA8A 5AJHA 4AI6A 1SBTA 2QTVB 4QU9A 1CJMA 2FG7C 4NTZA 1SXHA 2QRKA 5FBVB 2FQQA 3KPYA 1SBNE 1GR1A 5EC2C 2NUBA 1K06A 3PFCA 1YUNA 4G1BA 4DEYA 1QP7A 4P7GA 4TROA 3VV2A 1AJPA 4ZAYA 4DEXA 4JBLA 4H7JA 1FYVA 4ZMSA 1RKBA 2ZG6A 3GUCA 1XKLA 1E1DA 1FDRA 3ZVLA 1E2LA 3T9EA 2WSYB 1XHZA 4FD2A 2JK5C 2ACEA 3VQVA 4Y9RA 2NTVA 3PNMA 2PZJA 1V4VA 4C7VA 4FIPC 3J7TA 4KWCA 1HL7A 4LVOA 2CV0A 2J0EA 2WKQA 1IG3A 3M34A 4MWCA 2YBEA 3C4QA 3K9GA 5DYYA 4O1HA 4IJWA 4D46A 1NVXQ 1I3NA 1E6LA 4MHTA 2PX8A 3BH0A 4A5UB 2X8AA 3OUUA 3G6BA 4GXRA 4GOOD 2QPLA 4GLBA 2BEUA 5BSWA 5TGZA 4ZQBA 4IXMA 4U2CA 2X2EA 2V4UA 1IWBB 1YVDA 5JXJA 4X24A 3S7TA 3LBFA 4DV0O 3E03A 4F97A 4OB8A 2ZE6A 4MUEA 2AXTZ 4QBFA 3MWDA 3V1YA 3I04M 2GFHA 4MDYA 4A0GA 3ASUA 1T1GA 4N7JA 4QTXA 5JQGB 2FGKA 2QD2A 3SQXA 3ANMA 1FXSA 1NBMA 1X38A 2REBA 1BKDR 2UUOA 1QP8A 2OFXA 2O5EA 2QE6A 5DHTA 2F17A 4IO0A 3N05A 3VQWA 1T3TA 4EGCB 5EE1A 1BDHA 1VM6A 3ZQKA 3A1WA 4LF6B 4EGFA 4LXXA 2ITCC 2WHPB 3ZEAA 3WBFA 1BMFG 3G59A 1UH5A 4EL5A 3MJRA 5DGIA 1GD1O 4BE7B 4PIVA 1E1QG 4QYMA 2B25A 4E2LA 1JB9A 2PZ8A 4FZJA 4LCJA 1U5BA 3BRQA 4AROA 4RNDB 3IULA 4UCVA 2CLSA 3CRQA 1SFRA 4YJ2F 4HNGA 1EBBA 1BEUB 3ZIUA 4CKXA 4WXHA 3B6JA 4H60A 2GK3A 3COPA 1JB1A 1Y6ZA 1R74A 5LMUO 2C7VA 2ZJ8A 2AW9A 1QBZA 4TXLA 3V9AA 5D2CA 4LVUA 3IPRA 4TKMA 4HPWA 5L3FA 3AB3A 4J7UA 2O9JA 2P2ZA 1AQIA 4NVPA 4HDKB 1RWNA 3G85A 4DGSA 4A2WA 2CYCA 1AY0A 4OYRA 3OQOA 3QWFA 5KNCD 3S70A 1U0HC 1N0JA 2FNAA 3SD7A 2AR9A 2OCKA 3DTVB 1EIWA 4WCEV 3OUSA 1ZSNA 1ABEA 1NSFA 1SCJA 1KOGA 1RHQA 3SK0A 4I14A 4UV9A 1FOEB 1WMEA 2EFEB 2QOEA 4J0CA 1H2NA 3ZN1A 1MPXA 3WL4A 5LKRA 4ITVA 3GDFA 1C4XA 2H17A 1T91A 2D0IA 2BI4A 4BGEA 3ZY4A 1TPZA 3AG2B 1YVRA 5A6SA 1J20A 2CKMA 1N5RA 3OE7A 1JIKA 3DBRB 5AKLA 3MS2A 2Q2VA 3DCJA 5ADVA 3GT0A 2B1JA 2BRUA 2C4TA 5H59A 1T3HA 1E2KA 3GB9A 2P8SA 4NBLA 1ZRSA 5GJVC 3OQ6A 1KI4A 3V4SA 1YR2A 1IN8A 4TRJA 3BTUA 4EG6A 4C78A 5EIEA 2EFYA 1D0IA 3AIIA 1RRGA 1OKKD 4W5OA 4OX9B 2XGGA 2FYUH 4F8YA 4IDCA 1FD9A 3CMAV 5SZHB 4UAUA 5TQJA 4B7KA 3WG9A 5E6UB 1DO2A 1DAGA 1Z6YA 2CT8A 1NVPB 3VHXB 3ZNQA 1MC1A 1LPSA 3ND7A 2AZ0A 4FBMA 4ASUG 2A2ZA 4MVYA 3NAMA 5JARA 1N78A 2V7UA 5AVKA 1VE6A 2JI4A 5ESDA 3S1AA 1IVYA 1R3JC 3A3PA 3H6KA 2Z1DA 2CVZA 3IRUA 5KHAA 2HRRA 4UQPA 1DPGA 2O7VA 3HB0A 3MUEA 2V0NA 3W9UA 1I08A 3E0XA 3FPKA 2VDVE 4XTRA 1K08A 3AFIA 3C7AA 1F8UA 1JMKC 1NZDA 4TXJA 4WNCA 5FADA 2GH1A 3KXPA 1C41A 2HNAA 3ETHA 1S2OA 3JASB 1TTTA 3Q8KA 1KP2A 1S72V 4ZANA 5ER9A 4ZDWA 1TI7A 1Z2EA 3FUWA 4BB6A 3K9LA 4HP8A 1MJGM 1E3QA 3E3NA 1E7YA 2YJZA 1KZ9A 3RT9A 1Z7WA 1DBWA 2PT6A 1EIZA 4OP3A 1SD2A 3A9RA 4IGKA 2I87A 2WLMA 3WNCA 4LPKA 3QX9A 3GFSA 1I2MA 2BTQB 2FZLA 4KH0A 3WNZA 1KETA 5LL6Y 2QYTA 4F6RB 3IKVA 5F2OA 3WSWA 4H7IA 2PNFA 1WR8A 3THWA 2E76B 3TMYA 3PTAA 2ZYDA 3V3KA 1V7PC 1R4NB 2YWXA 2D0DA 1I9GA 1T36A 1VKJA 4W8GA 2VH2A 1TT5B 2QTAA 3VU3A 3GL9A 4XFJA 1AKMA 2PVPA 3BL5A 4PVDA 1UUFA 1XHLA 3KWJA 4R7TA 4ZXFA 4GL4A 1IK4A 4WT7A 4RDIA 4QLAA 4QTTB 1MPTA 8ADHA 2AW3A 1PV1A 4X20B 1Z8HA 4N23A 1Q83A 3TZ6A 1K9VF 4B3BA 4JVMA 1NF3A 4RSRA 2VF2A 4BNNA 3PDIA 2X7HA 4CLRB 2XMPA 2E2WA 2AZ2A 4RA9A 2ZBFA 1S01A 4R2XA 4TKZA 4DLLA 4DSNA 1VFNA 1QHNA 3JTEA 1RXWA 1YE8A 1Z0AA 4F91B 4M7RA 4P0TA 3F98A 2AA3A 4KO8A 1PW7A 1DUVG 1UADA 4IXNA 1Z5WA 1KZGB 1A50B 2R9RB 1Y8QB 2BSXA 2Q2QA 4KTTE 2WWGA 4TS1A 1VLJA 3PXBA 1Y81A 3QLUC 2GPTA 3L6CA 3SXUB 3CJTA 4OBWA 3AG2C 1V47A 4PC1A 2JJ2A 4NFYA 3WK8A 4YQFA 4JI2B 4BAUA 9LDBA 5COAA 4UEWA 4MLCA 3EZ7A 1W5BA 3RTGA 3QE3A 4H08A 3OPNA 1YFZA 1I2CA 3MUFA 3O31A 3U3DA 3ZD7A 4DLZA 3IHLA 4YH1A 1HSZA 3RFCA 5GOTA 1PCXA 4R6WA 1U3DA 3AF0A 1KVSA 5DNWA 2GXQA 2RGWA 5NULA 4OHUA 1DUSA 3B78A 5DEOA 2GF0A 4JBIA 2IW5A 4BFUA 2HVJC 1GZSA 3L8ZA 1H65A 1P74A 4ZQCB 2ZSHA 3ZLVA 5AXCA 4CMAA 4HWRA 2QZJA 4X65B 3HA5A 1SBIA 4WBNF 2XCLA 3G7UA 2BAGA 4X41A 2GBOA 2J67A 1KBHA 3TINA 3W8EA 3FZEA 3KZOA 2QTSA 1X1EA 1JJ2U 3SF0A 1P29A 5AVYA 3MG9A 2PQ2A 3KTAA 4FWIB 2Y76A 5B36A 4HDCA 3IAS1 4DHWA 2PLWA 4BNWA 3DS8A 1D07A 1DAMA 3G9TA 3K2IA 1YS9A 2JNWA 2UDPA 1Z13A 3DOIA 3FYIB 4Q00A 4LFAO 3CJRA 1EGMB 3RFVA 4LFCB 3DAPA 3NG1A 1EXVA 1RKUA 2P0YA 2Q6TA 3M4YA 1A95A 1L3CA 3TAUA 2ATVA 1G21A 1T5HX 5BT8A 1QGED 4D26A 1QC5B 4DV6B 2HGSA 3SR2C 1LA2A 4FT4A 3TSWA 1QAOA 2OXEA 3ZH9B 5CVVA 1Y98A 1NJ5A 1CJBA 1EUCB 3I2GA 2XAFA 4JELA 3TMAA 1KJZA 2BGRA 4JWKA 3PA8A 2CNBA 3I9OA 3BWXA 1A9PA 5CNMA 1J90A 3PFFA 1C3VA 2MOKA 2A57A 2HKIA 1ZHFA 3SICE 3X2EA 3LCJA 4RQUA 3MC1A 4PR0A 1VLMA 4B6SA 2HU2A 2JK1A 5L7TA 4IUCS 2HO4A 1TK3A 5HFNA 3WLQA 3CZMA 3A2NA 1ZNYA 1YK0A 2P9YA 3PVCA 3DLIA 1R0CA 1KGDA 2CE7A 3O93A 3LY5A 4DJTA 5JANA 4WNAA 4MUXA 3CGWA 3SMQA 1HEUA 3SDZA 3WL7A 3ZWVA 4MA5A 2HA6A 3H5IA 4QJ4A 1IQ0A 1YXMA 1AUQA 1ID8A 5F23A 2X4DA 2VJKA 4TVBA 1V54B 1Z8FA 4CODB 1IRIA 1NRXA 3D6FA 4KDRA 1KJ9A 5T64A 1THMA 4JI0B 1NVGA 2VQSA 1P7WA 4REQA 4IICA 4DR5O 1OWPA 1T4MA 3DR3A 3PNLA 1N1EA 3H11A 1GM8A 4TLLB 3OIUA 3FYUA 4GI1A 4FR5A 4PAWA 3T41A 4QEZA 3I2KA 4IF4A 1S8FA 1OZHA 2NQ8A 2IHJA 3ZMUA 3LDGA 3Q8LA 1BVYF 1L5FA 2YV4A 1K7SN 2QROA 4PA6A 1W29A 2H07A 2QKYA 4LSWA 5EZYB 2QRQA 4NV1A 3NBFA 2R7MA 3ORHA 2XSZA 3SC4A 4ZEOA 4DCCA 4JT8A 1M1YB 4IKEA 3PWTA 5LA6F 1JDPA 4TLBA 3C6YA 4Z99A 3IJEB 3GCDA 1GGHA 1RVV1 3THYB 4QPZA 3LXXA 1EG2A 1N1DA 2VG8A 1HM5A 5TEWA 1RBQA 1AXEA 3AH8A 1CY2A 4TZ0A 3ESQA 3BHMA 4BBPA 3O90A 4JS0A 3JQ6A 4EBBA 2IOYA 3V5NA 4DCNA 3EXFA 5JH7B 3S2YA 3EG9B 3RGBA 2LPMA 4PX3A 1E9CA 4M0EA 4ILEA 4TL9A 1KE1A 4QBIA 1LFAA 1Y3IA 2KBFA 2HFJA 1ARZA 2EX0A 4QUDA 1PVOA 4DJ5X 1Q7RA 4HXGA 2LFRA 2R62A 4UQOA 4PGHA 1QE0A 2R7KA 4YRLA 1P8AA 3AR6A 3QA3E 1OXKB 4TLEA 4UDYX 4NCAA 3T4XA 4KGXA 4Q7QA 3L0SA 1O9BA 3TB6A 3CINA 1DG1G 3V7UA 4GLFA 1YB1A 4HDSA 4G0UA 2FP4A 4NNOA 1V6AA 1E9SA 3B2QA 3RSSA 3ONVA 2P90A 1SKYB 4J0EA 2GAJA 2YXPX 1J0AA 5IM5A 4JUFA 2YYSA 3OEEG 4MCJA 4H18A 4PRLA 1O5TA 2V7BA 4DA7A 5H6QA 2LR0A 3CLHA 3A11A 3EGOA 4KREA 3WMGA 2NZ2A 4E5NA 2FWMX 1Z07A 3W7TA 1TM7E 1Q92A 3QVJA 3UMMA 4C7OB 2GVZC 1R0WA 1PEDA 2CC2A 3QKWA 5T6MA 3G7NA 1LVGA 1RMYA 3T54A 3D36C 3L5KA 2OZLA 1U2DC 1DBRA 4MWEA 4JYZA 4TYMA 4F9TA 2C99A 4QZVA 1HURA 4HZUB 3EVTA 1PSWA 2WAXA 2BZ1A 5F73A 3MWGA 4JQOA 3U80A 2WQ6A 1GZ3A 4QNNA 3EPPA 3JYCA 1B73A 2WLHA 4RPIA 4K03A 2I6UA 4BJ5A 4FFVA 2JASA 5BSEA 3L6DA 5AHXA 2B30A 2BHNA 3MOGA 2VJBA 1UPXA 4CIWA 2C58A 2ZSUA 2A5YB 4F2WA 4QOGA 3RU3A 2E3JA 1SCBA 3MIIA 4LG1A 3QKRB 3CC8A 3DTNA 5FNVA 3BB1A 3Q0TA 1NXTA 4KV7A 3ZDCA 4RZXA 5KYKA 4E7PA 2ZJYA 1CQPA 4BVJA 4BL5A 4B84A 4O2AA 2FSIA 2XNKA 4HBNA 3CLUD 3RSHA 3H8VA 4ZRNA 3LX4A 1HL3A 3E1KA 1NULA 2Z8YM 3ABIA 1E1QD 3FHTA 2MSDB 2DHDA 3TPCA 1WDLA 4A1OA 2MINB 2MIIA 1FS5A 1I6MA 1AKTA 3TZCA 3IHWA 1WLEA 3PUIA 2ATKC 2F6RA 1RHMA 1T6BY 2NXJA 2QT1A 3EW9A 3QIAA 4RVSA 2WIAA 2G88A 4UOEA 2PLNA 3NBUA 3Q3JB 1I0LA 1MABA 3WRYC 4RK6A 2A1UA 3FNQA 3D59A 5B3LA 4KIGA 1CX9B 5F35A 1VBNA 3E4CA 2YZ2A 3QK7A 4PFQA 1E5DA 2O23A 1C9NA 1IXYA 1E2HA 1RWQA 1DAKA 2EYUA 2H7YA 3RG2A 1R3KC 1XI2A 1NBHA 1GITA 4PY2A 5JRZA 1HNXO 3RTDA 2Y69C 1P0PA 1Y6JA 4GBJA 4IIJB 3DXZA 3TQSA 2JGRA 2OYSA 1X7GA 2JHCA 3IQGX 1FFSA 2B1IA 5K2MA 4IJMA 3BCSA 3ZMTA 3N0XA 4A8TA 1CLEA 1S4QA 2IDZA 1S7GA 1R50A 4Q9HA 5CDHA 3OUZA 3U3JA 3TKLA 5FIUA 1Z38A 4EGJA 4DOMA 1Q0UA 2XLCA 2R8RA 1O03A 2BMAA 4EGSA 2PN1A 1FUEA 1JDTA 2G5TA 4JBHA 4B75A 4Z2AA 5L3QB 1DV2A 4MW2A 2W6IA 3IKJA 1O97D 1E1CA 2UUCO 4NV0A 4E5DA 4R1LA 2Z57A 4WEOA 4L6AA 1MEJA 3C90A 2B1GA 3CNLA 2P6JA 3I9JA 1I7FA 1ADBA 1CDOA 2IC5A 3WFIA 5F5NA 3Q3CA 3UWOA 3LL4A 1JE0A 4MVCA 1KYYA 3ZZTA 1GN2A 1TTPB 3P7MA 1TFUA 5EQFA 4B7ZA 5TIIA 1ZAKA 1P7GA 5KQPA 4RZSA 4C5BA 3BCCH 4JP2A 2AHZA 4YECA 3N2ZB 1NKSA 2RGEA 2JA2A 3GK3A 4ZVRA 3FNBA 1N3LA 1UMCB 1T9HA 1XDBA 2QV7A 3DCIA 3IIEA 4TMWA 1JAXA 5BOVA 4BNMA 3OA0A 1T8RA 4W9NC 1VJDA 4G65A 2ZR7A 2W8ZA 3AM1A 3ZDXB 2HH9A 3TFWA 4PBSA 4GMXA 1YK1A 4XB1A 4ZZ1A 3F6EX 4QOIA 5GONA 5I4IA 3E5NA 4OQEA 3JAKB 1KK0A 4TS9A 1KF0A 4H9GA 1UZLA 1OYVA 4CMHA 4MWOA 1MEEA 4D0SA 2FUKA 4MIOA 3WK4A 2WF5A 3LUFA 5AUNB 3ZN0A 3BVOA 3GRYA 2IYRA 2P3OA 5E1BA 1OCCB 5CB4F 3QHQA 2FN8A 1ULUA 2VP5A 2F2TA 4BNXA 2QAGA 1ZP6A 3K6RA 4P2GA 1PQYA 1GA6A 1Z5NA 4EHDA 1E59A 4RTPA 2GM9A 1QNMA 4RHCA 3R4CA 2H6EA 4COKA 5EP1A 3X2QC 4S1NA 5K4HA 4C04A 2BDEA 1UBJS 2CL0X 3W34A 3JVDA 4L02A 5G41A 3NGLA 1M2OA 5IARA 3PPVA 1XMVA 2RIRA 1K98A 2C8VA 1FSPA 3DLTA 2G80A 3QUBA 1YZFA 3GLGE 2QRPA 1DS6A 3A3OA 4JI3O 3Q3VA 5ADWA 2Z2JA 4X3PA 3K1TA 3MCUA 2G72A 1W0KA 4I50F 1D7AA 1JFFB 2FEPA 5B1EA 4WZAE 1FVFA 4RDCA 4FCCA 3DQZA 4ZODA 1YS4A 3SWWA 1SUIA 1PWHA 1F48A 5FB3A 4ZJUA 4XB2A 5EJ8A 3HJAA 4C7KA 3I1JA 5TF0A 3T34A 4Q05A 2P9ZA 4MZDA 1PO7A 4OQDA 4CIXA 2XMRA 2HMWA 2JJMA 4KNVA 3WWZA 4DUYO 3ELDA 1PS8A 3S99A 1SZPA 4DLUA 4LHSA 3UT5B 3ESCA 4LCUC 3LC7O 2OCHA 2D4AA 4KNWA 2AZDA 2RGBA 3EGVA 5B6JA 3AT1A 3ZNOA 7ABPA 3OBIA 2O19A 3B1ZA 5KSWB 1M33A 5HF5A 4BP3A 1ABBA 4DA9A 2WB4A 5AK3A 3BGWA 3IV7A 4I9WA 3RVKA 3R5TA 4BWAA 1WXDA 3PNYA 5ARBA 1BGWA 3PGLA 1XWWA 3EGWA 4Q12A 4KAXA 4XDLA 1W36B 3HHPA 2PGIA 3IAEA 1EG7A 1U04A 2Q1UA 3U4GA 5KYUB 5JMPA 5I7UA 3IIIA 1L0NH 4FONA 3FVQA 4V02A 3PE4A 1YQ9A 3KVRA 2DHRA 1V16B 3LKBA 1QSGA 5BMVA 1IZ3A 1P2VA 3N5CA 1Y3CE 2FPMA 1NNEA 3GV0A 1IOVA 4D8WA 4LJ8A 1VECA 2OOKA 1WXIA 4EHBA 4HADA 2WPDA 1MO3A 3HWWA 2YFYA 4PG7A 1GNSA 5KIAA 2L19A 1EFTA 4P83A 1J97A 3QKSB 2YI8A 3LF1A 3AXSA 3GLSA 4BZPA 1UWLA 4HFJA 4WOJA 1K63A 3GOQA 2F66C 3K4HA 3WJ2A 2X8JA 1H2LA 5SICE 1DIRA 4WN3A 2ZBGA 3WLKX 1CF4A 2GZAA 2XB4A 4RIHA 3DOJA 3S5JA 2JGFA 3SSAA 1VE7A 3JZMA 4BKMA 2HXGA 2R79A 4PO1A 2LGQA 2V74B 1N36B 1YZQA 3V4FA 1RM1B 4K1LA 4C87A 5DXJA 4FWBA 3QELB 4QHYA 5SZIA 3C7KA 4ZZ2A 2GSMB 1DDOA 5T5QA 4BB0A 2IUYA 3HWRA 3P9IA 4ID9A 4L8WB 4B73A 3IV9A 4TYQA 3ENZA 3LFTA 3UNXA 3UHPA 3PEWA 4COOA 2GTAA 4LC1A 3FSGD 3IMCA 3TDNA 2O8EB 4E12A 2Q1SA 1E3EA 3HVHA 2O8CA 1QH0A 2XIJA 3VR6A 3DT8A 5E0KB 3DDOA 1AF7A 1E2FA 5J2UA 1M8FA 2CLOB 4JLMA 1DTWB 2IT1A 3NTRA 4RFLA 4B44A 1TLFA 5B1OA 3T94A 1OCCC 1H8EG 3PV0A 1Y1PA 3C6BA 4ZJYA 2RGRA 5CVUA 3NHFA 4FZRA 4HLUA 4WOBA 3N58A 4OYHA 2GEDA 1BXKA 3R77A 3FTDA 2DQSA 3QBTA 3CF0A 4XQ0A 4JYAB 2DQ4A 3MOSA 4KQ6A 2NSDA 2ZIVB 3VHQA 4B76A 4MRPA 1URPA 3FVWA 2ZRIA 3GW8A 2VS1A 4FOSA 3D2AA 3FPSA 4QVIA 1U2TA 1I7QB 4RHXA 4LKRA 4Z4FA 1FFHA 2Z0MA 4AUMA 3MT0A 3K2EA 3KQVA 2I91A 1TAEA 4Y2TA 1T9GR 1ZGHA 4JB3A 4NOLA 1JGTA 3MAQA 3SBOA 2GN6A 3VKHA 2X6BA 4Y2SA 1RWVA 4Y7CA 2I9PA 2JCXA 2K7ZA 3L0BA 3CPJB 3F2VA 2BE9A 5A7FA 2PUVA 3OZXA 5TX7A 1RP3B 2O0KA 3DE2X 1I3LA 2WSSD 1LJLA 1AVMA 1D2AA 1RSZA 1DADA 2WDPA 1Y74A 5COQA 3ZJZA 1JHPA 3PU6A 4EG5A 2CNDA 2OV1A 4XYBA 3JVIA 1FW8A 5CNJA 2R6R1 2X76A 3BA8A 4LZLA 4P7BA 4F3TA 2RH9B 5K3FA 2IM9A 2XAJA 4ZT3A 1TJYA 2GNOA 1DX6A 4LZPA 4M53A 4LF5O 4WRRA 2C2YA 2PUWA 1GPAA 1OREA 4LGMA 3RU7A 2EZTA 4RMJA 3K5HA 2BFNA 1PSZA 2CLLB 3I8OA 2QSYA 4L0DA 1E9VA 4PSUA 3CUSA 4BCBA 1OLSB 1QJCA 5JY1A 2P62A 4N82A 3PCXA 3HUTA 1VDZA 1NN3A 2ZOSA 1DC4A 2WM2A 2CL7X 4N40A 1OH6A 1U4NA 5J63A 3ISVA 1IMJA 2EL9A 4MUGA 2OKGA 4ZO6A 1WXWA 3NFRA 2FUG1 2QDKA 1EM1A 2AJ8A 1MXHA 2OLEA 4UZSA 2B4YA 2R9AA 2G71A 3NM5A 1MRSA 1A8UA 1ULHA 4OSPA 3Q0IA 1N75A 4FNAA 3AL2A 3NUZA 1N7JA 4QTZA 5ILGA 4MRVA 2E85A 2EP7A 2H7XA 3BRWD 4I4TA 4LYGA 3GAMA 4MVJH 3SNHA 1VL5A 1QRDA 3DVAA 3H8SA 5ITZA 1U9JA 5DTRA 5EE3A 2DHCA 4AS2A 5F4ZA 3EX7C 3V8RA 5IFLA 4KO4S 4RDHA 3W0LB 1HZZA 3K92A 4CTOA 4DV4B 1TUEA 3RVYA 5LQMA 4DR4O 1G60A 3CLSD 1BAPA 1MIHA 3ACDA 3DT6A 3QM1A 3DDHA 1I24A 2Y67A 1NXWA 4ZOCA 3SXJA 1E2EA 4AZ0B 4RADA 2VRWA 2ZLBA 3AFOA 3BL6A 3CEPB 1DKRA 1BGVA 2XAUA 3MJCA 3CIFA 1QH8A 3U4CA 4FEAA 4PLPA 3MCTA 2ZBDA 1DZIA 1R0RE 1RM1C 2FAXA 1EWTA 3HR0A 4OJTA 2FK8A 1KZ4A 2GSDA 2QQGA 4ZYTA 1GK9A 1THGA 4NDNE 3BCRA 2BUAA 4MYDA 2WLLB 4EEQA 1NF2A 1UXKA 5HJ7A 1NWCA 1W96A 3RV3A 1BO6A 3IE2A 3FCYA 4AJOA 3ZRVA 5DTIA 2CDRA 1I33A 1SO8A 3R6WA 5CVJA 4UMEA 1B8PA 2IP1A 3MWJA 4CC6A 2JS3A 5KOJA 1Z5GA 3I23A 3EGXB 3HL4A 1ZDMA 5HKKD 4QYIB 4TM8A 4I6EA 2RHGB 1R0SA 2G6BA 1CPYA 4DIBA 2BCJQ 3SYMA 1KMMA 2FDXA 4J11A 1XRQA 2HWUA 2EZ4A 4OBEA 4UV8A 4KXQA 2EAUA 3PJEA 1ZUD1 5SV2A 4XASA 1Q3TA 1OILA 3KXLA 5KMGB 3DDSA 3IODA 4C7XA 6ABPA 1X7YB 5FUBA 3DV9A 1E8MA 1NVKA 3A9CA 2V03A 4HRAA 3U7FB 2R8BA 3RADC 2D74A 2I99A 2G5CA 2YIBD 5HG0A 3ZDAA 3S2EA 3FWYA 3C8DA 3Q11A 5KCMA 3K04A 3K3WA 1NASA 4Y0AA 1WKVA 1JHZA 5WRFA 5G40A 5FV4A 1UBOS 1KYWA 4ZVKA 7YASA 3U1BA 4D81A 2AG0A 5TJ9A 4ZOLA 2R8OA 1F7VA 5EQJB 3OZBA 3NR7A 1G6HA 3M9LA 1I10A 1O1YA 2ZJAA 3O91A 5KSZA 1DEKA 1UJWB 3R66A 4RWUA 4ZI7A 4B74A 5DK6A 4Y2RA 1WETA 4N7RA 1BVRA 5LUBA 4G81A 4ARZB 2ZBUA 5FTJA 3UGTA 2F8TA 3ZXUB 2EKBA 1I7PA 1GAQA 4YJGB 3VR4H 3K0FA 4QXAA 3OTOB 3ZZMA 3CM0A 1IBMO 3NNSA 1IN1A 1Y6GA 2ADMA 1DAHA 4GDMA 2IPAB 3GVHA 1TUBB 3BWCA 5JZMA 1N2ZA 1L5HA 1XZEA 4RJKA 4UFOA 4Y2VA 1UCFA 1VKOA 2NYVA 1OU0A 3WGTA 1Y67A 3ZIAA 5I9MA 5JJIA 5EKXA 1V9LA 5E9WA 1C7JA 3O4IA 1TQ6A 2VDLB 5JSKA 1SG9A 2ISSD 4Y2HA 1G8PA 1JEYA 4IFIA 4RELA 3CR3C 3W1WA 3SZUA 4OQ4A 2X9VA 4QRIA 4FP9A 1ZIDA 3B1XA 3KJQA 3AEZA 2CL6X 1Z6QA 1RJDA 1PBNA 2VZ0A 2VP2A 3GEIA 5ERYA 2QEQA 1Y9EA 1X7XA 4K87A 1XHFA 4M1SA 2C1ZA 1DXOA 4YUYA 1FZTA 4G0YA 3WIUA 1PJLA 4A5SA 4P4GA 3EQ7A 2I2AA 3REGA 1BW9A 4C9BA 2VN8A 3I45A 2SHKA 2ZS7A 4KODA 4BKOA 4G9EA 1UXOA 1Q12A 2QPTA 5GZ1A 2XA9A 1M0WA 1LWOA 3IUJA 1SPBS 4HMQA 2XE6A 4RH1A 4PIMA 4ABMA 4MAAA 1SCUB 1GNLA 1JDNA 3WOHA 2E4WA 3AILA 1B16A 1MRZA 4QJFB 2GYWA 3IUMA 3RVBA 3VYVA 3ELUA 1VJRA 2J0UB 1D2RA 3W5DA 4GRIA 1ZK3A 2WZQA 3DZBA 1RQLA 3IDQA 5IWAB 4QREA 1FRNA 3PJGA 3ZKWB 5T8KC 4B2YA 1XJ5A 3TUZC 3DHWC 1YL7A 4L3WA 1J2YA 3NAZA 3EZYA 3H1AA 2WA3A 3U61B 4BLWA 5BV2P 1A88A 1H94A 2P5TB 3Q7PA 2VHWA 5KYXB 4CKCA 4B3SB 1NMSA 3GEGA 5KA5A 3FX2A 4HEHA 2ZXWB 4ND8A 4URHA 1SQ5A 1ZLYA 5IAAA 3K0CC 1X2BA 2FOIA 3UCSC 3GLIB 2H2WA 2C78A 2ZAGA 1EH5A 3D6AA 4XWOA 3OVMA 1G5QA 3KEOA 5K6AC 2G8LA 4QC2A 4DUZO 2HJGA 5JCJA 3GAAA 1ONPA 5BSGA 1GTG1 1L7BA 5HMLA 1D1QA 3V1LA 2VJMA 4BMOB 1KAHA 2YIMA 5HCUA 2OXFA 4FOPA 1Q6YA 3ABZA 3A58B 4BIZA 2EYQA 2TYSB 5K6RA 1JKXA 2BSAA 3UWPA 4QASA 1XRRA 1NYLA 4JI5B 5MFPA 2AHRA 1B1AA 3AEUB 3OM1A 5HNKA 2BCEA 1T4GA 1EFLA 1YA4A 4EHLA 1BRMA 3VKGA 1RADA 1IBLO 2E5LB 5H68A 5A1JA 2O6LA 3AF2A 1EA7A 2PKQO 3LWNA 2XRZA 4OQMA 1XKQA 3WY9A 1R0LA 3JZFA 1NMEA 1BFDA 2EHJA 3D4PA 1PT6A 4XWYA 2XE8A 1EJ2A 4G5FA 1KR5A 1U7DA 2FSUA 3NI2A 2GTSA 3WQQA 2C98A 4B1FA 1Y8ZA 3TUIC 2BTEA 2FSPA 4DJJA 5BQOA 5A9SB 3KR1A 4BFTA 4C0WA 3HP7A 4KQFA 3C1TA 4MR9B 4JASB 3QF7A 1K88A 4KR3A 3HVIA 3U19A 2W2PA 2RKBA 4XM2A 2DYSB 3ZWWA 1HZJA 1FX1A 3OF2A 1YR7A 4JI7B 1SC1A 3SEAA 2FG6C 2W2MA 1HNZB 3DPUA 4EFBA 4RTQA 1KIFA 1LQTA 4TXHA 2FOLA 4PO3X 4J7CA 4OAQA 4E7OA 3H75A 1QR8A 1NQAO 5KQSA 4CV1A 4EPTA 2MYNA 2Y6UA 2ZSBA 5LDGA 2FFJA 4IGFA 4EBFA 4N9QA 3GVCA 1CLUA 1M2JA 5EHNA 2QA4V 3PVSA 4RFSA 2PZBA 4DXWA 1WW2A 1AZTA 2BFDB 2CXTA 2O2YA 3T8YA 1WL8A 3R3VA 1V4BA 3K5IA 1D3AA 2V3VA 3GO4A 2JDID 1I1NA 4MARA 3W79A 1DKMA 4RVGA 3BF8A 1BA3A 3CWQA 4N54A 5ALYA 3ORQA 4E3ZA 1X7ZB 4ZWNA 3PWKA 3WLIA 4YGYA 1CJCA 4Q4HA 1ORQC 4S2UA 1JBKA 1YI1A 3ZRWB 3ABUA 2HSWA 3F96A 4A2PA 3FB1A 1PEAA 4LY3A 2G63A 1V6SA 4O2BA 2G67A 5CBHA 1KU0A 1OX6A 4Y6GB 3D5QA 1QHHB 2Y48A 1PGJA 1PLLA 1O8BA 5CNKA 1QUEA 3TZBA 4V0LA 3LW8A 3MGKA 3S8MA 4BQEA 1GVHA 3GEMA 3A2FA 2J45A 4RD1A 4D74A 1NNLA 4RF2A 2ZRLA 4JI6B 1YRHA 2RGUA 3QX3A 4O4LA 1WPXA 2X5KO 2GCNA 1U90A 3TAHA 3ORYA 3W6OA 4DJDC 2ZRMA 3E2MA 2ZFUA 1UP7A 2GARA 4YCBA 4LSMA 2GXUA 4LRTB 1V8FA 4IWXA 4DQLA 1DAEA 5JCPA 1R88A 3IPCA 1YRYE 4LY6A 4M54A 3ZI0A 2AZ4A 3IC5A 3RFXA 3COYA 4LZJA 3BWVA 4J16C 2X0JA 2CUTA 2HOQA 4DZRA 3LHSA 2LNDA 1T8UA 2PZLA 3KCNA 4ACBA 3NRJA 3ZCTA 1D2NA 3WMXA 5DLEA 4TWJA 5TPWA 2C2WA 2ZIEA 4IYJA 2NVUA 2ZXWC 1Z7EA 5AM1A 5B58C 1UDBA 1F2TB 1K2VN 1X8LA 4CH3A 3UB3A 1E9BA 4G5RA 4YRSA 3MLAA 4D7SA 3JAMA 1R6BX 2V7TA 2J9FA 5IS2A 1ZOIA 4AZTA 2GAAA 1ZJ4A 5ESXA 1Z0IA 1GQRA 2DOKA 1X3LA 2QM8A 2XUQA 4WOPA 1N7IA 1EVIA 3TXYA 1MNQA 3AVXA 3VZQA 3T7JA 1R0XA 5IPFA 4HQKA 5IX8A 1PSDA 2B2CA 3S28A 3D5EA 1ZC3A 3NIWA 1TCAA 1Z5ZA 3DV0A 3E1GA 1MO6A 4CL8A 3T9CA 1JG1A 4K26A 1YJ8A 2CXUA 3P9QA 4BFLA 1CBUA 4B4KA 4KE8A 4KBFA 2OE2A 1ZD1A 1RI3A 1E2JA 1OZGA 3F8TA 1VEWA 4AJHA 4L8VA 2I4IA 1T25A 5AKYA 1ZBDA 3M9WA 1KE2A 2PS9A 4TLCA 5H83A 3OQIB 5EOVA 2CZGA 4B32A 2J1LA 2M9MA 5F2NA 2XB6A 5JC1A 2QN6A 4EA9A 4RZIA 2HTFA 1JAIA 4CR7A 4JJGA 1IBKB 2ALJA 2XYQA 2EFHB 2DYSC 1AUOA 3VDRA 3SZGA 3PQ4A 3CVOA 2DPYA 1QS0A 1U7PA 1N6OA 3ER8A 4EH1A 4J80A 2LO1A 4G1EB 5G0VA 2WKWA 1J0EA 2BIFA 3KL4A 3LVRE 5IVDA 2AOUA 1GM9A 1RCFA 2O14A 1M90W 5I9TA 3C7CB 4XEUA 3O1IC 2YJ3A 5E8JA 2V6MA 4RL4A 3WSVA 3C7DB 1H42A 3ZCSA 3CSDA 1PKXA 4DV5O 3GF4A 1Z3CA 3RC2A 3TD2A 3WKBA 3DFKA 5BP7A 1WU7A 2OD9A 5CXUA 1JU3A 4L8JA 1LB1B 2VDWA 5KYNA 2GAIA 2HZ7A 4FUTA 4MJLA 3HACA 4K35A 2YTZA 1KJJA 3K4QA 2FPPB 5K99A 1LSJA 4BDTA 2BGWA 2BKAA 4PZZA 2IOQA 2DUWA 3LLUA 1JJIA 1PV4A 4RPKA 1LUWA 2G7ZA 4YJ3F 5C8VA 3RS7A 4KJZA 2AQIA 5ALVA 5BW5A 4AXBA 1NL3A 3M33A 1I4TD 6PFKA 3B9BA 4RPJA 4WH0A 3BIFA 3FMIA 1YDXA 3GFQA 4NZZA 1A5AB 4I9UA 2COKA 2O3JA 5LIPA 4IQ4A 4BQRA 2JHAA 3VC7A 3OZCA 4R7GA 2IZZA 2XNDA 5BSKA 3OHPA 3AY7A 2YNMC 2Z9CA 4EGQA 5A2QA 3AM4A 1YFKA 4BX9A 1E92A 1WZNA 3A1FA 4CBCA 3BE5A 3CO0S 1GQ2A 3F90A 1OU4A 1TCVA 4AK9A 2E49A 1VQLV 3CW9A 3P94A 4BMNA 2V7QA 2RCVA 2VJQA 1QYVA 2Q3FA 5FWYB 3SP1A 4E31A 1JFRA 1K75A 2DR2A 3WADA 2XVMA 2P4EA 3U9LA 5LP6B 3I0MA 1HDIA 1K6XA 4QYSA 2PSSA 3QUQA 2GEJA 5L3EA 4DILA 1D2DA 5JS6A 1YRLA 3DAHA 2ZT9B 1V8PA 3IGFA 2YHUA 4WLUA 4DLBA 1HFEL 1ZL2A 3ICPA 5SYNA 1J56A 3VI4B 1O4VA 5LYJF 3UG6A 1LRLA 2ZDIC 2J09A 3H5OA 3F6RA 3PPIA 1QTRA 3H5VA 4ECAA 1Z8NA 4TYPA 2H4JA 3P32A 3MWLA 2YRWA 2QTHA 1JNXX 4DSOA 2GN1A 1AKUA 4KYIB 2CTPA 3DEKA 3MJ4A 3D4LA 3ZHSA 5FI0B 4AY6A 1A69A 4IFEA 4II2A 2WTEA 2UZ4A 3C4JA 3TTTA 4E2WA 1BS3A 5FPQA 5H80A 3FZGA 1E58A 3RS3A 4HGNA 1DOZA 1T0PA 1N5DA 2OP0A 5C51B 2GXAA 2WB2A 1GKKA 2R00C 2XA1A 3BK2A 1K5HA 5AKHA 1NIJA 3LCVB 1C0EA 3GA7A 3CEHA 3GZ4A 3O8BA 1LBIA 5LDHA 4F1KA 5CCXA 4YHHB 3GP3A 2H8PC 4JBNA 2XZTA 3JQBA 5JI3E 3KZXA 2GD2A 4JAVA 5B3SB 1UJNA 3HJTA 2N74A 4Y7DA 4FZ5A 4KSYA 1NXQA 4YMGA 1N2CB 4X6LA 3UIEA 3OZEA 1KSFX 1FFBA 4Q03A 4TKUB 2PZSA 4KXMA 3SVLA 5MN4A 1FPOA 4AFNA 1EFCA 2XDAA 1L4NA 1VB5A 2JKZA 2OWOA 1L4KA 3AHIA 1BL8A 2ANBA 4O3FA 4XUDA 3U4AA 1MMMA 3GMSA 2I2CA 3FDZB 1B23P 2P0AA 4MROA 4G23A 4AJ9A 3T3EA 4D4MA 3HU1A 2CVFA 2D8AA 1C81A 3AESB 3WMWA 5ALHA 1H2YA 5C4GB 4B81A 1RRFA 1FXKB 4JTDB 4QVGA 2WLNA 3PGJA 2DKFA 4C89A 3TCKA 3E3AA 3FOAA 5I7VA 4DCPA 4KP7A 4FD3A 3H97A 2NYAA 2E9SA 1ZW6A 3PD1A 3GUVA 4MHSA 1ZGGA 2WWXA 3T0FA 2JA1A 1NBEA 4XTCS 1K6JA 2Q0HA 4PJ0Z 1KP9A 5B1SA 3F4KA 3W9YA 1CRZA 1V5FA 3VPBA 1GFIA 2WTXA 1NKVA 1KMQA 2PAAA 5LMZA 2OQRA 3HO6A 1S02A 1HH4A 3INGA 2VDUE 4CCAA 3R4VA 4M8LA 3E48A 3NO4A 2PJZA 2AHYA 2JB9A 4GKKO 4BN4A 4NJEB 2HYDA 1M2VB 5DCUA 3QQ5A 4CS4A 3C97A 3I3SR 2G0NA 3U9TA 1NFRA 5I45A 5I7FA 3GRUA 1V43A 3PC7A 3S55A 3FCXA 1GA4A 4QOFA 2CXHA 1CV2A 4IMIB 4JBWA 2DH5A 1MX3A 1JHUA 3D8SA 4E13A 3NFYA 4BNTA 5HJ2A 2V5VA 1YMQA 1DJQA 1E6WA 4WOCA 4LKOA 1CK4A 4UPVA 3UVEA 5HXAA 3OQNA 1T26A 5GW7A 2WY2D 3HUFA 4Z3DA 1WSBA 1T0JB 1XDCA 3NPAA 4BQNA 3DLBA 4DLPA 3I9V6 4FFRA 5K3CA 5LP6C 4MUHA 3OQJA 1OFUX 2NU8B 4FI3F 2VT3A 2NWQA 4PPFA 3TLGB 4B4UA 3NVKI 3DMTA 5PGMA 3N2YA 2EJWA 3IO5A 4E46A 1NIPA 3IERA 2C8KA 3U0ZA 3KJZA 3VU1A 1DZ3A 4NCNA 2WM8A 1SC9A 3EMKA 4IWNA 2NSYA 3NRCA 4QT0A 1XAJA 4MULA 1I1HA 3ANLA 3P0FA 3I9MA 3ANTA 1XNRO 1N5MA 4BEWA 1RW4A 4LDZA 3IPAA 4R81A 3GNSA 3UWSA 3PC8C 2OBYA 2QX7A 1UKBA 3OU2A 1A4RA 1IBSA 4RMGA 1G16A 3I6YA 1XDGA 1N0NA 2C0PA 3PFBA 3UZUA 2OHXA 2DFKB 2EWVA 4KPUA 3ZD9A 4UE6A 1E4EA 4QJ5A 2ENUA 3PDUA 5EERA 4IHKA 1K0FA 3LCRA 3CCJV 2FVXA 1BXRB 4YXWA 4MQFB 3NIGB 3H0CA 3QHPA 3W7AA 1C7FA 1ROPA 3IE0A 4N6OA 4QNMA 1DEAA 1D5NA 5CYFA 3JALA 4Y8VA 3TTVA 4XOUA 1XA0A 5K01A 4K2AA 4ROSA 2QU7A 1R1DA 4MJXA 3K6JA 2C8JA 1D2CA 5E3HA 4CDRA 1ZSYA 3WGUA 4NX2A 1XLWA 3L7DA 2FMIA 2QRJA 4CU5A 1PGQA 2YN0A 1DKOA 2C77A 5E8RA 4V1CB 3KLOA 4U8HA 3AR8A 1NNUA 2JLBA 4CM7A 2ZJFA 3JQ8B 2UXDB 1ACJA 3HY6A 4TLAA 4I1SA 4LHWA 3HLYA 1Z6TA 4O4JF 3S7ZA 2MSEB 1TT7A 4KYUA 4HPJB 4FCWA 1KP3A 1Y4MA 1T3ZA 4LF9B 2XE4A 2LXNA 2CDNA 1W6UA 4DR2B 1FXKC 3WV5A 3LM8A 3AR7A 5B1IA 4I1VA 1HE4A 4R51A 4J94A 1JFLA 4E5KA 1AO3A 1BZKA 2QTTA 3ZU6A 3WK6A 3CE6A 4S2EA 4TTAA 3O4VA 2JF0A 2HBRA 3ISJA 1OJHA 5AI5A 5JEEA 2CUZA 1JQ0A 1YU6A 4XUCA 2DQ3A 1NYQA 4QFDA 1ZVQA 4A3SA 2GBLA 3MJTA 1J8DA 4Q4JB 3V8VA 3VBEA 5GTIZ 3M8KA 1N0IA 3EVEA 1TM3E 3MELA 2ZANA 2WAOA 1YTFB 2VOJA 3VISA 3SPGA 1T35A 1TKBA 1DAIA 4OV6B 2QWPB 3AJEA 4FKBA 1E9RA 2ZWAA 1JBEA 3I58A 2HCRA 4MWDA 3TI9A 1Q0LA 1U8XX 3RHFA 1BMFD 4MLDA 1ZD8A 5SY9A 1CY1A 1PNLA 5A2GA 3PI7A 1NV9A 3RYFA 1OXMA 2IDKA 1M8KA 3BZWA 3RVZA 3DAYA 3E89A 2JFFA 3I2JA 2FRDA 2VH5R 5A4FS 1V54C 4RHTA 3L8EA 3M6FA 4Q9IA 4BQQA 2V58A 2EQBA 2WTAA 2ZTUA 1CEEA 2ZIWB 2JLUA 4IG4A 1DXHA 1RC0A 2IITA 2QMQA 4EG8A 4IOLA 4XA8A 1SU4A 4WADA 4U7WA 1MN6A 4EOGA 3CT6A 4FCVA 3R3XA 4IVQA 4IVNA 5JXWA 1EWKA 2E4ZA 2QF7A 2GVNA 1OXXK 3FFTA 1GFWA 4QHTA 4PNZA 3AOEA 2E4AA 3PKIA 4JYYA 5FUVA 3D7RA 3BMNA 3IB6A 2HQRA 1GSOA 4TTJA 3BXPA 3QKIA 1P33A 3QJYA 4DV3B 3LSTA 4X1YA 5BYAA 2I7VA 5CGZA 2P2SA 5KDDA 2A9PA 5ISMA 2YINC 5LMNB 2IELA 3O2JA 2GILA 3ZI7A 1KSJA 5A03A 3OZAA 4EI8A 4RLSA 4X45A 2GASA 4BNDB 2CMKA 1KOLA 2BFBB 1Z88A 4MS4B 3TFQA 3B3JA 4A8PA 2P0EA 3HJNA 5KNCH 1DARA 2VUIB 4EHAA 3H2BA 4ZEWA 4N5NA 3E9NA 1B06A 4NHEA 5JNRA 2NU6B 1KY2A 2BM0A 2YEVB 4IVRA 2P77A 4EX6A 2Q3CA 1UIMA 2I22A 3PQCA 2DQ0A 3HSKA 1N77A 3WGZA 1T6NA 3AFMA 4WD3A 4YVFA 4ANFA 4UC0A 5FDFA 1AGPA 1FUKA 4P22A 4RU1A 2EGUA 2CWDA 1Q0TA 2OCYC 4ISBA 3UF0A 3W4JA 4A03A 4AJKA 4KMMA 1QOZA 3KZIZ 1CR2A 2FPIA 3E7PA 3QVUA 3MJFA 3BQMB 2YICA 2MYTA 2OC9A 1UXHA 4CKEB 1FXWF 3N0RA 3CWCA 4HAWA 1XZJA 3BJZA 2DAPA 2EXXA 1IEVA 3U0BA 1XZLA 1RPAA 3NNNA 1D4OA 4GOKA 4YPFA 3HCAA 4LA4A 3PQ6A 3I55V 2OZEA 4ASUD 1O94A 5F3WB 2C61A 1Z7YA 1J8FA 3L8HA 1TCCA 3ASNB 4R8LA 5ADHA 3COVA 2ZI7A 3BXGA 2N75A 3BCHA 3CXCU 4L2IB 1JKFA 1I6LA 2I62A 3UXMA 3BGSA 5FBKA 4BGDA 1FE8A 2YXLA 5FNZA 4Q3NA 3SIRA 5BN5A 1I01A 3N8NA 1S6YA 4E15A 3FOCA 2HAEA 4ZIRB 3EXAA 5A4AA 3RLIA 2P9FA 2ZUUA 5HSGA 3G49A 1RXYA 1XMSA 4KRGA 1VKHA 4RTMA 2GN8A 1IEQA 1AP6A 2AZXA 3ZUGA 3VC2A 3ZV3A 4OHOA 2P06A 2QM4A 2DUJA 3LRTA 1PQPA 3QWBA 3K2QA 4DMKA 2Q5JA 1GO2A 3W7UA 3R6LA 2VI5A 5CTJA 2JHFA 1HE8B 5K8CA 2QA5A 3V1TC 3VH3A 2OBNA 3P4UA 5ED0A 5FBZA 5K8UA 2PBFA 3FCAA 4NOJA 2QI9F 4CLDA 3DFIA 5L4SA 3VPHA 5PNTA 5D84A 4IJQA 1WLYA 5GOZA 4KO1S 4EI7A 4C0HA 2IXBA 5K0LA 3VAAA 1PFUA 4DKJA 2JJ1A 1XL1A 2BEVA 4Z7OB 5JFGA 4ED9A 4Z8XA 3E8XA 3M6AA 4K2HA 1FA9A 4BVBA 2Z5UA 1QG2A 4NPCA 1GWNA 3Q9UA 3PDHA 4HQRA 4JJKA 4NEGA 3WOVA 1HA3A 1WXFA 2XWBF 3D1LA 1XRNA 4C21A 3EPRA 4PI0A 2O0LA 4ZHQA 2LCQA 1RZRD 4NV3A 5FQOA 3DMHA 2OHJA 2W6QA 1HDEA 4R41A 2A9HA 1LRJA 1NE7A 4MR7A 2HDNB 4M8SA 1T5OA 1C50A 2LJ2A 1L7XA 3ZCVA 2YBDA 2X8BA 4Y9TA 3HNOA 1VQPV 5HHTA 4I0XA 4OQQA 1N2HA 1SZDA 2DX7A 2QW1A 2JVDA 2VXCA 5HZGA 3P2MA 4DM4A 2ZRFA 3FTNA 3PUKA 2V1DA 4RH0A 5JYBA 3EF0A 2ZI3A 4EI2A 3ROKA 3C6QA 5CM8B 3ZGOA 1F51A 3NOOA 3ROGA 1S0UA 5BURA 3DFFA 3HA3A 5EA2A 1H2XA 1IY0A 1MT0A 4IHQA 4PZ0A 3G9ZA 4DMUB 1A2QA 1KU6A 1NQVA 3RCBA 1Y34E 2RDMA 3K9CA 4UNIA 2W6JG 4JZGA 5EXEA 4P3YA 1XTPA 2OTJV 3EG5A 5DHQA 4YAGA 1VMIA 2X0DA 5CK4A 2C04A 1T4CA 2A92A 4RXMA 2ZT8A 1N25A 4LRWA 5BRAA 3RSZA 1V8OA 4JJZA 5BWOA 1RFLA 2IIVA 3RC9A 4DV7B 2I2WA 2Y3IA 3CUVA 4V39A 4KQ1A 2XGSA 4Z3OA 1QFSA 4HDRB 2G5PA 2WU3A 4XJVA 1I5XA 4HVTA 2CK3A 2FMXA 2J46A 3KU4A 5E7JA 1W8DA 4YJFB 3TZEA 3P27A 1R73A 1SHJA 4Z4CA 2R7NA 2OTCA 3MT8A 4TSRA 2NU7B 1J7KA 1AC5A 1DG9A 2QNRA 2QTWB 5E1AC 4WACA 1JDJA 3OZFA 1J99A 5KYYB 1BQ0A 1DJMA 2JJ8A 3Q9SA 3C0KA 2PWAA 2ZPAA 1I2AA 2CLHB 2JFNA 1U65A 1O8CA 3R24A 1V1JA 3UK6A 2R7AA 2Z83A 3D7MA 1NXVA 4QICA 1IURA 2ZB7A 1FNDA 1WP8A 1Z4NA 2UXBO 2RHCA 4QELA 3AK4A 2F4VO 3ASNC 1GPMA 5LZ8A 1JN0A 1YBAA 2GJ9A 3LUAA 1JLLB 3BGDA 3L79A 1WWKA 2NSJA 1AX9A 3QUAA 4UBOA 3FYEB 3ETCA 4TSFA 5GGXA 3ZHRA 1PT7A 4EB8A 2HJFC 1YF2A 1JG7A 3B5JA 3T7SA 2RHDA 1ZPDA 4KMSA 4A2CA 5IFKA 5FWAA 1RPJA 4C3OB 1PL0A 3ETQA 3OU7A 2JFZA 3VOTA 3V2GA 2FR8C 3EQ8A 5KHIA 5TPZA 1U81A 4NYIQ 1GZ5A 3GJ0A 2G07A 2YIDA 2OBMA 3HCOA 4C7JA 1XU7A 2WEKA 1WOMA 4PSDA 4G5SA 4OSOA 1E1MA 1N2IA 3JPWA 4UE2A 2I4MA 4WKOA 4ZO9A 4PWZA 3KBOA 2R5WA 3DR5A 3RKUA 3IP3A 5KAIZ 2FDRA 3NVMB 1GZUA 3VGPA 3Q0EA 5C81A 5I9NA 1JYEA 2EW8A 1V3TA 1WA5A 1SQVH 2XWPA 4DWOA 4DMFA 2EWMA 4TL6A 3VSAA 4AUNA 3CZCA 2FJ0A 4BLSA 4NPAA 2FSVC 4EFKA 1P5RA 3H3FA 2ZJOA 1ESCA 5EJ7A 1MU0A 4R2JA 5C8YB 1B41A 4ROTA 2C9CA 3IUEA 4N0PA 1AK1A 2UZIR 1K92A 2EKPA 4EAAA 1M34B 1IHPA 4J90A 2ONYA 4UTOA 1J07A 1SRYA 4HFMA 4ZQHA 3K4PA 3RTCA 4EB6A 3RFTA 1E8NA 3CX5F 3A4MA 1F9EA 3OC6A 1ZJYA 1U6JA 1SUEA 3OLCX 4EHFA 2X5NA 2RG7A 2ECKA 4C0JA 1ZN2A 3OUTA 2XUDA 4QPPA 4CQJA 3UYLA 4DF3A 2E7ZA 4PRYA 1HTBA 4IDNA 1QLWA 2EG5A 1D4FA 1VJ0A 1W36C 2WA2A 4R5HA 1WY7A 2HLHA 3OPYB 4MJ7A 3UMGA 2XNJA 5A02A 1RZUA 1PHPA 1F17A 4MS1A 1N8RW 3AXTA 5LZ9A 3K6KA 3HB9A 4AX8A 4Z9XA 4N5IX 3QFRA 2Y1WA 4YRRA 3TNJA 3HVUA 3F7VC 4HLDA 5NLLA 5ICEA 1X1SA 4AG6A 3BHNA 1CXZA 3FPCA 4G84A 1JJBA 1Q7GA 4CM9A 2JI7A 4V38A 4M99A 2HSDA 1GSIA 3EJWA 2YC0A 1OV4A 5P8WA 1HOXA 3H2GA 4JU9A 1FUUA 4GLLA 3AEQB 1MOFA 4QRHA 2PVSA 2B98A 3H17A 4OHRA 1X1DA 5H4HA 1Q8IA 3CZ5A 2V4ZA 2X0KA 3S8EA 1JP7A 4HWKA 1YL5A 2B3DA 4RDXA 3FNFA 1ZU4A 3G8DA 1GRNA 2VYVD 3WLTA 3DTUB 4E08A 4AQYO 1HFJA 3WGLA 1KFCB 3ZY2A 3NB0A 1BFUA 3Q8WA 4P54A 3QI7A 4QM6A 4U1RA 3NR2A 2ZYSA 5E7IA 1XDDA 1XT6A 5AYVA 2H1SA 2V97A 4YAUA 1KMIY 4I5SA 4BNZA 3IE1A 2H8KA 1SD5A 1AU9A 2BF4A 2B6HA 2EZ9A 5LNK6 3OEED 2Y9MB 4KDFA 4MVWA 4X8MA 1ZCBA 5AFSA 2ZUSA 3QU9A 5CLLA 1DBIA 4IXTA 1TYAE 3ZS8C 3UJ6A 2SECE 3TGLA 2NOAA 3OMLA 5EIAA 3JQGB 2J4DA 1M2HA 2IYXA 3LY8A 1NJ2A 1GH6A 1JNYA 4PXSA 2N04A 2GJKA 3A70A 3EEIA 2Q3EA 3MHHC 1NQUA 2J3KA 1FDVA 2VAWA 4KXUA 2Q3HA 2H1VA 5TQ0A 4ZC1A 1KKMA 3A37A 2O2CA 4LTDA 1GO3F 3HDHA 4EMSA 2IY7A 1E2DA 1GPH1 4QUEA 2P9JA 3R7FA 2ZRGA 2XCQA 5IT9A 3WGGA 1RJEA 3BH7A 4YB8A 2PRZA 2DHQA 3NP9A 1HP8A 4R3NA 1E1RA 1VF5B 1UEJA 1UM8A 4MRMB 2GA8A 4UBMA 3SKYA 5IN4A 4K3AA 3UOAB 1RM4A 2DCUA 4NBNA 1S9DA 2GF2A 1GTZA 1TVEA 3A1VA 2AXPA 4LN1A 1FIUA 3R5HA 2Y93A 4RMHA 2ET6A 4TQUS 1YRAA 1AK2A 4PYRA 4E1BA 1E4YA 2DHEA 1QKJA 2H2GA 4MVJA 3MM4A 2Q8QA 4G2KA 5KSPA 5K0TA 2VCYA 4NCHA 2E6KA 1AOXA 3O3NB 1OSNA 1AN9A 3RSGA 3GPDG 1XXHA 2D7DA 3T1TA 1JQJC 4DKXA 2IKSA 2JFUA 2Q0AA 4MINA 4DY6A 3ZQ6A 2Q46A 2JJYA 1P9LA 3OEHA 4YALA 1QFJA 3BGOS 5CA1F 4L28A 1ZR4A 4ZJPA 2GZ1A 2ZBPA 1JWAB 4P3XA 3KLPX 4LHZA 1G20E 2BI7A 4EVSA 3CX3A 1FP6A 3JCZA 5EI5A 3OZ7A 1Y4DE 3ZK9A 1D9ZA 3JD2A 2YDYA 1YR6A 3A9SA 3FD9A 3VHRA 1ZWLA 1YR1A 3R7BA 3UXYA 1UDXA 1IATA 2C2BA 1P1JA 3FGPA 4AYXA 4J0DA 4UHEA 2XUGA 1QBGA 4CHGA 4FM0A 4KR0A 3BXOA 3BWMA 2COEA 4WI1A 4C05A 1BHJA 3PE6A 3SVTA 3FSEA 3O7WA 3OZUA 2HLDG 2ATIA 4ER6A 3FF4A 3OOSA 5CDFE 3RJZA 4GT1A 3WE7A 4HJRA 4C2UA 5JNSA 1FDSA 5AHKA 4FC7A 3HKCA 1SKMA 1THTA 3MSCA 1GQSA 2AUTA 4CL2A 2M2IA 3B38A 2WMYA 3LS2A 1Z16A 3D3WB 4MWBA 2I1LA 3I0ZA 1F4VA 5BNIA 1ZHHA 4QE9A 5HW0A 4LI3X 4O2AF 2HQ1A 4L76A 3ZHYA 3H1KH 4D6YA 3EFFK 4F1WA 3GLFE 4HQ6A 2AL7A 3F9IA 2I7CA 1B15A 3TR6A 4HS9A 3RG8A 4P5PA 3NWBA 4EECA 5CMLA 3IAHA 4D4JA 2WP0A 2XXAB 2OFWA 3CV3A 5J23A 2J59A 2CHVA 4EKWA 4Q18A 1TXGA 5GY7A 4E88A 2GEUA 1YV9A 5LQCA 4G63A 1KJWA 3M7MX 2AW5A 2I3GA 1JCHA 4NATA 5G0TA 3S1SA 2YW9A 2X5XA 4P5DA 5DBGA 3PZBA 3VH1A 5GZ6A 4DR7B 2RGDA 2HCBA 1UM9A 5LB4A 4PA3A 2LDBA 1Y80A 5U1PA 3WXBA 4H1UA 3SFVA 1WD7A 1ZUWA 3SLKA 3KZ1E 2V45A 3VR1A 1Z74A 1KMIZ 4DR1B 1LUAA 1R7RA 4BNGA 2BM1A 3VR4A 1WVGA 4EM6A 3Q6MA 3CS5A 3CNQS 3NHJA 2EFDB 2IUUA 4LNHA 1XRPA 2YS8A 3IOCA 1D0VA 1XOUA 3LYHA 3USES 5G0UA 2J7PA 1ADCA 4TWIA 4MI3A 3A31A 2A84A 1FCJA 1P2DA 3SS7X 2W2VA 4G5HA 3FOEC 2HHCA 5CK5A 4LZAA 1L4FA 2C1XA 1WB7A 2F55A 5CFPA 3DNFA 2RE8A 4QSMA 4GMDA 3VKWA 2QD1A 3T2MA 4GPAA 1QIGA 1RIFA 5B1DA 1XZBA 2KG7A 3PIDA 4NNJA 1VP9A 3WGJA 4LWSA 1X13A 5KWIA 3D81A 1C9KA 2HF2A 2QX6A 3IT2A 3HU3A 4PBRA 1RR6A 3FZNA 1JYFA 4P9OA 4DVJA 3EARA 3ZVRA 2H51A 2HXSA 1DWOA 3A2MA 1Z47A 2DLDA 2P91A 4ZVNA 2PUAA 1SHZA 4B6JA 2WUGA 3FDJA 1NTZH 4IDDA 3BY6A 4UULA 5LOVB 4AICA 3C3XA 4I4CA 3W6PA 2WJVA 1GAXA 3OE4A 5JWOA 2JCSA 5FAKA 3RFUA 3ND8A 5JBNA 3IAM6 1VB3A 2AEFA 5REQA 4YT8A 3R23A 4LF4B 4B3XA 3TECE 4MVRA 4PIPA 3RKRA 2J5KA 4I55A 2MSLA 3UMYA 2ANCA 3QV2A 5HKLA 1YJNV 2JGMA 1ICEA 3DMNA 2IPNA 2WU1A 1EXMA 1QG4A 5GONF 4X8LA 1DTOA 1P5JA 1NHGA 4OK5A 1PR0A 1XZKA 2UUBO 1APBA 1NZ6A 2BEWB 1JTEA 2EZUA 4HDQB 3V8EA 4Z53A 1N7GA 1HWYA 4E1AA 1L2TA 8LDHA 4QEDA 4WZZA 3O8OA 1P3Y1 3UM7A 5I01A 5CA0A 2DC1A 2P4VA 2ZBEA 4XQCA 5GQSA 5K0CA 4WLVA 3HZOA 4LE1A 3AX6A 4ILKA 3ZYCA 3O95A 1CJUC 3FWHA