5D5UB

Crystal structure of human hsf1 with hse dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
100
Chain Sequence
SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEERDDTEFQHPCFLRGQEQLLENIKRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock Element DNA
publication title Structure of human heat-shock transcription factor 1 in complex with DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 26
structure length 100
sequence length 107
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d5uB00
2ZNYA 1R22A 1KYZA 4L5JA 3GFIA 2P7CB 3JAMK 1QO0D 2HQNA 4UHTA 1XN7A 1ODDA 3HTUA 3FF5A 1IZ1A 2QQAA 4UVCA 1XMAA 2Q0OA 4L9JA 3IL2A 1D8JA 3GX4X 3CUQA 1FYLA 1IXRC 1IUYA 1K6OA 4WF2A 3QU6A 1Z9CA 1XGOA 4EJUA 2HYGD 3DKWA 1SFEA 2K4BA 3JSPA 2P4WA 4BNCA 4DQ2A 2KRFA 1PP8F 1K78A 2VT3A 1P4XA 1ZREA 1CGPA 3WTSC 1HBXG 2NRAC 1G6NA 2QYOA 4IRHA 3BPVA 2DFIA 5DV5A 2R7DA 5F64A 3SZPA 1LDDA 2MD5A 3HYIA 4HLYA 3HRSA 3FXRA 2GXBA 4LK0F 3L2CA 1R7JA 1FP2A 1HXDA 2Z99A 5HDNA 1MJBA 1EV7A 3T0YA 2CQKA 1RI7A 1B1BA 2Y75A 2HQRA 3E6MA 2E7WA 3GW2A 3M1EA 2IPQX 5CLSA 2ADUA 3I53A 1D3YA 1GXPA 2ESHA 3QU3A 4G9YA 1O3QA 1HSTA 2CW0F 1QPMA 5DUKA 1IXCA 4M71A 1STZA 2DLLA 3FZVA 4EJOA 1G3SA 3LQRA 3DQVC 2QENA 3HRTA 4BHCA 1TQMA 4RGSA 3LA3A 4O5VA 3F3XA 5F1RA 2HKXA 1ZN2A 5JVTA 5IT9Z 2XIGA 4LD5A 4LJZF 1MKMA 5D4SA 2VC0A 3T8TA 1FT9A 2XROA 2Q2EA 2IVMA 3FMRA 2Z33A 4UUVA 5ILSA 5IT3A 2QQBA 1FBSA 2XASA 4LB6B 1E2XA 1S3JA 2BEOA 4HV5A 2EFPA 5D8KB 1J0RA 4RB2C 5ICEA 1H0MA 2FRHA 3ZMSA 5A2QZ 4RAYA 2LF8A 3LAPA 3GFMA 1BJAA 5LRRA 4ON0A 4I0BA 3BJOA 1ZLJA 5CVRA 1ZG1A 4MHGA 5DDGA 1IXSB 4ETSA 4R79A 5E18F 2STTA 3I5UA 1IN5A 2DQLA 1HKQA 4KNYA 1K7AA 3HIFA 3KZZA 4YFKF 1QNTA 4A6EA 4HOBA 2STWA 5DD4A 5LHHA 2W57A 3KP7A 4EJVA 5HS9A 1KGSA 1I1SA 5DCMA 2H09A 2MA3A 2Z5UA 4N0BA 1U8RA 3EYIA 2VBWA 3TO6A 3GEZA 1O57A 1WQ2A 3TO9A 2H6CA 1Y0UA 4Q5SF 1NHAA 2HFHA 4A12A 1P6RA 4Y13A 3EYYA 4GCVA 1CF7B 1OYWA 3CO7C 4F7ZA 4JBAA 1XGNA 2GWRA 3ABUA 1ZG5A 3IHUA 3TQNA 1TLHB 1RIOH 3W6KB 4HDUA 2A6EF 5D8LB 3KP5A 3B73A 5HOOA 4EV0A 3KP6A 4NHJA 5HS7A 2P6SA 4WXDA 1FLIA 4CDGA 1TW2A 4LFUA 4RGUA 3K0LA 1R5GA 3H92A 4L9TA 2ELHA 4ZYGA 3E6CC 2JPBA 3E5UA 1FX7A 2F5FA 1IN8A 2M30A 4GYIA 1YYVA 3TKYA 4ENKA 2A5YB 4BAYA 1SMYF 1XB4A 3SXYA 1XCBA 2FE3A 3BP8A 1MDMB 2O3FA 3C1DA 4AIKA 2HS5A 4G7HF 3GFLA 4KN7X 3G3ZA 1FY7A 3F23A 2R3SA 4LK1F 1ONVA 4LGWA 3BZ6A 1IN4A 3F6OA 1TNTA 1R23A 4S04A 1HQCA 4M9SA 3V7SA 2EFWA 3I58A 3F22A 3J7AO 2J5PA 1MD0A 1LDJA 1YO5C 5E8GA 4FHTA 3V8LA 2FF4A 2P8TA 5AIQA 4ZH4F 2ZJ2A 3QOPA 5JR3A 4LG0A 3U9GA 1FOKA 2WTEA 5BQTA 3F6VA 1V3FA 3JTHA 3WTVC 1H9TA 1PUEE 1W4MA 3WGIA 1IF1A 2E1CA 5D6EA 2DQRA 1UFMA 1OR7A 3FWEA 1T98A 3HSFA 5K1YA 2HKOA 4UXNA 3ULQB 2PQ8A 2M8EA 1O3SA 2A68F 2QWWA 2HWVA 2QUFA 1BC7C 5TRDA 3RPUA 2QZ8A 3CO6C 2YSRA 4U0WA 4CYDA 2Z3YA 1T38A 1XSXA 3MZYA 2FBHA 4IHSA 1JE8A 2ISZA 2DT5A 3Q9SA 5FLXK 3NQOA 2G9WA 4ZYHA 5ICGA 4AIHA 4D0PA 2DPUA 5AIPA 1IAWA 2IA1A 2XVCA 5H6QA 2RC4A 4ZZDA 2GZWA 3QP6A 3W6JB 2D45A 3KCCA 2PLYA 3FM3A 4O3MA 1TTYA 4M9XA 4IXAA 2DAOA 3OV8A 3VEPA 1FSEA 2FNAA 4WCGA 3KE2A 4CXFA 1BI1A 4B8XA 1TNSA 3BY6A 4EVIA 3OOPA 5D5WB 2J5OA 1AWCA 4EM1A 1V4RA 3KEQA 5DYMA 5LGUA 3K1NA 1IN6A 5LHIA 3ECOA 1SFUA 4U0VA 2B0LA 2ZNZA 2E7XA 2A3SA 1IRFA 1QBJA 1YW8A 2DU9A 4BH9A 1WI9A 2ISYA 3F21A 2XRNA 4AWXB 2A6HF 1XD7A 3MZHA 2PJPA 1USSA 1VTNC 4OU0A 2K02A 3GUDA 2HGCA 5KVRA 4LLNA 3KEOA 2YX7A 2NNYA 4A2UA 1W5TA 3KLOA 5LRSA 2EJRA 1I6XA 4HX4A 2P5VA 2EV0A 2COMA 1YLFA 2QM3A 4RB0A 1YQAA 1ON2A 1R58A 1MDMA 1UCRA 3S2WA 4MQ9F 5L3BA 2H27A 2EWNA 5E20A 2DBBA 4IRGA 5FFXA 3KETA 1FNNA 2JSCA 5DD8A 2DTRA 4M6YA 4IJAA 3VOEA 2RNJA 2ZCWA 2V1DA 4LB5A 3RKWA 3R4KA 5HVQC 2XAQA 5CVJA 1P4WA 2PI0A 2JRTA 1OYIA 1F9NA 4OMYA 4P9FA 1FSHA 4YFXF 2XUBA 3RIRA 3HHGA 2Q8KA 3V8JA 3MEXA 3V7RA 3CUQC 1ZARA 2ZFWA 1KQ9A 1UHMA 3K2ZA 3RPQA 3GXOA 3HOTA 4DNCA 4L0ZB 4ASNA 2FNPA 1ZG3A 5BPDA 3O6BB 3EUHA 3FMSA 3ZQ7A 2OD5A 4RGXA 6PAXA 1L3LA 4TV7A 4GYGA 1F1ZA 3RJPA 3Q5FA 1KU3A 5EEGA 2ZMEA 1T6SA 2HTSA 3N4MA 3R0JA 2O6GE 3ZPLA 1J59A 1EH6A 3T1BA 3TO7A 5K5OA 3MFKA 2PN6A 1ZHFA 4HF1A 2G7HA 3EETA 4R1HA 4QWQA 1J75A 3ZN0A 1FWZA 5LGNA 1R1VA 1YTYA 4YFNF 2FMLA 1GHCA 5FB2A 2TDXA 4OMZA 3WU1B 3D5LA 2EA2A 2F5DA 1TBXA 3K1PA 4I09A 1WKMA 3KP2A 4L9VA 3GFJA 1MJAA 2HDCA 3SHFA 2W85A 1HW2A 4I01A 3LFKA 4HX8A 3J81K 1SMTA 2IRFG 2L01A 4U7DA 1RNLA 2VBYA 2CO5A 4HAMA 2RVCA 3MAJA 2GA1A 5F6FA 5FD6A 1I27A 1J7KA 3PFIA 5JHUA 2KJBA 3LAJA 1U5TA 3REOA 2LDUA 3JSOA 4P96A 5BS6A 2K27A 1FYMA 4HQEA 2WV0A 2CFXA 3RYPA 4A0YA 2E1NA 1B9MA 2RV8A 3HSEA 5D5VB 4Q47A 2XAHA 5E1ZB 1BC8C 2VONA 2JPCA 3KP3A 1YW9A 1SAXA 3SZTA 3ZP5A 2DW4A 2FXAA 2JT1A 1FP1D 3WTZA 2IP2A 2VN2A 3BPXA 1Z6RA 3SFZA 3WU0A 3I59B 3DEUA 2R7FA 1HSJA 4A0XA 2C6YA 3SQNA 1O3TA 5LHGA 1D5VA 4KMFA 3GVAA 4LMYA 3ZMZA 3QAHA 4RB3C 3ECHA 4ZYEA 4CO8A 2ETHA 3DXJF 2A61A 1P2FA 2HYFA 2L02A 4G6DA 4MNUA 2O8XA 2BGCA 3IRRA 2BE5F 3BWGA 1HKSA 4ESFA 3IC7A 2QQ9A 3I54A 3HUGA 3C3WA 2RN7A 3H3ZA 1G3YA 3MCZA 4ESBA 4KICA 3IWZA 1Z6TA 2GIVA 5HLGA 1KA8A 1XSDA 3ZMDA 4HZFA 5L3FA 2IT0A 5HDGA 5H20A 3RKXA 3Q9VA 3V8KA 2V6CA 2V9VA 2MLGA 2FBIA 4GO1A 1JHHA 2EFOA 4XSZF 3WTWC 3I71A 3P9IA 2BBYA 1XDUA 1ZRFA 4FX0A 3PQJA 3LSTA 5BOXA 3JTGA 2O0YA 3R0AA 3CUQB 4CGZA 1R1UA 5ILVA 3C18A 1B6AA 5LEKA 3DPTA 2FSWA 1I1GA 5A2QK 2UXNA 5JFRA 3E97A 2NS0A 2MH9A 2DK5A 1YG2A 2Z9OA 4L0YB 3E5QA 1K78B 2IA2A 3GO5A 3LQQA 4ZZLA 3P7NA 4OIRF 2W24A 3GLXA 1IRGA 5BPIA 5ICCA 3GZ6A 3EQLF 5DEQA 2VE8A 4UNOA 1W7PD 2A07F 5HLHA 4B09A 1YW7A 4GXOA 3HRUA 2GA2A 3E3VA 2O03A 4CHUA 3ELKA 3T8RA 4N9IA 3C7JA 3U2RA 2KIFA 3FMQA 1DP7P 3FM5A 4P5OA 2FU4A 1PP7U 2ZKZA 1F4KA 3G73A 1L0OC 1IW7F 1FBUA 3JAMZ 3HSRA 5ILUA 3QRFF 4BHBA 2M1BA 4UV8A 2GQQA 3WG9A 4I7HA 1Z05A 2RDPA 3BDDA 3B02A 3HOSA 1J5YA 3TDUC 2OQGA 5K5RA 1O7LA 1G3TA 3I64A 3WTYC 3ZN1A 2QBYB 1HKTA 1B4AA 2AS5F 1FYKA 1YFHA 4KYWA 1QZZA 1E17A 2VXZA 1ZH5A 4NB5A 1LEAA 3T5XA 1H9GA 3U1DA 1W7PB 2EB7A 1D8KA 4FT8A 2HZTA 4OIQF 2EV6A 4JK1X 1TQPA 3BJ6A 4EQQA 1K79A 3WE3A 2XHKA 1Z1DA 4MTEA 4KMUX 1ZGAA 2PG4A 4MQVA 3I59A 1S29A 2OU2A 2K4JA 3D0SA 5E8IA 5DUIA 2K86A 3DPLC 1C0WA 2VODA 4EM2A 3ZMUA 4KN4X 2M45A 5CJ9A 3DF8A 5AONA 5CVIA 1DPRA 5J8CA 3KLNA 3KP4A 1CF7A 1SD4A 4CICA 1XCVA 1UB9A 4A0ZA 4WXCA 4RS8A 2IA0A 5ED4A 4UVAA 4OIPF 1WSUA 3K1MA 3RKYA 1LB2A 2YX4A 4EM0B 4KIFA 2NYXA 2YPRA 2F5CA 4MTDA 1ON1A 1MJ9A 1I5ZA 2OA4A 2P5LC 4S05A 5HLIA 2JZYA 3WE2A 3CJNA 3F8CA 2HOEA 2M5WA 1BIAA 4U88A 5J8FA 3LA7A 4MEXF 3O2PE 3R6SA 1ZLKA 2DPDA 2W25A 1Z91A 3GF2A 1MZBA 2X0LA 1FC3A 2KJCA 3GWZA 2O61A 3J81Z 4KUMA 1GXQA 2ACJA 1SD6A 3I0TA 3ROUA 2ZBKA 4HBLA 2G7UA 2VBXA 2LSOA 3DFGA 4KFCA 4M9ZA 3FHZA 3TOBA 2GXGA 2W84A 4M74A 3IKVA 3F8MA 3O3KA 3M8FA 5E1WA 5CYVA 4M72A 1FZPB 3V7CA 4IPAA 4Y17A 3L9FA 5DCFA 3P9CA 1GVJA 1BI2A 2KIUA 2VC1A 4L9NA 4CZZA 2CSOA 4ENMA 1UHWA 3ZMVA 3K9TA 3WGGA 2Y0MA 3CTAA 3PQKA 4HA8A 4ENNA 1KQ8A 1U2WA 3V4GA 4EGZA 4XBFA 2AXLA 4HDVA 3FXUA 2F2EA 2VOOA 4G7ZF 2BV6A 3AAFA 3NEUA 2OBPA 4LLGF 4I02A 5L3EA 4IHTA 1ZRDA 2HTJA 3E6DA 3R61A 5JI6A 3E5XA 2CG4A 2X4HA 3J80K 1ZYRF 2DK8A 1JHFA 4EGYA 4G8XA 1RUNA 2LNBA 5FGMA 1OMIA 2KKOA 4HF0A 4H0EA 5L3CA 1KU7A 2QVOA 2ZO4A 3M8EA 1LNWA 4LG0B 2YR2A 5CVUA 4XRFA 1KQ0A 3QPTA 2VBZA 3IKTA 4QLCU 4BYYA 3R60A 2OQRA 1R36A 5HS8A 2QBYA 1MGTA 2OAZA 4OIOF 1W5SA 4KDPA 3RI4A 3F8BA 1LJ9A 1Z7UA 2XAFA 4LLLA 4WWCA 1AOYA 1W7PA 1QQIA 4HYEA 2CYYA 1ZRCA 1S7OA 3IWFA 4Z2YA 2EK5A 4YIFA 1R5HA 1T0FA 2RQPA 4E70A 3IRQA 4P55A 2XV4S 4ESJA 1EH7A 1REPC 4JQFA 4RAZA 2D1HA 2HEOA 2BYVE 4EJWA 4MEYF 1B9NA 4Q48A 3F8NA 2DI3A 2V79A 4A5MA 1ZAOA 2PEXA 2P6TA 5D4RA 4L18B 4WX9A 4G6QA 3P9KA 5D6FA 5FFZA 5LLQA 1ZGJA 4KIGA 3WTXC 3WTUC 2NNNA 1LDKB 1R1TA 2UXXA 1U5TC 2EA4A 4I2OA 1XDSA 1PDNC 1U3EM 1FBQA 2KIMA 4M73A 1KU9A 5E17F 4KIBA 3FX3A 2P5KA 3RTRA 2FEZA 4AIJA 3GYHX 3TGNA 1WRJA 2K7LA 1BN5A 4GGGA 2L3DA 4PGGA 5H6RA 2XGXA 1P92A 4K2EA 1U78A 2FQ3A 5FD5A 2M87A 2D1VA 3ABTA 3NRVA 2QLZA 4M6XA 1G4DA 3BROA 2DO7A 1YIOA 5ICFA 4EMSA 3F8FA 1BI3A 4YIIA 2WWYA 3HHHA 4HW0A 3WODF 3TOAA 3VB2A 4WK8F 1O7FA 2RKHA 3EDPA 1O3RA 1Q1HA 1QGPA 3L7WA 4KT5C 1P4AA 4BHPA 2RGVA 1J9IA 5IT9K 1TW3A 2IW5A 1HW5A 2YU3A 4OINF 2MH2A 3CDHA 3I4PA 1YS6A 3QPHA 2EFNA 4KA4A 5FLXZ 1DPUA 5ERIA 3WTTC 2PFBA 1QZYA 2UWMA 2FA5A 1LEBA 4P9UA 4PGHA 3DP7A 1ULYA 2IJLA 4AVPA 2V1XA 3QP5A 2XKOA 1OPCA 3LWFA 1G3WA 5D5XB 2XKPA 1JXSA 1X3UA 3DV8A 2UZKA 5BMZA 3E6BA 3N97A 5TJJA 1BBYA 5E1XA 1SD5A 1B59A 3BOQA 3VFZA 4R8HA 5CVVA 4OOIA 4HV6A 4RB1A 3M7GA 4G7OF 3VODA 1YS7A 4FX4A 4IRIA 3JW4A 1HW1A 2P7VB 4PDKA 5K5QA 3H3UA 3LA2A 2XAGA 4IVNA 5L3DA 3F72A 1XSVA 4L5IA 2MC3A 1XMKA 4A6DA 2VT2A 2VOPA 2FBKA 4PZJA 1USTA 3ML6A 2WC2A 5LBQA 4O6JA 3L09A 4UV9A 1RZ4A 1SD7A 4I0AA 4I98B 3RDIA 1LQ1A 1RUOA 1EH8A 2CGPA 1F5TA 3MQ0A 1J2XA 2L4MA 4A5NA 3HTSB 2ZMEB 1DDNA 2OZ6A 4AD9A 1BI0A 4UVBA 2HR3A 2H6BA 4N9HA 2ESNA 1A04A 2LF7A 4ZYDA 1JGSA 2PBIA 2CWEA 4U7BA 4NQWA 2V1UA 3COAC 1U6GA 2D2WA 2L54A 4WXHA 4MGRA 2EFQA 4Q4ZF 1T2KA 1DUXC 2ZXJA 1BOAA 4HF2A 2OZUA 4EJTA 2EV5A 1WWXA 4HQMA 5KK1A 2Y48A 1S6LA 1XGMA 5LGTA 1FPQA 4Y15A 3TDZC 5D5UB 3K69A 4HLXA 2XAJA 4XLPF 4YG2F 1KU2A 3FXQA 3M9AA 2LKPA 5HDKA 5EEHA 2NAZA 5FO5A 2FOKA 1OYYA 4BXUA 3KZYA 2A69F 1XGSA 4XLNF 2MBFA 4BQAA 1U5TB 3CLOA 4IF4A 5J6XA 4U0YA 1LVAA 3GZ5A 2VE9A 1R00A 5L3GA 3ZMTA 3MWMA 2JTVA 1TQIA 3CUOA 2L4AA 3HRMA 3L00A 2H94A 3J80Z 2F5EA 4XSXF 1S8NA 4HX7A 4PCQA 2GAUA 2FMYA 1IN7A 4G94A 1T39A 1BM9A 1OKRA 4ENJA 3WGHA 3BJAA 1SFXA 1KYWA 1S7AA 3RYRA 3ERED 2PMHA 3ISPA 3KFWX 4RGRA 1BIBA 5DCMB 5LEJA 2MLKA 2PMUA
chains in the Genus database with same CATH superfamily
2ZNYA 1T95A 3CLQA 1JT0A 1R22A 1S72I 1KYZA 4L5JA 3GFIA 2P7CB 3JAMK 1QO0D 2HQNA 2CH0A 1NG7A 4UHTA 3OSGA 1XN7A 1ODDA 2WBMA 3HTUA 3PNVA 3FF5A 1Y1VJ 1VQOI 1IZ1A 2QQAA 4UVCA 2X9DA 3TP3A 1OCRH 4JOMA 1FOWA 5J1YA 1XMAA 4F93B 2Q0OA 4L9JA 3IL2A 1D8JA 3GX4X 3CUQA 1FYLA 5GTIC 2IGKA 3HBLA 4X0GA 1IXRC 3UR3C 1IUYA 3A02A 2VI6A 2P81A 4XL9A 2BW3B 1K6OA 3M4OJ 1JI8A 2FD5A 5KAIC 4WF2A 3QU6A 1T08B 1Z9CA 1XGOA 2EQRA 3RQ4A 4EJUA 4M3DA 2HYGD 3DKWA 4JX4A 3HUGB 4IKFA 1SFEA 2K4BA 3JSPA 3H0GJ 3PO2J 2HXIA 2E71A 2P4WA 4BNCA 2JVHA 3X2QH 4DQ2A 4BGDA 1RRJA 2KRFA 4XOTA 2O8KA 1PP8F 3SDGA 1SVOA 3TBIA 1K78A 1Q1VA 4F3QA 4A3CJ 2PX9A 2VT3A 3ERMA 1D0YA 3Q0VA 1U0JA 1P4XA 1ZREA 1CGPA 1JJ8C 3WTSC 1HBXG 2NOJB 2NRAC 1G6NA 2QYOA 4IRHA 3BPVA 2DFIA 5DV5A 2R7DA 2JA5J 1S5LC 3WG7H 5F64A 3CCQI 3SZPA 3CMYA 1SFKA 1LDDA 2LREA 2DYRH 2MD5A 3HYIA 2DTZA 4HLYA 3HRSA 3FXRA 3ZQFA 2DOAA 2QKMB 2GXBA 2JRMA 2A5WA 4IOAF 4LK0F 2Y0SN 3GZNB 1MW7A 1J09A 1R7JA 1FP2A 5E3MA 1HXDA 4XRSG 2Z99A 3L2CA 2OTJI 3S1RJ 1N75A 2LH9A 5HDNA 3HOXJ 1MJBA 2ECBA 2CW8A 2IXSA 1EV7A 3T0YA 2BXZA 1K6YA 1PUFA 4UY8I 2L0KA 2V7FA 1IRXA 2CQKA 1LE8B 1RI7A 4W97A 1B1BA 2OTLI 1MSEC 2Y75A 3S93A 2HQRA 3E6MA 2E7WA 3FIWA 4YIRX 3GW2A 3M1EA 2IPQX 5CLSA 1FOYA 2ADUA 1UAAA 3I53A 4V2FA 1QZEA 1D3YA 2L7MP 1V5GA 1GXPA 2ESHA 3QU3A 1IGNA 4G9YA 1O3QA 4J19A 3OSFA 1DGRM 2LKSA 2I5UA 1HSTA 2CW0F 1VQKI 1LFPA 1QPMA 1TWAJ 1Z0XA 5DUKA 1IXCA 3H9QA 4M71A 2VKDA 2ZC2A 3FBIB 1D0XA 3KYLA 1STZA 4BKXA 1WVRA 2DLLA 3FZVA 4EJOA 2CUJA 1G3SA 2MC4A 3LQRA 3BR0A 3OL3A 3CCMI 1RR7A 3DQVC 2QENA 3HRTA 4BHCA 1TQMA 4RGSA 5F1JA 3LA3A 2IS1A 4O5VA 3F3XA 5F1RA 2E1MB 2HKXA 1ITYA 1ZN2A 2X1CA 5JVTA 3FISA 3HG9A 2EZLA 2R0QC 4OWRB 3J7AY 5IT9Z 3PSFA 2XIGA 3AG3H 4LD5A 1OFCX 4LJZF 4H4KC 1NTCA 2LC2A 1MKMA 4I6ZA 5D4SA 2VC0A 2M8GX 4OAYA 3J7YJ 3DBHB 3T8TA 1FT9A 2B9SA 3H0DA 1BR2A 4RDUA 2HOTA 2LG4A 4HG2A 4LG3A 2XROA 1X1PA 2PJRA 4E6KG 3W2VA 2GOXB 3AG4H 2Q2EA 2HVSA 2IVMA 1X2MA 2XPUA 3FMRA 3CDLA 2Z33A 1UELB 2ZSIB 1X1BA 4UUVA 5ILSA 2VPRA 5IT3A 2EZHA 2LOOA 3HOUJ 1TWGJ 2QQBA 1FBSA 2XASA 3HKZA 4LB6B 1E2XA 2E5ZA 1S3JA 3A2KA 2BEOA 1MBGA 3M8JA 3WHCA 1R71A 4HV5A 2EFPA 5D8KB 1J0RA 4RB2C 5ICEA 3AKZA 3CC2I 1H0MA 5F0FA 2CQQA 2FRHA 3LFUA 2Z1DA 3ZMSA 5A2QZ 4RAYA 1GLNA 2LF8A 3LAPA 4N4OB 1GV5A 3EUKL 1ZK8A 3E0JB 1BJAA 3GFMA 2DOEA 5LRRA 2R7RA 3KPHA 1X4OA 2OF7A 4ON0A 4I0BA 3BJOA 1ZLJA 4NC7A 4M3EA 1PYVA 3GTLJ 5CVRA 1ZG1A 4MHGA 5DDGA 3W6VA 1IXSB 4ETSA 1W0UA 3CJTB 4R79A 1T0FC 1QA6A 3FKIJ 5E18F 2STTA 1X58A 1U9NA 3I5UA 4BQQA 3K4LA 1IN5A 2H8RA 2DQLA 1HKQA 2R5YA 1UMQA 4KNYA 3DLLF 1K7AA 3HIFA 3KZZA 4YFKF 1QNTA 4XMYA 4A6EA 4HOBA 2STWA 5DD4A 3DKYA 1WPKA 5LHHA 2H1KA 3BG3A 2W57A 3Q0WA 5J1RA 3KP7A 1LVKA 1VZ0A 4M6VA 5HS9A 2XPVA 4EJVA 1KGSA 1YJNI 1I1SA 2X1DA 3PSIA 3LSIA 5DCMA 2H09A 2CMPA 2MA3A 2HQAA 4ABZA 2Z5UA 4N0BA 1U8RA 3EYIA 2VBWA 2K3FA 3TO6A 3GEZA 1O57A 1WQ2A 3TO9A 2BY1A 2H6CA 2N8GA 3VPRA 3FXMA 2F5VA 1K4TA 1Y0UA 2K9MA 2HDDA 4Q5SF 2XSDC 1NHAA 2BHYA 2HFHA 3MKZA 4A12A 1P6RA 4Y13A 4PJMA 4PFOA 3EYYA 2BVMA 4GCVA 4DW6A 1CF7B 2X51A 1OYWA 3CO7C 4F7ZA 2L2OA 3BR1A 4JBAA 1IG7A 2R7WA 1XGNA 2GWRA 3ABUA 1ZG5A 4DIQA 3IHUA 1TWCJ 3TQNA 4F55A 1TLHB 3K4BA 1RIOH 3W6KB 4HDUA 2A6EF 2F4OB 3MMYB 5D8LB 4BY7J 4L5EA 3DKXA 2CS3A 3KP5A 3B73A 3O8GA 5HOOA 2ME0A 1MH4A 1BW5A 4EV0A 4F91B 1G8XA 3CDIA 2V26A 3KP6A 4NHJA 5HS7A 2VL8A 3BR3A 2P6SA 4M3GA 4WXDA 1FLIA 5J4YA 4CDGA 1TW2A 3CJQB 3LMMA 4LFUA 4RGUA 3K0LA 1R5GA 5E79C 2M4KA 3H92A 3NARA 4L9TA 4D5CA 5IOZA 2ELHA 2W00A 2ZFUA 4ZYGA 1MMAA 3E6CC 2JPBA 3E5UA 4IZZA 1D1BA 3NWSA 1FX7A 4BJ6C 2F5FA 1IN8A 2M30A 4GYIA 2VUMJ 1W36D 1YYVA 3TKYA 4CCMA 2A5YB 1SMYF 2L7FP 4BAYA 3VYUB 4ENKA 1XB4A 1OQYA 1XCBA 2FE3A 3SXYA 3D1NI 2L9SA 4FE7A 3OS1A 4IQJA 3BP8A 1MDMB 2O3FA 2QKLB 3ZOBA 4PJNA 4QIWN 1ETVA 1R6RA 2IEKA 3C1DA 4AIKA 5F04A 2HS5A 4BL0B 5FJ8J 2LVSA 1ACIA 2KISA 3IH3A 3ZGKA 4G7HF 3GFLA 4KN7X 3RCOA 3G3ZA 3CCUI 3S3MA 1T8IA 4J01A 2JVGA 1FY7A 3BZKA 2R3SA 2QCOA 3F23A 4ZTJA 3JRCA 3P5JA 4BXXJ 4LK1F 1ONVA 5IY5H 3BR6A 3HXLA 2R5ZB 3K4CA 4LGWA 1MBKA 3S2HJ 3CCYA 2PMZA 3PUBA 3BZ6A 4JYKA 1IN4A 3F6OA 4XLHA 4BEHB 1TNTA 1R23A 4S04A 4G12A 3M3YJ 4HNVA 4A69C 1HQCA 4M9SA 3V7SA 2EFWA 2X6WA 3I58A 2KDOA 3F22A 1ZR4A 3J7AO 2HU9A 4NC8A 2J5PA 5EJCA 1XS9A 5IYDJ 1MD0A 1LDJA 2WV1A 1YO5C 3FXOA 3BTIA 5E8GA 4FHTA 3V8LA 2K9QA 2FF4A 2P8TA 3A0BC 4PFPA 5AIQA 4BBRJ 4ZH4F 2ZJ2A 3QOPA 5JR3A 4LG0A 3PIOF 3U9GA 1FOKA 2WTEA 5BQTA 3HOZJ 3KYDB 3BCAA 3F6VA 3LSMA 1V3FA 1Y56A 2MSYA 3JTHA 1Y0NA 4CYCB 3WTVC 3PNYA 1H9TA 3MD2A 1AKHA 4Y7NJ 1PUEE 1W4MA 3WGIA 1IF1A 2E1CA 2ZXHA 5D6EA 3PM1A 2DQRA 2IS6A 1LFUP 3HDDA 4C30A 3HOYJ 4IHWA 4FE4A 2XB5A 1UFMA 1JTXA 2Y2ZA 1OR7A 3FWEA 4DYCA 1ETQA 4ZYAA 3UKGA 3OYCA 2E60A 1T98A 2K5CA 3HSFA 5K1YA 2HKOA 2E2IJ 1T33A 4UXNA 1P7IA 3ULQB 4FQGA 2PQ8A 2M8EA 1O3SA 3OOUA 2A68F 3CQZJ 2QWWA 2HWVA 2IGMA 3OYLA 2QUFA 1BC7C 2ICWG 2JUGA 3RPUA 5TRDA 4D9JA 2QZ8A 2FOWA 1VQ6I 1B72A 3CCEI 2ZXWH 3CC7I 3CO6C 2YSRA 1PJRA 2K9LA 3JCUC 2KQRA 1TL8A 2CW7A 4U0WA 3ZRGA 4CYDA 4PJLA 4PSXA 2XC7A 2Z3YA 2W7NA 1WJBA 2VQCA 2LR8A 1T38A 5IYCJ 2NXNB 1XSXA 2DT7B 3MZYA 2NOGA 2FBHA 3HM5A 2GIZA 2DMTA 3TW7A 5GAGJ 1N25A 4IHSA 1OR7C 1JE8A 2ISZA 2DT5A 2VLAA 4I99C 3ESWB 3Q9SA 2NS7A 5FLXK 3NQOA 1BR4A 3GTJJ 2G9WA 1X19A 4XLCA 4B4CA 3DBRB 3CP2A 4ZYHA 3CP8A 1FTZA 2KZGA 5ICGA 4XICA 4RA2A 5BNGA 1M1EB 4FETA 4CCKA 4LITA 5GPCA 1WHUA 4E7ZA 4AIHA 2LMDA 3AL0C 1VQLI 4YRVA 4E7JA 4D0PA 2DPUA 1AHDP 5AIPA 1IAWA 3NWTA 2IA1A 2XSJC 5EG0B 2XVCA 3HOWJ 5H6QA 2RC4A 3SEQA 2I8DA 1HA8A 4ZZDA 2GZWA 1OCTC 3QP6A 3L2RA 3GTQJ 1D1CA 3W6JB 4C3IJ 2D45A 1VQPI 3GCMA 2M2EA 3KCCA 2PLYA 3FM3A 5C44J 3I9V2 1QHHD 4O3MA 4XNFA 1TTYA 3LOCA 4M9XA 2GBYA 4IXAA 2DAOA 3W3CA 3OV8A 5IP9J 3VEPA 1FSEA 2FNAA 3SZGA 4WCGA 2HQ5A 2QEXI 3KE2A 1JTYA 4CXFA 1BI1A 2WY7Q 1W5CC 4B8XA 1LKXA 1TNSA 2BXYA 4KISA 2XGDA 3BY6A 4EVIA 3OOPA 2TCTA 3L2VA 5D5WB 4B43A 2J5OA 4BUPA 2RAEA 1AWCA 1FMWA 4EM1A 2Z2SB 1V4RA 3KEQA 5DYMA 5LGUA 3K1NA 3K70C 1IN6A 5LHIA 3ECOA 3BTCA 1SFUA 4U0VA 4AU7A 1X1DA 2B0LA 2ZNZA 3B6AA 2E7XA 2A3SA 1IRFA 1A6QA 1QBJA 1YW8A 4JX6A 2DU9A 3HGGA 1BOBA 4BH9A 4UB8C 1WI9A 5K7ZA 3DBLB 3V42A 4Y33A 1YOVB 2ISYA 5F27A 3F21A 2XRNA 1GVDA 4AWXB 2A6HF 1XD7A 3K2AA 3OYMA 3A01B 3MZHA 1B8IA 2PJPA 1USSA 2DN0A 4KT6A 4OU0A 1VTNC 2K02A 3GUDA 2HGCA 3DWLE 2WB1N 5KVRA 4LLNA 2G0EA 1RPWA 3KEOA 4ZTFA 2YX7A 2ID6A 2NNYA 3N05A 3LL7A 4A2UA 1W5TA 1YE9A 5IOYA 3KLOA 3HL2A 1IRZA 3DEWA 5LRSA 3PIPF 5E3OA 2EJRA 1I6XA 4D7NA 3HB9A 3B6CA 4AM3A 2KLOA 5B5EC 3BG5A 2P5VA 2EV0A 4HX4A 3K7AJ 2COMA 1YLFA 2QM3A 4RB0A 1YQAA 1ON2A 1R58A 1R4MB 4CUGA 2I10A 2HPIA 1MDMA 1UCRA 4BS9A 3S2WA 4MQ9F 5L3BA 2H27A 2KT0A 2Y31A 3GTOJ 2EWNA 3K6GA 2DA6A 5FLVA 2M7BA 2DBBA 4IRGA 5E20A 5FFXA 3KETA 1FNNA 2JSCA 3J7ZI 1MMNA 2FUG2 4CA0A 5EF6A 5DD8A 2CV2A 3JRHA 3QYBA 2L7ZA 1NK3P 2DTRA 4M6YA 1GT0C 5HNFA 4IJAA 3VOEA 2RNJA 3AG1H 2ZCWA 2V1DA 5B1BH 4LB5A 1Y8RB 1UG2A 3RKWA 2DFEA 3R4KA 1LFBA 5HVQC 2VASA 4UUSA 2R7VA 2O5RA 2XAQA 5CVJA 1P4WA 4BEHA 4YELA 2PI0A 2A6TA 3LSPA 2JRTA 1OYIA 4NUBA 1F9NA 4OMYA 4P9FA 1FSHA 4YFXF 2XUBA 3RIRA 3S2DJ 4B48A 3HHGA 2ELJA 5DS9A 2Q8KA 3V8JA 4AYBA 2VQHA 3MEXA 1FTTA 3ONQA 3JRDA 2XAUA 3V7RA 3CUQC 1ZARA 1DGWY 2ZFWA 1KQ9A 1UHMA 1XX5A 3K2ZA 3RPQA 3GXOA 3HOTA 1H8AC 4DNCA 4ANJA 2BZTA 4L0ZB 1V54H 2CUEA 1WJ5A 5TGTA 3OYAA 4ASNA 3FXLA 2FNPA 3HC7A 1VFCA 1ZG3A 5BPDA 3O6BB 3EUHA 3FMSA 4CYCA 5M5YJ 3ZQ7A 2OD5A 4RGXA 1X4PA 2Z16A 6PAXA 1L3LA 4TV7A 4GYGA 1F1ZA 3U1KA 3RJPA 3Q5FA 3L2UA 1KU3A 2X48A 3CCLI 1OISA 1YHQI 3TP0A 5EEGA 2D5VA 2VQLA 2ZMEA 4S0HB 2QSHX 1T6SA 1HDDC 4AUXA 1N77A 2HTSA 2CQNA 4GFBA 3N4MA 4M3BA 3R0JA 2O6GE 5IP6A 3GTGJ 3IH2A 3ZPLA 5FRNA 1J59A 1EH6A 3T1BA 3TO7A 3F9KA 5K5OA 3MFKA 2JK3A 2PN6A 3VYSB 3ABKH 1OLTA 1ZHFA 4D5FA 4HF1A 1W1WE 2G7HA 4BE2A 1D0ZA 3EETA 4R1HA 4QWQA 1J75A 3ZN0A 2JA2A 1FWZA 2E19A 5LGNA 3RQIA 1R1VA 2VIXA 4CCOA 5J47A 1E3OC 4XN3A 4A3BJ 1YTYA 4YFNF 4PJ0C 3TEDA 2FMLA 1GHCA 2AXTC 3G6EI 5FB2A 1SVLA 4NDLA 2TDXA 4OMZA 1XTAA 4G6TB 3WU1B 1MIJA 4AYBN 1SEUA 1DP3A 1OCCH 4A3FJ 1QHGA 3D5LA 2EA2A 2F5DA 1Y8QB 2CQXA 4MO7A 2NVQJ 1TBXA 3K1PA 3G1OA 2MD0A 4I09A 1WKMA 3KP2A 4L9VA 3GFJA 1MJAA 3K70D 2HDCA 1U9OA 3SHFA 2LY2A 1IV8A 2Y9YA 2W85A 1HW2A 5C4JJ 2CFOA 2DA2A 3FHNA 4I01A 3VSLA 2JQ7A 4BQOA 3LFKA 4HX8A 1RKTA 3J81K 3I3LA 3EUAA 1SMTA 2IRFG 2L01A 4U7DA 1RNLA 2VBYA 1YX3A 2CO5A 4HAMA 2RVCA 2NVUB 3MAJA 4BACA 2GA1A 5F6FA 5FD6A 4B44A 2CV1A 1I27A 2DA1A 1XPXA 1J7KA 1VQ8I 3PFIA 5JHUA 5EDNA 2KJBA 1VQNI 2UV1A 4NQWB 3LAJA 4QSHA 5EZGA 1U5TA 4XQFA 3REOA 2H8WA 3LSHA 3H5NA 2LDUA 3JSOA 4P96A 1FMVA 5BS6A 5IPAA 2K27A 1EF4A 1FYMA 5EGOB 3GLLA 5M5WJ 4C9YA 4HQEA 2WV0A 1P7JA 2KFDA 2CFXA 3RYPA 2O7OA 2E1NA 4A0YA 2NVYJ 1B9MA 1V5FA 2RV8A 3HSEA 3CZ6A 4XLEA 4BE0A 3ZQGA 3CD6I 2JJ7A 1UZCA 5D5VB 4Q47A 5KCMA 2NS8A 2XAHA 3OS2A 5E1ZB 3OYDA 1BC8C 2VONA 1BJZA 1K4SA 4D7MA 3CCJI 5C4XJ 3OR1C 1WJEA 4E7HA 1PVEA 1RETA 4V2GA 5J1UA 4DGWB 1APLC 2JPCA 1JUPA 3H9JA 2GXAA 4IL6C 3KP3A 1JKRC 1YW9A 1SAXA 1LUJB 3G4SI 2F4MB 3KEYA 1BA5A 4A3DJ 3SZTA 3OYHA 2ID3A 4CCLA 3S1MJ 3JRFA 1JKQC 1KONA 3ZP5A 1LPQA 2DW4A 2FXAA 2JT1A 1FP1D 3WTZA 2IP2A 2VN2A 3OL4A 3BPXA 3E1SA 1Z6RA 3SFZA 3WU0A 2VJ5A 3I59B 3CMEI 3DEUA 2R7FA 2YUSA 4BY1J 9ANTA 3DLAA 1HSJA 4A0XA 2C6YA 3SQNA 1MSFC 1O3TA 3HKZN 5LHGA 1D5VA 4KMFA 2DA7A 3GVAA 4LMYA 1MBEA 4ZDOA 1AA7A 3QAHA 3ZMZA 4RB3C 1EJ9A 2LBFB 3ECHA 4ZYEA 4CO8A 3BTJA 2ETHA 3DXJF 4IHVA 2A61A 2JA6J 1A6IA 1P2FA 5JHFA 2HYFA 2DCEA 2L02A 2AO9A 4AVZA 2L5QA 4NC6A 3MKLA 4CZCA 4RBOA 1GDTA 4G6DA 2MGQA 2O8XA 2BGCA 4MNUA 3IRRA 1YJWI 2DJIA 1YJ9I 2BE5F 2JA7J 2BW3A 3BWGA 1DU6A 1HKSA 5J3LA 4ESFA 5KAFC 5JVGF 2OCEA 3IC7A 4A3IJ 3OYKA 2QQ9A 4RLQA 3I54A 3HUGA 3C3WA 2RN7A 3H3ZA 3OMYA 4IO9F 1G3YA 2DXIA 3MCZA 4MFEA 4ESBA 4KICA 1MNEA 3IWZA 1QRYA 1I39A 1Z6TA 5GPAA 3SDBA 4Y4RA 2GIVA 3H1CA 5HLGA 1KA8A 3MZ8A 3ZQQA 1JJ6C 1XSDA 3H9GA 3BCBA 3ZMDA 2YS9A 4HZFA 2ZSHB 5L3FA 2IT0A 5HDGA 3HPGA 5H20A 3RKXA 3Q9VA 3V8KA 4YEJA 2DOFA 2V6CA 3H5AA 1RC9A 5J4VA 1TZLA 2V9VA 2CUFA 2FBIA 2MLGA 3O8HA 4GO1A 1DU0A 1QVTA 2MFZA 1JHHA 2EFOA 4XSZF 3WTWC 2H1LA 3I71A 2AQEA 3P9IA 1N78A 2BBYA 1XDUA 4QPQA 4FX0A 1ZRFA 3IUOA 1ZELA 1E3PA 1MMGA 4XONA 3PQJA 2M7AA 3LSTA 5BOXA 1S9HA 3JTGA 5FKNA 4BDZA 2M0MA 3OWTA 3LSRA 2O0YA 3R0AA 3CUQB 4CGZA 1R1UA 3H3VK 3OYGA 5ILVA 3C18A 3ZXSA 1B6AA 3D5RC 5LEKA 2X6XA 2BHZA 3DPTA 1LE8A 2OJED 3S3NA 4ZDLA 4HNUA 4XK4A 2FSWA 2DYSH 2QSFX 3G1MA 4MFDA 4XOPA 1I1GA 1VQ7I 5A2QK 2UXNA 5JFRA 3E97A 3OYFA 1Z3YA 2NS0A 3CMMA 1SAUA 1I3AA 2MH9A 2DK5A 2EZIA 1YG2A 1WJAA 2Z9OA 4L0YB 4DYRA 3E5QA 1K78B 3I4MJ 2IA2A 3GO5A 2BY0A 3LQQA 4II3A 1T56A 2DMUA 3H35A 4ZZLA 4IHXA 3P7NA 4OIRF 2W24A 2GM4A 3GLXA 1IRGA 2ELKA 4B3XA 4DJAA 5BPIA 1X3WB 2R7OA 3RZOJ 3PFYA 5FKMA 5ICCA 3GZ6A 4A3MJ 3EQLF 3LSJA 5DEQA 1SVMA 2VE8A 5J40A 4UNOA 1W7PD 3BG6A 2A07F 5HLHA 4B09A 5HODA 1MBFA 5GP9A 1YW7A 3HOVJ 4GXOA 3HRUA 2KZVA 1WH5A 4QTRA 2GA2A 3E3VA 2O03A 2EZKA 1RKWA 4CHUA 3ELKA 4PSWA 3T8RA 4N9IA 3RKQA 3BLYA 3U21A 3C7JA 3U2RA 2KIFA 3FMQA 2M0CA 1DP7P 2R7UA 3FM5A 1GUUA 2KIQA 3CESA 1MH3A 1VF9A 4XR6A 4P5OA 4BJ5C 2FU4A 4E4HA 5IYBJ 1PUFB 1PP7U 2ZKZA 3BR2A 3ZQCA 1F4KA 3G73A 2OPTA 1L0OC 1IW7F 3C2HA 1FBUA 2MABA 3JAMZ 2XF6A 3HSRA 4B47A 4GDFA 1UJ8A 2PMZN 2KP6A 2X6OA 1ETOA 5ILUA 3QRFF 3A1YA 2DDAA 4BHBA 5GAEJ 2M1BA 1XC5A 2IS4A 2DT6A 4UV8A 1VI0A 2GQQA 3WG9A 2R7TA 4M3FA 2DA5A 1WH7A 3DPUA 4I7HA 1Z05A 1IUFA 5KHDA 2ZB9A 2RREA 4DBRA 2RDPA 3BDDA 3CCSI 3B02A 3HOSA 3OYNA 1J5YA 3TDUC 3VSKA 3M07A 4GRIA 2OQGA 5K5RA 1O7LA 1G3TA 3I64A 1HF0A 3WTYC 2MG4A 3PJRA 1V5EA 3ZN1A 4C2UA 1EKEA 3OYEA 2K9NA 5IP7J 5EGOA 3S17J 2ME6A 2IGNA 1FIAA 4C3JJ 2QQ8A 5GTHC 4A3EJ 2QBYB 1HKTA 1B4AA 2AS5F 4Y52J 1FYKA 1Z77A 2KDZA 1YFHA 2TRTA 3QQAA 2JUCA 4KYWA 4HNTA 4ZDPA 1QZZA 4ZJZA 2L9NA 1E17A 2VXZA 4JX5A 1YITI 1ZH5A 4XKCA 4NB5A 2W4SA 1LEAA 3T5XA 1H9GA 2M9HA 1TWFJ 3U1DA 1W7PB 2XRLA 2EB7A 3H36A 1D8KA 3L2WA 2L9RA 4ZC3A 4FT8A 2HZTA 4HEA2 2WAQA 2PJRB 4OIQF 2EV6A 2Q2EB 2OC6A 3GMEA 2DMQA 4JK1X 4JP0A 1TQPA 1I6HJ 3BJ6A 4EQQA 1E3HA 1K79A 3ZR8X 3WE3A 1QVUA 2WAFA 1Z1DA 2XHKA 4CH7A 2EH3A 2DMNA 3TMOA 2R7XA 4XIDA 4QPOA 4MTEA 4KMUX 1EA3A 1ZGAA 2PG4A 1K61A 4MQVA 3WU2C 3I59A 1ZGWA 1JKPC 1S29A 1BL0A 2OU2A 2K4JA 3D0SA 5E8IA 5DUIA 2K86A 3DPLC 1VQMI 1C0WA 2VODA 4EM2A 3ZMUA 4KN4X 2M45A 5CJ9A 1HDPA 1CQTA 3DF8A 5AONA 5CVIA 3UNGC 1R4NB 5FROA 1DPRA 1DQUA 5J8CA 3KLNA 3KP4A 1FOXA 3AG2H 1YRNB 1CF7A 1WJFA 1VQ4I 1SD4A 4CICA 5M5XJ 1XCVA 1UB9A 4A0ZA 5K7FA 4WXCA 4RS8A 3GTPJ 2IA0A 4Z6YA 5ED4A 4UVAA 4XKWA 4D1QA 4OIPF 3VWBA 4IEJA 1WSUA 3K1MA 3RKYA 1LB2A 4BQNA 2YX4A 4EM0B 5C3EJ 4KIFA 3BC8A 2NYXA 3SFIA 2LRDA 2YPRA 2VKHA 2VJIA 3BG9A 2F5CA 4KJZA 4MTDA 3CC4I 1ON1A 2E1OA 2HXOA 1MJ9A 1I5ZA 2OA4A 2P5LC 3SYTA 4S05A 3CJRB 5HLIA 1ZR2A 2HI3A 2JZYA 3WE2A 2JWTA 3BG7A 3IP4B 3CJNA 3F8CA 2E34A 2HOEA 2M5WA 1BIAA 2Q1ZB 4U88A 3W2WA 5J8FA 2W48A 3LA7A 3VYTB 4MEXF 2QF7A 3ABMH 3O2PE 3R6SA 1ZLKA 2DPDA 2YU9J 2W25A 3L2QA 1Z91A 3GF2A 3M1CA 1MZBA 2X0LA 5CQGA 3H5RA 4C2TA 1NK2P 3OS0A 1ETWA 1FC3A 2KJCA 3GWZA 2Y0SA 2O61A 3J81Z 4EATA 5H2FC 4KUMA 3SEZA 4IOCF 1GXQA 2JMWA 2ACJA 1SD6A 2X85A 3I0TA 4LIVA 4IX7A 2XGCA 3ROUA 5DTDA 2ZBKA 4HBLA 2G7UA 2VBXA 4RLFA 2F6CA 2LSOA 3DFGA 1A5JA 5CPRB 3ZQHA 1ZQ3P 4KFCA 2CUZA 2CQ7A 1A31A 4M9ZA 1ETYA 3FHZA 3A0HC 3K4JA 3TOBA 2GXGA 4FTHA 2W84A 1KZHA 2M3AA 3IH4A 4RAFA 4M74A 3I55I 5TISC 2JA8J 3IKVA 2R5ZA 2KMUA 3F8MA 3O3KA 3Q3SA 3M8FA 5E1WA 1H88C 5CYVA 4M72A 1FZPB 2V9PA 1G2HA 2K85A 3V7CA 3K4NA 4IPAA 4Y17A 3L9FA 1POGA 4UB6C 4EEFG 5LFAA 5DCFA 3P9CA 3FDYA 1GVJA 2BY3A 1BI2A 5HLTA 3WHBA 2KIUA 5K7HA 5EZHA 2VC1A 4L9NA 2L7KA 1UG0A 4CZZA 2CSOA 4ENMA 4J00A 1RR8C 1UHWA 5JLWA 3LSKA 3EPZA 3JRIA 3ZMVA 3K9TA 3WGGA 5B1AH 2Y0MA 4DZJA 3ZCOA 3CTAA 1ORKA 2JSPA 3PQKA 5F0CA 1AU7A 3QODA 4IQ4A 4HA8A 4XKVA 5FKKA 4ENNA 1KQ8A 2Y9ZA 1U2WA 3V4GA 4EGZA 4XBFA 2AXLA 4HDVA 3QPSA 1IDYA 3FXUA 2F2EA 5DM6F 1I50J 2VOOA 4G7ZF 1R49A 2BV6A 3DU5A 3AAFA 3NEUA 2OBPA 3E7LA 4LLGF 1MNMC 4I02A 5L3EA 3RPUD 4IHTA 1ZRDA 3CF5F 2HTJA 4A3JJ 3E6DA 4A3GJ 1WZ2A 1MMDA 3R61A 5JI6A 3HGYA 3E5XA 2CG4A 2LY1A 1Y39A 2X4HA 3J80K 5F08A 2R7QA 1MNDA 3OY9A 1ZYRF 2DK8A 5CKTA 2DDBA 1Y6IA 2VJJA 1JHFA 1JGGA 3OYIA 2XDVA 4EGYA 1ENHA 4G8XA 1RUNA 2LNBA 4PK4A 5FGMA 5DM7F 1F36A 3FK7A 2IS2A 1OMIA 3K4MA 3EUHC 2KKOA 4HF0A 3MKWB 5L3CA 4H0EA 1IC8A 1KU7A 2EIMH 2LK2A 3KIOA 5EEAA 4BDYA 2QVOA 1UHSA 2ZO4A 3M8EA 3S15J 2E5NA 1LNWA 2M4GA 4FASD 4LG0B 2YR2A 5CVUA 3LSGA 2VKVA 4XRFA 1KQ0A 4F52A 3QPTA 3JRBA 2VBZA 2DFHA 1R5ID 3QOEA 4X6AJ 2AHQA 3IKTA 1W36C 3FKJA 1AKHB 4QLCU 4BYYA 2ZMEC 3R60A 2OQRA 2KHMA 1R36A 5HS8A 3BZCA 3DTIA 2QBYA 1MGTA 2M34A 2EIKH 2OAZA 4KITB 4PUSA 5KNLA 2LD5A 3G2BA 4OIOF 2R7ZJ 4CCNA 1W5SA 4KDPA 3RI4A 3F8BA 4DBQA 1LJ9A 1Z7UA 2XAFA 1K83J 4LLLA 4WWCA 1U8BA 1AOYA 4FISA 3AFHA 1FEXA 2A05A 2V9KA 1W7PA 5EG0A 3OR2C 2R92J 1QQIA 2FQ4A 4RM3A 1WGXA 2EINH 2F4IA 4BE1A 1V55H 1R9TJ 4HPQA 4BJTA 3TL4X 4HYEA 2CYYA 2LFBA 4CSWA 3CMAI 3AL0B 1ZRCA 1S7OA 3QWLA 3IWFA 1SC7A 1RESA 4U87A 1Z7LA 4Z2YA 2EK5A 4YIFA 1B72B 1R5HA 2IAIA 2XPWA 1T0FA 2HOAA 2RQPA 4E70A 3IRQA 4P55A 1YI2I 2XV4S 4ESJA 2B7EA 1EH7A 1REPC 4JQFA 4RAZA 2D1HA 2E2JJ 2HEOA 1VNDA 2BYVE 3MN2A 5M3MJ 4EJWA 4HRIA 4MEYF 1B9NA 3ASOH 4XKBA 4BU2A 2HNHA 4Q48A 2EIJH 3F8NA 2DI3A 4P1WA 2V79A 4A5MA 2ECCA 1HLVA 1ZAOA 2KL4A 2PEXA 3KYCB 2E2HJ 2P6TA 4HSTA 5D4RA 2WA0A 2WADA 4L18B 2DA3A 4WX9A 4MIMA 4G6QA 3P9KA 5D6FA 5FFZA 4C3HJ 5LLQA 1YRNA 2KPMA 4XORA 1ZGJA 3DTEA 4RM2A 4KIGA 3WTXC 2VPLA 4C2MJ 1MBJA 3JREA 3WTUC 3PUFA 2NNNA 1LDKB 2ZJPF 2X1EA 1R1TA 3I56I 1ERDA 2UXXA 1U5TC 2EA4A 4I2OA 1XDSA 1FJLA 1PDNC 1U3EM 3A03A 1FBQA 2Y30A 2KIMA 1BR1A 5E3LA 4M73A 1KU9A 2VB6A 3HZJA 2OV7A 2HOSA 5E17F 4KIBA 3BQYA 3FX3A 1SFOJ 2K9SA 3A01A 2P5KA 1Z3XA 2MYSA 3VYRB 3K10A 3RTRA 2FEZA 4AIJA 3GYHX 3MKYB 2HZDA 2F48A 3TGNA 1WRJA 4DYQA 2K7LA 1BN5A 5F0HA 5E3NA 4GGGA 2L3DA 4PGGA 5H6RA 2NVTJ 1NG6A 3FBNB 5HNHA 2XGXA 1P92A 2FJ1A 1IO2A 3S32A 4K2EA 1U78A 2FQ3A 5FD5A 2M87A 2D1VA 3ABTA 3NRVA 2QLZA 4M6XA 1G4DA 2GOMA 3BROA 3LNQA 2DO7A 2QA4I 1YIOA 2KRCA 4LIUA 5ICFA 4EMSA 1OCPA 3OYBA 2FX0A 1JT6A 3F8FA 1W0TA 1YX5A 4RAGA 2CRGA 2RQQA 1BI3A 4YIIA 3C2GA 2UUZA 2WWYA 4FCYA 4AIDA 3S1NJ 2B63J 3HHHA 4HSRA 2CV0A 3I4NJ 4HW0A 3WODF 3TOAA 3VB2A 2IGOA 1JUSA 4DOZA 1O7FA 2RKHA 1FIPA 4WK8F 1HCRA 3S1QJ 4XM3A 3EDPA 1O3RA 1Q1HA 1QGPA 1ZKGA 2V6EA 3L7WA 3KX2A 4KT5C 1P4AA 4BHPA 5M3FJ 1O4XA 1BW6A 2RGVA 1YIJI 1J9IA 5IT9K 3GTKJ 1TW3A 2IW5A 2V4JC 2XF5A 1HW5A 2YU3A 4OINF 2R4GA 3VDXA 2ZJQF 2MH2A 3CDHA 3I4PA 1YS6A 2BOLA 2EFNA 3QPHA 1B8IB 5CQEA 5FLXZ 4KA4A 1DPUA 4IHYA 5ERIA 3WTTC 2MW8A 1HC8A 4X1EA 5GADJ 2PFBA 1QZYA 1WJDA 1OCZH 2UWMA 2FA5A 1LEBA 4P9UA 4LOCA 1S7EA 1E0EA 3PL8A 4PJJA 4XN0A 1Z67A 3QYEA 4PGHA 3DP7A 1GV2A 3K4KA 1Z21A 1ULYA 2IJLA 4AVPA 2OCCH 2V1XA 3QP5A 2XKOA 3PO3J 1OPCA 3LWFA 4E7IA 1G3WA 5D5XB 2HPMA 2LTPA 2XKPA 1TT5B 1JXSA 2DA4A 1X3UA 3DV8A 3IV5A 2QGUA 4A3KJ 3CF2A 3BQZA 2UZKA 5BMZA 2HVQA 2LP0A 3KZIC 3E6BA 3N97A 5EYRA 5TJJA 1BBYA 5E1XA 1SD5A 3FK6A 3S14J 1B59A 3ABLH 3BOQA 3VFZA 4R8HA 1WCMJ 4W1UA 5CVVA 4OOIA 5B3SH 4HV6A 2AQFA 5FKLA 4Y3OA 5FKOA 4RB1A 2HYJA 3M7GA 4G7OF 3VODA 1YS7A 4FX4A 4IRIA 1XMXA 1TC3C 1TT0A 2R93J 4UUSB 3JW4A 3JRGA 3HPHA 1HW1A 4AC0A 4BBSJ 2P7VB 4PDKA 5K5QA 3H3UA 3RSNA 3LA2A 2XAGA 4IVNA 4E7SA 5L3DA 3G1LA 3HJEA 3F72A 1D5YA 1XSVA 1F43A 3GBGA 1A36A 1WFXA 3OIQA 5JLXA 3MVPA 4L5IA 2MC3A 1XMKA 3CCVI 4A6DA 2VT2A 1OCOH 2VOPA 2FBKA 4NNJA 4PZJA 1USTA 2R7SA 2NVXJ 3ML6A 3QYFA 2WC2A 2X6YA 4MLOA 5LBQA 4O6JA 3L09A 3OIOA 2CU7A 2IBDA 1WJCA 4UV9A 5LD2C 1RZ4A 1SD7A 4I0AA 1G59A 4DZPA 3DTKA 4I98B 3RDIA 1LQ1A 1RUOA 1EH8A 3DCFA 1QU3A 2XGEA 2CGPA 3JRAA 4OAZA 1A35A 1F5TA 1OJLA 3MQ0A 4E7KA 1J2XA 2L4MA 4A5NA 3HTSB 2ZMEB 1DDNA 2OZ6A 2KRHA 1X1CA 3TW6A 4AD9A 3BTLA 1BI0A 2XB0X 4UVBA 2HR3A 2Y69H 3FXKA 2H6BA 4N9HA 2ESNA 3D5SC 1A04A 2LF7A 4ZYDA 2K3PA 1JGSA 1VQ9I 1MBHA 2PBIA 2OUMA 2CWEA 1X3ZB 4U7BA 2VQGA 2LLKA 4NQWA 3W2AA 2EILH 2V1UA 1U6GA 2D2WA 2L54A 3COAC 3ZQLA 2DFFA 2DODA 2E1MC 3G71I 4XLAA 4WXHA 3RZDJ 4MGRA 2EFQA 4RMNA 4Q4ZF 1T2KA 2JN6A 1IDZA 1DUXC 5B66C 2LY9A 3OIPA 2ZXJA 2LKXA 3SJMA 2EBIA 3DU6A 1BOAA 3A4CA 3PNTA 4HF2A 2OZUA 4EJTA 1JKOC 2EV5A 1WWXA 4II2A 4HQMA 2VKEA 2COBA 5KK1A 2DMPA 2Y48A 3ASNH 1S6LA 3L1PA 1SANA 1XGMA 1WI3A 1HOMA 5LGTA 3OYJA 4V19K 1IJWC 4E7LA 1FPQA 2VXDA 4Y15A 3TDZC 3JR9A 1P9QC 5D5UB 3K69A 2GLOA 4HLXA 2WAEA 2XAJA 4XLPF 4YG2F 1KU2A 1I3QJ 3FXQA 2HVRA 3M9AA 2LKPA 3NAUA 5HDKA 2DJNA 2L9VA 5EEHA 2ZXIA 4N4NB 2NAZA 4B3AA 5FO5A 2FOKA 1OYYA 3IAS2 4BXUA 3BR5A 3KZYA 3F0CA 1NH3A 2RNGA 2A69F 3S16J 1XGSA 2WB1A 4XLNF 1Y1WJ 5FRMA 4A93J 2MBFA 4BQAA 4I76A 2K40A 1ETKA 1U5TB 2W82A 2P0WA 1IV6A 3GTMJ 3CLOA 3DEEA 4IF4A 5J6XA 3Q0UA 1LVAA 4U0YA 3S3OA 2BVLA 3GZ5A 3HEFA 2VE9A 2LBFA 2WY8Q 1R00A 5L3GA 3ZMTA 4B1RA 3MWMA 2JTVA 1TQIA 3BT9A 4XRMA 4ITVA 1ETXA 4F92B 2EPFA 1X2NA 3S8PA 4UUTA 3CUOA 2L4AA 2QSGX 3HRMA 3FXJA 3L00A 2HDWA 2H94A 4CCJA 3J80Z 2ZJRF 1TWHJ 2F5EA 4XSXF 1MMSA 1S8NA 4HX7A 2CJJA 2O9LA 4PCQA 1TP4A 2GAUA 2FMYA 1IN7A 4G94A 4NBQA 1T39A 2R5YB 2E36A 1BM9A 1OKRA 3C2BA 4ENJA 1ZTRA 2BY2A 1XG1A 3IAM2 3BJAA 3WGHA 4XLFA 5GAHJ 3CCRI 4A3LJ 1VQ5I 1SFXA 1KYWA 1S7AA 2WAQN 3RYRA 3ZQIA 4XRSA 1QPIA 3ERED 2VJ4A 2PMHA 1H89C 3ISPA 3KFWX 4RGRA 1BIBA 4BXFA 2E35A 2LYCA 1D1AA 2XF7A 3QPLA 1X1AA 2W1OA 2V1NA 1JUMA 5DCMB 5FLMJ 5LEJA 2MLKA 2PMUA
chains in the Genus database with same CATH topology
2ZNYA 1R22A 1KYZA 4L5JA 3GFIA 2P7CB 3JAMK 1QO0D 2HQNA 4UHTA 1XN7A 1ODDA 3HTUA 3FF5A 1IZ1A 2QQAA 4UVCA 1XMAA 2Q0OA 4L9JA 3IL2A 1D8JA 3GX4X 3CUQA 1FYLA 1IXRC 1IUYA 1K6OA 4WF2A 3QU6A 1Z9CA 1XGOA 4EJUA 2HYGD 3DKWA 1SFEA 2K4BA 3JSPA 2P4WA 4BNCA 4DQ2A 2KRFA 1PP8F 1K78A 2VT3A 1P4XA 1ZREA 1CGPA 3WTSC 1HBXG 2NRAC 1G6NA 2QYOA 4IRHA 3BPVA 2DFIA 5DV5A 2R7DA 5F64A 3SZPA 1LDDA 2MD5A 3HYIA 4HLYA 3HRSA 3FXRA 2GXBA 4LK0F 3L2CA 1R7JA 1FP2A 1HXDA 2Z99A 5HDNA 1MJBA 1EV7A 3T0YA 2CQKA 1RI7A 1B1BA 2Y75A 2HQRA 3E6MA 2E7WA 3GW2A 3M1EA 2IPQX 5CLSA 2ADUA 3I53A 1D3YA 1GXPA 2ESHA 3QU3A 4G9YA 1O3QA 1HSTA 2CW0F 1QPMA 5DUKA 1IXCA 4M71A 1STZA 2DLLA 3FZVA 4EJOA 1G3SA 3LQRA 3DQVC 2QENA 3HRTA 4BHCA 1TQMA 4RGSA 3LA3A 4O5VA 3F3XA 5F1RA 2HKXA 1ZN2A 5JVTA 5IT9Z 2XIGA 4LD5A 4LJZF 1MKMA 5D4SA 2VC0A 3T8TA 1FT9A 2XROA 2Q2EA 2IVMA 3FMRA 2Z33A 4UUVA 5ILSA 5IT3A 2QQBA 1FBSA 2XASA 4LB6B 1E2XA 1S3JA 2BEOA 4HV5A 2EFPA 5D8KB 1J0RA 4RB2C 5ICEA 1H0MA 2FRHA 3ZMSA 5A2QZ 4RAYA 2LF8A 3LAPA 3GFMA 1BJAA 5LRRA 4ON0A 4I0BA 3BJOA 1ZLJA 5CVRA 1ZG1A 4MHGA 5DDGA 1IXSB 4ETSA 4R79A 5E18F 2STTA 3I5UA 1IN5A 2DQLA 1HKQA 4KNYA 1K7AA 3HIFA 3KZZA 4YFKF 1QNTA 4A6EA 4HOBA 2STWA 5DD4A 5LHHA 2W57A 3KP7A 4EJVA 5HS9A 1KGSA 1I1SA 5DCMA 2H09A 2MA3A 2Z5UA 4N0BA 1U8RA 3EYIA 2VBWA 3TO6A 3GEZA 1O57A 1WQ2A 3TO9A 2H6CA 1Y0UA 4Q5SF 1NHAA 2HFHA 4A12A 1P6RA 4Y13A 3EYYA 4GCVA 1CF7B 1OYWA 3CO7C 4F7ZA 4JBAA 1XGNA 2GWRA 3ABUA 1ZG5A 3IHUA 3TQNA 1TLHB 1RIOH 3W6KB 4HDUA 2A6EF 5D8LB 3KP5A 3B73A 5HOOA 4EV0A 3KP6A 4NHJA 5HS7A 2P6SA 4WXDA 1FLIA 4CDGA 1TW2A 4LFUA 4RGUA 3K0LA 1R5GA 3H92A 4L9TA 2ELHA 4ZYGA 3E6CC 2JPBA 3E5UA 1FX7A 2F5FA 1IN8A 2M30A 4GYIA 1YYVA 3TKYA 4ENKA 2A5YB 4BAYA 1SMYF 1XB4A 3SXYA 1XCBA 2FE3A 3BP8A 1MDMB 2O3FA 3C1DA 4AIKA 2HS5A 4G7HF 3GFLA 4KN7X 3G3ZA 1FY7A 3F23A 2R3SA 4LK1F 1ONVA 4LGWA 3BZ6A 1IN4A 3F6OA 1TNTA 1R23A 4S04A 1HQCA 4M9SA 3V7SA 2EFWA 3I58A 3F22A 3J7AO 2J5PA 1MD0A 1LDJA 1YO5C 5E8GA 4FHTA 3V8LA 2FF4A 2P8TA 5AIQA 4ZH4F 2ZJ2A 3QOPA 5JR3A 4LG0A 3U9GA 1FOKA 2WTEA 5BQTA 3F6VA 1V3FA 3JTHA 3WTVC 1H9TA 1PUEE 1W4MA 3WGIA 1IF1A 2E1CA 5D6EA 2DQRA 1UFMA 1OR7A 3FWEA 1T98A 3HSFA 5K1YA 2HKOA 4UXNA 3ULQB 2PQ8A 2M8EA 1O3SA 2A68F 2QWWA 2HWVA 2QUFA 1BC7C 5TRDA 3RPUA 2QZ8A 3CO6C 2YSRA 4U0WA 4CYDA 2Z3YA 1T38A 1XSXA 3MZYA 2FBHA 4IHSA 1JE8A 2ISZA 2DT5A 3Q9SA 5FLXK 3NQOA 2G9WA 4ZYHA 5ICGA 4AIHA 4D0PA 2DPUA 5AIPA 1IAWA 2IA1A 2XVCA 5H6QA 2RC4A 4ZZDA 2GZWA 3QP6A 3W6JB 2D45A 3KCCA 2PLYA 3FM3A 4O3MA 1TTYA 4M9XA 4IXAA 2DAOA 3OV8A 3VEPA 1FSEA 2FNAA 4WCGA 3KE2A 4CXFA 1BI1A 4B8XA 1TNSA 3BY6A 4EVIA 3OOPA 5D5WB 2J5OA 1AWCA 4EM1A 1V4RA 3KEQA 5DYMA 5LGUA 3K1NA 1IN6A 5LHIA 3ECOA 1SFUA 4U0VA 2B0LA 2ZNZA 2E7XA 2A3SA 1IRFA 1QBJA 1YW8A 2DU9A 4BH9A 1WI9A 2ISYA 3F21A 2XRNA 4AWXB 2A6HF 1XD7A 3MZHA 2PJPA 1USSA 1VTNC 4OU0A 2K02A 3GUDA 2HGCA 5KVRA 4LLNA 3KEOA 2YX7A 2NNYA 4A2UA 1W5TA 3KLOA 5LRSA 2EJRA 1I6XA 4HX4A 2P5VA 2EV0A 2COMA 1YLFA 2QM3A 4RB0A 1YQAA 1ON2A 1R58A 1MDMA 1UCRA 3S2WA 4MQ9F 5L3BA 2H27A 2EWNA 5E20A 2DBBA 4IRGA 5FFXA 3KETA 1FNNA 2JSCA 5DD8A 2DTRA 4M6YA 4IJAA 3VOEA 2RNJA 2ZCWA 2V1DA 4LB5A 3RKWA 3R4KA 5HVQC 2XAQA 5CVJA 1P4WA 2PI0A 2JRTA 1OYIA 1F9NA 4OMYA 4P9FA 1FSHA 4YFXF 2XUBA 3RIRA 3HHGA 2Q8KA 3V8JA 3MEXA 3V7RA 3CUQC 1ZARA 2ZFWA 1KQ9A 1UHMA 3K2ZA 3RPQA 3GXOA 3HOTA 4DNCA 4L0ZB 4ASNA 2FNPA 1ZG3A 5BPDA 3O6BB 3EUHA 3FMSA 3ZQ7A 2OD5A 4RGXA 6PAXA 1L3LA 4TV7A 4GYGA 1F1ZA 3RJPA 3Q5FA 1KU3A 5EEGA 2ZMEA 1T6SA 2HTSA 3N4MA 3R0JA 2O6GE 3ZPLA 1J59A 1EH6A 3T1BA 3TO7A 5K5OA 3MFKA 2PN6A 1ZHFA 4HF1A 2G7HA 3EETA 4R1HA 4QWQA 1J75A 3ZN0A 1FWZA 5LGNA 1R1VA 1YTYA 4YFNF 2FMLA 1GHCA 5FB2A 2TDXA 4OMZA 3WU1B 3D5LA 2EA2A 2F5DA 1TBXA 3K1PA 4I09A 1WKMA 3KP2A 4L9VA 3GFJA 1MJAA 2HDCA 3SHFA 2W85A 1HW2A 4I01A 3LFKA 4HX8A 3J81K 1SMTA 2IRFG 2L01A 4U7DA 1RNLA 2VBYA 2CO5A 4HAMA 2RVCA 3MAJA 2GA1A 5F6FA 5FD6A 1I27A 1J7KA 3PFIA 5JHUA 2KJBA 3LAJA 1U5TA 3REOA 2LDUA 3JSOA 4P96A 5BS6A 2K27A 1FYMA 4HQEA 2WV0A 2CFXA 3RYPA 4A0YA 2E1NA 1B9MA 2RV8A 3HSEA 5D5VB 4Q47A 2XAHA 5E1ZB 1BC8C 2VONA 2JPCA 3KP3A 1YW9A 1SAXA 3SZTA 3ZP5A 2DW4A 2FXAA 2JT1A 1FP1D 3WTZA 2IP2A 2VN2A 3BPXA 1Z6RA 3SFZA 3WU0A 3I59B 3DEUA 2R7FA 1HSJA 4A0XA 2C6YA 3SQNA 1O3TA 5LHGA 1D5VA 4KMFA 3GVAA 4LMYA 3ZMZA 3QAHA 4RB3C 3ECHA 4ZYEA 4CO8A 2ETHA 3DXJF 2A61A 1P2FA 2HYFA 2L02A 4G6DA 4MNUA 2O8XA 2BGCA 3IRRA 2BE5F 3BWGA 1HKSA 4ESFA 3IC7A 2QQ9A 3I54A 3HUGA 3C3WA 2RN7A 3H3ZA 1G3YA 3MCZA 4ESBA 4KICA 3IWZA 1Z6TA 2GIVA 5HLGA 1KA8A 1XSDA 3ZMDA 4HZFA 5L3FA 2IT0A 5HDGA 5H20A 3RKXA 3Q9VA 3V8KA 2V6CA 2V9VA 2MLGA 2FBIA 4GO1A 1JHHA 2EFOA 4XSZF 3WTWC 3I71A 3P9IA 2BBYA 1XDUA 1ZRFA 4FX0A 3PQJA 3LSTA 5BOXA 3JTGA 2O0YA 3R0AA 3CUQB 4CGZA 1R1UA 5ILVA 3C18A 1B6AA 5LEKA 3DPTA 2FSWA 1I1GA 5A2QK 2UXNA 5JFRA 3E97A 2NS0A 2MH9A 2DK5A 1YG2A 2Z9OA 4L0YB 3E5QA 1K78B 2IA2A 3GO5A 3LQQA 4ZZLA 3P7NA 4OIRF 2W24A 3GLXA 1IRGA 5BPIA 5ICCA 3GZ6A 3EQLF 5DEQA 2VE8A 4UNOA 1W7PD 2A07F 5HLHA 4B09A 1YW7A 4GXOA 3HRUA 2GA2A 3E3VA 2O03A 4CHUA 3ELKA 3T8RA 4N9IA 3C7JA 3U2RA 2KIFA 3FMQA 1DP7P 3FM5A 4P5OA 2FU4A 1PP7U 2ZKZA 1F4KA 3G73A 1L0OC 1IW7F 1FBUA 3JAMZ 3HSRA 5ILUA 3QRFF 4BHBA 2M1BA 4UV8A 2GQQA 3WG9A 4I7HA 1Z05A 2RDPA 3BDDA 3B02A 3HOSA 1J5YA 3TDUC 2OQGA 5K5RA 1O7LA 1G3TA 3I64A 3WTYC 3ZN1A 2QBYB 1HKTA 1B4AA 2AS5F 1FYKA 1YFHA 4KYWA 1QZZA 1E17A 2VXZA 1ZH5A 4NB5A 1LEAA 3T5XA 1H9GA 3U1DA 1W7PB 2EB7A 1D8KA 4FT8A 2HZTA 4OIQF 2EV6A 4JK1X 1TQPA 3BJ6A 4EQQA 1K79A 3WE3A 2XHKA 1Z1DA 4MTEA 4KMUX 1ZGAA 2PG4A 4MQVA 3I59A 1S29A 2OU2A 2K4JA 3D0SA 5E8IA 5DUIA 2K86A 3DPLC 1C0WA 2VODA 4EM2A 3ZMUA 4KN4X 2M45A 5CJ9A 3DF8A 5AONA 5CVIA 1DPRA 5J8CA 3KLNA 3KP4A 1CF7A 1SD4A 4CICA 1XCVA 1UB9A 4A0ZA 4WXCA 4RS8A 2IA0A 5ED4A 4UVAA 4OIPF 1WSUA 3K1MA 3RKYA 1LB2A 2YX4A 4EM0B 4KIFA 2NYXA 2YPRA 2F5CA 4MTDA 1ON1A 1MJ9A 1I5ZA 2OA4A 2P5LC 4S05A 5HLIA 2JZYA 3WE2A 3CJNA 3F8CA 2HOEA 2M5WA 1BIAA 4U88A 5J8FA 3LA7A 4MEXF 3O2PE 3R6SA 1ZLKA 2DPDA 2W25A 1Z91A 3GF2A 1MZBA 2X0LA 1FC3A 2KJCA 3GWZA 2O61A 3J81Z 4KUMA 1GXQA 2ACJA 1SD6A 3I0TA 3ROUA 2ZBKA 4HBLA 2G7UA 2VBXA 2LSOA 3DFGA 4KFCA 4M9ZA 3FHZA 3TOBA 2GXGA 2W84A 4M74A 3IKVA 3F8MA 3O3KA 3M8FA 5E1WA 5CYVA 4M72A 1FZPB 3V7CA 4IPAA 4Y17A 3L9FA 5DCFA 3P9CA 1GVJA 1BI2A 2KIUA 2VC1A 4L9NA 4CZZA 2CSOA 4ENMA 1UHWA 3ZMVA 3K9TA 3WGGA 2Y0MA 3CTAA 3PQKA 4HA8A 4ENNA 1KQ8A 1U2WA 3V4GA 4EGZA 4XBFA 2AXLA 4HDVA 3FXUA 2F2EA 2VOOA 4G7ZF 2BV6A 3AAFA 3NEUA 2OBPA 4LLGF 4I02A 5L3EA 4IHTA 1ZRDA 2HTJA 3E6DA 3R61A 5JI6A 3E5XA 2CG4A 2X4HA 3J80K 1ZYRF 2DK8A 1JHFA 4EGYA 4G8XA 1RUNA 2LNBA 5FGMA 1OMIA 2KKOA 4HF0A 4H0EA 5L3CA 1KU7A 2QVOA 2ZO4A 3M8EA 1LNWA 4LG0B 2YR2A 5CVUA 4XRFA 1KQ0A 3QPTA 2VBZA 3IKTA 4QLCU 4BYYA 3R60A 2OQRA 1R36A 5HS8A 2QBYA 1MGTA 2OAZA 4OIOF 1W5SA 4KDPA 3RI4A 3F8BA 1LJ9A 1Z7UA 2XAFA 4LLLA 4WWCA 1AOYA 1W7PA 1QQIA 4HYEA 2CYYA 1ZRCA 1S7OA 3IWFA 4Z2YA 2EK5A 4YIFA 1R5HA 1T0FA 2RQPA 4E70A 3IRQA 4P55A 2XV4S 4ESJA 1EH7A 1REPC 4JQFA 4RAZA 2D1HA 2HEOA 2BYVE 4EJWA 4MEYF 1B9NA 4Q48A 3F8NA 2DI3A 2V79A 4A5MA 1ZAOA 2PEXA 2P6TA 5D4RA 4L18B 4WX9A 4G6QA 3P9KA 5D6FA 5FFZA 5LLQA 1ZGJA 4KIGA 3WTXC 3WTUC 2NNNA 1LDKB 1R1TA 2UXXA 1U5TC 2EA4A 4I2OA 1XDSA 1PDNC 1U3EM 1FBQA 2KIMA 4M73A 1KU9A 5E17F 4KIBA 3FX3A 2P5KA 3RTRA 2FEZA 4AIJA 3GYHX 3TGNA 1WRJA 2K7LA 1BN5A 4GGGA 2L3DA 4PGGA 5H6RA 2XGXA 1P92A 4K2EA 1U78A 2FQ3A 5FD5A 2M87A 2D1VA 3ABTA 3NRVA 2QLZA 4M6XA 1G4DA 3BROA 2DO7A 1YIOA 5ICFA 4EMSA 3F8FA 1BI3A 4YIIA 2WWYA 3HHHA 4HW0A 3WODF 3TOAA 3VB2A 4WK8F 1O7FA 2RKHA 3EDPA 1O3RA 1Q1HA 1QGPA 3L7WA 4KT5C 1P4AA 4BHPA 2RGVA 1J9IA 5IT9K 1TW3A 2IW5A 1HW5A 2YU3A 4OINF 2MH2A 3CDHA 3I4PA 1YS6A 3QPHA 2EFNA 4KA4A 5FLXZ 1DPUA 5ERIA 3WTTC 2PFBA 1QZYA 2UWMA 2FA5A 1LEBA 4P9UA 4PGHA 3DP7A 1ULYA 2IJLA 4AVPA 2V1XA 3QP5A 2XKOA 1OPCA 3LWFA 1G3WA 5D5XB 2XKPA 1JXSA 1X3UA 3DV8A 2UZKA 5BMZA 3E6BA 3N97A 5TJJA 1BBYA 5E1XA 1SD5A 1B59A 3BOQA 3VFZA 4R8HA 5CVVA 4OOIA 4HV6A 4RB1A 3M7GA 4G7OF 3VODA 1YS7A 4FX4A 4IRIA 3JW4A 1HW1A 2P7VB 4PDKA 5K5QA 3H3UA 3LA2A 2XAGA 4IVNA 5L3DA 3F72A 1XSVA 4L5IA 2MC3A 1XMKA 4A6DA 2VT2A 2VOPA 2FBKA 4PZJA 1USTA 3ML6A 2WC2A 5LBQA 4O6JA 3L09A 4UV9A 1RZ4A 1SD7A 4I0AA 4I98B 3RDIA 1LQ1A 1RUOA 1EH8A 2CGPA 1F5TA 3MQ0A 1J2XA 2L4MA 4A5NA 3HTSB 2ZMEB 1DDNA 2OZ6A 4AD9A 1BI0A 4UVBA 2HR3A 2H6BA 4N9HA 2ESNA 1A04A 2LF7A 4ZYDA 1JGSA 2PBIA 2CWEA 4U7BA 4NQWA 2V1UA 3COAC 1U6GA 2D2WA 2L54A 4WXHA 4MGRA 2EFQA 4Q4ZF 1T2KA 1DUXC 2ZXJA 1BOAA 4HF2A 2OZUA 4EJTA 2EV5A 1WWXA 4HQMA 5KK1A 2Y48A 1S6LA 1XGMA 5LGTA 1FPQA 4Y15A 3TDZC 5D5UB 3K69A 4HLXA 2XAJA 4XLPF 4YG2F 1KU2A 3FXQA 3M9AA 2LKPA 5HDKA 5EEHA 2NAZA 5FO5A 2FOKA 1OYYA 4BXUA 3KZYA 2A69F 1XGSA 4XLNF 2MBFA 4BQAA 1U5TB 3CLOA 4IF4A 5J6XA 4U0YA 1LVAA 3GZ5A 2VE9A 1R00A 5L3GA 3ZMTA 3MWMA 2JTVA 1TQIA 3CUOA 2L4AA 3HRMA 3L00A 2H94A 3J80Z 2F5EA 4XSXF 1S8NA 4HX7A 4PCQA 2GAUA 2FMYA 1IN7A 4G94A 1T39A 1BM9A 1OKRA 4ENJA 3WGHA 3BJAA 1SFXA 1KYWA 1S7AA 3RYRA 3ERED 2PMHA 3ISPA 3KFWX 4RGRA 1BIBA 5DCMB 5LEJA 2MLKA 2PMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNY A;  1R22 A;  1KYZ A;  4L5J A;  3GFI A;  2P7C B;  3JAM K;  1QO0 D;  2HQN A;  4UHT A;  1XN7 A;  1ODD A;  3HTU A;  3FF5 A;  1IZ1 A;  2QQA A;  4UVC A;  1XMA A;  2Q0O A;  4L9J A;  3IL2 A;  1D8J A;  3GX4 X;  3CUQ A;  1FYL A;  1IXR C;  1IUY A;  1K6O A;  4WF2 A;  3QU6 A;  1Z9C A;  1XGO A;  4EJU A;  2HYG D;  3DKW A;  1SFE A;  2K4B A;  3JSP A;  2P4W A;  4BNC A;  4DQ2 A;  2KRF A;  1PP8 F;  1K78 A;  2VT3 A;  1P4X A;  1ZRE A;  1CGP A;  3WTS C;  1HBX G;  2NRA C;  1G6N A;  2QYO A;  4IRH A;  3BPV A;  2DFI A;  5DV5 A;  2R7D A;  5F64 A;  3SZP A;  1LDD A;  2MD5 A;  3HYI A;  4HLY A;  3HRS A;  3FXR A;  2GXB A;  4LK0 F;  3L2C A;  1R7J A;  1FP2 A;  1HXD A;  2Z99 A;  5HDN A;  1MJB A;  1EV7 A;  3T0Y A;  2CQK A;  1RI7 A;  1B1B A;  2Y75 A;  2HQR A;  3E6M A;  2E7W A;  3GW2 A;  3M1E A;  2IPQ X;  5CLS A;  2ADU A;  3I53 A;  1D3Y A;  1GXP A;  2ESH A;  3QU3 A;  4G9Y A;  1O3Q A;  1HST A;  2CW0 F;  1QPM A;  5DUK A;  1IXC A;  4M71 A;  1STZ A;  2DLL A;  3FZV A;  4EJO A;  1G3S A;  3LQR A;  3DQV C;  2QEN A;  3HRT A;  4BHC A;  1TQM A;  4RGS A;  3LA3 A;  4O5V A;  3F3X A;  5F1R A;  2HKX A;  1ZN2 A;  5JVT A;  5IT9 Z;  2XIG A;  4LD5 A;  4LJZ F;  1MKM A;  5D4S A;  2VC0 A;  3T8T A;  1FT9 A;  2XRO A;  2Q2E A;  2IVM A;  3FMR A;  2Z33 A;  4UUV A;  5ILS A;  5IT3 A;  2QQB A;  1FBS A;  2XAS A;  4LB6 B;  1E2X A;  1S3J A;  2BEO A;  4HV5 A;  2EFP A;  5D8K B;  1J0R A;  4RB2 C;  5ICE A;  1H0M A;  2FRH A;  3ZMS A;  5A2Q Z;  4RAY A;  2LF8 A;  3LAP A;  3GFM A;  1BJA A;  5LRR A;  4ON0 A;  4I0B A;  3BJO A;  1ZLJ A;  5CVR A;  1ZG1 A;  4MHG A;  5DDG A;  1IXS B;  4ETS A;  4R79 A;  5E18 F;  2STT A;  3I5U A;  1IN5 A;  2DQL A;  1HKQ A;  4KNY A;  1K7A A;  3HIF A;  3KZZ A;  4YFK F;  1QNT A;  4A6E A;  4HOB A;  2STW A;  5DD4 A;  5LHH A;  2W57 A;  3KP7 A;  4EJV A;  5HS9 A;  1KGS A;  1I1S A;  5DCM A;  2H09 A;  2MA3 A;  2Z5U A;  4N0B A;  1U8R A;  3EYI A;  2VBW A;  3TO6 A;  3GEZ A;  1O57 A;  1WQ2 A;  3TO9 A;  2H6C A;  1Y0U A;  4Q5S F;  1NHA A;  2HFH A;  4A12 A;  1P6R A;  4Y13 A;  3EYY A;  4GCV A;  1CF7 B;  1OYW A;  3CO7 C;  4F7Z A;  4JBA A;  1XGN A;  2GWR A;  3ABU A;  1ZG5 A;  3IHU A;  3TQN A;  1TLH B;  1RIO H;  3W6K B;  4HDU A;  2A6E F;  5D8L B;  3KP5 A;  3B73 A;  5HOO A;  4EV0 A;  3KP6 A;  4NHJ A;  5HS7 A;  2P6S A;  4WXD A;  1FLI A;  4CDG A;  1TW2 A;  4LFU A;  4RGU A;  3K0L A;  1R5G A;  3H92 A;  4L9T A;  2ELH A;  4ZYG A;  3E6C C;  2JPB A;  3E5U A;  1FX7 A;  2F5F A;  1IN8 A;  2M30 A;  4GYI A;  1YYV A;  3TKY A;  4ENK A;  2A5Y B;  4BAY A;  1SMY F;  1XB4 A;  3SXY A;  1XCB A;  2FE3 A;  3BP8 A;  1MDM B;  2O3F A;  3C1D A;  4AIK A;  2HS5 A;  4G7H F;  3GFL A;  4KN7 X;  3G3Z A;  1FY7 A;  3F23 A;  2R3S A;  4LK1 F;  1ONV A;  4LGW A;  3BZ6 A;  1IN4 A;  3F6O A;  1TNT A;  1R23 A;  4S04 A;  1HQC A;  4M9S A;  3V7S A;  2EFW A;  3I58 A;  3F22 A;  3J7A O;  2J5P A;  1MD0 A;  1LDJ A;  1YO5 C;  5E8G A;  4FHT A;  3V8L A;  2FF4 A;  2P8T A;  5AIQ A;  4ZH4 F;  2ZJ2 A;  3QOP A;  5JR3 A;  4LG0 A;  3U9G A;  1FOK A;  2WTE A;  5BQT A;  3F6V A;  1V3F A;  3JTH A;  3WTV C;  1H9T A;  1PUE E;  1W4M A;  3WGI A;  1IF1 A;  2E1C A;  5D6E A;  2DQR A;  1UFM A;  1OR7 A;  3FWE A;  1T98 A;  3HSF A;  5K1Y A;  2HKO A;  4UXN A;  3ULQ B;  2PQ8 A;  2M8E A;  1O3S A;  2A68 F;  2QWW A;  2HWV A;  2QUF A;  1BC7 C;  5TRD A;  3RPU A;  2QZ8 A;  3CO6 C;  2YSR A;  4U0W A;  4CYD A;  2Z3Y A;  1T38 A;  1XSX A;  3MZY A;  2FBH A;  4IHS A;  1JE8 A;  2ISZ A;  2DT5 A;  3Q9S A;  5FLX K;  3NQO A;  2G9W A;  4ZYH A;  5ICG A;  4AIH A;  4D0P A;  2DPU A;  5AIP A;  1IAW A;  2IA1 A;  2XVC A;  5H6Q A;  2RC4 A;  4ZZD A;  2GZW A;  3QP6 A;  3W6J B;  2D45 A;  3KCC A;  2PLY A;  3FM3 A;  4O3M A;  1TTY A;  4M9X A;  4IXA A;  2DAO A;  3OV8 A;  3VEP A;  1FSE A;  2FNA A;  4WCG A;  3KE2 A;  4CXF A;  1BI1 A;  4B8X A;  1TNS A;  3BY6 A;  4EVI A;  3OOP A;  5D5W B;  2J5O A;  1AWC A;  4EM1 A;  1V4R A;  3KEQ A;  5DYM A;  5LGU A;  3K1N A;  1IN6 A;  5LHI A;  3ECO A;  1SFU A;  4U0V A;  2B0L A;  2ZNZ A;  2E7X A;  2A3S A;  1IRF A;  1QBJ A;  1YW8 A;  2DU9 A;  4BH9 A;  1WI9 A;  2ISY A;  3F21 A;  2XRN A;  4AWX B;  2A6H F;  1XD7 A;  3MZH A;  2PJP A;  1USS A;  1VTN C;  4OU0 A;  2K02 A;  3GUD A;  2HGC A;  5KVR A;  4LLN A;  3KEO A;  2YX7 A;  2NNY A;  4A2U A;  1W5T A;  3KLO A;  5LRS A;  2EJR A;  1I6X A;  4HX4 A;  2P5V A;  2EV0 A;  2COM A;  1YLF A;  2QM3 A;  4RB0 A;  1YQA A;  1ON2 A;  1R58 A;  1MDM A;  1UCR A;  3S2W A;  4MQ9 F;  5L3B A;  2H27 A;  2EWN A;  5E20 A;  2DBB A;  4IRG A;  5FFX A;  3KET A;  1FNN A;  2JSC A;  5DD8 A;  2DTR A;  4M6Y A;  4IJA A;  3VOE A;  2RNJ A;  2ZCW A;  2V1D A;  4LB5 A;  3RKW A;  3R4K A;  5HVQ C;  2XAQ A;  5CVJ A;  1P4W A;  2PI0 A;  2JRT A;  1OYI A;  1F9N A;  4OMY A;  4P9F A;  1FSH A;  4YFX F;  2XUB A;  3RIR A;  3HHG A;  2Q8K A;  3V8J A;  3MEX A;  3V7R A;  3CUQ C;  1ZAR A;  2ZFW A;  1KQ9 A;  1UHM A;  3K2Z A;  3RPQ A;  3GXO A;  3HOT A;  4DNC A;  4L0Z B;  4ASN A;  2FNP A;  1ZG3 A;  5BPD A;  3O6B B;  3EUH A;  3FMS A;  3ZQ7 A;  2OD5 A;  4RGX A;  6PAX A;  1L3L A;  4TV7 A;  4GYG A;  1F1Z A;  3RJP A;  3Q5F A;  1KU3 A;  5EEG A;  2ZME A;  1T6S A;  2HTS A;  3N4M A;  3R0J A;  2O6G E;  3ZPL A;  1J59 A;  1EH6 A;  3T1B A;  3TO7 A;  5K5O A;  3MFK A;  2PN6 A;  1ZHF A;  4HF1 A;  2G7H A;  3EET A;  4R1H A;  4QWQ A;  1J75 A;  3ZN0 A;  1FWZ A;  5LGN A;  1R1V A;  1YTY A;  4YFN F;  2FML A;  1GHC A;  5FB2 A;  2TDX A;  4OMZ A;  3WU1 B;  3D5L A;  2EA2 A;  2F5D A;  1TBX A;  3K1P A;  4I09 A;  1WKM A;  3KP2 A;  4L9V A;  3GFJ A;  1MJA A;  2HDC A;  3SHF A;  2W85 A;  1HW2 A;  4I01 A;  3LFK A;  4HX8 A;  3J81 K;  1SMT A;  2IRF G;  2L01 A;  4U7D A;  1RNL A;  2VBY A;  2CO5 A;  4HAM A;  2RVC A;  3MAJ A;  2GA1 A;  5F6F A;  5FD6 A;  1I27 A;  1J7K A;  3PFI A;  5JHU A;  2KJB A;  3LAJ A;  1U5T A;  3REO A;  2LDU A;  3JSO A;  4P96 A;  5BS6 A;  2K27 A;  1FYM A;  4HQE A;  2WV0 A;  2CFX A;  3RYP A;  4A0Y A;  2E1N A;  1B9M A;  2RV8 A;  3HSE A;  5D5V B;  4Q47 A;  2XAH A;  5E1Z B;  1BC8 C;  2VON A;  2JPC A;  3KP3 A;  1YW9 A;  1SAX A;  3SZT A;  3ZP5 A;  2DW4 A;  2FXA A;  2JT1 A;  1FP1 D;  3WTZ A;  2IP2 A;  2VN2 A;  3BPX A;  1Z6R A;  3SFZ A;  3WU0 A;  3I59 B;  3DEU A;  2R7F A;  1HSJ A;  4A0X A;  2C6Y A;  3SQN A;  1O3T A;  5LHG A;  1D5V A;  4KMF A;  3GVA A;  4LMY A;  3ZMZ A;  3QAH A;  4RB3 C;  3ECH A;  4ZYE A;  4CO8 A;  2ETH A;  3DXJ F;  2A61 A;  1P2F A;  2HYF A;  2L02 A;  4G6D A;  4MNU A;  2O8X A;  2BGC A;  3IRR A;  2BE5 F;  3BWG A;  1HKS A;  4ESF A;  3IC7 A;  2QQ9 A;  3I54 A;  3HUG A;  3C3W A;  2RN7 A;  3H3Z A;  1G3Y A;  3MCZ A;  4ESB A;  4KIC A;  3IWZ A;  1Z6T A;  2GIV A;  5HLG A;  1KA8 A;  1XSD A;  3ZMD A;  4HZF A;  5L3F A;  2IT0 A;  5HDG A;  5H20 A;  3RKX A;  3Q9V A;  3V8K A;  2V6C A;  2V9V A;  2MLG A;  2FBI A;  4GO1 A;  1JHH A;  2EFO A;  4XSZ F;  3WTW C;  3I71 A;  3P9I A;  2BBY A;  1XDU A;  1ZRF A;  4FX0 A;  3PQJ A;  3LST A;  5BOX A;  3JTG A;  2O0Y A;  3R0A A;  3CUQ B;  4CGZ A;  1R1U A;  5ILV A;  3C18 A;  1B6A A;  5LEK A;  3DPT A;  2FSW A;  1I1G A;  5A2Q K;  2UXN A;  5JFR A;  3E97 A;  2NS0 A;  2MH9 A;  2DK5 A;  1YG2 A;  2Z9O A;  4L0Y B;  3E5Q A;  1K78 B;  2IA2 A;  3GO5 A;  3LQQ A;  4ZZL A;  3P7N A;  4OIR F;  2W24 A;  3GLX A;  1IRG A;  5BPI A;  5ICC A;  3GZ6 A;  3EQL F;  5DEQ A;  2VE8 A;  4UNO A;  1W7P D;  2A07 F;  5HLH A;  4B09 A;  1YW7 A;  4GXO A;  3HRU A;  2GA2 A;  3E3V A;  2O03 A;  4CHU A;  3ELK A;  3T8R A;  4N9I A;  3C7J A;  3U2R A;  2KIF A;  3FMQ A;  1DP7 P;  3FM5 A;  4P5O A;  2FU4 A;  1PP7 U;  2ZKZ A;  1F4K A;  3G73 A;  1L0O C;  1IW7 F;  1FBU A;  3JAM Z;  3HSR A;  5ILU A;  3QRF F;  4BHB A;  2M1B A;  4UV8 A;  2GQQ A;  3WG9 A;  4I7H A;  1Z05 A;  2RDP A;  3BDD A;  3B02 A;  3HOS A;  1J5Y A;  3TDU C;  2OQG A;  5K5R A;  1O7L A;  1G3T A;  3I64 A;  3WTY C;  3ZN1 A;  2QBY B;  1HKT A;  1B4A A;  2AS5 F;  1FYK A;  1YFH A;  4KYW A;  1QZZ A;  1E17 A;  2VXZ A;  1ZH5 A;  4NB5 A;  1LEA A;  3T5X A;  1H9G A;  3U1D A;  1W7P B;  2EB7 A;  1D8K A;  4FT8 A;  2HZT A;  4OIQ F;  2EV6 A;  4JK1 X;  1TQP A;  3BJ6 A;  4EQQ A;  1K79 A;  3WE3 A;  2XHK A;  1Z1D A;  4MTE A;  4KMU X;  1ZGA A;  2PG4 A;  4MQV A;  3I59 A;  1S29 A;  2OU2 A;  2K4J A;  3D0S A;  5E8I A;  5DUI A;  2K86 A;  3DPL C;  1C0W A;  2VOD A;  4EM2 A;  3ZMU A;  4KN4 X;  2M45 A;  5CJ9 A;  3DF8 A;  5AON A;  5CVI A;  1DPR A;  5J8C A;  3KLN A;  3KP4 A;  1CF7 A;  1SD4 A;  4CIC A;  1XCV A;  1UB9 A;  4A0Z A;  4WXC A;  4RS8 A;  2IA0 A;  5ED4 A;  4UVA A;  4OIP F;  1WSU A;  3K1M A;  3RKY A;  1LB2 A;  2YX4 A;  4EM0 B;  4KIF A;  2NYX A;  2YPR A;  2F5C A;  4MTD A;  1ON1 A;  1MJ9 A;  1I5Z A;  2OA4 A;  2P5L C;  4S05 A;  5HLI A;  2JZY A;  3WE2 A;  3CJN A;  3F8C A;  2HOE A;  2M5W A;  1BIA A;  4U88 A;  5J8F A;  3LA7 A;  4MEX F;  3O2P E;  3R6S A;  1ZLK A;  2DPD A;  2W25 A;  1Z91 A;  3GF2 A;  1MZB A;  2X0L A;  1FC3 A;  2KJC A;  3GWZ A;  2O61 A;  3J81 Z;  4KUM A;  1GXQ A;  2ACJ A;  1SD6 A;  3I0T A;  3ROU A;  2ZBK A;  4HBL A;  2G7U A;  2VBX A;  2LSO A;  3DFG A;  4KFC A;  4M9Z A;  3FHZ A;  3TOB A;  2GXG A;  2W84 A;  4M74 A;  3IKV A;  3F8M A;  3O3K A;  3M8F A;  5E1W A;  5CYV A;  4M72 A;  1FZP B;  3V7C A;  4IPA A;  4Y17 A;  3L9F A;  5DCF A;  3P9C A;  1GVJ A;  1BI2 A;  2KIU A;  2VC1 A;  4L9N A;  4CZZ A;  2CSO A;  4ENM A;  1UHW A;  3ZMV A;  3K9T A;  3WGG A;  2Y0M A;  3CTA A;  3PQK A;  4HA8 A;  4ENN A;  1KQ8 A;  1U2W A;  3V4G A;  4EGZ A;  4XBF A;  2AXL A;  4HDV A;  3FXU A;  2F2E A;  2VOO A;  4G7Z F;  2BV6 A;  3AAF A;  3NEU A;  2OBP A;  4LLG F;  4I02 A;  5L3E A;  4IHT A;  1ZRD A;  2HTJ A;  3E6D A;  3R61 A;  5JI6 A;  3E5X A;  2CG4 A;  2X4H A;  3J80 K;  1ZYR F;  2DK8 A;  1JHF A;  4EGY A;  4G8X A;  1RUN A;  2LNB A;  5FGM A;  1OMI A;  2KKO A;  4HF0 A;  4H0E A;  5L3C A;  1KU7 A;  2QVO A;  2ZO4 A;  3M8E A;  1LNW A;  4LG0 B;  2YR2 A;  5CVU A;  4XRF A;  1KQ0 A;  3QPT A;  2VBZ A;  3IKT A;  4QLC U;  4BYY A;  3R60 A;  2OQR A;  1R36 A;  5HS8 A;  2QBY A;  1MGT A;  2OAZ A;  4OIO F;  1W5S A;  4KDP A;  3RI4 A;  3F8B A;  1LJ9 A;  1Z7U A;  2XAF A;  4LLL A;  4WWC A;  1AOY A;  1W7P A;  1QQI A;  4HYE A;  2CYY A;  1ZRC A;  1S7O A;  3IWF A;  4Z2Y A;  2EK5 A;  4YIF A;  1R5H A;  1T0F A;  2RQP A;  4E70 A;  3IRQ A;  4P55 A;  2XV4 S;  4ESJ A;  1EH7 A;  1REP C;  4JQF A;  4RAZ A;  2D1H A;  2HEO A;  2BYV E;  4EJW A;  4MEY F;  1B9N A;  4Q48 A;  3F8N A;  2DI3 A;  2V79 A;  4A5M A;  1ZAO A;  2PEX A;  2P6T A;  5D4R A;  4L18 B;  4WX9 A;  4G6Q A;  3P9K A;  5D6F A;  5FFZ A;  5LLQ A;  1ZGJ A;  4KIG A;  3WTX C;  3WTU C;  2NNN A;  1LDK B;  1R1T A;  2UXX A;  1U5T C;  2EA4 A;  4I2O A;  1XDS A;  1PDN C;  1U3E M;  1FBQ A;  2KIM A;  4M73 A;  1KU9 A;  5E17 F;  4KIB A;  3FX3 A;  2P5K A;  3RTR A;  2FEZ A;  4AIJ A;  3GYH X;  3TGN A;  1WRJ A;  2K7L A;  1BN5 A;  4GGG A;  2L3D A;  4PGG A;  5H6R A;  2XGX A;  1P92 A;  4K2E A;  1U78 A;  2FQ3 A;  5FD5 A;  2M87 A;  2D1V A;  3ABT A;  3NRV A;  2QLZ A;  4M6X A;  1G4D A;  3BRO A;  2DO7 A;  1YIO A;  5ICF A;  4EMS A;  3F8F A;  1BI3 A;  4YII A;  2WWY A;  3HHH A;  4HW0 A;  3WOD F;  3TOA A;  3VB2 A;  4WK8 F;  1O7F A;  2RKH A;  3EDP A;  1O3R A;  1Q1H A;  1QGP A;  3L7W A;  4KT5 C;  1P4A A;  4BHP A;  2RGV A;  1J9I A;  5IT9 K;  1TW3 A;  2IW5 A;  1HW5 A;  2YU3 A;  4OIN F;  2MH2 A;  3CDH A;  3I4P A;  1YS6 A;  3QPH A;  2EFN A;  4KA4 A;  5FLX Z;  1DPU A;  5ERI A;  3WTT C;  2PFB A;  1QZY A;  2UWM A;  2FA5 A;  1LEB A;  4P9U A;  4PGH A;  3DP7 A;  1ULY A;  2IJL A;  4AVP A;  2V1X A;  3QP5 A;  2XKO A;  1OPC A;  3LWF A;  1G3W A;  5D5X B;  2XKP A;  1JXS A;  1X3U A;  3DV8 A;  2UZK A;  5BMZ A;  3E6B A;  3N97 A;  5TJJ A;  1BBY A;  5E1X A;  1SD5 A;  1B59 A;  3BOQ A;  3VFZ A;  4R8H A;  5CVV A;  4OOI A;  4HV6 A;  4RB1 A;  3M7G A;  4G7O F;  3VOD A;  1YS7 A;  4FX4 A;  4IRI A;  3JW4 A;  1HW1 A;  2P7V B;  4PDK A;  5K5Q A;  3H3U A;  3LA2 A;  2XAG A;  4IVN A;  5L3D A;  3F72 A;  1XSV A;  4L5I A;  2MC3 A;  1XMK A;  4A6D A;  2VT2 A;  2VOP A;  2FBK A;  4PZJ A;  1UST A;  3ML6 A;  2WC2 A;  5LBQ A;  4O6J A;  3L09 A;  4UV9 A;  1RZ4 A;  1SD7 A;  4I0A A;  4I98 B;  3RDI A;  1LQ1 A;  1RUO A;  1EH8 A;  2CGP A;  1F5T A;  3MQ0 A;  1J2X A;  2L4M A;  4A5N A;  3HTS B;  2ZME B;  1DDN A;  2OZ6 A;  4AD9 A;  1BI0 A;  4UVB A;  2HR3 A;  2H6B A;  4N9H A;  2ESN A;  1A04 A;  2LF7 A;  4ZYD A;  1JGS A;  2PBI A;  2CWE A;  4U7B A;  4NQW A;  2V1U A;  3COA C;  1U6G A;  2D2W A;  2L54 A;  4WXH A;  4MGR A;  2EFQ A;  4Q4Z F;  1T2K A;  1DUX C;  2ZXJ A;  1BOA A;  4HF2 A;  2OZU A;  4EJT A;  2EV5 A;  1WWX A;  4HQM A;  5KK1 A;  2Y48 A;  1S6L A;  1XGM A;  5LGT A;  1FPQ A;  4Y15 A;  3TDZ C;  5D5U B;  3K69 A;  4HLX A;  2XAJ A;  4XLP F;  4YG2 F;  1KU2 A;  3FXQ A;  3M9A A;  2LKP A;  5HDK A;  5EEH A;  2NAZ A;  5FO5 A;  2FOK A;  1OYY A;  4BXU A;  3KZY A;  2A69 F;  1XGS A;  4XLN F;  2MBF A;  4BQA A;  1U5T B;  3CLO A;  4IF4 A;  5J6X A;  4U0Y A;  1LVA A;  3GZ5 A;  2VE9 A;  1R00 A;  5L3G A;  3ZMT A;  3MWM A;  2JTV A;  1TQI A;  3CUO A;  2L4A A;  3HRM A;  3L00 A;  2H94 A;  3J80 Z;  2F5E A;  4XSX F;  1S8N A;  4HX7 A;  4PCQ A;  2GAU A;  2FMY A;  1IN7 A;  4G94 A;  1T39 A;  1BM9 A;  1OKR A;  4ENJ A;  3WGH A;  3BJA A;  1SFX A;  1KYW A;  1S7A A;  3RYR A;  3ERE D;  2PMH A;  3ISP A;  3KFW X;  4RGR A;  1BIB A;  5DCM B;  5LEJ A;  2MLK A;  2PMU A; 
#chains in the Genus database with same CATH topology
 2ZNY A;  1T95 A;  3CLQ A;  1JT0 A;  1R22 A;  1S72 I;  1KYZ A;  4L5J A;  3GFI A;  2P7C B;  3JAM K;  1QO0 D;  2HQN A;  2CH0 A;  1NG7 A;  4UHT A;  3OSG A;  1XN7 A;  1ODD A;  2WBM A;  3HTU A;  3PNV A;  3FF5 A;  1Y1V J;  1VQO I;  1IZ1 A;  2QQA A;  4UVC A;  2X9D A;  3TP3 A;  1OCR H;  4JOM A;  1FOW A;  5J1Y A;  1XMA A;  4F93 B;  2Q0O A;  4L9J A;  3IL2 A;  1D8J A;  3GX4 X;  3CUQ A;  1FYL A;  5GTI C;  2IGK A;  3HBL A;  4X0G A;  1IXR C;  3UR3 C;  1IUY A;  3A02 A;  2VI6 A;  2P81 A;  4XL9 A;  2BW3 B;  1K6O A;  3M4O J;  1JI8 A;  2FD5 A;  5KAI C;  4WF2 A;  3QU6 A;  1T08 B;  1Z9C A;  1XGO A;  2EQR A;  3RQ4 A;  4EJU A;  4M3D A;  2HYG D;  3DKW A;  4JX4 A;  3HUG B;  4IKF A;  1SFE A;  2K4B A;  3JSP A;  3H0G J;  3PO2 J;  2HXI A;  2E71 A;  2P4W A;  4BNC A;  2JVH A;  3X2Q H;  4DQ2 A;  4BGD A;  1RRJ A;  2KRF A;  4XOT A;  2O8K A;  1PP8 F;  3SDG A;  1SVO A;  3TBI A;  1K78 A;  1Q1V A;  4F3Q A;  4A3C J;  2PX9 A;  2VT3 A;  3ERM A;  1D0Y A;  3Q0V A;  1U0J A;  1P4X A;  1ZRE A;  1CGP A;  1JJ8 C;  3WTS C;  1HBX G;  2NOJ B;  2NRA C;  1G6N A;  2QYO A;  4IRH A;  3BPV A;  2DFI A;  5DV5 A;  2R7D A;  2JA5 J;  1S5L C;  3WG7 H;  5F64 A;  3CCQ I;  3SZP A;  3CMY A;  1SFK A;  1LDD A;  2LRE A;  2DYR H;  2MD5 A;  3HYI A;  2DTZ A;  4HLY A;  3HRS A;  3FXR A;  3ZQF A;  2DOA A;  2QKM B;  2GXB A;  2JRM A;  2A5W A;  4IOA F;  4LK0 F;  2Y0S N;  3GZN B;  1MW7 A;  1J09 A;  1R7J A;  1FP2 A;  5E3M A;  1HXD A;  4XRS G;  2Z99 A;  3L2C A;  2OTJ I;  3S1R J;  1N75 A;  2LH9 A;  5HDN A;  3HOX J;  1MJB A;  2ECB A;  2CW8 A;  2IXS A;  1EV7 A;  3T0Y A;  2BXZ A;  1K6Y A;  1PUF A;  4UY8 I;  2L0K A;  2V7F A;  1IRX A;  2CQK A;  1LE8 B;  1RI7 A;  4W97 A;  1B1B A;  2OTL I;  1MSE C;  2Y75 A;  3S93 A;  2HQR A;  3E6M A;  2E7W A;  3FIW A;  4YIR X;  3GW2 A;  3M1E A;  2IPQ X;  5CLS A;  1FOY A;  2ADU A;  1UAA A;  3I53 A;  4V2F A;  1QZE A;  1D3Y A;  2L7M P;  1V5G A;  1GXP A;  2ESH A;  3QU3 A;  1IGN A;  4G9Y A;  1O3Q A;  4J19 A;  3OSF A;  1DGR M;  2LKS A;  2I5U A;  1HST A;  2CW0 F;  1VQK I;  1LFP A;  1QPM A;  1TWA J;  1Z0X A;  5DUK A;  1IXC A;  3H9Q A;  4M71 A;  2VKD A;  2ZC2 A;  3FBI B;  1D0X A;  3KYL A;  1STZ A;  4BKX A;  1WVR A;  2DLL A;  3FZV A;  4EJO A;  2CUJ A;  1G3S A;  2MC4 A;  3LQR A;  3BR0 A;  3OL3 A;  3CCM I;  1RR7 A;  3DQV C;  2QEN A;  3HRT A;  4BHC A;  1TQM A;  4RGS A;  5F1J A;  3LA3 A;  2IS1 A;  4O5V A;  3F3X A;  5F1R A;  2E1M B;  2HKX A;  1ITY A;  1ZN2 A;  2X1C A;  5JVT A;  3FIS A;  3HG9 A;  2EZL A;  2R0Q C;  4OWR B;  3J7A Y;  5IT9 Z;  3PSF A;  2XIG A;  3AG3 H;  4LD5 A;  1OFC X;  4LJZ F;  4H4K C;  1NTC A;  2LC2 A;  1MKM A;  4I6Z A;  5D4S A;  2VC0 A;  2M8G X;  4OAY A;  3J7Y J;  3DBH B;  3T8T A;  1FT9 A;  2B9S A;  3H0D A;  1BR2 A;  4RDU A;  2HOT A;  2LG4 A;  4HG2 A;  4LG3 A;  2XRO A;  1X1P A;  2PJR A;  4E6K G;  3W2V A;  2GOX B;  3AG4 H;  2Q2E A;  2HVS A;  2IVM A;  1X2M A;  2XPU A;  3FMR A;  3CDL A;  2Z33 A;  1UEL B;  2ZSI B;  1X1B A;  4UUV A;  5ILS A;  2VPR A;  5IT3 A;  2EZH A;  2LOO A;  3HOU J;  1TWG J;  2QQB A;  1FBS A;  2XAS A;  3HKZ A;  4LB6 B;  1E2X A;  2E5Z A;  1S3J A;  3A2K A;  2BEO A;  1MBG A;  3M8J A;  3WHC A;  1R71 A;  4HV5 A;  2EFP A;  5D8K B;  1J0R A;  4RB2 C;  5ICE A;  3AKZ A;  3CC2 I;  1H0M A;  5F0F A;  2CQQ A;  2FRH A;  3LFU A;  2Z1D A;  3ZMS A;  5A2Q Z;  4RAY A;  1GLN A;  2LF8 A;  3LAP A;  4N4O B;  1GV5 A;  3EUK L;  1ZK8 A;  3E0J B;  1BJA A;  3GFM A;  2DOE A;  5LRR A;  2R7R A;  3KPH A;  1X4O A;  2OF7 A;  4ON0 A;  4I0B A;  3BJO A;  1ZLJ A;  4NC7 A;  4M3E A;  1PYV A;  3GTL J;  5CVR A;  1ZG1 A;  4MHG A;  5DDG A;  3W6V A;  1IXS B;  4ETS A;  1W0U A;  3CJT B;  4R79 A;  1T0F C;  1QA6 A;  3FKI J;  5E18 F;  2STT A;  1X58 A;  1U9N A;  3I5U A;  4BQQ A;  3K4L A;  1IN5 A;  2H8R A;  2DQL A;  1HKQ A;  2R5Y A;  1UMQ A;  4KNY A;  3DLL F;  1K7A A;  3HIF A;  3KZZ A;  4YFK F;  1QNT A;  4XMY A;  4A6E A;  4HOB A;  2STW A;  5DD4 A;  3DKY A;  1WPK A;  5LHH A;  2H1K A;  3BG3 A;  2W57 A;  3Q0W A;  5J1R A;  3KP7 A;  1LVK A;  1VZ0 A;  4M6V A;  5HS9 A;  2XPV A;  4EJV A;  1KGS A;  1YJN I;  1I1S A;  2X1D A;  3PSI A;  3LSI A;  5DCM A;  2H09 A;  2CMP A;  2MA3 A;  2HQA A;  4ABZ A;  2Z5U A;  4N0B A;  1U8R A;  3EYI A;  2VBW A;  2K3F A;  3TO6 A;  3GEZ A;  1O57 A;  1WQ2 A;  3TO9 A;  2BY1 A;  2H6C A;  2N8G A;  3VPR A;  3FXM A;  2F5V A;  1K4T A;  1Y0U A;  2K9M A;  2HDD A;  4Q5S F;  2XSD C;  1NHA A;  2BHY A;  2HFH A;  3MKZ A;  4A12 A;  1P6R A;  4Y13 A;  4PJM A;  4PFO A;  3EYY A;  2BVM A;  4GCV A;  4DW6 A;  1CF7 B;  2X51 A;  1OYW A;  3CO7 C;  4F7Z A;  2L2O A;  3BR1 A;  4JBA A;  1IG7 A;  2R7W A;  1XGN A;  2GWR A;  3ABU A;  1ZG5 A;  4DIQ A;  3IHU A;  1TWC J;  3TQN A;  4F55 A;  1TLH B;  3K4B A;  1RIO H;  3W6K B;  4HDU A;  2A6E F;  2F4O B;  3MMY B;  5D8L B;  4BY7 J;  4L5E A;  3DKX A;  2CS3 A;  3KP5 A;  3B73 A;  3O8G A;  5HOO A;  2ME0 A;  1MH4 A;  1BW5 A;  4EV0 A;  4F91 B;  1G8X A;  3CDI A;  2V26 A;  3KP6 A;  4NHJ A;  5HS7 A;  2VL8 A;  3BR3 A;  2P6S A;  4M3G A;  4WXD A;  1FLI A;  5J4Y A;  4CDG A;  1TW2 A;  3CJQ B;  3LMM A;  4LFU A;  4RGU A;  3K0L A;  1R5G A;  5E79 C;  2M4K A;  3H92 A;  3NAR A;  4L9T A;  4D5C A;  5IOZ A;  2ELH A;  2W00 A;  2ZFU A;  4ZYG A;  1MMA A;  3E6C C;  2JPB A;  3E5U A;  4IZZ A;  1D1B A;  3NWS A;  1FX7 A;  4BJ6 C;  2F5F A;  1IN8 A;  2M30 A;  4GYI A;  2VUM J;  1W36 D;  1YYV A;  3TKY A;  4CCM A;  2A5Y B;  1SMY F;  2L7F P;  4BAY A;  3VYU B;  4ENK A;  1XB4 A;  1OQY A;  1XCB A;  2FE3 A;  3SXY A;  3D1N I;  2L9S A;  4FE7 A;  3OS1 A;  4IQJ A;  3BP8 A;  1MDM B;  2O3F A;  2QKL B;  3ZOB A;  4PJN A;  4QIW N;  1ETV A;  1R6R A;  2IEK A;  3C1D A;  4AIK A;  5F04 A;  2HS5 A;  4BL0 B;  5FJ8 J;  2LVS A;  1ACI A;  2KIS A;  3IH3 A;  3ZGK A;  4G7H F;  3GFL A;  4KN7 X;  3RCO A;  3G3Z A;  3CCU I;  3S3M A;  1T8I A;  4J01 A;  2JVG A;  1FY7 A;  3BZK A;  2R3S A;  2QCO A;  3F23 A;  4ZTJ A;  3JRC A;  3P5J A;  4BXX J;  4LK1 F;  1ONV A;  5IY5 H;  3BR6 A;  3HXL A;  2R5Z B;  3K4C A;  4LGW A;  1MBK A;  3S2H J;  3CCY A;  2PMZ A;  3PUB A;  3BZ6 A;  4JYK A;  1IN4 A;  3F6O A;  4XLH A;  4BEH B;  1TNT A;  1R23 A;  4S04 A;  4G12 A;  3M3Y J;  4HNV A;  4A69 C;  1HQC A;  4M9S A;  3V7S A;  2EFW A;  2X6W A;  3I58 A;  2KDO A;  3F22 A;  1ZR4 A;  3J7A O;  2HU9 A;  4NC8 A;  2J5P A;  5EJC A;  1XS9 A;  5IYD J;  1MD0 A;  1LDJ A;  2WV1 A;  1YO5 C;  3FXO A;  3BTI A;  5E8G A;  4FHT A;  3V8L A;  2K9Q A;  2FF4 A;  2P8T A;  3A0B C;  4PFP A;  5AIQ A;  4BBR J;  4ZH4 F;  2ZJ2 A;  3QOP A;  5JR3 A;  4LG0 A;  3PIO F;  3U9G A;  1FOK A;  2WTE A;  5BQT A;  3HOZ J;  3KYD B;  3BCA A;  3F6V A;  3LSM A;  1V3F A;  1Y56 A;  2MSY A;  3JTH A;  1Y0N A;  4CYC B;  3WTV C;  3PNY A;  1H9T A;  3MD2 A;  1AKH A;  4Y7N J;  1PUE E;  1W4M A;  3WGI A;  1IF1 A;  2E1C A;  2ZXH A;  5D6E A;  3PM1 A;  2DQR A;  2IS6 A;  1LFU P;  3HDD A;  4C30 A;  3HOY J;  4IHW A;  4FE4 A;  2XB5 A;  1UFM A;  1JTX A;  2Y2Z A;  1OR7 A;  3FWE A;  4DYC A;  1ETQ A;  4ZYA A;  3UKG A;  3OYC A;  2E60 A;  1T98 A;  2K5C A;  3HSF A;  5K1Y A;  2HKO A;  2E2I J;  1T33 A;  4UXN A;  1P7I A;  3ULQ B;  4FQG A;  2PQ8 A;  2M8E A;  1O3S A;  3OOU A;  2A68 F;  3CQZ J;  2QWW A;  2HWV A;  2IGM A;  3OYL A;  2QUF A;  1BC7 C;  2ICW G;  2JUG A;  3RPU A;  5TRD A;  4D9J A;  2QZ8 A;  2FOW A;  1VQ6 I;  1B72 A;  3CCE I;  2ZXW H;  3CC7 I;  3CO6 C;  2YSR A;  1PJR A;  2K9L A;  3JCU C;  2KQR A;  1TL8 A;  2CW7 A;  4U0W A;  3ZRG A;  4CYD A;  4PJL A;  4PSX A;  2XC7 A;  2Z3Y A;  2W7N A;  1WJB A;  2VQC A;  2LR8 A;  1T38 A;  5IYC J;  2NXN B;  1XSX A;  2DT7 B;  3MZY A;  2NOG A;  2FBH A;  3HM5 A;  2GIZ A;  2DMT A;  3TW7 A;  5GAG J;  1N25 A;  4IHS A;  1OR7 C;  1JE8 A;  2ISZ A;  2DT5 A;  2VLA A;  4I99 C;  3ESW B;  3Q9S A;  2NS7 A;  5FLX K;  3NQO A;  1BR4 A;  3GTJ J;  2G9W A;  1X19 A;  4XLC A;  4B4C A;  3DBR B;  3CP2 A;  4ZYH A;  3CP8 A;  1FTZ A;  2KZG A;  5ICG A;  4XIC A;  4RA2 A;  5BNG A;  1M1E B;  4FET A;  4CCK A;  4LIT A;  5GPC A;  1WHU A;  4E7Z A;  4AIH A;  2LMD A;  3AL0 C;  1VQL I;  4YRV A;  4E7J A;  4D0P A;  2DPU A;  1AHD P;  5AIP A;  1IAW A;  3NWT A;  2IA1 A;  2XSJ C;  5EG0 B;  2XVC A;  3HOW J;  5H6Q A;  2RC4 A;  3SEQ A;  2I8D A;  1HA8 A;  4ZZD A;  2GZW A;  1OCT C;  3QP6 A;  3L2R A;  3GTQ J;  1D1C A;  3W6J B;  4C3I J;  2D45 A;  1VQP I;  3GCM A;  2M2E A;  3KCC A;  2PLY A;  3FM3 A;  5C44 J;  3I9V 2;  1QHH D;  4O3M A;  4XNF A;  1TTY A;  3LOC A;  4M9X A;  2GBY A;  4IXA A;  2DAO A;  3W3C A;  3OV8 A;  5IP9 J;  3VEP A;  1FSE A;  2FNA A;  3SZG A;  4WCG A;  2HQ5 A;  2QEX I;  3KE2 A;  1JTY A;  4CXF A;  1BI1 A;  2WY7 Q;  1W5C C;  4B8X A;  1LKX A;  1TNS A;  2BXY A;  4KIS A;  2XGD A;  3BY6 A;  4EVI A;  3OOP A;  2TCT A;  3L2V A;  5D5W B;  4B43 A;  2J5O A;  4BUP A;  2RAE A;  1AWC A;  1FMW A;  4EM1 A;  2Z2S B;  1V4R A;  3KEQ A;  5DYM A;  5LGU A;  3K1N A;  3K70 C;  1IN6 A;  5LHI A;  3ECO A;  3BTC A;  1SFU A;  4U0V A;  4AU7 A;  1X1D A;  2B0L A;  2ZNZ A;  3B6A A;  2E7X A;  2A3S A;  1IRF A;  1A6Q A;  1QBJ A;  1YW8 A;  4JX6 A;  2DU9 A;  3HGG A;  1BOB A;  4BH9 A;  4UB8 C;  1WI9 A;  5K7Z A;  3DBL B;  3V42 A;  4Y33 A;  1YOV B;  2ISY A;  5F27 A;  3F21 A;  2XRN A;  1GVD A;  4AWX B;  2A6H F;  1XD7 A;  3K2A A;  3OYM A;  3A01 B;  3MZH A;  1B8I A;  2PJP A;  1USS A;  2DN0 A;  4KT6 A;  4OU0 A;  1VTN C;  2K02 A;  3GUD A;  2HGC A;  3DWL E;  2WB1 N;  5KVR A;  4LLN A;  2G0E A;  1RPW A;  3KEO A;  4ZTF A;  2YX7 A;  2ID6 A;  2NNY A;  3N05 A;  3LL7 A;  4A2U A;  1W5T A;  1YE9 A;  5IOY A;  3KLO A;  3HL2 A;  1IRZ A;  3DEW A;  5LRS A;  3PIP F;  5E3O A;  2EJR A;  1I6X A;  4D7N A;  3HB9 A;  3B6C A;  4AM3 A;  2KLO A;  5B5E C;  3BG5 A;  2P5V A;  2EV0 A;  4HX4 A;  3K7A J;  2COM A;  1YLF A;  2QM3 A;  4RB0 A;  1YQA A;  1ON2 A;  1R58 A;  1R4M B;  4CUG A;  2I10 A;  2HPI A;  1MDM A;  1UCR A;  4BS9 A;  3S2W A;  4MQ9 F;  5L3B A;  2H27 A;  2KT0 A;  2Y31 A;  3GTO J;  2EWN A;  3K6G A;  2DA6 A;  5FLV A;  2M7B A;  2DBB A;  4IRG A;  5E20 A;  5FFX A;  3KET A;  1FNN A;  2JSC A;  3J7Z I;  1MMN A;  2FUG 2;  4CA0 A;  5EF6 A;  5DD8 A;  2CV2 A;  3JRH A;  3QYB A;  2L7Z A;  1NK3 P;  2DTR A;  4M6Y A;  1GT0 C;  5HNF A;  4IJA A;  3VOE A;  2RNJ A;  3AG1 H;  2ZCW A;  2V1D A;  5B1B H;  4LB5 A;  1Y8R B;  1UG2 A;  3RKW A;  2DFE A;  3R4K A;  1LFB A;  5HVQ C;  2VAS A;  4UUS A;  2R7V A;  2O5R A;  2XAQ A;  5CVJ A;  1P4W A;  4BEH A;  4YEL A;  2PI0 A;  2A6T A;  3LSP A;  2JRT A;  1OYI A;  4NUB A;  1F9N A;  4OMY A;  4P9F A;  1FSH A;  4YFX F;  2XUB A;  3RIR A;  3S2D J;  4B48 A;  3HHG A;  2ELJ A;  5DS9 A;  2Q8K A;  3V8J A;  4AYB A;  2VQH A;  3MEX A;  1FTT A;  3ONQ A;  3JRD A;  2XAU A;  3V7R A;  3CUQ C;  1ZAR A;  1DGW Y;  2ZFW A;  1KQ9 A;  1UHM A;  1XX5 A;  3K2Z A;  3RPQ A;  3GXO A;  3HOT A;  1H8A C;  4DNC A;  4ANJ A;  2BZT A;  4L0Z B;  1V54 H;  2CUE A;  1WJ5 A;  5TGT A;  3OYA A;  4ASN A;  3FXL A;  2FNP A;  3HC7 A;  1VFC A;  1ZG3 A;  5BPD A;  3O6B B;  3EUH A;  3FMS A;  4CYC A;  5M5Y J;  3ZQ7 A;  2OD5 A;  4RGX A;  1X4P A;  2Z16 A;  6PAX A;  1L3L A;  4TV7 A;  4GYG A;  1F1Z A;  3U1K A;  3RJP A;  3Q5F A;  3L2U A;  1KU3 A;  2X48 A;  3CCL I;  1OIS A;  1YHQ I;  3TP0 A;  5EEG A;  2D5V A;  2VQL A;  2ZME A;  4S0H B;  2QSH X;  1T6S A;  1HDD C;  4AUX A;  1N77 A;  2HTS A;  2CQN A;  4GFB A;  3N4M A;  4M3B A;  3R0J A;  2O6G E;  5IP6 A;  3GTG J;  3IH2 A;  3ZPL A;  5FRN A;  1J59 A;  1EH6 A;  3T1B A;  3TO7 A;  3F9K A;  5K5O A;  3MFK A;  2JK3 A;  2PN6 A;  3VYS B;  3ABK H;  1OLT A;  1ZHF A;  4D5F A;  4HF1 A;  1W1W E;  2G7H A;  4BE2 A;  1D0Z A;  3EET A;  4R1H A;  4QWQ A;  1J75 A;  3ZN0 A;  2JA2 A;  1FWZ A;  2E19 A;  5LGN A;  3RQI A;  1R1V A;  2VIX A;  4CCO A;  5J47 A;  1E3O C;  4XN3 A;  4A3B J;  1YTY A;  4YFN F;  4PJ0 C;  3TED A;  2FML A;  1GHC A;  2AXT C;  3G6E I;  5FB2 A;  1SVL A;  4NDL A;  2TDX A;  4OMZ A;  1XTA A;  4G6T B;  3WU1 B;  1MIJ A;  4AYB N;  1SEU A;  1DP3 A;  1OCC H;  4A3F J;  1QHG A;  3D5L A;  2EA2 A;  2F5D A;  1Y8Q B;  2CQX A;  4MO7 A;  2NVQ J;  1TBX A;  3K1P A;  3G1O A;  2MD0 A;  4I09 A;  1WKM A;  3KP2 A;  4L9V A;  3GFJ A;  1MJA A;  3K70 D;  2HDC A;  1U9O A;  3SHF A;  2LY2 A;  1IV8 A;  2Y9Y A;  2W85 A;  1HW2 A;  5C4J J;  2CFO A;  2DA2 A;  3FHN A;  4I01 A;  3VSL A;  2JQ7 A;  4BQO A;  3LFK A;  4HX8 A;  1RKT A;  3J81 K;  3I3L A;  3EUA A;  1SMT A;  2IRF G;  2L01 A;  4U7D A;  1RNL A;  2VBY A;  1YX3 A;  2CO5 A;  4HAM A;  2RVC A;  2NVU B;  3MAJ A;  4BAC A;  2GA1 A;  5F6F A;  5FD6 A;  4B44 A;  2CV1 A;  1I27 A;  2DA1 A;  1XPX A;  1J7K A;  1VQ8 I;  3PFI A;  5JHU A;  5EDN A;  2KJB A;  1VQN I;  2UV1 A;  4NQW B;  3LAJ A;  4QSH A;  5EZG A;  1U5T A;  4XQF A;  3REO A;  2H8W A;  3LSH A;  3H5N A;  2LDU A;  3JSO A;  4P96 A;  1FMV A;  5BS6 A;  5IPA A;  2K27 A;  1EF4 A;  1FYM A;  5EGO B;  3GLL A;  5M5W J;  4C9Y A;  4HQE A;  2WV0 A;  1P7J A;  2KFD A;  2CFX A;  3RYP A;  2O7O A;  2E1N A;  4A0Y A;  2NVY J;  1B9M A;  1V5F A;  2RV8 A;  3HSE A;  3CZ6 A;  4XLE A;  4BE0 A;  3ZQG A;  3CD6 I;  2JJ7 A;  1UZC A;  5D5V B;  4Q47 A;  5KCM A;  2NS8 A;  2XAH A;  3OS2 A;  5E1Z B;  3OYD A;  1BC8 C;  2VON A;  1BJZ A;  1K4S A;  4D7M A;  3CCJ I;  5C4X J;  3OR1 C;  1WJE A;  4E7H A;  1PVE A;  1RET A;  4V2G A;  5J1U A;  4DGW B;  1APL C;  2JPC A;  1JUP A;  3H9J A;  2GXA A;  4IL6 C;  3KP3 A;  1JKR C;  1YW9 A;  1SAX A;  1LUJ B;  3G4S I;  2F4M B;  3KEY A;  1BA5 A;  4A3D J;  3SZT A;  3OYH A;  2ID3 A;  4CCL A;  3S1M J;  3JRF A;  1JKQ C;  1KON A;  3ZP5 A;  1LPQ A;  2DW4 A;  2FXA A;  2JT1 A;  1FP1 D;  3WTZ A;  2IP2 A;  2VN2 A;  3OL4 A;  3BPX A;  3E1S A;  1Z6R A;  3SFZ A;  3WU0 A;  2VJ5 A;  3I59 B;  3CME I;  3DEU A;  2R7F A;  2YUS A;  4BY1 J;  9ANT A;  3DLA A;  1HSJ A;  4A0X A;  2C6Y A;  3SQN A;  1MSF C;  1O3T A;  3HKZ N;  5LHG A;  1D5V A;  4KMF A;  2DA7 A;  3GVA A;  4LMY A;  1MBE A;  4ZDO A;  1AA7 A;  3QAH A;  3ZMZ A;  4RB3 C;  1EJ9 A;  2LBF B;  3ECH A;  4ZYE A;  4CO8 A;  3BTJ A;  2ETH A;  3DXJ F;  4IHV A;  2A61 A;  2JA6 J;  1A6I A;  1P2F A;  5JHF A;  2HYF A;  2DCE A;  2L02 A;  2AO9 A;  4AVZ A;  2L5Q A;  4NC6 A;  3MKL A;  4CZC A;  4RBO A;  1GDT A;  4G6D A;  2MGQ A;  2O8X A;  2BGC A;  4MNU A;  3IRR A;  1YJW I;  2DJI A;  1YJ9 I;  2BE5 F;  2JA7 J;  2BW3 A;  3BWG A;  1DU6 A;  1HKS A;  5J3L A;  4ESF A;  5KAF C;  5JVG F;  2OCE A;  3IC7 A;  4A3I J;  3OYK A;  2QQ9 A;  4RLQ A;  3I54 A;  3HUG A;  3C3W A;  2RN7 A;  3H3Z A;  3OMY A;  4IO9 F;  1G3Y A;  2DXI A;  3MCZ A;  4MFE A;  4ESB A;  4KIC A;  1MNE A;  3IWZ A;  1QRY A;  1I39 A;  1Z6T A;  5GPA A;  3SDB A;  4Y4R A;  2GIV A;  3H1C A;  5HLG A;  1KA8 A;  3MZ8 A;  3ZQQ A;  1JJ6 C;  1XSD A;  3H9G A;  3BCB A;  3ZMD A;  2YS9 A;  4HZF A;  2ZSH B;  5L3F A;  2IT0 A;  5HDG A;  3HPG A;  5H20 A;  3RKX A;  3Q9V A;  3V8K A;  4YEJ A;  2DOF A;  2V6C A;  3H5A A;  1RC9 A;  5J4V A;  1TZL A;  2V9V A;  2CUF A;  2FBI A;  2MLG A;  3O8H A;  4GO1 A;  1DU0 A;  1QVT A;  2MFZ A;  1JHH A;  2EFO A;  4XSZ F;  3WTW C;  2H1L A;  3I71 A;  2AQE A;  3P9I A;  1N78 A;  2BBY A;  1XDU A;  4QPQ A;  4FX0 A;  1ZRF A;  3IUO A;  1ZEL A;  1E3P A;  1MMG A;  4XON A;  3PQJ A;  2M7A A;  3LST A;  5BOX A;  1S9H A;  3JTG A;  5FKN A;  4BDZ A;  2M0M A;  3OWT A;  3LSR A;  2O0Y A;  3R0A A;  3CUQ B;  4CGZ A;  1R1U A;  3H3V K;  3OYG A;  5ILV A;  3C18 A;  3ZXS A;  1B6A A;  3D5R C;  5LEK A;  2X6X A;  2BHZ A;  3DPT A;  1LE8 A;  2OJE D;  3S3N A;  4ZDL A;  4HNU A;  4XK4 A;  2FSW A;  2DYS H;  2QSF X;  3G1M A;  4MFD A;  4XOP A;  1I1G A;  1VQ7 I;  5A2Q K;  2UXN A;  5JFR A;  3E97 A;  3OYF A;  1Z3Y A;  2NS0 A;  3CMM A;  1SAU A;  1I3A A;  2MH9 A;  2DK5 A;  2EZI A;  1YG2 A;  1WJA A;  2Z9O A;  4L0Y B;  4DYR A;  3E5Q A;  1K78 B;  3I4M J;  2IA2 A;  3GO5 A;  2BY0 A;  3LQQ A;  4II3 A;  1T56 A;  2DMU A;  3H35 A;  4ZZL A;  4IHX A;  3P7N A;  4OIR F;  2W24 A;  2GM4 A;  3GLX A;  1IRG A;  2ELK A;  4B3X A;  4DJA A;  5BPI A;  1X3W B;  2R7O A;  3RZO J;  3PFY A;  5FKM A;  5ICC A;  3GZ6 A;  4A3M J;  3EQL F;  3LSJ A;  5DEQ A;  1SVM A;  2VE8 A;  5J40 A;  4UNO A;  1W7P D;  3BG6 A;  2A07 F;  5HLH A;  4B09 A;  5HOD A;  1MBF A;  5GP9 A;  1YW7 A;  3HOV J;  4GXO A;  3HRU A;  2KZV A;  1WH5 A;  4QTR A;  2GA2 A;  3E3V A;  2O03 A;  2EZK A;  1RKW A;  4CHU A;  3ELK A;  4PSW A;  3T8R A;  4N9I A;  3RKQ A;  3BLY A;  3U21 A;  3C7J A;  3U2R A;  2KIF A;  3FMQ A;  2M0C A;  1DP7 P;  2R7U A;  3FM5 A;  1GUU A;  2KIQ A;  3CES A;  1MH3 A;  1VF9 A;  4XR6 A;  4P5O A;  4BJ5 C;  2FU4 A;  4E4H A;  5IYB J;  1PUF B;  1PP7 U;  2ZKZ A;  3BR2 A;  3ZQC A;  1F4K A;  3G73 A;  2OPT A;  1L0O C;  1IW7 F;  3C2H A;  1FBU A;  2MAB A;  3JAM Z;  2XF6 A;  3HSR A;  4B47 A;  4GDF A;  1UJ8 A;  2PMZ N;  2KP6 A;  2X6O A;  1ETO A;  5ILU A;  3QRF F;  3A1Y A;  2DDA A;  4BHB A;  5GAE J;  2M1B A;  1XC5 A;  2IS4 A;  2DT6 A;  4UV8 A;  1VI0 A;  2GQQ A;  3WG9 A;  2R7T A;  4M3F A;  2DA5 A;  1WH7 A;  3DPU A;  4I7H A;  1Z05 A;  1IUF A;  5KHD A;  2ZB9 A;  2RRE A;  4DBR A;  2RDP A;  3BDD A;  3CCS I;  3B02 A;  3HOS A;  3OYN A;  1J5Y A;  3TDU C;  3VSK A;  3M07 A;  4GRI A;  2OQG A;  5K5R A;  1O7L A;  1G3T A;  3I64 A;  1HF0 A;  3WTY C;  2MG4 A;  3PJR A;  1V5E A;  3ZN1 A;  4C2U A;  1EKE A;  3OYE A;  2K9N A;  5IP7 J;  5EGO A;  3S17 J;  2ME6 A;  2IGN A;  1FIA A;  4C3J J;  2QQ8 A;  5GTH C;  4A3E J;  2QBY B;  1HKT A;  1B4A A;  2AS5 F;  4Y52 J;  1FYK A;  1Z77 A;  2KDZ A;  1YFH A;  2TRT A;  3QQA A;  2JUC A;  4KYW A;  4HNT A;  4ZDP A;  1QZZ A;  4ZJZ A;  2L9N A;  1E17 A;  2VXZ A;  4JX5 A;  1YIT I;  1ZH5 A;  4XKC A;  4NB5 A;  2W4S A;  1LEA A;  3T5X A;  1H9G A;  2M9H A;  1TWF J;  3U1D A;  1W7P B;  2XRL A;  2EB7 A;  3H36 A;  1D8K A;  3L2W A;  2L9R A;  4ZC3 A;  4FT8 A;  2HZT A;  4HEA 2;  2WAQ A;  2PJR B;  4OIQ F;  2EV6 A;  2Q2E B;  2OC6 A;  3GME A;  2DMQ A;  4JK1 X;  4JP0 A;  1TQP A;  1I6H J;  3BJ6 A;  4EQQ A;  1E3H A;  1K79 A;  3ZR8 X;  3WE3 A;  1QVU A;  2WAF A;  1Z1D A;  2XHK A;  4CH7 A;  2EH3 A;  2DMN A;  3TMO A;  2R7X A;  4XID A;  4QPO A;  4MTE A;  4KMU X;  1EA3 A;  1ZGA A;  2PG4 A;  1K61 A;  4MQV A;  3WU2 C;  3I59 A;  1ZGW A;  1JKP C;  1S29 A;  1BL0 A;  2OU2 A;  2K4J A;  3D0S A;  5E8I A;  5DUI A;  2K86 A;  3DPL C;  1VQM I;  1C0W A;  2VOD A;  4EM2 A;  3ZMU A;  4KN4 X;  2M45 A;  5CJ9 A;  1HDP A;  1CQT A;  3DF8 A;  5AON A;  5CVI A;  3UNG C;  1R4N B;  5FRO A;  1DPR A;  1DQU A;  5J8C A;  3KLN A;  3KP4 A;  1FOX A;  3AG2 H;  1YRN B;  1CF7 A;  1WJF A;  1VQ4 I;  1SD4 A;  4CIC A;  5M5X J;  1XCV A;  1UB9 A;  4A0Z A;  5K7F A;  4WXC A;  4RS8 A;  3GTP J;  2IA0 A;  4Z6Y A;  5ED4 A;  4UVA A;  4XKW A;  4D1Q A;  4OIP F;  3VWB A;  4IEJ A;  1WSU A;  3K1M A;  3RKY A;  1LB2 A;  4BQN A;  2YX4 A;  4EM0 B;  5C3E J;  4KIF A;  3BC8 A;  2NYX A;  3SFI A;  2LRD A;  2YPR A;  2VKH A;  2VJI A;  3BG9 A;  2F5C A;  4KJZ A;  4MTD A;  3CC4 I;  1ON1 A;  2E1O A;  2HXO A;  1MJ9 A;  1I5Z A;  2OA4 A;  2P5L C;  3SYT A;  4S05 A;  3CJR B;  5HLI A;  1ZR2 A;  2HI3 A;  2JZY A;  3WE2 A;  2JWT A;  3BG7 A;  3IP4 B;  3CJN A;  3F8C A;  2E34 A;  2HOE A;  2M5W A;  1BIA A;  2Q1Z B;  4U88 A;  3W2W A;  5J8F A;  2W48 A;  3LA7 A;  3VYT B;  4MEX F;  2QF7 A;  3ABM H;  3O2P E;  3R6S A;  1ZLK A;  2DPD A;  2YU9 J;  2W25 A;  3L2Q A;  1Z91 A;  3GF2 A;  3M1C A;  1MZB A;  2X0L A;  5CQG A;  3H5R A;  4C2T A;  1NK2 P;  3OS0 A;  1ETW A;  1FC3 A;  2KJC A;  3GWZ A;  2Y0S A;  2O61 A;  3J81 Z;  4EAT A;  5H2F C;  4KUM A;  3SEZ A;  4IOC F;  1GXQ A;  2JMW A;  2ACJ A;  1SD6 A;  2X85 A;  3I0T A;  4LIV A;  4IX7 A;  2XGC A;  3ROU A;  5DTD A;  2ZBK A;  4HBL A;  2G7U A;  2VBX A;  4RLF A;  2F6C A;  2LSO A;  3DFG A;  1A5J A;  5CPR B;  3ZQH A;  1ZQ3 P;  4KFC A;  2CUZ A;  2CQ7 A;  1A31 A;  4M9Z A;  1ETY A;  3FHZ A;  3A0H C;  3K4J A;  3TOB A;  2GXG A;  4FTH A;  2W84 A;  1KZH A;  2M3A A;  3IH4 A;  4RAF A;  4M74 A;  3I55 I;  5TIS C;  2JA8 J;  3IKV A;  2R5Z A;  2KMU A;  3F8M A;  3O3K A;  3Q3S A;  3M8F A;  5E1W A;  1H88 C;  5CYV A;  4M72 A;  1FZP B;  2V9P A;  1G2H A;  2K85 A;  3V7C A;  3K4N A;  4IPA A;  4Y17 A;  3L9F A;  1POG A;  4UB6 C;  4EEF G;  5LFA A;  5DCF A;  3P9C A;  3FDY A;  1GVJ A;  2BY3 A;  1BI2 A;  5HLT A;  3WHB A;  2KIU A;  5K7H A;  5EZH A;  2VC1 A;  4L9N A;  2L7K A;  1UG0 A;  4CZZ A;  2CSO A;  4ENM A;  4J00 A;  1RR8 C;  1UHW A;  5JLW A;  3LSK A;  3EPZ A;  3JRI A;  3ZMV A;  3K9T A;  3WGG A;  5B1A H;  2Y0M A;  4DZJ A;  3ZCO A;  3CTA A;  1ORK A;  2JSP A;  3PQK A;  5F0C A;  1AU7 A;  3QOD A;  4IQ4 A;  4HA8 A;  4XKV A;  5FKK A;  4ENN A;  1KQ8 A;  2Y9Z A;  1U2W A;  3V4G A;  4EGZ A;  4XBF A;  2AXL A;  4HDV A;  3QPS A;  1IDY A;  3FXU A;  2F2E A;  5DM6 F;  1I50 J;  2VOO A;  4G7Z F;  1R49 A;  2BV6 A;  3DU5 A;  3AAF A;  3NEU A;  2OBP A;  3E7L A;  4LLG F;  1MNM C;  4I02 A;  5L3E A;  3RPU D;  4IHT A;  1ZRD A;  3CF5 F;  2HTJ A;  4A3J J;  3E6D A;  4A3G J;  1WZ2 A;  1MMD A;  3R61 A;  5JI6 A;  3HGY A;  3E5X A;  2CG4 A;  2LY1 A;  1Y39 A;  2X4H A;  3J80 K;  5F08 A;  2R7Q A;  1MND A;  3OY9 A;  1ZYR F;  2DK8 A;  5CKT A;  2DDB A;  1Y6I A;  2VJJ A;  1JHF A;  1JGG A;  3OYI A;  2XDV A;  4EGY A;  1ENH A;  4G8X A;  1RUN A;  2LNB A;  4PK4 A;  5FGM A;  5DM7 F;  1F36 A;  3FK7 A;  2IS2 A;  1OMI A;  3K4M A;  3EUH C;  2KKO A;  4HF0 A;  3MKW B;  5L3C A;  4H0E A;  1IC8 A;  1KU7 A;  2EIM H;  2LK2 A;  3KIO A;  5EEA A;  4BDY A;  2QVO A;  1UHS A;  2ZO4 A;  3M8E A;  3S15 J;  2E5N A;  1LNW A;  2M4G A;  4FAS D;  4LG0 B;  2YR2 A;  5CVU A;  3LSG A;  2VKV A;  4XRF A;  1KQ0 A;  4F52 A;  3QPT A;  3JRB A;  2VBZ A;  2DFH A;  1R5I D;  3QOE A;  4X6A J;  2AHQ A;  3IKT A;  1W36 C;  3FKJ A;  1AKH B;  4QLC U;  4BYY A;  2ZME C;  3R60 A;  2OQR A;  2KHM A;  1R36 A;  5HS8 A;  3BZC A;  3DTI A;  2QBY A;  1MGT A;  2M34 A;  2EIK H;  2OAZ A;  4KIT B;  4PUS A;  5KNL A;  2LD5 A;  3G2B A;  4OIO F;  2R7Z J;  4CCN A;  1W5S A;  4KDP A;  3RI4 A;  3F8B A;  4DBQ A;  1LJ9 A;  1Z7U A;  2XAF A;  1K83 J;  4LLL A;  4WWC A;  1U8B A;  1AOY A;  4FIS A;  3AFH A;  1FEX A;  2A05 A;  2V9K A;  1W7P A;  5EG0 A;  3OR2 C;  2R92 J;  1QQI A;  2FQ4 A;  4RM3 A;  1WGX A;  2EIN H;  2F4I A;  4BE1 A;  1V55 H;  1R9T J;  4HPQ A;  4BJT A;  3TL4 X;  4HYE A;  2CYY A;  2LFB A;  4CSW A;  3CMA I;  3AL0 B;  1ZRC A;  1S7O A;  3QWL A;  3IWF A;  1SC7 A;  1RES A;  4U87 A;  1Z7L A;  4Z2Y A;  2EK5 A;  4YIF A;  1B72 B;  1R5H A;  2IAI A;  2XPW A;  1T0F A;  2HOA A;  2RQP A;  4E70 A;  3IRQ A;  4P55 A;  1YI2 I;  2XV4 S;  4ESJ A;  2B7E A;  1EH7 A;  1REP C;  4JQF A;  4RAZ A;  2D1H A;  2E2J J;  2HEO A;  1VND A;  2BYV E;  3MN2 A;  5M3M J;  4EJW A;  4HRI A;  4MEY F;  1B9N A;  3ASO H;  4XKB A;  4BU2 A;  2HNH A;  4Q48 A;  2EIJ H;  3F8N A;  2DI3 A;  4P1W A;  2V79 A;  4A5M A;  2ECC A;  1HLV A;  1ZAO A;  2KL4 A;  2PEX A;  3KYC B;  2E2H J;  2P6T A;  4HST A;  5D4R A;  2WA0 A;  2WAD A;  4L18 B;  2DA3 A;  4WX9 A;  4MIM A;  4G6Q A;  3P9K A;  5D6F A;  5FFZ A;  4C3H J;  5LLQ A;  1YRN A;  2KPM A;  4XOR A;  1ZGJ A;  3DTE A;  4RM2 A;  4KIG A;  3WTX C;  2VPL A;  4C2M J;  1MBJ A;  3JRE A;  3WTU C;  3PUF A;  2NNN A;  1LDK B;  2ZJP F;  2X1E A;  1R1T A;  3I56 I;  1ERD A;  2UXX A;  1U5T C;  2EA4 A;  4I2O A;  1XDS A;  1FJL A;  1PDN C;  1U3E M;  3A03 A;  1FBQ A;  2Y30 A;  2KIM A;  1BR1 A;  5E3L A;  4M73 A;  1KU9 A;  2VB6 A;  3HZJ A;  2OV7 A;  2HOS A;  5E17 F;  4KIB A;  3BQY A;  3FX3 A;  1SFO J;  2K9S A;  3A01 A;  2P5K A;  1Z3X A;  2MYS A;  3VYR B;  3K10 A;  3RTR A;  2FEZ A;  4AIJ A;  3GYH X;  3MKY B;  2HZD A;  2F48 A;  3TGN A;  1WRJ A;  4DYQ A;  2K7L A;  1BN5 A;  5F0H A;  5E3N A;  4GGG A;  2L3D A;  4PGG A;  5H6R A;  2NVT J;  1NG6 A;  3FBN B;  5HNH A;  2XGX A;  1P92 A;  2FJ1 A;  1IO2 A;  3S32 A;  4K2E A;  1U78 A;  2FQ3 A;  5FD5 A;  2M87 A;  2D1V A;  3ABT A;  3NRV A;  2QLZ A;  4M6X A;  1G4D A;  2GOM A;  3BRO A;  3LNQ A;  2DO7 A;  2QA4 I;  1YIO A;  2KRC A;  4LIU A;  5ICF A;  4EMS A;  1OCP A;  3OYB A;  2FX0 A;  1JT6 A;  3F8F A;  1W0T A;  1YX5 A;  4RAG A;  2CRG A;  2RQQ A;  1BI3 A;  4YII A;  3C2G A;  2UUZ A;  2WWY A;  4FCY A;  4AID A;  3S1N J;  2B63 J;  3HHH A;  4HSR A;  2CV0 A;  3I4N J;  4HW0 A;  3WOD F;  3TOA A;  3VB2 A;  2IGO A;  1JUS A;  4DOZ A;  1O7F A;  2RKH A;  1FIP A;  4WK8 F;  1HCR A;  3S1Q J;  4XM3 A;  3EDP A;  1O3R A;  1Q1H A;  1QGP A;  1ZKG A;  2V6E A;  3L7W A;  3KX2 A;  4KT5 C;  1P4A A;  4BHP A;  5M3F J;  1O4X A;  1BW6 A;  2RGV A;  1YIJ I;  1J9I A;  5IT9 K;  3GTK J;  1TW3 A;  2IW5 A;  2V4J C;  2XF5 A;  1HW5 A;  2YU3 A;  4OIN F;  2R4G A;  3VDX A;  2ZJQ F;  2MH2 A;  3CDH A;  3I4P A;  1YS6 A;  2BOL A;  2EFN A;  3QPH A;  1B8I B;  5CQE A;  5FLX Z;  4KA4 A;  1DPU A;  4IHY A;  5ERI A;  3WTT C;  2MW8 A;  1HC8 A;  4X1E A;  5GAD J;  2PFB A;  1QZY A;  1WJD A;  1OCZ H;  2UWM A;  2FA5 A;  1LEB A;  4P9U A;  4LOC A;  1S7E A;  1E0E A;  3PL8 A;  4PJJ A;  4XN0 A;  1Z67 A;  3QYE A;  4PGH A;  3DP7 A;  1GV2 A;  3K4K A;  1Z21 A;  1ULY A;  2IJL A;  4AVP A;  2OCC H;  2V1X A;  3QP5 A;  2XKO A;  3PO3 J;  1OPC A;  3LWF A;  4E7I A;  1G3W A;  5D5X B;  2HPM A;  2LTP A;  2XKP A;  1TT5 B;  1JXS A;  2DA4 A;  1X3U A;  3DV8 A;  3IV5 A;  2QGU A;  4A3K J;  3CF2 A;  3BQZ A;  2UZK A;  5BMZ A;  2HVQ A;  2LP0 A;  3KZI C;  3E6B A;  3N97 A;  5EYR A;  5TJJ A;  1BBY A;  5E1X A;  1SD5 A;  3FK6 A;  3S14 J;  1B59 A;  3ABL H;  3BOQ A;  3VFZ A;  4R8H A;  1WCM J;  4W1U A;  5CVV A;  4OOI A;  5B3S H;  4HV6 A;  2AQF A;  5FKL A;  4Y3O A;  5FKO A;  4RB1 A;  2HYJ A;  3M7G A;  4G7O F;  3VOD A;  1YS7 A;  4FX4 A;  4IRI A;  1XMX A;  1TC3 C;  1TT0 A;  2R93 J;  4UUS B;  3JW4 A;  3JRG A;  3HPH A;  1HW1 A;  4AC0 A;  4BBS J;  2P7V B;  4PDK A;  5K5Q A;  3H3U A;  3RSN A;  3LA2 A;  2XAG A;  4IVN A;  4E7S A;  5L3D A;  3G1L A;  3HJE A;  3F72 A;  1D5Y A;  1XSV A;  1F43 A;  3GBG A;  1A36 A;  1WFX A;  3OIQ A;  5JLX A;  3MVP A;  4L5I A;  2MC3 A;  1XMK A;  3CCV I;  4A6D A;  2VT2 A;  1OCO H;  2VOP A;  2FBK A;  4NNJ A;  4PZJ A;  1UST A;  2R7S A;  2NVX J;  3ML6 A;  3QYF A;  2WC2 A;  2X6Y A;  4MLO A;  5LBQ A;  4O6J A;  3L09 A;  3OIO A;  2CU7 A;  2IBD A;  1WJC A;  4UV9 A;  5LD2 C;  1RZ4 A;  1SD7 A;  4I0A A;  1G59 A;  4DZP A;  3DTK A;  4I98 B;  3RDI A;  1LQ1 A;  1RUO A;  1EH8 A;  3DCF A;  1QU3 A;  2XGE A;  2CGP A;  3JRA A;  4OAZ A;  1A35 A;  1F5T A;  1OJL A;  3MQ0 A;  4E7K A;  1J2X A;  2L4M A;  4A5N A;  3HTS B;  2ZME B;  1DDN A;  2OZ6 A;  2KRH A;  1X1C A;  3TW6 A;  4AD9 A;  3BTL A;  1BI0 A;  2XB0 X;  4UVB A;  2HR3 A;  2Y69 H;  3FXK A;  2H6B A;  4N9H A;  2ESN A;  3D5S C;  1A04 A;  2LF7 A;  4ZYD A;  2K3P A;  1JGS A;  1VQ9 I;  1MBH A;  2PBI A;  2OUM A;  2CWE A;  1X3Z B;  4U7B A;  2VQG A;  2LLK A;  4NQW A;  3W2A A;  2EIL H;  2V1U A;  1U6G A;  2D2W A;  2L54 A;  3COA C;  3ZQL A;  2DFF A;  2DOD A;  2E1M C;  3G71 I;  4XLA A;  4WXH A;  3RZD J;  4MGR A;  2EFQ A;  4RMN A;  4Q4Z F;  1T2K A;  2JN6 A;  1IDZ A;  1DUX C;  5B66 C;  2LY9 A;  3OIP A;  2ZXJ A;  2LKX A;  3SJM A;  2EBI A;  3DU6 A;  1BOA A;  3A4C A;  3PNT A;  4HF2 A;  2OZU A;  4EJT A;  1JKO C;  2EV5 A;  1WWX A;  4II2 A;  4HQM A;  2VKE A;  2COB A;  5KK1 A;  2DMP A;  2Y48 A;  3ASN H;  1S6L A;  3L1P A;  1SAN A;  1XGM A;  1WI3 A;  1HOM A;  5LGT A;  3OYJ A;  4V19 K;  1IJW C;  4E7L A;  1FPQ A;  2VXD A;  4Y15 A;  3TDZ C;  3JR9 A;  1P9Q C;  5D5U B;  3K69 A;  2GLO A;  4HLX A;  2WAE A;  2XAJ A;  4XLP F;  4YG2 F;  1KU2 A;  1I3Q J;  3FXQ A;  2HVR A;  3M9A A;  2LKP A;  3NAU A;  5HDK A;  2DJN A;  2L9V A;  5EEH A;  2ZXI A;  4N4N B;  2NAZ A;  4B3A A;  5FO5 A;  2FOK A;  1OYY A;  3IAS 2;  4BXU A;  3BR5 A;  3KZY A;  3F0C A;  1NH3 A;  2RNG A;  2A69 F;  3S16 J;  1XGS A;  2WB1 A;  4XLN F;  1Y1W J;  5FRM A;  4A93 J;  2MBF A;  4BQA A;  4I76 A;  2K40 A;  1ETK A;  1U5T B;  2W82 A;  2P0W A;  1IV6 A;  3GTM J;  3CLO A;  3DEE A;  4IF4 A;  5J6X A;  3Q0U A;  1LVA A;  4U0Y A;  3S3O A;  2BVL A;  3GZ5 A;  3HEF A;  2VE9 A;  2LBF A;  2WY8 Q;  1R00 A;  5L3G A;  3ZMT A;  4B1R A;  3MWM A;  2JTV A;  1TQI A;  3BT9 A;  4XRM A;  4ITV A;  1ETX A;  4F92 B;  2EPF A;  1X2N A;  3S8P A;  4UUT A;  3CUO A;  2L4A A;  2QSG X;  3HRM A;  3FXJ A;  3L00 A;  2HDW A;  2H94 A;  4CCJ A;  3J80 Z;  2ZJR F;  1TWH J;  2F5E A;  4XSX F;  1MMS A;  1S8N A;  4HX7 A;  2CJJ A;  2O9L A;  4PCQ A;  1TP4 A;  2GAU A;  2FMY A;  1IN7 A;  4G94 A;  4NBQ A;  1T39 A;  2R5Y B;  2E36 A;  1BM9 A;  1OKR A;  3C2B A;  4ENJ A;  1ZTR A;  2BY2 A;  1XG1 A;  3IAM 2;  3BJA A;  3WGH A;  4XLF A;  5GAH J;  3CCR I;  4A3L J;  1VQ5 I;  1SFX A;  1KYW A;  1S7A A;  2WAQ N;  3RYR A;  3ZQI A;  4XRS A;  1QPI A;  3ERE D;  2VJ4 A;  2PMH A;  1H89 C;  3ISP A;  3KFW X;  4RGR A;  1BIB A;  4BXF A;  2E35 A;  2LYC A;  1D1A A;  2XF7 A;  3QPL A;  1X1A A;  2W1O A;  2V1N A;  1JUM A;  5DCM B;  5FLM J;  5LEJ A;  2MLK A;  2PMU A; 
#chains in the Genus database with same CATH homology
 2ZNY A;  1R22 A;  1KYZ A;  4L5J A;  3GFI A;  2P7C B;  3JAM K;  1QO0 D;  2HQN A;  4UHT A;  1XN7 A;  1ODD A;  3HTU A;  3FF5 A;  1IZ1 A;  2QQA A;  4UVC A;  1XMA A;  2Q0O A;  4L9J A;  3IL2 A;  1D8J A;  3GX4 X;  3CUQ A;  1FYL A;  1IXR C;  1IUY A;  1K6O A;  4WF2 A;  3QU6 A;  1Z9C A;  1XGO A;  4EJU A;  2HYG D;  3DKW A;  1SFE A;  2K4B A;  3JSP A;  2P4W A;  4BNC A;  4DQ2 A;  2KRF A;  1PP8 F;  1K78 A;  2VT3 A;  1P4X A;  1ZRE A;  1CGP A;  3WTS C;  1HBX G;  2NRA C;  1G6N A;  2QYO A;  4IRH A;  3BPV A;  2DFI A;  5DV5 A;  2R7D A;  5F64 A;  3SZP A;  1LDD A;  2MD5 A;  3HYI A;  4HLY A;  3HRS A;  3FXR A;  2GXB A;  4LK0 F;  3L2C A;  1R7J A;  1FP2 A;  1HXD A;  2Z99 A;  5HDN A;  1MJB A;  1EV7 A;  3T0Y A;  2CQK A;  1RI7 A;  1B1B A;  2Y75 A;  2HQR A;  3E6M A;  2E7W A;  3GW2 A;  3M1E A;  2IPQ X;  5CLS A;  2ADU A;  3I53 A;  1D3Y A;  1GXP A;  2ESH A;  3QU3 A;  4G9Y A;  1O3Q A;  1HST A;  2CW0 F;  1QPM A;  5DUK A;  1IXC A;  4M71 A;  1STZ A;  2DLL A;  3FZV A;  4EJO A;  1G3S A;  3LQR A;  3DQV C;  2QEN A;  3HRT A;  4BHC A;  1TQM A;  4RGS A;  3LA3 A;  4O5V A;  3F3X A;  5F1R A;  2HKX A;  1ZN2 A;  5JVT A;  5IT9 Z;  2XIG A;  4LD5 A;  4LJZ F;  1MKM A;  5D4S A;  2VC0 A;  3T8T A;  1FT9 A;  2XRO A;  2Q2E A;  2IVM A;  3FMR A;  2Z33 A;  4UUV A;  5ILS A;  5IT3 A;  2QQB A;  1FBS A;  2XAS A;  4LB6 B;  1E2X A;  1S3J A;  2BEO A;  4HV5 A;  2EFP A;  5D8K B;  1J0R A;  4RB2 C;  5ICE A;  1H0M A;  2FRH A;  3ZMS A;  5A2Q Z;  4RAY A;  2LF8 A;  3LAP A;  3GFM A;  1BJA A;  5LRR A;  4ON0 A;  4I0B A;  3BJO A;  1ZLJ A;  5CVR A;  1ZG1 A;  4MHG A;  5DDG A;  1IXS B;  4ETS A;  4R79 A;  5E18 F;  2STT A;  3I5U A;  1IN5 A;  2DQL A;  1HKQ A;  4KNY A;  1K7A A;  3HIF A;  3KZZ A;  4YFK F;  1QNT A;  4A6E A;  4HOB A;  2STW A;  5DD4 A;  5LHH A;  2W57 A;  3KP7 A;  4EJV A;  5HS9 A;  1KGS A;  1I1S A;  5DCM A;  2H09 A;  2MA3 A;  2Z5U A;  4N0B A;  1U8R A;  3EYI A;  2VBW A;  3TO6 A;  3GEZ A;  1O57 A;  1WQ2 A;  3TO9 A;  2H6C A;  1Y0U A;  4Q5S F;  1NHA A;  2HFH A;  4A12 A;  1P6R A;  4Y13 A;  3EYY A;  4GCV A;  1CF7 B;  1OYW A;  3CO7 C;  4F7Z A;  4JBA A;  1XGN A;  2GWR A;  3ABU A;  1ZG5 A;  3IHU A;  3TQN A;  1TLH B;  1RIO H;  3W6K B;  4HDU A;  2A6E F;  5D8L B;  3KP5 A;  3B73 A;  5HOO A;  4EV0 A;  3KP6 A;  4NHJ A;  5HS7 A;  2P6S A;  4WXD A;  1FLI A;  4CDG A;  1TW2 A;  4LFU A;  4RGU A;  3K0L A;  1R5G A;  3H92 A;  4L9T A;  2ELH A;  4ZYG A;  3E6C C;  2JPB A;  3E5U A;  1FX7 A;  2F5F A;  1IN8 A;  2M30 A;  4GYI A;  1YYV A;  3TKY A;  4ENK A;  2A5Y B;  4BAY A;  1SMY F;  1XB4 A;  3SXY A;  1XCB A;  2FE3 A;  3BP8 A;  1MDM B;  2O3F A;  3C1D A;  4AIK A;  2HS5 A;  4G7H F;  3GFL A;  4KN7 X;  3G3Z A;  1FY7 A;  3F23 A;  2R3S A;  4LK1 F;  1ONV A;  4LGW A;  3BZ6 A;  1IN4 A;  3F6O A;  1TNT A;  1R23 A;  4S04 A;  1HQC A;  4M9S A;  3V7S A;  2EFW A;  3I58 A;  3F22 A;  3J7A O;  2J5P A;  1MD0 A;  1LDJ A;  1YO5 C;  5E8G A;  4FHT A;  3V8L A;  2FF4 A;  2P8T A;  5AIQ A;  4ZH4 F;  2ZJ2 A;  3QOP A;  5JR3 A;  4LG0 A;  3U9G A;  1FOK A;  2WTE A;  5BQT A;  3F6V A;  1V3F A;  3JTH A;  3WTV C;  1H9T A;  1PUE E;  1W4M A;  3WGI A;  1IF1 A;  2E1C A;  5D6E A;  2DQR A;  1UFM A;  1OR7 A;  3FWE A;  1T98 A;  3HSF A;  5K1Y A;  2HKO A;  4UXN A;  3ULQ B;  2PQ8 A;  2M8E A;  1O3S A;  2A68 F;  2QWW A;  2HWV A;  2QUF A;  1BC7 C;  5TRD A;  3RPU A;  2QZ8 A;  3CO6 C;  2YSR A;  4U0W A;  4CYD A;  2Z3Y A;  1T38 A;  1XSX A;  3MZY A;  2FBH A;  4IHS A;  1JE8 A;  2ISZ A;  2DT5 A;  3Q9S A;  5FLX K;  3NQO A;  2G9W A;  4ZYH A;  5ICG A;  4AIH A;  4D0P A;  2DPU A;  5AIP A;  1IAW A;  2IA1 A;  2XVC A;  5H6Q A;  2RC4 A;  4ZZD A;  2GZW A;  3QP6 A;  3W6J B;  2D45 A;  3KCC A;  2PLY A;  3FM3 A;  4O3M A;  1TTY A;  4M9X A;  4IXA A;  2DAO A;  3OV8 A;  3VEP A;  1FSE A;  2FNA A;  4WCG A;  3KE2 A;  4CXF A;  1BI1 A;  4B8X A;  1TNS A;  3BY6 A;  4EVI A;  3OOP A;  5D5W B;  2J5O A;  1AWC A;  4EM1 A;  1V4R A;  3KEQ A;  5DYM A;  5LGU A;  3K1N A;  1IN6 A;  5LHI A;  3ECO A;  1SFU A;  4U0V A;  2B0L A;  2ZNZ A;  2E7X A;  2A3S A;  1IRF A;  1QBJ A;  1YW8 A;  2DU9 A;  4BH9 A;  1WI9 A;  2ISY A;  3F21 A;  2XRN A;  4AWX B;  2A6H F;  1XD7 A;  3MZH A;  2PJP A;  1USS A;  1VTN C;  4OU0 A;  2K02 A;  3GUD A;  2HGC A;  5KVR A;  4LLN A;  3KEO A;  2YX7 A;  2NNY A;  4A2U A;  1W5T A;  3KLO A;  5LRS A;  2EJR A;  1I6X A;  4HX4 A;  2P5V A;  2EV0 A;  2COM A;  1YLF A;  2QM3 A;  4RB0 A;  1YQA A;  1ON2 A;  1R58 A;  1MDM A;  1UCR A;  3S2W A;  4MQ9 F;  5L3B A;  2H27 A;  2EWN A;  5E20 A;  2DBB A;  4IRG A;  5FFX A;  3KET A;  1FNN A;  2JSC A;  5DD8 A;  2DTR A;  4M6Y A;  4IJA A;  3VOE A;  2RNJ A;  2ZCW A;  2V1D A;  4LB5 A;  3RKW A;  3R4K A;  5HVQ C;  2XAQ A;  5CVJ A;  1P4W A;  2PI0 A;  2JRT A;  1OYI A;  1F9N A;  4OMY A;  4P9F A;  1FSH A;  4YFX F;  2XUB A;  3RIR A;  3HHG A;  2Q8K A;  3V8J A;  3MEX A;  3V7R A;  3CUQ C;  1ZAR A;  2ZFW A;  1KQ9 A;  1UHM A;  3K2Z A;  3RPQ A;  3GXO A;  3HOT A;  4DNC A;  4L0Z B;  4ASN A;  2FNP A;  1ZG3 A;  5BPD A;  3O6B B;  3EUH A;  3FMS A;  3ZQ7 A;  2OD5 A;  4RGX A;  6PAX A;  1L3L A;  4TV7 A;  4GYG A;  1F1Z A;  3RJP A;  3Q5F A;  1KU3 A;  5EEG A;  2ZME A;  1T6S A;  2HTS A;  3N4M A;  3R0J A;  2O6G E;  3ZPL A;  1J59 A;  1EH6 A;  3T1B A;  3TO7 A;  5K5O A;  3MFK A;  2PN6 A;  1ZHF A;  4HF1 A;  2G7H A;  3EET A;  4R1H A;  4QWQ A;  1J75 A;  3ZN0 A;  1FWZ A;  5LGN A;  1R1V A;  1YTY A;  4YFN F;  2FML A;  1GHC A;  5FB2 A;  2TDX A;  4OMZ A;  3WU1 B;  3D5L A;  2EA2 A;  2F5D A;  1TBX A;  3K1P A;  4I09 A;  1WKM A;  3KP2 A;  4L9V A;  3GFJ A;  1MJA A;  2HDC A;  3SHF A;  2W85 A;  1HW2 A;  4I01 A;  3LFK A;  4HX8 A;  3J81 K;  1SMT A;  2IRF G;  2L01 A;  4U7D A;  1RNL A;  2VBY A;  2CO5 A;  4HAM A;  2RVC A;  3MAJ A;  2GA1 A;  5F6F A;  5FD6 A;  1I27 A;  1J7K A;  3PFI A;  5JHU A;  2KJB A;  3LAJ A;  1U5T A;  3REO A;  2LDU A;  3JSO A;  4P96 A;  5BS6 A;  2K27 A;  1FYM A;  4HQE A;  2WV0 A;  2CFX A;  3RYP A;  4A0Y A;  2E1N A;  1B9M A;  2RV8 A;  3HSE A;  5D5V B;  4Q47 A;  2XAH A;  5E1Z B;  1BC8 C;  2VON A;  2JPC A;  3KP3 A;  1YW9 A;  1SAX A;  3SZT A;  3ZP5 A;  2DW4 A;  2FXA A;  2JT1 A;  1FP1 D;  3WTZ A;  2IP2 A;  2VN2 A;  3BPX A;  1Z6R A;  3SFZ A;  3WU0 A;  3I59 B;  3DEU A;  2R7F A;  1HSJ A;  4A0X A;  2C6Y A;  3SQN A;  1O3T A;  5LHG A;  1D5V A;  4KMF A;  3GVA A;  4LMY A;  3ZMZ A;  3QAH A;  4RB3 C;  3ECH A;  4ZYE A;  4CO8 A;  2ETH A;  3DXJ F;  2A61 A;  1P2F A;  2HYF A;  2L02 A;  4G6D A;  4MNU A;  2O8X A;  2BGC A;  3IRR A;  2BE5 F;  3BWG A;  1HKS A;  4ESF A;  3IC7 A;  2QQ9 A;  3I54 A;  3HUG A;  3C3W A;  2RN7 A;  3H3Z A;  1G3Y A;  3MCZ A;  4ESB A;  4KIC A;  3IWZ A;  1Z6T A;  2GIV A;  5HLG A;  1KA8 A;  1XSD A;  3ZMD A;  4HZF A;  5L3F A;  2IT0 A;  5HDG A;  5H20 A;  3RKX A;  3Q9V A;  3V8K A;  2V6C A;  2V9V A;  2MLG A;  2FBI A;  4GO1 A;  1JHH A;  2EFO A;  4XSZ F;  3WTW C;  3I71 A;  3P9I A;  2BBY A;  1XDU A;  1ZRF A;  4FX0 A;  3PQJ A;  3LST A;  5BOX A;  3JTG A;  2O0Y A;  3R0A A;  3CUQ B;  4CGZ A;  1R1U A;  5ILV A;  3C18 A;  1B6A A;  5LEK A;  3DPT A;  2FSW A;  1I1G A;  5A2Q K;  2UXN A;  5JFR A;  3E97 A;  2NS0 A;  2MH9 A;  2DK5 A;  1YG2 A;  2Z9O A;  4L0Y B;  3E5Q A;  1K78 B;  2IA2 A;  3GO5 A;  3LQQ A;  4ZZL A;  3P7N A;  4OIR F;  2W24 A;  3GLX A;  1IRG A;  5BPI A;  5ICC A;  3GZ6 A;  3EQL F;  5DEQ A;  2VE8 A;  4UNO A;  1W7P D;  2A07 F;  5HLH A;  4B09 A;  1YW7 A;  4GXO A;  3HRU A;  2GA2 A;  3E3V A;  2O03 A;  4CHU A;  3ELK A;  3T8R A;  4N9I A;  3C7J A;  3U2R A;  2KIF A;  3FMQ A;  1DP7 P;  3FM5 A;  4P5O A;  2FU4 A;  1PP7 U;  2ZKZ A;  1F4K A;  3G73 A;  1L0O C;  1IW7 F;  1FBU A;  3JAM Z;  3HSR A;  5ILU A;  3QRF F;  4BHB A;  2M1B A;  4UV8 A;  2GQQ A;  3WG9 A;  4I7H A;  1Z05 A;  2RDP A;  3BDD A;  3B02 A;  3HOS A;  1J5Y A;  3TDU C;  2OQG A;  5K5R A;  1O7L A;  1G3T A;  3I64 A;  3WTY C;  3ZN1 A;  2QBY B;  1HKT A;  1B4A A;  2AS5 F;  1FYK A;  1YFH A;  4KYW A;  1QZZ A;  1E17 A;  2VXZ A;  1ZH5 A;  4NB5 A;  1LEA A;  3T5X A;  1H9G A;  3U1D A;  1W7P B;  2EB7 A;  1D8K A;  4FT8 A;  2HZT A;  4OIQ F;  2EV6 A;  4JK1 X;  1TQP A;  3BJ6 A;  4EQQ A;  1K79 A;  3WE3 A;  2XHK A;  1Z1D A;  4MTE A;  4KMU X;  1ZGA A;  2PG4 A;  4MQV A;  3I59 A;  1S29 A;  2OU2 A;  2K4J A;  3D0S A;  5E8I A;  5DUI A;  2K86 A;  3DPL C;  1C0W A;  2VOD A;  4EM2 A;  3ZMU A;  4KN4 X;  2M45 A;  5CJ9 A;  3DF8 A;  5AON A;  5CVI A;  1DPR A;  5J8C A;  3KLN A;  3KP4 A;  1CF7 A;  1SD4 A;  4CIC A;  1XCV A;  1UB9 A;  4A0Z A;  4WXC A;  4RS8 A;  2IA0 A;  5ED4 A;  4UVA A;  4OIP F;  1WSU A;  3K1M A;  3RKY A;  1LB2 A;  2YX4 A;  4EM0 B;  4KIF A;  2NYX A;  2YPR A;  2F5C A;  4MTD A;  1ON1 A;  1MJ9 A;  1I5Z A;  2OA4 A;  2P5L C;  4S05 A;  5HLI A;  2JZY A;  3WE2 A;  3CJN A;  3F8C A;  2HOE A;  2M5W A;  1BIA A;  4U88 A;  5J8F A;  3LA7 A;  4MEX F;  3O2P E;  3R6S A;  1ZLK A;  2DPD A;  2W25 A;  1Z91 A;  3GF2 A;  1MZB A;  2X0L A;  1FC3 A;  2KJC A;  3GWZ A;  2O61 A;  3J81 Z;  4KUM A;  1GXQ A;  2ACJ A;  1SD6 A;  3I0T A;  3ROU A;  2ZBK A;  4HBL A;  2G7U A;  2VBX A;  2LSO A;  3DFG A;  4KFC A;  4M9Z A;  3FHZ A;  3TOB A;  2GXG A;  2W84 A;  4M74 A;  3IKV A;  3F8M A;  3O3K A;  3M8F A;  5E1W A;  5CYV A;  4M72 A;  1FZP B;  3V7C A;  4IPA A;  4Y17 A;  3L9F A;  5DCF A;  3P9C A;  1GVJ A;  1BI2 A;  2KIU A;  2VC1 A;  4L9N A;  4CZZ A;  2CSO A;  4ENM A;  1UHW A;  3ZMV A;  3K9T A;  3WGG A;  2Y0M A;  3CTA A;  3PQK A;  4HA8 A;  4ENN A;  1KQ8 A;  1U2W A;  3V4G A;  4EGZ A;  4XBF A;  2AXL A;  4HDV A;  3FXU A;  2F2E A;  2VOO A;  4G7Z F;  2BV6 A;  3AAF A;  3NEU A;  2OBP A;  4LLG F;  4I02 A;  5L3E A;  4IHT A;  1ZRD A;  2HTJ A;  3E6D A;  3R61 A;  5JI6 A;  3E5X A;  2CG4 A;  2X4H A;  3J80 K;  1ZYR F;  2DK8 A;  1JHF A;  4EGY A;  4G8X A;  1RUN A;  2LNB A;  5FGM A;  1OMI A;  2KKO A;  4HF0 A;  4H0E A;  5L3C A;  1KU7 A;  2QVO A;  2ZO4 A;  3M8E A;  1LNW A;  4LG0 B;  2YR2 A;  5CVU A;  4XRF A;  1KQ0 A;  3QPT A;  2VBZ A;  3IKT A;  4QLC U;  4BYY A;  3R60 A;  2OQR A;  1R36 A;  5HS8 A;  2QBY A;  1MGT A;  2OAZ A;  4OIO F;  1W5S A;  4KDP A;  3RI4 A;  3F8B A;  1LJ9 A;  1Z7U A;  2XAF A;  4LLL A;  4WWC A;  1AOY A;  1W7P A;  1QQI A;  4HYE A;  2CYY A;  1ZRC A;  1S7O A;  3IWF A;  4Z2Y A;  2EK5 A;  4YIF A;  1R5H A;  1T0F A;  2RQP A;  4E70 A;  3IRQ A;  4P55 A;  2XV4 S;  4ESJ A;  1EH7 A;  1REP C;  4JQF A;  4RAZ A;  2D1H A;  2HEO A;  2BYV E;  4EJW A;  4MEY F;  1B9N A;  4Q48 A;  3F8N A;  2DI3 A;  2V79 A;  4A5M A;  1ZAO A;  2PEX A;  2P6T A;  5D4R A;  4L18 B;  4WX9 A;  4G6Q A;  3P9K A;  5D6F A;  5FFZ A;  5LLQ A;  1ZGJ A;  4KIG A;  3WTX C;  3WTU C;  2NNN A;  1LDK B;  1R1T A;  2UXX A;  1U5T C;  2EA4 A;  4I2O A;  1XDS A;  1PDN C;  1U3E M;  1FBQ A;  2KIM A;  4M73 A;  1KU9 A;  5E17 F;  4KIB A;  3FX3 A;  2P5K A;  3RTR A;  2FEZ A;  4AIJ A;  3GYH X;  3TGN A;  1WRJ A;  2K7L A;  1BN5 A;  4GGG A;  2L3D A;  4PGG A;  5H6R A;  2XGX A;  1P92 A;  4K2E A;  1U78 A;  2FQ3 A;  5FD5 A;  2M87 A;  2D1V A;  3ABT A;  3NRV A;  2QLZ A;  4M6X A;  1G4D A;  3BRO A;  2DO7 A;  1YIO A;  5ICF A;  4EMS A;  3F8F A;  1BI3 A;  4YII A;  2WWY A;  3HHH A;  4HW0 A;  3WOD F;  3TOA A;  3VB2 A;  4WK8 F;  1O7F A;  2RKH A;  3EDP A;  1O3R A;  1Q1H A;  1QGP A;  3L7W A;  4KT5 C;  1P4A A;  4BHP A;  2RGV A;  1J9I A;  5IT9 K;  1TW3 A;  2IW5 A;  1HW5 A;  2YU3 A;  4OIN F;  2MH2 A;  3CDH A;  3I4P A;  1YS6 A;  3QPH A;  2EFN A;  4KA4 A;  5FLX Z;  1DPU A;  5ERI A;  3WTT C;  2PFB A;  1QZY A;  2UWM A;  2FA5 A;  1LEB A;  4P9U A;  4PGH A;  3DP7 A;  1ULY A;  2IJL A;  4AVP A;  2V1X A;  3QP5 A;  2XKO A;  1OPC A;  3LWF A;  1G3W A;  5D5X B;  2XKP A;  1JXS A;  1X3U A;  3DV8 A;  2UZK A;  5BMZ A;  3E6B A;  3N97 A;  5TJJ A;  1BBY A;  5E1X A;  1SD5 A;  1B59 A;  3BOQ A;  3VFZ A;  4R8H A;  5CVV A;  4OOI A;  4HV6 A;  4RB1 A;  3M7G A;  4G7O F;  3VOD A;  1YS7 A;  4FX4 A;  4IRI A;  3JW4 A;  1HW1 A;  2P7V B;  4PDK A;  5K5Q A;  3H3U A;  3LA2 A;  2XAG A;  4IVN A;  5L3D A;  3F72 A;  1XSV A;  4L5I A;  2MC3 A;  1XMK A;  4A6D A;  2VT2 A;  2VOP A;  2FBK A;  4PZJ A;  1UST A;  3ML6 A;  2WC2 A;  5LBQ A;  4O6J A;  3L09 A;  4UV9 A;  1RZ4 A;  1SD7 A;  4I0A A;  4I98 B;  3RDI A;  1LQ1 A;  1RUO A;  1EH8 A;  2CGP A;  1F5T A;  3MQ0 A;  1J2X A;  2L4M A;  4A5N A;  3HTS B;  2ZME B;  1DDN A;  2OZ6 A;  4AD9 A;  1BI0 A;  4UVB A;  2HR3 A;  2H6B A;  4N9H A;  2ESN A;  1A04 A;  2LF7 A;  4ZYD A;  1JGS A;  2PBI A;  2CWE A;  4U7B A;  4NQW A;  2V1U A;  3COA C;  1U6G A;  2D2W A;  2L54 A;  4WXH A;  4MGR A;  2EFQ A;  4Q4Z F;  1T2K A;  1DUX C;  2ZXJ A;  1BOA A;  4HF2 A;  2OZU A;  4EJT A;  2EV5 A;  1WWX A;  4HQM A;  5KK1 A;  2Y48 A;  1S6L A;  1XGM A;  5LGT A;  1FPQ A;  4Y15 A;  3TDZ C;  5D5U B;  3K69 A;  4HLX A;  2XAJ A;  4XLP F;  4YG2 F;  1KU2 A;  3FXQ A;  3M9A A;  2LKP A;  5HDK A;  5EEH A;  2NAZ A;  5FO5 A;  2FOK A;  1OYY A;  4BXU A;  3KZY A;  2A69 F;  1XGS A;  4XLN F;  2MBF A;  4BQA A;  1U5T B;  3CLO A;  4IF4 A;  5J6X A;  4U0Y A;  1LVA A;  3GZ5 A;  2VE9 A;  1R00 A;  5L3G A;  3ZMT A;  3MWM A;  2JTV A;  1TQI A;  3CUO A;  2L4A A;  3HRM A;  3L00 A;  2H94 A;  3J80 Z;  2F5E A;  4XSX F;  1S8N A;  4HX7 A;  4PCQ A;  2GAU A;  2FMY A;  1IN7 A;  4G94 A;  1T39 A;  1BM9 A;  1OKR A;  4ENJ A;  3WGH A;  3BJA A;  1SFX A;  1KYW A;  1S7A A;  3RYR A;  3ERE D;  2PMH A;  3ISP A;  3KFW X;  4RGR A;  1BIB A;  5DCM B;  5LEJ A;  2MLK A;  2PMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...