5D5QA

Hcgb from methanocaldococcus jannaschii with the pyridinol derived from fegp cofactor of [fe]-hydrogenase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
VMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards artificial methanogenesis: biosynthesis of the [Fe]-hydrogenase cofactor and characterization of the semi-synthetic hydrogenase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Uncharacterized protein MJ0488, Guanylyltransferase
total genus 51
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5d5qA01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 5d5qA02
1UC5B 1RSOA 1IWBB 3WB2A 3BRCA 5JJEB 1NBWB 1T5EA 2F95B 1IWPB 2F1MA 1EEXB 1DIOB 5D5QA 1VF7A 5JJJB 1MMFB 1EGMB 4L8JA 2F93B 4GYCB 3AUJB 5D5PA 2V4DA 2D0PB 4DK1A 2D0OB 5JJNB 3WB0A 4DK0A 3LNNA 3WB1A 1EGVB 1H2SB 1UC4B
chains in the Genus database with same CATH superfamily
1NOKA 1TYZA 2L82A 1QP0A 1OT5A 1Z08A 2H4ZA 1LQUA 1BE0A 1GU1A 3U4MA 3AWDA 4A8TA 1GHTA 1BE1A 3DHYA 3PC6A 2HGSA 3M4YA 2LWIA 4ZAFA 2HSDA 4FDTA 3TFWA 1EHCA 3BHIA 3OHPA 4ASUA 3OEHG 4B3IA 4BV3A 2WLLA 1H8HA 1P3Y1 5C93A 5BSRA 4GLFA 4KO8A 4F38A 4PRZA 2ZIXA 3KXPA 2QX4A 2YV4A 3AEKA 3H0EA 3N2YA 1QJCA 1L0BA 2C4WA 2V03A 4P58A 2Z9DA 4X45A 2IL1A 3VAAA 1R0KA 2OZKA 2A3QA 2VAVA 4HTFB 7MDHA 4ZZ0A 5IAAA 3RAGA 1F0PA 3UWPA 1VXOA 4ZO9A 2BP7B 3FMGA 2B8NA 4O1IA 1OMOA 1Q57A 4ZCMA 3S2EA 1Y4DE 4FFSA 1N5JA 1LR1A 2TYSB 1H2RS 1WWKA 2R6AA 2FR8C 2WW8A 4URHA 1JE0A 5JHGB 4M88A 4W1RA 5A5VA 4CWAA 2IXDA 1UT6A 2IXEA 5MN4A 4MCIA 2HDHA 4IVNA 4P38A 2GD0A 1JVNA 1SRRA 3M5DA 1W85A 1A7JA 1DOZA 1VQPV 2O8DB 1NQWA 2JLRA 2ZSJA 2Q5HA 3FR8A 1QAMA 4HGQA 2A4KA 4HS4A 5CXSA 3W6NA 4A2PA 3JYNA 2QN6A 4DGQA 3QSYA 4X44A 1U2DC 3F47A 2H52A 2QG4A 4S0ZA 1H5QA 1T26A 3ENVA 3HR8A 1ND5A 4UBIA 3L4BC 4TGLA 1LBTA 5HKBA 2ZAGA 1BQEA 5A9SB 4OXXA 2CHUA 4L1KA 3TKYA 3QF4B 2A9QA 3HCEA 3BXPA 3ROTA 1P2VA 3LT4A 4GEGA 1AD2A 1VPTA 4ZAYA 3PICA 3TSAA 4FYKA 4M86A 4AU1A 2D7DA 4ROSA 3IUYA 3KJZA 4K9SA 1N3YA 3EWSA 3NHWA 3IEKA 3IT0A 1NIPA 3WDSA 3RC9A 5BW4A 2N04A 4KE6A 2X4GA 3UUGA 4AS2A 3GEHA 5FTNA 5HXAA 3V1YA 1FFTB 4PF1A 2WPDG 4KO4S 1Z2GA 2FN4A 4MZXA 2PRJA 3OY2A 1XQ9A 2YC4C 4HCJA 2OKCA 2IPLA 4BLQA 1I5RA 1Y48E 3PRJA 3QEMA 5CT5A 5J2TA 1R8QA 2EFHB 2KX7A 1PV4A 4U3JA 3OUTA 3AETB 1D09A 1F8UA 1Y4UA 4MR8A 3ABIA 4H0CA 4R3WA 3STWA 4MYUA 1N5RA 3CZAA 3MBOA 3QELB 2ATVA 4EA6A 4UCRA 3M9XA 1Z7YA 5LQCA 2OZLB 5F33A 1SCJA 2Z3VA 4YXWA 1WCXA 1X8JA 2XKJE 2A67A 3RRBA 4IMJB 3WK5A 4X20B 1GMGA 1L5HB 2JLAA 3VR6D 2XJ4A 1G8FA 2SCUB 1XU9A 3H3FA 3ONVA 4TVBA 1CIJA 2XQJA 4D8VA 4PZCA 4L78A 4PYIA 4KRFA 3DVLA 2I8AA 4CG3A 1L4HA 3Q98A 4OHRA 2BI7A 5T4BA 4RTRA 3HRIA 2OZVA 1DXOA 2VKTA 1FP7A 2QL6A 1U97A 4OHUA 3DTNA 2HSZA 2JI9A 3QKRA 1Z0JA 2H1CA 2ZM6B 1SG0A 4KQIA 5ALWA 3ZY5A 3DJFA 3WB2A 5FBWB 1G8JA 3LUAA 4KVGA 6REQB 5HWSA 3BRCA 3K72B 4CCYB 3B7WA 3VSBA 4A5OA 3SR2C 3ANLA 3EWNA 4UZFA 5AJHA 4F71A 5D00A 2Y0PA 2UYOA 2JZCA 1WCV1 4M0LA 4F6LA 1CS4C 2J85A 4E3WA 1WXXA 1QIHA 2WJPA 3PWZA 3ADBA 1VDZA 2GAFA 4UHJA 2FMUA 5K3DA 4DIFA 1SIWA 5BUZA 1Q17A 1JZTA 1WMBA 2QLFA 1LNQA 2YHSA 2FWJA 3N76A 4IHQA 3RFVA 1KPIA 1EXWA 3QEMB 1E6MA 2HA5A 3UO3A 2AOXA 2EG9A 5AVQA 2GILA 3VYVA 3GGPA 4YRRA 3LLUA 2Z2IA 3OCWA 1GQRA 3KZMA 1CS0A 3GB7C 4TS1A 2D1YA 2RKWA 1UZUA 4B6EA 3MUOA 4OYRA 2QSAA 1NOJA 1V7ZA 2CZQA 1SHTX 3RHSA 3U26A 4DG9A 5KAFZ 1IWPB 2IP1A 5JXJA 1ACMA 1SUWA 4P0QB 1MEEA 2YI9A 1IXSB 3GDFA 4I81A 3T6KA 4DZTA 2EJBA 1HV8A 4GL4A 2BM8A 2ZXFA 5ES3A 5TPZA 5K0BA 1IXBA 3NKLA 1Z28A 3LXRA 1V39A 4R1NA 2CNLA 3HXLA 2XA2A 2ZSAA 4A0SA 4B8ZA 1Y34E 1D7AA 5AXAA 5DTMA 4LYJA 1J70A 1V8OA 1UMCB 2GPYA 2XUMA 2OVFA 2RK4A 3KLPX 1P0MA 1MZVA 3AEUB 1ZSYA 3K1TA 2P1ZA 2IW1A 2E89A 3IR5A 3MS7A 4NWIA 1KJ8A 1XPJA 3B1YA 1QR8A 1O5IA 3D6HA 1VYUA 2CUKA 2J6HA 3GVXA 4CLEA 5C8XA 3GMSA 5HE9A 3N0VA 3BMCB 5A62A 1JCHA 4DMCA 5CAEA 3BD7A 4JI2O 1AQ6A 3OPMA 1A27A 2OECA 4KWCA 3JD0A 4JP5A 5FR1A 3VTZA 2IYWA 2IOYA 4R2IA 1M0TA 1MTOA 2R4TA 2X40A 4FZ5A 4P4GA 4YLEA 3ADDA 1I7PA 4DR7O 3T1QA 5KYYA 1BS2A 1UT5A 3K71B 2EBHX 3L9WA 3JWPA 4R0NA 4GMDA 4BNNA 1Q1QA 4RKRA 2PKEA 4XLTA 1HE2A 2FUG1 4I6EA 2B1JA 4I50F 3ZG6A 1QAOA 4LJAA 4BWVA 2GM5A 2QQEA 1AKWA 1OE0A 2W6ID 4IQFA 4ZTBA 3BH6A 1X80A 1MW9X 2J32A 3L7DA 4RDCA 5IUKC 2Q46A 4YMUA 2H4XA 4JZKA 2ZSFA 4QJFB 4MB0A 4YJ3F 3WFZA 4OK3A 5G3YA 2AFHA 4PA9A 5EG5A 1YJCA 1PM9A 4M1KA 2BPOA 2FLKA 1TVEA 2VJMA 5DWQA 2ZQZA 1H3EA 1S96A 3VHQA 1ND6A 2EJRA 4F5ZA 2MSWA 1RFGE 1E3QA 2DZDA 3GH3A 4XDJA 4X6UA 2NSDA 2D4HA 5K0ZA 4B3RB 4XXHA 2RCNA 4EY7A 4FZJA 5DTEA 2ZR3A 2AV6A 3RKUA 1OAOA 3U3MA 4J16C 3KPVA 4PAWA 4HOYA 1AGRA 2NX2A 4IDAA 5DWDA 4BZPA 5A6SA 5LMNO 4R2JA 2BCEA 3K09A 3GW8A 2VBCA 5LZ5A 3NVAA 3OETA 1XCOA 5JAPA 4ZWNA 3WU2Z 3D8RA 5I9TA 4B87A 2IC5A 5CB4A 2J9YB 3FPBA 4NS4A 4G0YA 4O25A 3HNPA 5IY5C 1KDOA 1UDXA 3EEBA 1R4MB 3H5RA 4PX2A 4R1OA 3WLKX 2PX3A 1RWKA 1IN5A 5GJCA 1NU6A 2YJZA 3PIIA 3ND7A 1VE1A 1MA1A 4ZQBA 3EC7A 5FL3A 2QN2A 4QWWA 3BQNB 1QRSA 4MA4A 1XAHA 4OJNA 2X15A 4YRTA 3NAZA 2A4MA 5JJJB 3T3PB 3OZEA 3DMTA 3AJRA 3OLCX 2XE4A 1P9WA 5FOUA 1Q43A 4CR8A 3JZIA 5JUWA 4YRMA 3ZYZA 4IF4A 2FG6C 1S5LZ 2ZQ5A 4XUEA 3PD0A 2H31A 4IZOA 2NSYA 1Z4NA 1MAWA 1UXKA 3D4NA 3MJVA 4JBGA 4LBWA 2A5FA 1IIRA 1VSUA 2R97A 4TYMA 5FP0A 1U2DA 2RCYA 1VMGA 1MAUA 2CNWD 4V0SA 5LXTF 5I9LA 1KZ6A 3RAFC 3A1NA 2YIMA 2YV1A 3AI1A 1BWRA 1FXVA 4GM4A 4RHTA 3KQWA 2LP7A 3BPZA 4MKIA 3JQ9A 3AVUA 4Q7EA 4MW9A 2BJHA 1MB9A 2A3NA 4YCCA 4Y3UA 3TDNA 1NF3A 3CNLA 3OTWA 3EOZA 1E3TA 2Y92A 5DE3A 2XVMA 4PA6A 3IL2A 4QQRA 4B79A 3X2FA 3G9XA 3VQXA 1SC4A 1VHDA 4MXDA 1OBHA 3FYUB 3QBEA 2ZOSA 3E3OA 4NKGB 4JI0B 1C4WA 5LYYA 1VMIA 1JQDA 4Q00A 5F64A 1CY8A 2GZSA 2IQIA 2WFZA 2XLCA 4JI7B 3AC0A 1O97C 3EULA 3M9LA 4TTPA 3PXEA 4J0GA 2VCEA 4BKPA 3V4RA 5D8DA 2C5BA 1F51A 1EUDB 4PC7A 1XZEA 3RVSA 4DDTA 2VHEA 4MW8A 1QDUA 4R05A 3ZV5A 2D2IA 5B7GA 3ETJA 5JMWA 1PK7A 1K34A 1THZA 4JGBA 3SJAA 3U44B 3CC2V 4Q1CA 3SYTA 5JNUA 3RYCB 3H6GA 4DXHA 1XHEA 3MCZA 4NARA 4XWOA 3KHSA 3RE1A 4FDMA 3VDQA 3K8YA 3CR3C 5IKPA 3WISA 5LBTA 3KT6A 4LJ7A 1LLCA 1TGOA 4EG4A 1A8SA 4RKYA 3D4IA 4XPZA 2JZNA 1NBAA 1Q7TA 3AETA 4FEGA 1PP4A 1R7RA 3LC2O 3BL8A 3JVDA 2ETVA 2O2HA 4ZAXA 2IH2A 2B5WA 3MHHC 5H59A 1TA9A 1RWQA 2H57A 5TDHA 3RFTA 4BL5A 3V6LA 1E94E 1L7QA 1VMKA 4NR1A 1GPYA 2Y0CA 5ALRA 2F90A 3W5SA 3FG9A 2D1SA 1KS9A 1E9CA 1G55A 2H4HA 2QKSA 3DP9A 1N2ZA 3FUXA 4GH5A 4F4IA 1X74A 3C4QA 2O2EA 1R9NA 1RWBA 1XALA 3A36A 3PKZA 4WXPA 5EJ6A 1FVHA 1G7CA 5EMHA 4KYUA 3SNKA 2XJ9A 3BRSA 5IF3A 4X7RA 3AESA 3B2EA 2CT8A 4JSRA 4AQYB 1O6CA 3QQPA 3ONEA 1JDBC 3U37A 3RIXA 3RTGA 1R50A 4JNCA 4JJKA 3VU0A 3S8YA 1PJRA 4M8IA 1W5AA 4QBHA 5ALGA 4BZQA 4BCDA 4IIBA 5FOSA 5BQ5A 2V5AA 3RWOA 2O6LA 4DUYB 2OP0A 2ZJ8A 2MSCB 3HN2A 2J6CA 2E1RA 3CUTA 5K99A 4JSTA 1W36B 4FYPA 1VIBA 4CL0A 1K66A 3I56V 2B34A 5ESWA 1NBIA 1RU3A 2YFYA 3HYNA 4HPJB 4MW5A 1XDDA 4XE5A 4RLFA 5EQDA 2BELA 3HLKA 4KCGA 4QBIA 4KSCA 4K5QA 2BDTA 2H2AA 2ZWOA 4AO7A 3E1KA 2YMPA 3QTBA 4JJ4A 1GWNA 4K9MA 4GOJA 5F7JA 5CDUA 4I19A 1DIBA 3MCWA 4KSBA 1B4DA 1VYTA 2A58A 4LJ5A 3F98A 4W6QA 4CEJA 4HKTA 1D6SA 1ZW6A 1M4UA 3D8TA 3DT8A 4BBJA 5DX8A 5CT8A 1WB4A 1Q1NA 3N39C 4CH3A 1WD7A 2ZWPA 4WKPA 1NXOA 2A30A 2H9IA 2Y3IA 2MWMA 1US8B 3GVCA 2P9ZA 4F5EA 5KKNB 4RIEA 2GEUA 5FORA 1FS6A 4WOBA 3P3NA 2HSEA 1GFZA 1SELA 1HYGA 2WIKA 3NZEA 5TARA 5HF8A 4KPGA 1Z6AA 3B1VA 621PA 4KLRA 1LB1B 6LDHA 1GZHB 2VH2A 5AVOA 2VAPA 5AW8A 5BNZA 1UWKA 3HWWA 1SQPH 4DCUA 4X9XA 1JFVA 1UODA 4YUXA 4CMBA 3R3ZA 2A35A 4GLLA 4GPTA 1RI3A 4MS4A 5EPEA 4DDHA 3U6BA 3ZDAA 3HR7A 2WMNB 5DIFA 4ZQEA 3HMKA 4NNOA 1U8UA 4ER3A 2M6KA 1ODFA 1AGPA 2R25B 3L1UA 2BN4A 3L7KA 4YUZA 4UHKA 5I7SA 3L73H 2VOEA 3MCTA 1BXGA 3C98A 3WRXC 2QRGA 4OXYA 3SC6A 4KKXB 4CNBA 1XZLA 4I36A 2I9PA 2R8YA 1AB6A 1KR2A 2WWFA 4IJVA 5EXXA 4ZZ2A 2CLEB 4LSZA 5FPSA 1H2MA 4GR4A 4RPJA 1M8JA 1ZHHA 4UVHA 1QFYA 2VZ0A 5GPBA 1QKJA 1EFRA 2DUJA 3OQOA 1JKMA 2WQ6A 3I6BA 1NDHA 1M6NA 4D4JA 3D6UA 1NQUA 2IOQA 3GLQA 4UQOA 3G0OA 4YQYA 4EECA 4PGFA 5A2GA 3HSYA 4JTDB 3I6IA 2PUSA 2E4UA 2WF5A 5FO0A 1V6SA 5IU6A 4QM6A 3SQXA 4B08A 1G1XB 1MXFA 5JC8A 1RXYA 2E74B 2PT6A 4PZYA 5KWJA 4TMYA 1U31A 5JNRA 5IRCD 5C18A 4Y0AA 4JYZA 3K57A 1JKXA 4B48A 1Q1EA 1T3HA 2FUEA 1JJ7A 1Y3IA 3KT8A 1U9IA 3E03A 3NKVA 2AZ0A 4KMSA 4MKGA 2C2XA 3VFDA 1ZDMA 2ITDC 1KVQA 1PUXA 3AIKA 3OHMA 4M0DA 3D5TA 2PH1A 3AR9A 3CLSD 3TTTA 1WBDA 3Q72A 1C8BA 3CPSA 4KLAA 3KR9A 1VEWA 2V97A 3BL6A 2WTUA 3EIHA 3ZIAA 4H7PA 4ERXA 4QARA 1JHVA 2XVAA 4FC7A 4J10A 1XZQA 3KEGA 1ZRNA 4PTZA 1CF4A 1C1XA 1XZPA 2W2LD 3OZDA 2X7JA 3P0RA 4P83A 3SP1A 4KR6A 4QTUB 4XJSA 2KSDA 4YV7A 1U7HA 3CR8A 2RHJA 5KOYA 4CH5A 3EXAA 4KQFA 1G21B 2JVDA 3OO1A 4RU1A 1QYVA 3OG9A 3STVA 2NXJA 3GWZA 4Y2UA 2IUUA 1DEOA 3X43A 1E2EA 5B7PA 5GIPE 4DR2O 4HDSB 3HY3A 4E03A 4PA3A 4W5NA 2Q67A 1QQ7A 3Q85A 1X0XA 1ANKA 4J0CA 4KXLA 2OK7A 2FPXA 4TRNA 4ZARA 3QHAA 4AYTA 1E3WA 1TZKA 1W7AA 4ZMBA 3SYOA 1PI3A 1WCWA 3G2QA 4L5AA 5IHXA 4EYSA 3AESB 2AWNA 4PI0A 4GE3A 3S1AB 2Y05A 1E7WA 5GMOA 2AF3C 2CHEA 4QGPA 1V7PC 1CT9A 1C4OA 3O7WA 3JATB 3CZ9A 3E5RA 1AXGA 1M2JA 1V16B 1YZYA 1AZLA 1UT8A 3IC7A 2VJCA 4O4LA 3E9EA 3NCTA 3ND5A 4MO9A 1Q77A 4D26A 4H77A 4FI3F 1OXUA 1L5KA 3T12A 1UZMA 4YHHO 3FLEA 4W5HA 4A5UB 4BFYA 2O3UA 3LVBA 3JPWA 4E2YA 2OA0A 4QRHA 4JHXA 3DC7A 2OENG 4ZYVA 5J47A 5K0EA 3P0HA 4B32A 1BDHA 3DOIA 3REGA 3ZDEA 3JU3A 4L7VA 1DWPA 2BW0A 3GNQA 1OZ0A 3TOZA 3V8QA 1R8XA 1E0DA 3IOCA 4ZDIA 1QV7A 1LK7A 4ND8A 2HJGA 5BXZA 1BKDR 4L75A 1NJGA 2PHZA 1NI8A 2WJGA 4I1IA 4JVLA 4OQYA 4R2LA 1P74A 3LZDA 3H1PA 5FNZA 1I2DA 3FYUA 3V7WA 2OAP1 4JB0A 2Z3ZA 4BRZA 5CCBA 2WLKA 1PHPA 1ZSPA 3I39X 3KOYA 1RSOB 4JKYA 1X38A 2GEFA 2AOUB 4A82A 3VHXB 4Q21A 1JQLB 3KT0A 5K0FA 4V03A 1EUDA 4GFDA 4HWTA 1RQRA 2O7QA 1AI6A 2VIIA 3DKVA 3FZNA 3J7AC 4V38A 4G27B 3OQPA 3P9PA 3WBKA 5ED4A 5BN5B 3E6AA 3IP1A 4MEJA 3ED5A 3IFSA 3CRZA 5FLEX 4AB1A 5GW7A 3WQQA 1SQVH 4EVIA 1BW9A 1E9DA 2CUZA 4PA7A 5FBKA 4JD5A 2XI4A 4DLZA 1GKKA 2NYUA 3MTIA 1OWLA 4Q7JB 1GQYA 2GYYA 2DFVA 2R4UA 4NTWA 3VPBA 5EWMB 5ELLA 1WF6A 5AHXA 3SXJA 2BM9A 1DELA 2IDZA 1GTMA 3CRCA 1ZBQA 1GADO 3HVIA 2X4LA 4G81A 4LRYA 2O8CA 2F59A 4YIPA 2CH7B 3IPRA 4D96A 4K9KA 2X0NA 5DNUA 1NXSA 1U4NA 3RVKA 4BMDA 2ZFUA 1R64A 1UDCA 3MS4A 2WYHA 5E7JA 2DCUA 3ZOZA 1F8XA 1KXZA 2JW5A 1RYNA 2GPSA 3SR4A 1S3JA 1M34B 4QPZA 1XEXB 4G5SA 2ZI7A 4K3UA 2FGKA 4JVNA 5GV8A 4D0SA 1JFRA 1LBSA 2Z8YM 2J6BA 3HV2A 3FAVB 3OZTA 4IDFA 3PVCA 3G2PA 4GVXA 2IYZA 2V1XA 3PXAA 4O02B 4BX2A 3WNZA 4RE5A 3B5IA 4QDUA 4MCJA 2W6JD 3VPDA 1E2DA 2H7YA 1KZ1A 5H3HA 1K75A 3BKXA 3L04A 2ORYA 2NV6A 4BZWA 2JHGA 1AXEA 1SBIA 3H7AA 3LH5A 2R6R1 1DZ3A 2Z9CA 5TQ2A 2QJ1A 2BONA 2CTWA 4KRYA 4N6OA 1U0GA 4MWGA 2O9JA 4EWLA 4FB5A 5JASA 4D80A 3WGUA 1Z4PX 4W5OA 2DETA 3E5HA 4IVPA 3C3TA 3OE5A 3ZNNA 2OIEA 2JIOA 1NVUQ 3ZIAG 2NUPA 3BMNB 4FNAA 5F77A 3WYFA 4FE4A 4TV8B 2VNIA 1T91A 2Q5EA 1GV0A 3D8UA 1AKUA 1H5NA 2ZE5A 2GAIA 3HUFA 1Y3HA 4Q3LA 4RLHA 2RHCA 1A8PA 3HI6A 3G7UA 3IPLA 4MPPA 5EIWA 4DQ0A 1O0BA 2H63A 4R6XA 4OHPA 4ZCSA 4PIMA 5DNVA 4XX0A 1GTG1 4AJKA 3ORSA 4PLTA 1YL5A 3A1VA 3BXZA 3NOOA 4OIMA 3BD8A 4HR7A 4MDYA 4MWCA 1STOA 4PYLA 4MDEA 3OQHA 2ZRGA 2PL3A 2OCHA 3CS5A 4AULA 1OWPA 4LSMA 4I4TB 2ZKIA 3OJWA 2HFKA 3CS3A 4HLQB 2BWJA 5J4VA 4BFWA 2BKEA 3ZDBA 4C04A 3AKZA 3BA9A 1L8DA 2AVDA 4E4EA 4JN6B 4Q20A 4JI8O 2FRXA 3ZC3A 1R6TA 1IQPA 1DZIA 1B6RA 3AB7A 3ZXUB 4YLGA 3SF0A 3EC2A 3IERA 3NLLA 3ZDQA 1CEXA 4CNQA 2J67A 4DARA 3JX9A 3ZWNA 4U7PB 3WMEA 4F21A 2ZXEA 1Q5PA 2VK4A 5FTWA 5MHTA 4F2DA 3CRAA 2FR0A 1I14A 2UXBO 4BMVA 5LMCA 4LE1A 3AM5A 4HI0E 2R00A 5DI3B 3ZHUA 3K5NA 3ZJZA 2FW7A 1E0KA 1Y1KE 2ZPUA 4QXQA 1JZQA 3ZGNA 4BQFA 2PLAA 1SETA 3HPLC 3AZPA 2OG1A 3I4FA 1EUCB 3B82A 4K46A 4K40A 3TVTA 3NVDA 4BX0A 2ZTVA 1Y3FE 4TSFD 3KZNA 3ZXYA 2VNJA 1K7YA 2AXEA 3VX3A 3LYAA 3TGLA 4BYGA 1QF9A 3QFTA 2PUVA 3BAFA 1V1RA 2QZZA 1JAHA 1FYDA 2YY5A 3LC7O 2B1RA 5CAEB 2IU4A 2WUGA 5LP6C 1PSZA 1RRVA 4FFWA 1ZXBA 4MX8A 3ZEDA 2EBWA 5AKXA 2ZWAA 4JYMA 1C9YA 4BVFA 2AIRA 3NHLA 4QGFA 1I6KA 2C7BA 4P4SB 4WLEA 2BE9A 2BISA 5BNTA 4NYMQ 1EN6A 1Q3KA 3U40A 2QSYA 4WZ6A 2GI4A 2OB1A 1XHZA 4IZIA 2OM6A 3UEOA 2L17A 2C0CA 3V00A 3CLVA 3TZKA 3ODGA 1GRJA 1IN6A 1X9IA 4RA9A 1UBCA 1SXJE 3DHNA 3OOHA 5SYNA 1O6BA 1DDIA 3CNBA 3DZIA 4IDPA 4RGBA 4XUDA 3O73A 3BGVA 3OM8A 3WYCA 5LUBA 1JHXA 1W6RA 1ZITA 3B9BA 3NNDA 1WSBA 5L45A 3KAKA 2C94A 2XOKA 3CRMA 4Q01A 4BV8A 3ZE8A 4BVHA 4RS3A 5IYCO 1QO7A 2A59A 2WWIA 3C0KA 4M1MA 1QVRA 2VYCA 1IUPA 4HZGA 1WUTA 4L4YA 1YJWV 2PU7A 3AY0A 7REQA 3BIWA 1NOIA 1H2KA 1HQDA 4FYXA 1XL6A 1SXIA 4TUYB 2GK4A 2ZTUA 5I7RA 2PKXA 3NBZC 3L0CA 4HFNA 1QOPB 1J2RA 1ZX1A 2NNLD 3R0XA 3DEAA 4YREA 4ITRC 3TMAA 4BNLA 2NR5A 4YCAA 2V7QD 3EVCA 3F67A 1C0KA 2ZSEA 2PT7A 2P68A 3F6BX 4GLOA 4I5FA 2QORA 3D4OA 3D64A 3HWSA 5AW1A 2YICA 4OH7A 2QR4A 1J1IA 1IDOA 3BULA 2H6EA 3L8EA 4XB6B 4C5BA 3JARA 4DADA 5HKOA 4A8PA 3QU2A 3E8FA 3FCEA 3WR5A 3ESBA 3T9DA 4YYZA 2NNWB 2F23A 1Q86W 3OMWA 4NZYA 1SVNA 2NXWA 3GU3A 1NUTA 4ZGGA 1DGQA 1QPGA 1R6BX 5IX8A 3SXPA 3PI6A 3RHFA 1RWWA 1YKGA 3AYXB 3SLGA 3SZLA 3VH1A 5LQJA 5B58T 4D9EA 2QMEA 2PT5A 3NBQA 1HDGO 2VRWA 3RIEA 2WJIA 2QZSA 2CL6X 2XMSA 3F97A 4OPHA 1SC1A 4M8SA 1B43A 4N8EA 4YFVA 5IM4A 4YJ2B 3GK3A 1YZBA 3B09A 4PYKA 2LKCA 2OYSA 3ABRB 2BCCH 4YIOA 1P1CA 1IQUA 1DX9A 2I4NA 4G0PA 3NEAA 4IHJF 3LBNA 5JQGF 4Y2JA 1WMSA 3HH8A 3NAQA 3OZAA 2D5BA 1JWBB 4JQCA 4EZBA 4URUR 4LH6A 1X7ZB 3P71T 3QVGB 2EZ4A 2QTOA 2ACWA 4CS3A 1N75A 3BREA 4KN5A 4NZPA 4H3VA 1BVHA 2J0UA 1I33A 1FFWA 2R44A 4HQRA 3W7SA 1KY2A 4CV3A 5E3IA 3IDZA 2AFIE 2ANBA 1AZSC 3DBRA 1X7XA 1XUOA 4I3GA 4NS1A 4PE5B 4BO8A 3QA3E 4FOTA 2YC2C 5AM3A 3TLZA 5FD8A 2HK7A 5F52A 3AF3A 4FXOA 3I5AA 4WH0A 1SQ5A 2OAEA 1KVTA 1PGNA 2PGGA 3LBAA 1IBKO 3BRQA 2FR8A 4NFHA 2Q0QA 4OX9O 1AY0A 2IPOA 4LI0A 4MRMA 3AF6A 1GPBA 1YDGA 3PLNA 4O0MA 2QZ9A 1C1YA 3EIEA 1DP4A 3NVKI 4JYCA 2Z5FA 1JSXA 2PWYA 3DT9A 4NZOA 2BFEA 1DEKA 1N0HA 2O7SA 3W2TA 4ZZIA 5BOSA 1FB5A 2F1RA 4XR9A 2EP8A 3ZCQA 1B73A 1P62B 2FEXA 4IGIA 4EHHA 3KZVA 1EWRA 4OYHA 3FLMA 3WBJA 2C31A 1TTQB 3TQRA 2AG8A 2AHZA 3H97A 3K0AA 4GMHA 8ABPA 5JSZB 4GR9A 3UJ8A 1NT2A 1K6JA 3QW4B 3H86A 5F76A 4Q4HB 4E1BA 1DX4A 5FXMA 3WWZA 1H42A 2FQ1A 4C0SA 4MVJG 2UXDB 5BSMA 2ZJ3A 4ZV4A 3ICVA 2DEUA 4RGYA 5CX1A 3JQ7B 2DPMA 1Y3BE 3PC2A 1I3MA 2J5BA 5HFLA 2P9BA 3T3HA 1KFCB 1CUXA 4WY5A 1BS3A 1VGRA 2QROA 2XCSB 3AUKA 4N5NA 4M49A 1ECBA 3NKFA 2Q68A 2OKGA 1X1BA 2CBGA 4JIGA 3T9CA 2BFDB 4LBYA 4PSVA 3M1AA 5JWPA 4BFVA 2QJWA 1TLTA 2XOKG 2NO5A 1FXUA 1A2KC 3E9ZA 4UUOA 4DV0O 3LM8A 3IQWA 2PKCA 5JCPA 4Q7LA 5FPOA 1SQGA 1BMQA 1KO5A 2GT1A 2F9FA 2RHWA 4PXYA 2BT4A 1T9ZA 3L0ZA 1TA8A 1R3JC 3TG8A 1NNSA 2OO5C 5DJ5A 3UB2A 3KJHA 4LY9A 4O2BF 2Q7DA 1SCKA 1ZLYA 4NU8X 3MAGA 3TQFA 2XZDA 1YR9A 3GLGA 5KO2A 2H4YA 4N41A 4LZLA 1M74A 3S4YA 2HADA 1EM8B 2O4CA 2OT3B 3EEQA 3UG6A 3CEJA 4R81A 5IC4A 4W9MC 3JQEA 4P7GA 5G1OA 3VH4A 3EB9A 2NQTA 3GAFA 5IZCA 5HGXA 1K98A 5CNKA 4UB8Z 2FX5A 4XBFA 4E2FA 5HQ3A 1A8QA 2X23A 3S3WA 5BN4B 4CLOB 1L7PA 2BF7A 1R0WA 2CSXA 3TSYA 2QBYA 2ZJ4A 4KDRA 3UATA 2WKSA 3BM5A 1DOAA 4CM4A 1D1QA 1Z18A 2X1MA 4ZYXA 2VJAA 1IBLO 1U2EA 2H1SA 3EQ9A 4JA2A 4CI9A 3FNBA 1U6JA 2ERXA 1BZKA 3P96A 3ZGVA 5FAKA 3E1SA 3WYBA 1QVAA 4B34A 1VQ9V 2ZIXB 3T7IA 2QLTA 1KJJA 4YMSA 1JEYB 3VR5H 4WSOA 2ADFA 2DHRA 1PT5A 4BN5A 2WTXA 4DUGA 1G20B 4TXHA 1RJEA 2P3OA 1DTOA 2A57A 3Q1KA 1HNXB 2FWPA 3AVPA 2LRHA 4U63A 3IV7A 3HU2A 5FBQB 4GL2A 3OEWA 2BZGA 2V4ZA 2GZ3A 3DMRA 3LV8A 3T52A 4QPPA 1JQJC 1YU9A 5IBPA 3FHTA 4FWIB 4Q7QA 1MUUA 1PIWA 1X3SA 4U5QA 1CY1A 1SBHA 3GFOA 3PB3A 2VXCA 4WDQA 1KHTA 2WJZB 3SDSA 3DULA 4KAFA 3RBXA 5DGDA 5LYJF 2V9ZA 2XNHA 4HYEA 3EDMA 5FV4A 3ORHA 4RKWA 1LTQA 3BIOA 4QEDA 4REOA 1R4ZA 1KVUA 3ASUA 4U7JA 3UJBA 3U60B 3E1GA 2HRQA 1NH2B 3ZD8A 2RH4A 1XYYA 1E6UA 2DBQA 4G4GA 4MQUA 3GJ6A 2ZE6A 1GITA 1K6XA 2BV3A 4FWBA 1U0SY 2ODAA 4G85A 4J94A 1SR8A 4BNUA 5KBYA 2Q1XA 4ND1A 4QRIA 3SHTA 2JCYA 4BMYA 1ZTEA 1LPPA 4JCCA 4PLVA 3OJXA 1WXWA 4X3OA 3UXHA 4MKHA 2PUWA 3DEKA 1GG2A 1JDJA 3GEBA 3KPJA 1X59A 3EGDA 4H16A 4M9XA 1EFRG 5BP7A 3H1GA 3KQVA 3ROEA 3H99A 5L3RA 4B09A 2C7GA 5ENDA 2H0RA 3AUUA 3TUZC 4OCZA 3QLEA 2EFEB 1N9ZA 1XMVA 2YZMA 1Z38A 4MQFA 3WZLA 5LKRA 3F4KA 2CJWA 1H2LA 3KZIZ 4JC5A 4WCEV 1I94B 1LPSA 2DT5A 3KZ1E 3NJ4A 4LS3A 5HBRA 2VAMA 3NIBA 1V4BA 1XXHA 3LXMA 3PQFA 2W2QA 4OV6B 1Z7GA 1JP7A 5JSUA 3CVWA 1LDYA 5JLJA 1FUKA 3TKAA 2ODBA 3AOGA 1RC0A 1O94C 2FWIA 5C7YA 1M56B 4OQ4A 4PPYA 4JGSA 1JHDA 3H13A 4JP3A 3UJ9A 1YWGO 3BEHA 4OYYA 2CK3A 1EA7A 4UTOA 4K05A 5LOVA 2XVXA 1PW7A 3B51X 4G36A 3S28A 3PJEA 1J25A 1XROA 2VFAA 1SCUB 1NATA 3OLYA 4MS2A 3KTAB 4JOBA 4NICA 3SBDA 3O4HA 5TMBA 1QR6A 4JC0A 1U90A 4XQ9A 4B33A 4CQLB 2D59A 5HUHA 4OLHA 2ZNJA 1SCDA 5CG1A 1M6VB 1Y4ZA 4U4AA 4YAOA 3O38A 5TT1A 4OGGA 2HK6A 5AOVA 2VDLB 1D1SA 5BY1A 1H6AA 1SIOA 2EBUA 4FHEA 1P4AA 3RYTC 4EL5A 2A1TS 4B9EA 2C4UA 2HIGA 3FXAA 4HO1X 3WGLA 4BIMA 5JCXA 3VZPA 3KD2A 4TTTS 4X8LA 2RE8A 4FDAA 2QLJA 3T38A 2DECA 4BEBA 2P35A 2WILA 4IZHA 3MFQA 1WA8A 3UMRA 1V1MB 5TQ0A 2W7TA 1ZH2A 2OLEA 3DVAB 5D3ZA 1PWHA 4BFCA 4D56A 4EY5A 4IDOA 1MBZA 5FADA 2ORWA 4UREA 2V0GA 1IBKB 2BVNA 5AOBA 4B5KA 1KZHA 1KI8A 3D36C 1SXJA 3USES 1GGHA 1NQVA 3V8BA 3RWBA 2O23A 2OGSA 4JI2B 3MT7A 2ZUBA 5FCDA 3VOAA 3ZWMA 1R74A 1GRRA 1OBFO 2LIPA 1RBYA 3BKWA 1E77A 2WFMA 5DN9A 2C7QA 2O8FA 1T36B 2F3UA 4PDMA 3FI0A 1XEWY 2Q6KA 2Y4OA 3IT2A 2XGOA 3Q41A 3IXLA 3UJPA 3ZMVA 1JJIA 1G8MA 2QTBA 3WHLA 4C0WA 1B00A 1TCVA 5A4KA 4PLZA 4BRUA 3JQ6A 3V6MA 2IV2X 2ZAIA 2C5LA 1JIUA 1Y8AA 3FFQA 3ENQA 5A3RA 3EZ2A 3TJMA 4GVLA 1U9ZA 1MN6A 2ID7A 2HBZA 2QP4A 2UYYA 1MX1A 4GZ6A 1PS9A 1BAPA 4OJTA 2B1GA 2Q3CA 2RSLA 4LDQA 4NEGA 1C9JA 2VH1A 3TIVA 4FHFA 2CWWA 1PZNA 1XRRA 3JAWA 4UDNA 3OPYI 4EI7A 2JF0A 2PZSA 4GICA 4LG1A 3ANXA 3R7BA 1HLFA 1Q3TA 2X86A 2DPXA 5FA5A 1OKKA 2PYLA 4Q02A 4UQPA 1UAAA 2I6TA 4O4IA 3IODA 3GLIA 4NBWA 3U6KA 2AFVA 1UJWB 4EFBA 1LBHA 1IEWA 1BS1A 1EHYA 2VYND 2YFQA 3FB8C 1GLNA 4N7JA 1GTOA 2JCXA 3SS7X 5KNDH 3H2SA 5KREA 4DCSA 3A27A 1N6PA 4EY4A 1FP2A 5JSKA 3HFJA 5JMTA 1KYTA 4DR1O 5FUBA 1RQXA 3EFEA 4MNTA 4DPLA 1HEUA 1D5WA 1TQ4A 2YN0A 4HFRA 2C2MA 3A6HA 4ASUG 2AN9A 4Z4EA 3GH1A 3PBKA 5KSYA 1I4DD 1TJPB 3TRHA 2YHIB 4AZ3A 2OBXA 2C9CA 5A3VA 4IIFA 4YQZA 3FIJA 1RAIA 4AI6A 3FF4A 4BP9A 4RZHA 3EBOA 3ZQJA 1PR4A 5ICFA 1LPNA 4K6OA 3H42B 4D44A 3EXEA 3U3ZA 4D3YA 2A7WA 3EPRA 4I5DA 1IHYA 3IMKA 4C14A 2ZJ0A 5LSAA 4UV8A 3T9BA 4TQAA 1N3IA 3O4FA 1HWYA 1W88B 1BEZA 3AR3A 1P80A 1SOMA 3NBXX 4I50B 2FNAA 5EERA 3ZH9B 1NTRA 1A5ZA 1VPDA 3I34X 1IM2A 1EAMA 2QVXX 1BD3A 3IOEA 3I3OA 2EP5A 4HATA 4KUHA 4RF3A 4RHXA 4ZQGA 4B6JA 2V54A 2CE7A 4ECAA 4TSFG 3BG5A 1X8XA 5JJCA 4RD6A 1QZUA 2C4TA 4D8XA 1A5TA 1L1EA 5CA0B 1SUCA 2IEBA 1V3UA 2JI7A 3IEPA 4FJCC 3KQTA 4GRAA 1NP7A 5JVDB 3AIOA 4X0EA 4PHHA 4ZI3A 1HFKA 1NR7A 3I9FA 1FOEB 1Y8QA 2V65A 1R3IC 4XVCA 4DXDA 4LOJA 4RJIA 4HNUA 4M1OA 1FW6A 3HSSA 3UH0A 2EBFX 4C2BA 3LA6A 2VRCA 3KWLA 5AO9A 3FE2A 4WXEA 2Q2NA 2PMWB 1S3FA 2RC6A 1XPOA 3PVZA 4D57A 3H11B 3NTQA 2QTTA 1Q6IA 4M36A 5DLQC 2BUBA 1P0CA 4L07A 1I4LD 3X44A 1BOFA 4CETA 1HOTA 4C0JA 4R1LA 1F38A 1RXUA 1VKZA 1I6WA 2EHJA 3WKDA 3R41A 3EIWA 3KUKA 1HMYA 3M34A 121PA 4AKGA 3JD1A 1EXVA 4OFXA 4ALLA 4YRSA 2W0XA 2J5KA 4FUQA 4E30A 1U0BB 4YLYA 1KEUA 2H0AA 3P45A 1RYYA 3RU9A 3UT6A 2O59A 1DCTA 1E5TA 1W2WB 4WZAE 4ZVPA 3RSQA 1K5GA 3MWEA 2FPUA 5C35A 1H8ED 2H08A 1EDEA 1ZQ1A 5DTIA 3W3AH 4AJOA 3VGJA 5DOVA 2GPAA 2X8BA 3QM1A 2OTJV 3J80N 4H15A 4P4UA 1JZSA 3N6VA 4E14A 9ATCA 1CEZA 5ECGC 3LCMA 4HQ0A 2CXOA 5A1TA 3PJDA 2R6HA 4HRYA 1E3DA 3W7WA 821PA 1ECLA 1NWCA 3Q15C 3K0CC 2G08A 2F3RA 2YQ4A 3HKCB 1MDFA 4PIVA 1BE8A 1P45A 4Q82A 4TQUS 5AHWA 3WMGA 3ZJUA 1OIVA 2BZSA 2CCKA 3LHDA 3R20A 1JEQA 1RYHA 4O4JB 3H0CA 1KP3A 4G5YA 4LECA 4R9VA 3PC3A 5MGBA 2NNUA 4JL5A 1QKIA 4P3PA 4B80A 2X41A 2GZ2A 1TO1E 2MR5A 1ISRA 1M8PA 3QWIA 5CYGA 3DAPA 3GFFA 3T7KA 2WLNA 1GN6A 1NXTA 2FRDA 4IPTA 4RQBA 3UMBA 1NQOA 4D82A 4V1CA 2J7PA 3EZGA 1O77A 2QS9A 1MJHA 1TM7E 3ZBHA 1WW8A 2JEUA 3SQMA 2IHJA 2X5KO 3TTSA 2QRZA 2C2WA 2QQ0A 3LPCA 3M7MX 3VHXA 4C76A 1C30B 1YBMA 3MGKA 2PMBA 4HB4A 1E1KA 4MUXA 2J4FA 3RJ5A 1AKYA 3KVVA 4G3XA 4CV0A 1E4EA 1C7RA 1JJOA 2OWOA 1N7JA 3LHSA 5BR8B 4CFSA 4F5DA 1NFRA 4MVSA 2VHXA 4Q9LA 2VJQA 4E33A 1MC8A 1UBOS 4PA4A 2AI1A 1RKBA 2WE8A 5IDWA 1WOMA 1P91A 1RJWA 1GTL1 3B8EA 3KAQA 5ICMA 1A4RA 1RMYA 5CFNA 4MR7B 1QG0A 1JAYA 1SCIA 1W1IA 2SKEA 5JWRA 4ENTA 1RM4A 2O1SA 2KM1A 2WEKA 3CB4A 3DE2X 2RGRA 3A32A 4ZEVA 2QG9A 1X7YA 1ULAA 4FTWA 4GPBA 4PU0A 5IK2A 2QPOA 3N2EA 3FAZA 4UEOA 3VZDA 4PPFA 2WLSA 4LF5B 1HL3A 1KY4A 2F8LA 1V16A 3O0TA 3CURA 3PXCX 1X8KA 3H01A 1V55B 1OXVA 5EI5A 5FFNA 4BLOA 5K05A 2B4QA 3QVOA 4KIJA 1PTJC 3CO5A 3ASNB 1CU1A 1YHZA 1N6IA 1M72A 2F1KA 1RC8A 2OB2A 3VSAA 2ZIAA 4RVSA 1JFFA 1FRZA 1P2TA 3LC0A 3SX4A 2I7XA 3U4AA 5HRCA 1F6WA 3WB0A 4YRLA 5DXFA 5JY1A 3ZCSA 1G0NA 4L0QA 2N05A 3ESZA 2X8WA 5JZOA 5EP2A 1ZNZA 5DSZA 3UT5B 3TRFA 1JIVA 3AL2A 3B4SA 4MKZA 5DEIA 2G1UA 4LMRA 2VBFA 5IW8A 5A4JA 3THYB 5T57A 1PG2A 5IKOA 3T7RA 4XRGA 3KFLA 4OSPA 3A7EA 2XDAA 2XY4A 2YHAA 2QTFA 4ZDWA 5BURA 3NXSA 3MXTA 4FCWA 4YASA 2LGQA 3NUQA 2IY7A 5EP4A 3VKVA 5GADl 4CTNA 2VWHA 5DOZA 3QVUA 4U6SA 4BAUA 4EMTA 2PX0A 3UKMA 1PQ4A 1T15A 2H18A 2H07A 2HSJA 3EGOA 4CIBA 1Q7YW 2V6IA 4L4XA 2Q7OE 3K8OE 3QA9A 4RJLA 1F0KA 4ZYZA 2YCBA 4MRAA 3HCOA 3O26A 2CHGA 3Q9NA 5KX5B 4LXQA 4DC9A 1Z0DA 1K9SA 3GGSA 3R77A 2FFBA 1PBNA 3IXMA 4E32A 1O6ZA 5KWSA 3OF3A 3UQYS 3QUTA 1OXXK 2DFNA 4B81A 2O2IA 1UDAA 3K32A 1T35A 1HOXA 3L06A 3I8SA 4II7A 4XTRA 1AP5A 1OLSB 4LNUA 1EDZA 1NVPD 1GQFA 1OGIA 4Q24A 4CLXA 1ONBA 5EIEA 5KTKA 3DBHA 3I2KA 1YJAA 2YYYA 1KK2A 1U99A 2J3LA 3CKYA 3KLOA 3EG9B 4HJRA 3FB7C 2C78A 4HAUA 3FSRA 2OGZA 4UM7A 3WHKA 3PUHA 2B99A 3QTLA 3PCXA 2I34A 2PMFA 4B9AA 3F0TA 2X0DA 2L35A 1B0UA 1GSIA 3MBIA 4F45A 3OCZA 5BYBA 5AVXA 2ZUSA 3ZD7A 4H4CA 1EP1B 3OWXA 5LPNA 2ANCA 3JCUZ 2CXXA 3M6UA 4XLLA 2PUAA 1SQ6A 3RV3A 1XP5A 3CGWA 4PRYA 3JQFA 4CHGA 3P9NA 1LNSA 2WPDD 1G2QA 4BC1A 5BQ3A 2XMGA 5TMPA 1MW8X 2FUNB 3T35A 4NPCA 2PR7A 5FPYA 1BHAA 4D45A 3IRVA 1PT8A 2VDUE 4Z51A 2NVUA 2FZKA 2P06A 2IS6A 1LSUA 1ZUNB 1OWOA 4UCVA 1X9HA 2IPXA 2X0EA 2P62A 5EC8A 3WAJA 1E3MA 2HBQA 3I2YX 3NNSA 1FQJA 4BIIA 1UOQA 1ISJA 2OZPA 3FMOB 1JE1A 1TM2A 3LDEA 3PGA1 1BFKA 1EWTA 1PV2A 5LDDC 1PNOA 3QF7A 4OYLA 3MPOA 1VQKV 5IMSA 2JI8A 2JLYA 1MH9A 1U1GA 4UNPA 3L4JA 1DS6A 3QWAA 4L72A 3LRXA 2HHJA 1YRLA 3CCMV 5I7AA 4B6OA 4GC5A 4G0QA 5IFKA 3DFUA 4MVJA 3OJ0A 1P4RA 2DHQA 2QI9F 2H2FA 2XGMA 2FSFA 4X95A 5ICGA 1KE1A 3QXJA 1UWLA 2RB4A 2HVJC 3L6EA 5CDYA 3PJSK 5E4JA 1E2IA 2CMKA 4YAWA 5DW0A 1KC1A 5IEBA 4JFAA 2CD9A 1N6NA 3D0QA 3T9EA 2YWRA 4N3NA 3DZDA 4GOLD 3HB3B 3VDNB 1KD1W 5CBPB 2X0RA 3WAGA 5AUOB 3ICXA 4CM9D 1OHHA 3LQKA 3DEFA 2ZBGA 3DUFA 4HPWA 3M6MD 4O0LA 1I4TD 1MH1A 1B0ZA 2FFQA 2GKGA 1FJHA 2PE5A 3EF1A 1EIZA 1XFAA 4UPDA 3QQ5A 1UEJA 1Z13A 3B1WA 3QY0A 3MSCA 1NV9A 3OT1A 1H1LA 4XARA 4DIMA 2WLIA 4HTAA 3GRKA 3PT5A 3U3OA 1Z2CA 2PMDA 2RGYA 3ISJA 3AVTA 1Y7HA 4YECA 1QIFA 3RSHA 3E81A 2ID8A 4PHTA 3W5VA 5HKKA 2G04A 4P81A 3UMSA 3EPJA 1GNVA 3P5SA 1QQBA 1EVQA 1ZXLA 1QGDA 4M3NA 1UL1X 2IGTA 5EIXA 3FVRA 4TVSA 2UUAB 3ZKAA 2RBKA 3ROXA 1V1RB 1FU7A 4R4JA 1RADA 4D5EA 3EZXA 5FPTA 4PXAA 1T4DA 2PPLA 5IULC 1BOOA 2DWOA 3H1AA 2HA2A 1YQTA 2XDQB 4JEUA 2OV3A 1NYLA 4LSWA 3W4JA 2IH4A 1FMJA 1EX6A 2AG1A 3BMXA 3NAGA 3H1EA 3ENNA 3NOXA 4H7JA 5GZ6A 4NE7A 1HTTA 1EJ6A 1OKKD 2UYGA 1V8FA 2RJNA 4NZZA 1Y1PA 2HU5A 3E8BA 3UOGA 4B4VA 2XTNA 2WIGA 1PJ2A 3ISVA 4IUYA 1T1SA 2J3HA 1N2HA 2D62A 2QV7A 2GZRA 3GMDA 4R2KA 4ENPA 4FFLA 3GVPA 4MQ4A 5CU7A 1E3IA 4QOJA 1X2EA 3QE4A 3T1OA 1EB9A 1LRJA 3HJCA 3SHVA 1U3VA 1H6DA 3ZRXA 3ICWA 2C4VA 1MSDA 3W8EA 1HR0O 1V95A 4FM1A 2VYVA 3KOZA 3PZRA 1FY2A 2VK2A 2BGWA 4GPEA 1DDOA 1XA4A 3ED1A 4LOLA 3ZWXA 2ZTLA 3OZIA 3VKGA 4RLSA 3R3JA 2RGDA 2OM2A 2PBZA 1RQ7A 3KSBC 1XNRO 3U0BA 4P1ZA 1DBQA 4PINA 1I10A 1GTJ1 3X1ZA 4UM5A 1A0OA 4IDNA 1JTVA 5LUAA 4NDAA 5E3HA 5G02A 4NI5A 4CT4B 1ZAKA 1UC5B 4CM1A 1AQLA 3G82C 4YCLA 4AZSA 3ZOKA 1RI5A 1BX1A 4IQ8A 5FOVA 4IV5A 3CIOA 1J42A 1FTGA 1WBJB 3ZGZA 1A7AA 3BIXA 4DV5O 1OD6A 2XB2A 4R84A 3IE2A 4JY7A 3RQSA 2E55A 3FWPA 1XU7A 1Y1SA 3I09A 5BRJA 1GCGA 3IMGA 3M6IA 3TXYA 5HMLA 2AN4A 1RQPA 4QHYA 1VIAA 1FS4A 1HKUA 2PSFA 5F51A 2JAQA 1L7MA 4G1MB 2GZMA 1DWOA 4DG5A 2B8WA 1JA0A 1KF0A 4WI1A 4QM7A 1KBHA 1QNLA 4GXRA 4ZC8A 4YY3B 3HU1A 4QQKA 5CW1A 4B4WA 4D9NA 3L2OB 3SJCC 4RAIA 3G5UA 5JFTA 1J95A 2O5VA 4F11A 3HKDB 2P6NA 5JJLA 3N2LA 5EJ2A 2NTEA 3RRMA 3RAJA 4YRAA 4PYOA 1EIWA 4CIDA 1Z4KA 1GYRA 2XD9A 3PDJA 4GDMA 1FX1A 4I4CA 3T8YA 4QAQA 1Z6GA 3LPLA 5C4MA 2PZBA 3BE8A 4RTQA 1L4MA 4QA9A 3IOMA 1SD5A 3ZZ0A 5HHTA 1XJWA 1BX0A 2XMRA 4IH4A 1H2XA 4LRTB 3HUUA 5AJZA 4YDSA 4E5DA 4QGSA 2OVBA 3DBRB 3MBKA 5KDDA 4XFKA 5AVWA 1OHHG 2EJWA 2Q07A 4DQDA 5DF1A 4CC5A 1PJAA 4WA8A 5AOCA 2JIZD 4D7AA 5DSXA 4YALA 8LDHA 1SM4A 2YYSA 3COWA 4KDFA 1C50A 4NU5A 4F6EA 4CVNA 3PEYA 2WD9A 1WKBA 5LGUA 1XD9A 1Y6JA 4MVOA 2DPLA 2PBLA 1XCGB 2Q5CA 3A1WA 3F5QA 1OC2A 2YX1A 4Y9SA 4D8WA 4B4UA 3U7HB 1JHAA 2F3PA 3NONA 4X8OA 2D1QA 4CS4A 1AIPA 5CYOA 3VYWA 4DANA 1PR1A 1QDLB 1RAEA 1J0XO 1JJAA 1U9YA 2EEPA 3TAXA 4M8KA 2L6LA 4EHFA 5FOQA 1NRJB 4TPKA 3TVDA 1A69A 4KOAA 4JVOA 5KYUA 1I7QB 2Z6UA 3KKYA 1E3JA 1F5SA 2WDZA 3KKQA 4AICA 5I8WA 1GZ7A 2ZD9A 3M6FA 1NQXA 3UC5A 2D7JA 2YASA 3CRVA 2JCSA 5J9FA 2WG2A 4DKXA 2Z5VA 2ZPAA 3NM6B 5LP1A 3E35A 2IYNA 3PT9A 3N8DA 4WADA 2SKCA 5L8VA 5JJ5A 2PZ8A 4EENA 1D2NA 1Z6YA 2LKDA 3TW4A 2WV7A 3FMIA 2IEAA 3QU5A 1IHPA 5KUMA 4Q9NA 1U5AA 3FRIA 5FL7D 3RUPA 2QYTA 3OQJA 4OREX 5JNTA 3W3AA 3UUFA 2ZB8A 2DX7A 3ETEA 4ABMA 3A58B 4YCDA 3I1JA 1QYXA 1JH9A 1WPXA 3OJFA 4ARZA 4LXIA 2DRIA 1HLPA 2VT3A 3A3OA 5PNTA 3WLSA 1DAHA 1V3VA 1BXZA 1ISSA 1DC3A 1HFEL 2JIDA 2O2ZA 3ONWA 4G86A 4H6WA 5TMEA 2A7XA 3TLGA 1U2RA 3U3KA 3CPWU 2WLJA 1NMZA 1ZLXA 3D6TB 1YIOA 1U1EA 1VB5A 2C2OA 2QRVB 2YVLA 4W8GA 4MB2A 4H3HB 1H9CA 1BROA 2FLWA 3LYLA 3LDAA 5KX5F 2HQRA 1VE3A 3DOFA 3E27A 3QEBZ 1VHWA 2NTJA 4A26A 1K63A 1T9CA 3V55A 4EEQA 5LDHA 1NSYA 3EQ8A 5T4HA 5ITZB 1CPYA 2D0DA 2Y77A 1S6YA 1I7NA 1KO4A 3BEDA 3U0ZA 2WSSA 4JL6A 2DKOA 4R68A 4KR3A 3F71A 1JTEA 1V5GA 5JC1A 3CYFA 1MDBA 1FDWA 4A10A 1QFSA 4RIHA 4EHLA 1P1FA 1WS6A 2G67A 1RZUA 1MOQA 4ZN6A 3FOFC 1T5HX 4H35A 4B85A 2EGUA 1KQPA 3HA7A 1RCUA 1OV6A 3HA3A 4FR0A 3BT7A 4RO2A 2TRSB 4HV4A 1WR8A 4J1QA 4NX2A 4GMXA 1JLRA 2ZIMA 1TFUA 1V43A 1Z0SA 1G19A 2BMVA 3ZWQA 2Q69A 4FONA 5JMPA 1W29A 1I9GA 3QEKA 3PCRB 5AHOA 4YHHB 3EK2A 3C8ZA 1RFYA 4N0QA 4U0JA 3ETCA 5JAQA 1AILA 5H3LA 4FYMA 1NVTA 1ZNQO 2Q6OA 1PVDA 2BGKA 3H9BA 3I5UA 3KOXA 3PWSA 1ZIXA 4M1TA 1OXMA 2NW6A 4IBOA 2DT8A 1QJ4A 1REQB 4R5MA 2P90A 4DR6B 1P2FA 3CXCU 4MW0A 3RFFA 3RADC 2LGWA 3CSUA 4K86A 2CD7A 4OLBA 5KOJB 5EKTA 1N57A 3ONFA 4PLCA 1PJSA 4PO1A 5KTNA 2SKDA 1XEXA 2Q3HA 2WR8A 2EX0A 4XYLA 2CV0A 4WKOA 1TB4A 2R86A 1IOZA 3KU1A 2WJ6A 1O97D 1T2AA 2FDRA 3LRPA 1U2SA 2QAGA 4RK4A 3UF0A 2J09A 5I48A 1Q5OA 5ALEA 1VQ8V 1YQGA 3EAQA 5AHRA 2QVYX 5IJ9B 4PG8A 2G72A 1QIEA 3PSAA 4FMCF 4GT1A 4DYLA 2QTLA 3EGCA 1YQXA 1OVGA 3FWKA 3PSHA 5CT9A 3TOCA 2AWOA 1MRNA 2W2TA 3NHAA 2Y1CA 1JHOA 1VA5A 2CDAA 3PQ6A 3CUEF 3OT7A 1EVZA 4GGPA 1TUEA 4KH0A 5KNCH 4AD8A 4BLSA 4ZTZB 1NQ5A 1ZHOA 2CUGA 4M6WB 1XMOB 1XDUA 2FPSA 2HA0A 1B42A 1RAFA 4D0NA 4B0OA 3MJFA 3ZCCA 3JR3A 4UE2A 1DJPA 2Y4NA 3LPAA 4PDVA 1L5ZA 1XL0A 3AKDA 3IQZA 5JIBA 5CVEA 4P2BA 4B2LA 4G4IA 4O4IF 3EUFA 4HAYA 5EZSA 3BMQB 3K8QA 4IG9A 2WFAA 3FWYA 1V9PA 4FNGA 2XEXA 3CMCO 4LH7A 2LJ2A 4RMIA 3X1MA 1D6NA 1HT3A 4MAMA 4P2GA 1KMNA 3W7UA 1TJYA 2O8NA 5U4QA 3R8FA 4RK7A 1Z2OX 1SURA 3N70A 5ALYA 3J81k 2HRZA 3TSOA 4B5LA 3L8DA 3ZEIA 3C6YA 3OP4A 2AOWA 4ND8B 1ULHA 4BGDA 2V1DA 4FZRA 2PK3A 2NYVA 4FFMA 3KQLA 4DR5B 2DUNA 3ZMUA 3J81A 3H2IA 3WYNA 1OGJA 4KOEC 4DYDA 5C8YA 3Q3VA 2FVXA 1UM8A 1XMJA 3DOOA 3ANNA 4G09A 2DJ5A 1Z37A 2OXRA 1V8BA 4DQKA 3HPRA 4F72A 1KFJB 3H75A 4F8EA 3V8PA 5FL7G 1EI9A 4QULA 4YRPA 3R7WA 1OCRB 4KQHA 4BNDA 3QYPA 2F7SA 1DBSA 3BIJA 5KEIA 2PUBA 1DBIA 1RR6A 3KDSE 3SC4A 2IU3A 5K2MA 3TWOA 1GQOA 1X1CA 1W44A 3NEJA 4A0FA 1M34E 2FB5A 4FIZA 4EA9A 1UM9B 3RREA 4MEAA 3OFNG 1JPNA 5EKDA 3WSTA 1G4HA 2XV1A 4FQ7A 3QPCA 4R41A 1ONPA 2PFGA 2IZZA 4UBMA 1AVMA 1GPDG 3SNHA 4DDVA 1TQ6A 4ZVRA 1EBBA 1D03A 4EB6B 1IHXA 2C3OA 1Q0TA 1GUDA 4L9SA 4PTYA 5JJKA 4KUMA 4MMXB 2IEIA 4COOA 1K08A 2C59A 3B85A 4IFEA 2ERYA 3PUWA 2H3OA 3BWXA 3OCVA 2PY5A 3WHPA 3ZQUA 1HSZA 2FEMA 4W1QA 1KIMA 1W5BA 2IXBA 2XAUA 4PGHA 1ZH0A 1N0JA 4HB2A 1HQKA 4A2CA 4DMFA 1R3KC 4YAIA 5EHZA 4NJMA 2CDNA 2JAPA 3UT5A 5ALJA 5K3FB 5IFLA 2Q3DA 4AMBA 4LF7O 1OFIA 3AUYA 2C61A 4QRDA 4Q4JA 1UKZA 4REMA 4I9UA 3KJFA 2X6AA 4IM7A 4TMXA 3GP8A 1ZUWA 3I9LA 4K2HA 2ZJAA 5JPCA 3IVAA 1VHQA 1BXRA 3PC8C 1NKDA 3D0RA 3L8ZA 3JQGA 3H05A 2YIJA 2WWWA 3WNCA 2PEZA 1TECE 3LG2A 1BVUA 3D7KA 3ICCA 3VC3A 1G20A 2FSHA 1MABB 2W70A 3I28A 2QD5A 1NR1A 4GSYA 3OOWA 4I5GA 4U9HS 3VSCA 1T9DA 3MJEA 2HC9A 2ZQMA 1NTZH 1RAAA 2QQFA 1IQ0A 1XVLA 4MHTA 2JAHA 4KKVA 2C2GA 4K9DA 4Q3DA 1XA0A 2Q62A 2WIJA 3STZC 4IEEA 2R00C 1QPZA 1CUFA 1Z4QA 1FDIA 1HFWA 1MRZA 3PTZA 3QE2A 3WLQA 3O91A 2Y2UA 2B78A 5AT1A 5HQ3B 2AG0A 5KOJA 4I08A 5DBFA 1V2HE 2JGKA 5E9JA 1R4AA 1A77A 1IM8A 3KZXA 1IPEA 1SZXA 1JTFA 2W6IG 3TM4A 4A92A 4J9UE 2QN9A 4EUFA 1R73A 2JL1A 5E1OA 4HH1A 1SUEA 4J7AA 5H70A 2CN1A 3GVHA 3U61B 1EZ4A 1R9JA 5KHJA 1DTEA 3O8QB 3TYXA 3WNBA 4AL4A 4CKBA 3T7DA 1SQFA 4FI3C 3HP4A 1BQZA 1PR0A 5GIOE 2F9MA 1WPGA 1V54B 4PO9A 3ULKA 3VOBA 4ESEA 4F12A 1NN0A 2RGWA 3H4IA 2P77A 1V26A 3DD5A 1X1TA 2VN8A 4UBNA 2XIQA 5DNCA 4UEWA 5AJTA 1G16A 3LQ4A 4DVGA 1FIUA 1ENZA 4MPJA 2X6TA 2I9KA 1A2BA 1R6DA 3DMPA 3QO5A 3MOSA 5DHFA 4CMIB 3D3WB 2E75B 1QONA 4WLFA 2VK8A 1QHYA 4Q3AA 5EHNA 3ROZA 1RRMA 4TT3G 3DMHA 1CZOA 1EKXA 1SVIA 1GA4A 2X0KA 3G6KA 3NC0C 2CLHB 3DDWA 3QFRA 1B15A 2FE4A 4LX8A 2WP8J 3IC9A 4BJ6A 5A7GA 4HWSA 4W5QA 3G2OA 4YK7A 1E59A 5FPPA 4AVYA 4OM8A 2GD2A 4KQ1A 4NBLA 2VP0A 1VDMA 5CBFA 2C2KA 4LPKA 1X92A 4TYPA 2DY0A 4LNUB 4JBNA 5BWBA 1VBMA 2FCAA 1SCUA 1Y7TA 2PL5A 4ZD6A 9LDBA 4HNGA 5TVGA 2ONYA 3SQNA 3JVIA 1YF3A 1LUVA 3OR7C 4LN1A 3SEZA 4RZIA 4K1LA 3FLBA 3LHKA 5TISZ 4AKIA 3QKIA 4MWSA 3TR6A 1BXRB 3AHJA 3KSZO 4NTZA 3IDAA 4EG0A 5K8TA 4TL7A 4B31A 2VSOA 2JIQA 1USVA 3TBHA 1CR2A 2J59A 3LPDA 4WVFA 4XWTA 3F8WA 5JROA 1L4FA 1RI1A 1D0VA 4ER5A 5KAIZ 2FEOA 2IYUA 1CJVC 3PIDA 3E8MA 1U28A 3OQIB 3IILA 4F7DA 2WNHA 5FX2A 3BZBA 1S3GA 1KKUA 1OU4A 2FKAA 4YJGA 5HILA 1U7UA 3AVWA 4GU5A 1SOAA 3A6LA 3HFRA 2I33A 4YP1A 4X8HA 1U9JA 4ZT2A 1LLQA 2O2XA 4WX2B 5K0NA 4PAGA 1NUUA 2OHOA 3IDQA 3N8GA 4IQ4A 3FUCA 2WK1A 4E5VA 3FTFA 2HXGA 2OSVA 2YOFA 4WF9V 4JJ7A 4OAQA 1URFA 1N36O 3HUEA 3IBYA 3PA8A 4L76A 3QU4A 4OHMA 3RGGA 2B5UA 2EF1A 1DPGA 3L4BA 3NOQA 3ZUGA 1H1TA 4C0HA 3BFPA 3V2IA 1ZGCA 1DVRA 1UPCA 4NOKA 6AT1A 1JXMA 3HO6A 1S2DA 3L7IA 4HUQB 3SJZA 1XXHE 5JISA 4QPJC 3TAUA 4TOIA 1EFRD 1FUIA 1WTCA 1XDSA 2O4UX 2ZNIA 1Y33E 2Q9CA 2R68A 4DA0A 1TAUA 2QYSA 2R5NA 5JJNB 1D4ZA 1NX9A 5EXDA 2PH3A 3MPUA 1E1LA 4NCKA 4RK0A 1NW8A 5E1AC 1XLWA 2B92A 2GNOA 2YDYA 3IMCA 2L19A 5LR6A 3EZ6A 1BEEA 1TM4E 2B2NA 1IY2A 2PKWA 3WNDA 5LP6A 4F2PA 3LRTA 3WBBA 3P2JA 2GD1O 1C3OA 3WGIA 4F4JA 5IVIA 4JR1A 2C9BA 3VPAA 3I23A 4JJGA 4X66O 4JLDA 2X0LA 2P4SA 4FGKA 2FSVC 2M7WA 1NN5A 3KOUA 4M21A 4QLOA 1R9GA 2R5WA 3AKCA 4MS3A 4JBHA 3UJDA 5I9IA 4ILEA 1LDEA 2IUEA 1V7QA 4YDHB 2RH9B 1ZVVA 4FX5A 1S2MA 2Z5GA 3C16C 3I9V1 2JFUA 4I14A 4IGAA 3CE6A 3GLIB 1UWCA 2R48A 3PZBA 1HA3A 2N47A 2GYUA 1GZDA 2Q5OA 3HDGA 4GG1A 5LCXA 3UZUA 1F1BA 3V42A 3UAGA 5H2FZ 4MUHA 2J9FB 1H2FA 3WFJA 3U7GA 1X7GA 4IJWA 2DMXA 4P9OA 3HDHA 1KAEA 2HHCA 2KQUA 4GXQA 4DZRA 3T3OA 1QGAA 4ABTA 2M6YA 4GBJA 3OFJA 3PEUA 2XDYA 3FFAA 4LEIA 4Y2VA 3TQTA 1H8EG 2CTRA 3AR6A 2OHIA 1VKNA 1GZSA 2JAOA 1MKYA 1G6Q1 4GQBA 5I3ZA 1A32A 1Y67A 3N8KA 13PKA 3UKOA 4EK9A 5FA6A 2PJUA 3GFVA 1ZJYA 3L05A 5CLQA 3U3XA 4DMRA 4XJXA 4WK4B 4CF7A 1TNDA 3UHOA 4Z4CA 4ID3A 1HG0A 5LZ2A 1PQWA 3HUTA 4TT8A 1WRBA 3OMAB 3AG4B 4O4IB 3EXHB 3GO4A 4BNFA 2QKCA 4EJ2A 5I5EA 1E9BA 2G1JA 1IJEA 3ITDA 4KPFC 3IBFA 1P4JA 1Z7BA 3CN9A 3VZCA 1N9GB 1Q81W 2PQMA 5E8JA 4WOPA 1FX0B 1XTVA 1YITV 2X0JA 4OPMA 3SSMA 1EZZA 5AVSA 4DJEC 4BPRA 4JI1B 3L71H 3VJKA 1J8QA 4AY6A 3CF4G 3ASOB 5SZIA 4TKLA 1CUIA 1VLMA 2VJLA 1PZGA 3O4VA 4EX7A 3OU2A 1UJ6A 1WM1A 1YDFA 3MAJA 3W7TA 4H1VA 1XMPA 2V7WA 4GLXA 1XDZA 2HWYA 3KTOA 4ZRMA 4DILA 3UC9A 2I7DA 3G79A 4DIEA 1UKYA 2WM9B 2NU6B 5C7IO 5JQWA 3ETHA 1EMDA 1PZXA 1AUPA 4XSGA 3S3XA 3GA0A 5AOAA 3QELA 2W0SA 3B6JA 4DNFA 2ZANA 1VPLA 3BXXA 1I7FA 2YZKA 4IEIA 2Q99A 3QXSA 3WE7A 3DPIA 4UUQA 1IEXA 4N3CA 3DDCA 1G2OA 3R9XB 4FSXA 2MT9A 3LP6A 1NDQA 4G65A 3Q7RA 3CHXA 1OCRC 2V4MA 4RD2A 2CF6A 3HKBA 4Y9DA 4L2IB 1ZMRA 5LOVF 5KYGA 1AI5A 1ISPA 1VRCA 2MDTA 1I7LA 4LW8A 4A23A 5JSQA 4JZ2A 3C3EA 3GVMA 4GD3Q 2H48A 4MGHA 5CH8A 2FQXA 3SU8A 4C3UA 4FFKA 2CAZC 5C5CA 4BR6A 4LBZA 2CNOA 5AKGA 2IBTA 2QNBA 1PX2A 1E60A 4LV6A 1EDOA 1FRNA 2FP4A 3MFYA 4DW0A 2OAGA 4MGIR 5CLLA 2M1ZA 3S70A 1KC3A 4N0MA 3T7EA 3U80A 1RXEA 4FT2A 1WLYA 3CJRA 2DSNA 3IIKA 3S2FA 1X1QA 3GF4A 4J0EA 2QMZA 5G4KB 1EJ2A 4PPGA 4C0XA 1CDDA 5EMKA 1K33A 3JASA 5LXTB 2X9GA 4JBXA 2DTXA 1NBWB 1H05A 3GEGA 2FMTA 4UE3S 4R8SA 2CHFA 2GSMB 2ZZMA 1I94O 4RWEA 1TX4B 5IKXA 3APQA 5J2UA 2EWVA 4JOCA 2IXGA 1TT5B 4QUHA 1R4NA 3V5NA 1K3UB 4IT5A 5D3MB 2EILC 5IJ0B 4PZLA 1RWXA 4Z7NB 2WJHA 1QORA 3OA0A 1NU8A 3VQTA 2GJ9A 5ELXA 3UCSC 3RRYA 4I0XB 4WD3A 3RVQA 1J9EA 5JRZA 2OFOA 4L4UA 5B7NA 1QBZA 1YRHA 2D2EA 3C5EA 1P17A 2I4IA 4Q3EA 3ZBPA 1ZD3A 1M6WA 4K9OA 2XUAA 3LF1A 3ASYA 4JHLA 4RPLA 1MPTA 3I32A 2ZT7A 3GHYA 4LCJA 5ER9A 4NBKA 3HGMA 5DEDA 1VSTA 1XJCA 2EW8A 3EXG2 3A1UA 2GNPA 3OSZA 4DR4B 3OT1B 2XUJA 5GY7A 5HNKA 3FSGA 2ONJA 2V74B 1K5PA 1O96A 3RASA 3GGOA 1YR8A 3WVNA 5EP3A 4ZKDA 5HKAA 1W85B 2PTGA 1VM6A 3C2QA 5B4UA 5ENVA 1I4WA 3GT0A 4C7BA 3P94A 3KB2A 4J2HA 2R6CA 2XA1A 3W0LB 3RS9A 2QL9A 4DV7O 1JKJB 3P2OA 1RPNA 4AN0A 4F8JA 4ZT4A 3LPMA 1SUBA 1KSFX 2O07A 4LQCA 4DT1A 5TS2A 2K7FA 1FMFA 3KHTA 3T0IA 3HABA 3II6X 1WUIS 3OLVA 1KSHA 4X94A 4Z0TA 1JLSA 2BP7A 1Q7BA 2RHOA 1KA9H 2M1XA 4QD3A 2OORA 1SOVA 1UCFA 1JJBA 2VZLA 3LVQE 3FOEC 3ZRWA 3CX6A 3OPVA 1DKPA 4P34A 5GGXA 2BBTA 1GQSA 3NBKA 5IMBA 1NY5A 3TIGA 4K9NA 2O2SA 1ORTA 2WTEA 1ILWA 3DUWA 1K3FA 4LTMA 1OCCC 1I24A 4LJRA 5C8ZA 1E4YA 1B8UA 3ZHSA 1LZKA 1N9GA 2I87A 2PLFA 3BTUA 3HC7A 4IQGA 1ODIA 3ANTA 1UMBA 1JU3A 4YRJA 3V4OA 2VBIA 2WHQA 5JNLA 1VP9A 3EZ9A 4MQ5A 5TXGA 1ORVA 5CX1B 4BNVA 2HYDA 4P22A 2W2XA 1RQNA 4YV0A 1IATA 1YASA 2GF0A 2VC2B 1P72A 5KOHA 1N8TA 2TMDA 2Q49A 1RVV1 1KVSA 2I4MA 2CZCA 2QAGC 3CLTD 1YFLA 4IXTA 1UAYA 5C1IA 5FTJA 3AW8A 1CUUA 1OWNA 2ZUDA 2JFPA 1DAKA 5G41A 2QVZX 5DO9A 4LHWA 1JG4A 1P2DA 1GXSA 1KMIZ 1X19A 1CUZA 2QTHA 4BUJA 5JPDA 1GL9B 4YPOA 3BJIC 2VLBA 3RYFB 4ZJZA 3N2ZB 1YKFA 4BC0A 3OD1A 1PWZA 1EFVB 4BS9A 5B36A 4JBIA 2DW4A 2IF0A 3QVJA 4LZOA 1JX6A 1QTRA 3WL3A 1L3BA 2PWZA 3HHPA 4KWIA 4RDHA 1JDSA 1YZ3A 4G67A 4OLJA 4ZYYA 4D4HA 3AG3C 4IJKA 4JU8A 3VR5D 4RZXA 1OY1A 4IEFB 4J07A 5ICSA 1NJ6A 4U1RA 4AM8A 1KFBB 4C4XA 5GM1A 3DOUA 4EW3A 4RH0A 2VPIA 4IL5A 1NUQA 5HRUA 5CW2A 4XTCS 3CCBA 5ICEA 2FKNA 2FPMA 3L70H 2X6RA 4FLWA 3A9UA 1RKXA 3AVQA 3GUHA 4TQGA 5JH7F 2EYQA 2ET6A 3NCHA 4M98A 1P7PA 2VO1A 4BGIA 3ZS8A 4CN8A 4EMUA 1J09A 1U3WA 2CDYA 2OOKA 1EQUA 1L4YA 2R8OA 1VFPA 3WGGA 2VTBB 4CIAA 2DFLA 3TDMA 1K97A 4IKOA 1N32O 1DIGA 1KBOA 3H2GA 1U1DA 3BSFA 2I5PO 1GU0A 1L5SA 3U13A 1DEAA 3PGLA 1M54A 4DRXB 1KGSA 3JWJA 1IBCA 3DFMA 4G1VA 4WN9A 2AMFA 4R9NA 1FS0G 4RDXA 1PD0A 2I3BA 1VHLA 2MYUA 2YUAA 3MTQA 4LWPA 2WT9A 2EULA 4GOND 3CCVV 2QP9X 1P2BA 4A27A 2OCLA 3TZQA 3BABA 1HFJA 3W7BA 2IIVA 3AF1A 3LLMA 1PDVA 2G38A 3ZNPA 2JJ8A 3AY3A 3FCYA 5EZYA 1GO3F 3GPDG 4H7DA 1FFDA 4KVFA 3TS1A 2EILB 3F2IA 2ZYAA 1ZA2A 3D9QX 5A7HA 2V6JA 5DNAA 3A6GA 2ZUVA 3KXDA 1UDWA 4RHYA 3OQ6A 3WLIA 4RGVA 3OURA 2PFSA 1N2IA 3O5AA 1MJ5A 2PL9A 3A37A 4Z1MA 1DKNA 1P0FA 2V59A 2ICAA 3EJ6A 3I12A 3MQFA 1TYDE 2JH9A 3OIFA 4I9NA 3B40A 1XG5A 4OUKX 5CLIA 2PS1A 3T0FA 1E32A 3PXUA 4MAAA 1HNZB 3SY8A 3KO8A 3IXQA 4NAHA 1T5BA 2FETA 1U11A 2XAAA 5IAJA 4YYEA 3EIUA 1PL6A 1SCBA 3IVRA 3SPCA 1O3YA 4O4JF 1KJQA 3IP6A 3N5CA 1DXHA 1E4OA 3QNWA 4GOKA 2XHBA 4FLYA 4HG2A 3S55A 2CUTA 3LUKA 2FPLA 3PF8A 2WAAA 3C8UA 4PX5A 4WZZA 4RY8A 3CLTC 3G8DA 3OSUA 4WFAV 3FB4A 1GDDA 4DV3O 1CCWA 2WT4A 4W4KA 3P2EA 5IBCA 2R66A 2H8PC 1I3CA 4QOFA 3SR3A 4W8HA 4RABA 1LVUA 5F2EA 1ZQ9A 5AVTA 3ADCA 1P7VA 2GF2A 2AXPA 1PJZA 4K8ZA 2YZ7A 1G3MA 1ACJA 4HGZA 3WGJA 4J0KA 4LZNA 4PS1A 5C4GB 2J41A 3G88A 3OQVA 4U7NA 1ATIA 2JRIA 5ITWA 2PKYX 1J5EO 1JRLA 2RKOA 3D7NA 4LQ4A 4DWJA 1WQ4A 1LPAB 2NT3A 3IIJA 4MUNA 1YJ5A 4OEHA 1DNPA 4RAOA 2WVHA 3F74A 1NJIW 3JTEA 4LOAA 3FX7A 1QFJA 4CN9A 5JQGA 3K92A 4C08A 4ENWA 4FOSA 3DKIA 1HE1C 1QE5A 2QUKA 3GPCA 3A6EA 4AFNA 1TC2A 4TYYA 3EHBB 3MMXA 2Q2OA 3MJCA 2ZINA 4JA0A 4QOSA 1IY8A 3VNRA 1ZKMA 2UYHA 4LFAB 1DRUA 2P4VA 3CJTA 5K9ZA 3F7YC 2CB9A 2Y99A 3FMVA 4GGOA 4OB6A 1RBZA 1E5QA 2R8PA 5D1NA 3BGDA 5TQ0B 1BCRB 3OD4A 1MP0A 1X39A 1Y37A 3BWCA 1SJ9A 3E5MA 2ZR0A 1L1FA 1OFGA 2NZXA 3IVXA 4KQKA 3HP7A 5HZGA 5JZ9A 2RGAA 3H9JA 3H5AA 1XTZA 4P53A 3U10A 3M6VA 4OQQA 1OX5A 3DE3X 3ND8A 3TAHA 3GJ3A 7GPBA 1G5RA 1TZJA 4GRDA 1CJKC 2NAFA 4C4AA 3A4NA 3A3PA 4MVJH 1QRDA 2P7IA 2JCBA 2OPBA 4N9WA 1ZWLA 2DN9A 5E1BA 2OYQA 3L92A 1O58A 4AJJA 1OJ7A 3CRNA 5M2QA 3GGGA 1Z2EA 3LWDA 1FVXA 3RC3A 1Q1BA 4DCMA 1NI4A 3REOA 3A1SA 4FGWA 4QE9A 4AKTA 5IM4F 4N54A 4I8IA 3PD7A 1T3SA 2AEMA 2GFHA 3KQOA 1I9CA 1Q90D 4QU0A 2W4IA 2ETNA 4ND4A 1SBNE 2MR6A 4M83A 1F2UB 4QWMA 4O1HA 5GGYA 1C9KA 5FWXA 3U17A 4CE6A 3OM1A 2HOQA 4QTTB 2PKRA 1QS0B 3B60A 3S3TA 1Z47A 2QUIA 3HJUA 2JFNA 6PFKA 1YB7A 1QH9A 1DKQA 1DINA 2IBMA 1AKTA 2XQIA 1CP2A 3C48A 5JRJA 1KMIY 2XWBF 2PS3A 3PITA 3HZRA 3WFIA 4I1YA 4RIIA 5JFGA 4HBGA 4JC4A 1BKSB 1ZMOA 4Q3NA 3S2YA 5LMZA 4G1UC 4EUNA 5K8CA 4RZ3A 1XPUA 4GPAA 4Q0MA 3ELUA 4EPYA 2JBAA 5B3SB 2LP4Y 1AV6A 3BICA 2V6GA 3LQYA 4QELA 2PZMA 1AKQA 2HF7A 1BHQ1 2X76A 2ZE8A 4QDOA 5ADVA 1AKRA 2FSPA 1OCEA 2R0QC 5K0CA 1CD5A 2Q3BA 1RHRA 3EZFA 2YYZA 3D3WA 1USUA 1O4WA 1XTJA 4K9QA 4NYMR 5DW3A 2QVCA 5L6MB 1L7VC 4RF5A 3WMXA 1L2TA 1G64A 4B4OA 1X0VA 2OHGA 1P8JA 1KH3A 2QU8A 3GFGA 3M4JA 2X2PA 2GTSA 1A71A 4JI3O 3E2EA 1ESCA 2NUBA 2ZJ7A 4FKBA 1UJMA 2A6PA 3LT1A 4BNGA 3WNQA 4YDQA 1CVLA 3KCQA 1KEEA 1E5XA 5JAZA 1THMA 2RBGA 3ADKA 3KYBA 4D6XA 1CRLA 1NFFA 3FPJA 2EIKB 1CYDA 1HW7A 3SYAA 1YI0A 2HREA 1FP1D 2PX2A 3DS8A 1YJBA 3QXXA 4R2WA 2FTKE 4NMWA 5F4ZA 5A4FS 2CVQA 1VKRA 1TLLA 3GP5A 5K3EA 4HRAA 2X5NA 1EGHA 3CC7V 3MD9A 1GPUA 3I6ZA 4DBLC 3ZU5A 1M33A 2PI5A 2ZWMA 4EKNB 4WFEA 4L0DA 2D8AA 1XOIA 2IZ1A 2B36A 5FO1A 1NXQA 1S01A 1WXEA 4OQPA 1AC5A 1VJCA 4JP1A 1JXQA 3ZX6A 4UNQA 3WKBA 1YDXA 2XKAA 4Q19A 5AVKA 1P84F 5FWYB 2ZDGA 4KFSA 3RC1A 2IITA 4D9HA 4DZZA 3UM9A 2FUKA 3T1HB 1Q95A 1VE5A 4L0MA 1ODKA 2QPAA 3A1TA 3OOSA 4MV7A 5IJAA 3QE9Y 4HYTA 3T4DA 1JWAB 3O3CA 4UDXX 1L5VA 4KEAA 3AY7A 1HNWO 1L5QA 2QRHA 4G4SP 4YT5A 4QTYA 2I6QA 2O8FB 4ARBA 5K1XA 1EEHA 1KDRA 2F1OA 4S1PA 3WICA 4BTVA 4ZOQI 4AY3A 2OCXA 1FU8A 3KKEA 3OCCA 3RT7A 3SSAA 1G21A 1LX6A 4ETNA 1CRPA 2AUNA 3GRVA 5LC1A 4D46A 2X1VA 4CEIB 1M8GA 3L79A 1XHXA 4CG1A 2WF6A 1WCYA 3S29A 3JTMA 3UBTA 2YR0A 1A7UA 4BDTA 2VRNA 1NDUA 4INAA 1VLJA 4LZZA 4JI7O 2C98A 4NG5A 2AMLA 4AJ1A 4CL3A 4LR3A 4QJ3A 3HKEA 1FNBA 3C3XA 3GFPA 1E69A 3R6TA 4LE0A 4DBLE 2JIZG 3EEIA 3W1EA 3G0HA 4CT0A 4NV0A 4HQKA 1RM1C 1B6GA 3E0XA 3I0MA 4ZA2A 1IZ3A 4DLLA 1KGDA 1QFXA 4Y67A 2IZOA 2W6NA 5FTMA 4YQEA 4W9RA 3D7RA 2HLNA 5DB4A 5FH9A 3UJ6A 2W90A 3QLVC 1ZM7A 3DAOA 1QIGA 2A9PA 1R3LC 2DWDC 1EFCA 2O1EA 3OLZA 1W0KG 2VWPA 3NYRA 1N0UA 5C8DA 3KEMA 2WAYA 5A7FA 1F0YA 1SXGA 5JOQA 3U5ZB 4C2TA 2L42A 3FNQA 3P2YA 4GGMX 5SYMA 4O33A 1I2ZA 3QMWA 4X7BA 1BMFA 4YH1A 2QJRA 5UKDA 1MX5A 3RTEA 4DCCA 6YASA 3Q4HA 3UJNA 2XMZA 4PAQA 2EL9A 2AKEA 3HTXA 3WGOA 4FP9A 3VU8A 2LO1A 1ZH4A 4RENA 1BGYH 1VIMA 2NGRA 3C7TA 4V3BA 2ZIEA 2WSBA 2JJ2A 2FPRA 3A8TA 2XOEA 4IH1A 3SHFA 5ADUS 3PG5A 1O9HA 4XIFA 5A3QA 5KWEA 1ACLA 4P5DA 1H2WA 4WACA 1V71A 1DRWA 3DMYA 3ODPA 5BT9A 3R9KA 1K27A 1C3VA 4URWR 5D6NA 1S0VA 3QSGA 2WMDA 4ZVTA 2HJFC 2ZLBA 4HNHA 3AG3B 2Z0AA 3ZRVA 4FYYA 3HUDA 3ZE1B 1E4VA 3CE2A 2Q6IA 2UVPB 3BXEA 2H3EA 2JCGA 2JHAA 4YPVA 1PR9A 2C1EA 3CLKA 3C6BA 3DSQA 4TLEA 1X9GA 3VAZA 4HK4A 3AU8A 4KR7A 1AA9A 1NONA 1G63A 4JUIA 2GCEA 4B7AA 5JXGA 1PJTA 5FNVB 3PQ3A 4BQOA 3SGLA 5ALQA 2IVFA 4WKGA 3P8ZA 5I3CA 1T5DX 1AI7A 3KSMA 1GL7A 3M1LA 4DGSA 4BP1A 3CA8A 2YXLA 2Q4TA 3PE3A 3O3OB 2GEKA 2WKQA 4PNEA 4IRXA 2NOAA 4BJ5A 1T6ZA 1UBSB 1SUAA 2XUQA 1OAOC 3LUCA 2YHIA 3O9ZA 2ZRHA 3PGVA 2FJPA 4XD7A 1OF1A 2VNSA 1DG3A 1NKSA 4J3FA 4NEQA 5F2OA 4CEHA 4EI8A 1V11B 3C6QA 3WK6A 4KXRA 3EXFA 4HQNA 2JGMA 3LIPA 4P31A 5H6QA 4A2WA 3K5LA 3OBIA 2VDNB 5EUQB 3T7JA 1ESNA 1RIIA 4BNJA 4C20A 4F3NA 4AF7A 4L6CA 4XD2A 1X7ZA 5CDSA 1XI2A 5BY2A 4FCCA 3OJCA 3MW8A 3TQIA 1XQYA 1LH0A 1JOYA 3WWEA 4CODB 3EXIA 1RS0A 4U00A 3OF5A 2PUHA 3ILHA 1CUEA 4I1PA 3H6HA 2EC5A 1CFJA 2AVNA 2HWWA 3MGCA 2GYVA 3TX6A 3H4TA 3SHQA 3GMIA 1JIJA 3R7NA 4AROA 3WTBA 3LX4A 5LGNA 1L5RA 2YXDA 5L3VA 1BNCA 1EDBA 3JD3A 4KLZA 3U4DA 4B2PA 2ZUTA 1IK6A 4JV5B 2KG7B 1A76A 3DV2A 4L6IA 1MO5A 5KHHA 2ZKLA 2GUGA 4MI3A 4TLAA 4TS4A 2YDEA 1AHIA 1UMDB 4UV9A 2NG1A 1Z68A 4FFRA 3LDCA 5L4LA 2VL7A 2ZJ1A 2XF2A 3DR5A 3IAAA 5LZ7A 2Z2YA 3QKSA 2GEBA 4ZGWA 2JKYA 2Z4SA 3KFVA 3Q8XB 1OV9A 1XAJA 3L0DA 3AHDA 4OKIA 4GAEA 1F4PA 2O5RA 4TRJA 2VQFB 5AW7A 1XDGA 3M5CA 2IWHA 2ECFA 2A9HA 5AK6A 1NGSA