5D5UB

Crystal structure of human hsf1 with hse dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
100
Chain Sequence
b'SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEERDDTEFQHPCFLRGQEQLLENIKRKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock Element DNA
publication title Structure of human heat-shock transcription factor 1 in complex with DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 26
structure length 100
sequence length 107
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d5uB00
1G3WA 4M74A 3GEZA 1RIOH 3VOEA 3FMSA 5FB2A 3F3XA 2KIMA 2XV4S 5A2QK 4BHBA 1STZA 2IJLA 5FD6A 3HRMA 3BJOA 4XBFA 3P9IA 4KN7X 4KNYA 3FZVA 3KP2A 1C0WA 2C6YA 3E6CC 2HQRA 5AIPA 4HV5A 1RUNA 2HZTA 3FM3A 4L9JA 4HV6A 5ICGA 4P55A 2MLGA 2QENA 4IJAA 3LA2A 1G6NA 4HAMA 2ESNA 1MKMA 2KJBA 2W24A 5LRSA 2O8XA 1RI7A 1FBQA 1ZG5A 2QWWA 4ON0A 5D5UB 2UWMA 4I02A 1X3UA 3HTUA 5E8GA 2ZJ2A 4OIOF 5K1YA 1J7KA 4LK1F 1TTYA 2HKXA 2X0LA 3CLOA 3L00A 3WE2A 4IF4A 5LBQA 2KKOA 3P9KA 4S05A 3HSFA 1GVJA 1T2KA 2NRAC 2J5PA 3FXUA 4JQFA 2EA4A 5E18F 4GGGA 1ZYRF 1FC3A 2BE5F 4NHJA 3REOA 1XSVA 4EGYA 2HDCA 1PP7U 2HFHA 3F22A 2YSRA 2B0LA 1MZBA 1BI3A 3BOQA 2D1VA 3KLOA 2EB7A 2O03A 2HWVA 3ML6A 3U9GA 1DPRA 1J5YA 2K4BA 3I58A 1HQCA 3R60A 2A69F 2XAQA 4XSXF 3BWGA 2DI3A 5L3BA 4JBAA 2EJRA 3GW2A 3GWZA 2ZO4A 2XHKA 1FLIA 3LSTA 3RIRA 3I5UA 4M72A 4MGRA 5L3FA 4I2OA 2LF7A 2RVCA 1HSTA 4WCGA 2QVOA 2K86A 2L4MA 1TLHB 5E1XA 3WTZA 5LLQA 4ZZLA 2M87A 3QOPA 4CYDA 5FD5A 1XSDA 4I98B 2XUBA 3LQQA 3WTSC 2QQBA 2NS0A 2FQ3A 1B9MA 1P92A 2GA2A 1SFEA 5BPIA 1WWXA 3BPXA 1OR7A 5HLHA 1YW8A 4HBLA 4N0BA 2F5FA 1L3LA 1YW7A 3E5QA 3GFJA 2STWA 5BPDA 5LGTA 3RJPA 1TQPA 1P4AA 2FMYA 1SFXA 3FMQA 2P8TA 3GZ6A 2QBYB 3FWEA 3R0JA 2L02A 2YX7A 5H20A 1CGPA 1I1SA 5CVVA 3JTGA 3HHGA 4U0WA 3ZN1A 4YIIA 3PQKA 3BROA 4EJVA 4LG0B 1J59A 1LDDA 1LDKB 1U5TB 2RNJA 1QGPA 4YG2F 3QPTA 5FLXK 3KEOA 2CSOA 2OQGA 4HF0A 3BJAA 5DCMB 1J2XA 1FP1D 1QZZA 4HLXA 2RV8A 5D8LB 4RGRA 1UHWA 5JI6A 4MEYF 2A6EF 1KU2A 2GXBA 1UHMA 1HSJA 5K5QA 3I54A 5L3EA 5DUIA 3PFIA 4HX8A 4RS8A 4BH9A 1MJAA 1LB2A 1XGSA 1NHAA 3SFZA 1SMTA 2HR3A 2QQAA 1RZ4A 5HLIA 3GX4X 2IW5A 2PMHA 3O2PE 4UV9A 4BQAA 1KGSA 4EM2A 3EETA 3KP7A 1W7PA 4XLPF 3I64A 4G6DA 4RB0A 1R58A 1T98A 2FE3A 2VBXA 1LQ1A 4MTDA 1BC8C 4HW0A 2P5LC 3RPUA 2HYFA 5J8FA 2JSCA 1ZRFA 4Z2YA 4FHTA 1J0RA 2M45A 1LVAA 3HOTA 4YFXF 4UHTA 1H9GA 2YX4A 3I59A 3ABUA 3SHFA 1E17A 2Z5UA 1O7FA 2VC1A 3J7AO 4YFKF 2EV6A 2K7LA 1SD7A 4WXDA 2IT0A 1OYIA 3L09A 3EDPA 3T0YA 4O6JA 4IXAA 2Q0OA 2QUFA 1B6AA 2WWYA 3F8MA 1ZLKA 1KQ9A 4YFNF 2L3DA 3U2RA 2ZMEA 1JXSA 1FT9A 2O0YA 3MZHA 1BI2A 1B4AA 5TRDA 1QBJA 1IW7F 1GHCA 5D5XB 3LAPA 4G6QA 4I01A 3SZTA 1I6XA 2YPRA 4KMFA 1G3YA 3GZ5A 5HDKA 2EFWA 1HW2A 4KT5C 3E97A 4LD5A 3M9AA 3KFWX 2ACJA 4JK1X 4EJTA 1TNSA 4IRIA 1U2WA 4WK8F 4HF2A 3GVAA 5DV5A 3HSRA 1MDMB 1R1UA 4R1HA 1HKTA 2OZUA 2V79A 1D3YA 2STTA 4LLNA 5IT9Z 3NQOA 3RDIA 3TOBA 2MBFA 1FX7A 4OMZA 3T8TA 1SD4A 2R7FA 1Z9CA 2X4HA 4F7ZA 2Z99A 5HLGA 1KQ0A 1ZHFA 3P9CA 2MD5A 2ZNZA 4ZYEA 2XASA 2PBIA 2XGXA 4WWCA 2XKPA 4EJUA 4WF2A 4DQ2A 5KVRA 2QQ9A 3CTAA 2L4AA 3IWFA 1CF7A 1MJBA 2J5OA 2ISYA 2KIUA 3F6VA 3QU3A 1BIAA 3IC7A 5D4RA 3NEUA 1IZ1A 1SFUA 2XIGA 4KDPA 4HX7A 2JT1A 1IN5A 2H27A 2EV5A 2QZ8A 5FGMA 3TO6A 3WGIA 1Z05A 3TGNA 1S6LA 4KYWA 4AIHA 1ONVA 2DFIA 4RAZA 1F1ZA 4GYGA 5ICEA 2OBPA 2DPDA 3WG9A 4EV0A 4WX9A 2DTRA 4P5OA 2Z3YA 3KZZA 4LB6B 5CVUA 1YYVA 1QQIA 1BC7C 1S8NA 4HF1A 5FLXZ 5ICFA 2HTJA 5HDNA 1FYMA 3D0SA 4ENJA 3HSEA 4U88A 1FYLA 3CUOA 5ILVA 4PCQA 2P7CB 2W25A 1IN4A 2G9WA 3TDUC 1OMIA 4M9SA 4HX4A 3K1NA 2D1HA 1U5TC 1EV7A 4U7BA 2PLYA 1H0MA 2VT2A 4I7HA 4BAYA 2NNNA 1YQAA 2RDPA 1ZGJA 3F8CA 3E5XA 1K78A 4MEXF 2V9VA 4AVPA 5LEJA 3KP3A 2VBWA 4RGUA 4BXUA 3FX3A 1OKRA 4KIGA 5H6RA 5E1ZB 1IRGA 4I0AA 2CQKA 2NAZA 4QWQA 3FXQA 2RKHA 1QNTA 4UXNA 1P2FA 3OV8A 2HGCA 2EFNA 2DW4A 3EYYA 2DQRA 4IPAA 1XSXA 4LGWA 2W84A 4M6YA 1ZG1A 4ASNA 2VE9A 1BIBA 3FXRA 3MQ0A 3E5UA 2D45A 4FT8A 4GO1A 4AWXB 5L3DA 3RYPA 2FRHA 1WQ2A 3SQNA 3VFZA 4QLCU 3ZMZA 4PGHA 5J8CA 3WTVC 3GFMA 1D5VA 1S3JA 1KYWA 1FP2A 5ILSA 1FSHA 4A0ZA 4L5JA 3C7JA 5D6EA 1XCBA 2W57A 3QU6A 2F5DA 1YTYA 2M30A 2JTVA 2IA2A 1ZLJA 1Z7UA 3LAJA 1BN5A 2ZNYA 4NB5A 5D5VB 1I27A 3C3WA 3G73A 3VODA 3O3KA 5F64A 2ADUA 3JAMK 2L54A 2XAHA 4IHSA 1KQ8A 1ZARA 1GXPA 5IT9K 1T6SA 1U78A 4WXHA 2G7UA 1R23A 4P9FA 1USSA 2A07F 5HS9A 3GO5A 1V4RA 4M9XA 1HKSA 1UB9A 5IT3A 3GXOA 1WKMA 4Y15A 5LGNA 2LF8A 4LMYA 2FBHA 1SAXA 4M6XA 4E70A 2EWNA 2WTEA 4A0XA 2DPUA 3HTSB 2A61A 1B9NA 3J80K 4CHUA 3B02A 1IN8A 2VOOA 2ZFWA 3H3ZA 3PQJA 2BBYA 5H6QA 3GF2A 4HOBA 4KIFA 3KEQA 3JSPA 1O7LA 2QYOA 3WTXC 3BDDA 2VC0A 5FFZA 4CXFA 4KIBA 1XD7A 2VODA 4MQVA 4L18B 5AONA 4ESJA 1IUYA 3V8LA 4ZYDA 3KCCA 2BV6A 4RB3C 2JZYA 2FXAA 3I59B 5K5RA 5AIQA 3G3ZA 2DK8A 1B1BA 1SMYF 4GXOA 1FNNA 4U0YA 3TQNA 1OPCA 1OYWA 1JHHA 4OINF 2EFOA 1XGMA 2GQQA 3LWFA 2H94A 5BOXA 1FBUA 4D0PA 3V7CA 3V8KA 3KETA 1E2XA 1UFMA 2BEOA 4MNUA 4MTEA 2CFXA 3CUQB 3J81Z 5D5WB 3BPVA 1WSUA 3HOSA 1VTNC 4ESBA 4G7OF 3IKVA 1FPQA 3ECOA 3WE3A 2IA1A 3VEPA 1FBSA 4ENNA 3K2ZA 1YW9A 1JHFA 3I4PA 5HDGA 1K7AA 4DNCA 3KE2A 4CGZA 2O61A 4N9IA 3KZYA 1ZRDA 4ZZDA 2ZCWA 5DEQA 4L9TA 3RTRA 1EH6A 3W6JB 5ED4A 3GFIA 3C1DA 2QBYA 3HRUA 3EYIA 1Z6TA 4Y13A 2FBKA 2RC4A 3DFGA 3W6KB 4HLYA 4XLNF 2AXLA 4PZJA 1I1GA 2PEXA 2Z33A 4G9YA 4LG0A 3EUHA 1U5TA 2HOEA 2PFBA 2ZKZA 4UVCA 2AS5F 2HTSA 2HKOA 5DCMA 4Q4ZF 2DU9A 1F5TA 2FEZA 2H6BA 4ENKA 1IXSB 3R61A 4EGZA 3K0LA 2GZWA 2EA2A 1LJ9A 1BI1A 1XDSA 2NNYA 1T38A 5JR3A 3KP6A 3V7RA 3TO9A 3T5XA 2MH9A 4KMUX 3I71A 1IF1A 3Q9VA 4GYIA 3LFKA 5F1RA 3EQLF 3F6OA 2ZXJA 2CWEA 2F2EA 1Y0UA 1ZREA 3WGGA 1H9TA 3JAMZ 3RYRA 5D8KB 1HXDA 3WGHA 4EJOA 3V7SA 5BMZA 3JTHA 2Z9OA 5DCFA 1YFHA 1Z6RA 3TOAA 1Z91A 4CICA 4A0YA 5LHIA 1LEBA 3I53A 5JHUA 2M5WA 5BS6A 1DDNA 2P4WA 2R3SA 2DQLA 4A5MA 1XGNA 1QO0D 3KP5A 1XMAA 3F72A 5E8IA 2K4JA 2FBIA 2BGCA 4BHCA 3KP4A 1XDUA 5DD4A 2HEOA 2ISZA 2H09A 3V8JA 5CLSA 3J80Z 1R1TA 3IL2A 3R0AA 4OU0A 3ISPA 4IRHA 3QP5A 3RI4A 1BM9A 4A2UA 2COMA 1KU3A 3DF8A 3AAFA 3I0TA 3K1PA 5LHGA 1IXRC 4Q5SF 2XKOA 2HS5A 3WU0A 1FWZA 3T8RA 2DK5A 1USTA 4ESFA 3SZPA 2XVCA 4U7DA 2DAOA 4R8HA 5HS7A 1TQIA 2GWRA 2L01A 1U3EM 1MGTA 1MDMA 2HQNA 3Q9SA 5E1WA 3DP7A 4UVAA 1FZPB 3L7WA 2VE8A 1F9NA 3J81K 1DUXC 1KU7A 1O3RA 2FF4A 5K5OA 4EM0B 1MJ9A 4BYYA 4HDVA 3O6BB 5DUKA 1GXQA 5F6FA 1F4KA 2M8EA 4CZZA 2UXXA 3V4GA 3CO6C 3ZMVA 3R6SA 3DPTA 2GIVA 4G7HF 2K27A 3JW4A 3K69A 5J6XA 3M8FA 1ULYA 2V1UA 1Z1DA 3BZ6A 3S2WA 2UXNA 3F23A 4HA8A 3CUQC 3R4KA 3MZYA 2MH2A 5HOOA 3GUDA 2P5KA 3WODF 3F8BA 1R1VA 1IN6A 3WTWC 4ZYHA 5CVIA 3CDHA 1TW3A 1O57A 2R7DA 2YU3A 4MQ9F 3RKWA 2PQ8A 5CJ9A 1KU9A 1FY7A 1PDNC 3DQVC 1IAWA 3LA7A 2GA1A 1W4MA 4BHPA 4Q48A 5E17F 2PMUA 3ERED 3TO7A 2HYGD 3MFKA 4UUVA 2FNPA 4OMYA 3E6MA 4RGXA 4LLGF 2VBZA 4WXCA 2PN6A 2EFPA 5L3GA 5JFRA 3KLNA 5LHHA 4G7ZF 3ABTA 3BJ6A 1LEAA 2LSOA 1W5TA 2IVMA 1XGOA 3HUGA 2PJPA 2NYXA 2XAFA 3L9FA 2IPQX 3ZPLA 4O5VA 2WC2A 2CYYA 1WRJA 3IWZA 2DO7A 4ETSA 1S7OA 3MCZA 4UNOA 1TQMA 2VBYA 4RB1A 2YR2A 2CGPA 1ON2A 3QPHA 1YS6A 3MAJA 4A6DA 5LRRA 5DYMA 4FX0A 3CJNA 1G3SA 3Q5FA 4KA4A 1J75A 1OYYA 2M1BA 4HQMA 1TW2A 5EEGA 3E6DA 4AIJA 4R79A 2F5EA 4H0EA 2ELHA 1FYKA 1K79A 4A12A 2A5YB 2FSWA 5CVRA 2MA3A 1B59A 1U8RA 2EK5A 3VB2A 2A6HF 1SD5A 2EFQA 5FO5A 4LK0F 1O3QA 3CO7C 3H3UA 3BY6A 5LGUA 4ZYGA 3U1DA 4EQQA 4IHTA 2P6TA 4KUMA 2FOKA 1BJAA 5CVJA 4I0BA 1ZN2A 1WI9A 5E20A 1R36A 4YIFA 3HRSA 3ROUA 4A6EA 1HKQA 4BNCA 2DBBA 2RQPA 1HW5A 3BP8A 1YG2A 1YIOA 1UCRA 2P7VB 4ENMA 2ETHA 4P96A 4RGSA 4IRGA 1W7PB 3T1BA 1IRFA 4PDKA 1P4XA 4Q47A 1ZRCA 3IKTA 4OIRF 4HYEA 4AD9A 3JSOA 4LJZF 2OD5A 1K6OA 2DT5A 4L9VA 1O3SA 1R5HA 3RPQA 1ZAOA 4K2EA 3TKYA 2E7WA 3FM5A 2KRFA 3HHHA 1J9IA 1R00A 2F5CA 3WU1B 2O3FA 4EMSA 4CDGA 2JPBA 3B73A 2P5VA 4LLLA 1LDJA 2H6CA 2E1CA 3DV8A 1T39A 4N9HA 1SD6A 1JGSA 1EH7A 2MLKA 5D4SA 4XSZF 4EJWA 4KICA 2V6CA 2ZMEB 2Y48A 3M1EA 1L0OC 4OIQF 2ESHA 2VT3A 2K02A 2XRNA 1HBXG 1HW1A 2OQRA 3NRVA 4S04A 1ZG3A 2QLZA 3RKYA 3K1MA 3DKWA 1A04A 1W5SA 1FOKA 2EV0A 1PUEE 1ODDA 4B8XA 4G94A 3ECHA 4UVBA 5BQTA 3ELKA 1D8JA 2VOPA 1IXCA 2KIFA 1FSEA 4M73A 3M7GA 3DEUA 2CO5A 4OOIA 5A2QZ 3F21A 2FMLA 1ON1A 4FX4A 4HZFA 4G8XA 2G7HA 3ZP5A 2GXGA 1Q1HA 4CO8A 4TV7A 4L5IA 4L0YB 5HS8A 3GLXA 4PGGA 4M71A 4O3MA 3DPLC 3WTYC 1KYZA 1DPUA 1MD0A 5DDGA 2UZKA 3IRRA 2FU4A 3LA3A 1TBXA 5KK1A 2V1DA 4P9UA 3FMRA 2TDXA 5ICCA 2FA5A 4Y17A 1RNLA 3F8FA 2CG4A 1S29A 1YO5C 1D8KA 1CF7B 1S7AA 1PP8F 2OA4A 1O3TA 2ZBKA 1QPMA 3DXJF 1ZH5A 3CUQA 3M8EA 1IN7A 2JRTA 1XCVA 4B09A 1BI0A 3FHZA 1W7PD 4LFUA 1R5GA 5D6FA 1P6RA 3K9TA 4U0VA 2A3SA 2RN7A 1G3TA 5JVTA 5ILUA 3QP6A 1JE8A 3WTTC 3ZMUA 1QZYA 1XB4A 4OIPF 5DD8A 3IRQA 2OZ6A 2IA0A 1XMKA 2Q2EA 4L0ZB 4MHGA 1XN7A 2OAZA 5HVQC 1YS7A 1BOAA 2VXZA 4KN4X 4KFCA 1BBYA 2IRFG 3IHUA 4NQWA 6PAXA 4I09A 2WV0A 2A68F 1TNTA 2VN2A 2DLLA 3GFLA 5FFXA 3ZMTA 3COAC 3ZMSA 3GYHX 2VONA 2XAJA 3ZQ7A 3QAHA 1P4WA 1YLFA 4EM1A 4EVIA 3H92A 3E3VA 2LDUA 2XROA 2E7XA 2GAUA 1U6GA 2QM3A 5L3CA 1REPC 3QRFF 1K78B 1G4DA 2V1XA 4GCVA 4XRFA 3RKXA 4AIKA 2MC3A 3FF5A 3WTUC 4RAYA 1R22A 2KJCA 4M9ZA 3P7NA 2Y75A 3TDZC 4HQEA 2PG4A 3F8NA 2P6SA 2JPCA 4HDUA 4A5NA 3ZMDA 1RUOA 3N4MA 2OU2A 2PI0A 3OOPA 5LEKA 3LQRA 2IP2A 2LNBA 2W85A 5TJJA 2BYVE 2RGVA 2O6GE 3SXYA 4UV8A 2D2WA 3ULQB 4LB5A 2Q8KA 1R7JA 4ZH4F 2LKPA 5CYVA 4L9NA 2FNAA 1AOYA 5ERIA 5EEHA 3D5LA 3MWMA 3C18A 1KA8A 4RB2C 3L2CA 1I5ZA 2CW0F 3MEXA 3HIFA 2E1NA 1V3FA 1EH8A 3HRTA 1AWCA 1ZGAA 2XAGA 1DP7P 2Y0MA 1T0FA 1LNWA 3E6BA 4IVNA 3N97A 3ZN0A 3HYIA
chains in the Genus database with same CATH superfamily
1G3WA 2IAIA 4M74A 4ZDOA 2CQNA 3GEZA 2VKEA 2ZXHA 1RIOH 3VOEA 4Y52J 3FMSA 3FXOA 3RCOA 2R7OA 5FB2A 3F3XA 2KIMA 3CJRB 2XV4S 4XRSG 4PJ0C 5A2QK 4BHBA 1Z67A 3LMMA 1STZA 2IJLA 5FD6A 3HRMA 4Y3OA 3BJOA 4XBFA 3P9IA 2DXIA 4KN7X 2EZLA 4KNYA 3FZVA 2AQFA 2ZJRF 1LKXA 3KP2A 1C0WA 2C6YA 2QEXI 1Y39A 2KISA 5JLWA 1U9NA 1QPIA 3SJMA 3HZJA 1LPQA 3E6CC 2HQRA 5AIPA 2V4JC 1ETVA 4HV5A 3JRFA 3UKGA 1RUNA 2HZTA 3FM3A 5GADJ 1H8AC 4JOMA 4L9JA 4XKBA 4HV6A 1YJWI 5ICGA 4P55A 2MLGA 5C4XJ 2HYJA 2QENA 4DOZA 4IJAA 3LA2A 2IGNA 1G6NA 4HAMA 3AKZA 2ESNA 1MKMA 3S15J 2KJBA 2W24A 4PUSA 5LRSA 2O8XA 3QYFA 4AUXA 1ETOA 1RI7A 1FBQA 5B1AH 2WAFA 2K3PA 1ZG5A 2QWWA 4ON0A 2BHZA 3H9GA 3K4BA 5D5UB 4I02A 1X3UA 1IC8A 2UWMA 2ID3A 3HTUA 3CCJI 5E8GA 2ZJ2A 4OIOF 1V5EA 5K1YA 1J7KA 1EJ9A 5JVGF 4LK1F 1TTYA 2HKXA 5EG0A 2X0LA 4A3KJ 2XF7A 3CLOA 1A35A 3L00A 3WE2A 3DLLF 2NOJB 4IF4A 4ZDPA 1S7EA 4BU2A 5LBQA 2HZDA 2KKOA 3P9KA 1MNDA 2LRDA 4S05A 3HSFA 3OYGA 5LD2C 4IEJA 2XSDC 1GVJA 3PNYA 1T2KA 4YIRX 3G4SI 4CH7A 2NRAC 2Y9ZA 4XOTA 2QSHX 1ITYA 2J5PA 3FXUA 4JQFA 2EA4A 5E18F 4GGGA 4IHVA 1S72I 1ZYRF 1FC3A 2IBDA 4A69C 1YHQI 2BE5F 4NHJA 1ERDA 3DBHB 3S3OA 4C2UA 1MMAA 5IY5H 3REOA 3EUKL 4LITA 1G2HA 4XL9A 5FROA 1XSVA 4E7HA 4EGYA 2JA8J 2OCEA 2HDCA 1PP7U 4PFPA 4NBQA 2HFHA 1Y1WJ 3F22A 2YSRA 2MG4A 2B0LA 2P0WA 1MZBA 1BI3A 1I39A 3MKLA 3BOQA 2D1VA 3KLOA 2Y0SN 2EB7A 4E7KA 5M3MJ 4D5CA 2O03A 2HWVA 3ML6A 3U9GA 4D7MA 1DPRA 1J5YA 2K4BA 3I58A 2F48A 1HQCA 3KX2A 3R60A 1Q1VA 2A69F 1HC8A 2XAQA 4XSXF 3BWGA 1X19A 2HNHA 2DI3A 5L3BA 2E60A 4JBAA 2EJRA 2JVHA 4FTHA 1MNEA 1YX3A 2LP0A 3GW2A 3GWZA 2ZO4A 3K7AJ 4PJMA 2XHKA 1FLIA 1B72A 3CDLA 3LSTA 3RIRA 3I5UA 4M72A 4MGRA 5M5YJ 4UUSB 2HOAA 5L3FA 4I2OA 1SAUA 2LF7A 2RVCA 1HSTA 4ITVA 4M3EA 4WCGA 4XONA 2QVOA 2K86A 2L4MA 2MW8A 3I55I 1TLHB 5E1XA 3WTZA 5LLQA 4ZZLA 2M87A 2EZKA 3QOPA 4BUPA 4CYDA 4AM3A 5FD5A 1XSDA 2KL4A 4I98B 2DMNA 2XUBA 5DTDA 1VQOI 1A6QA 1TWCJ 1QU3A 3JRCA 3LQQA 3BT9A 1W1WE 4CCKA 3WTSC 2X9DA 3MZ8A 2QQBA 5DS9A 2NVUB 2NS0A 4BJTA 2FQ3A 2BY0A 3FDYA 1B9MA 2DJIA 1P92A 2GA2A 1TP4A 2VQHA 2IS1A 4U87A 1SFEA 2KT0A 5BPIA 1WWXA 1QVTA 3BPXA 1OR7A 5HLHA 1YW8A 4HBLA 4N0BA 2FX0A 1UAAA 2F5FA 1L3LA 3DEEA 1YW7A 2Z2SB 3E5QA 3GFJA 4UY8I 3HOZJ 1T8IA 5IOYA 2K3FA 2STWA 5BPDA 5LGTA 3BG7A 3RJPA 1TQPA 2GLOA 1P4AA 1K4SA 2FMYA 1SFXA 3FMQA 4RDUA 2P8TA 2DMPA 3OMYA 3GZ6A 2QBYB 2DMQA 3FWEA 4GRIA 3R0JA 2L02A 2YX7A 5H20A 1CGPA 1I1SA 3J7ZI 1Z0XA 4DZPA 5CVVA 3L2VA 3JTGA 1QHGA 3ZQQA 3HHGA 4U0WA 2CRGA 3HKZN 2DJNA 3ZN1A 3BR6A 5EZGA 4YIIA 1ZQ3P 3I4NJ 1WJ5A 3PQKA 1M1EB 3BROA 4EJVA 2QF7A 4LG0B 1J59A 1LDDA 1LDKB 2VKDA 4Y4RA 4J01A 1NTCA 5J1RA 1SEUA 1U5TB 1W0UA 4CCNA 2RNJA 1QGPA 2NVYJ 4YG2F 2X51A 3QPTA 5FLXK 2M7BA 3KEOA 2CSOA 4BE1A 4X1EA 2H1KA 1P7JA 4XMYA 2OQGA 4HF0A 3BJAA 2QQ8A 5DCMB 1J2XA 1HDPA 2I8DA 1CQTA 1FP1D 3OL3A 1QZZA 4HLXA 3DCFA 1AKHB 3S3MA 2RV8A 3ZQIA 5D8LB 4RGRA 3BTCA 3KIOA 1UHWA 5JI6A 4MEYF 1JUSA 2A6EF 2LOOA 1KU2A 4IL6C 3WG7H 4W97A 1UHMA 2GXBA 1HSJA 3H1CA 5GAHJ 5K5QA 3I54A 3CF5F 5L3EA 3JRAA 5DUIA 3DTIA 3PFIA 2X1DA 4HX8A 4RS8A 4BH9A 1MJAA 4MFEA 2XGEA 1QHHD 1LB2A 3S14J 2OV7A 1XGSA 2KHMA 3JRHA 1NHAA 3FISA 1BW6A 1BR2A 3SFZA 1SMTA 2JA7J 2F4IA 3HOXJ 3G1MA 2HR3A 2QQAA 1RZ4A 5HLIA 3GX4X 4BL0B 2IW5A 3DU6A 2PMHA 2K9SA 3O2PE 4UV9A 2DFHA 4BQAA 1KGSA 1PVEA 2K9MA 3IP4B 4EM2A 2DA2A 3EETA 3U21A 2DDBA 3KP7A 1DGWY 1W7PA 2WBMA 2BY1A 2F4MB 5IYDJ 4XLPF 2MYSA 4CYCA 3I64A 4G6DA 1HOMA 1R58A 1T98A 4RB0A 4BJ6C 3ZRGA 2FE3A 4ZTJA 2VBXA 4FISA 1LQ1A 4C3HJ 4MTDA 1BC8C 1XPXA 4HW0A 1OCOH 2P5LC 1LUJB 4H4KC 5EJCA 2DA1A 2HYFA 3RPUA 5J8FA 2JSCA 2E36A 1ZRFA 2PJRB 4Z2YA 4FHTA 1J0RA 2M45A 1LVAA 2ZJQF 3HOTA 3LSIA 2RQQA 3IAM2 3FKIJ 4UHTA 1H9GA 4YFXF 2R7ZJ 2VJJA 2YX4A 3I59A 5M5WJ 3ABUA 3SHFA 1E17A 2VPLA 2Z5UA 3BR0A 1O7FA 4DYCA 2VC1A 3J7AO 2WY7Q 2BY2A 2EILH 4YFKF 2Y31A 1OISA 2EV6A 2EZHA 2K7LA 1SD7A 3QODA 4WXDA 3I56I 1H88C 1A36A 2IT0A 4IQJA 3S3NA 1OYIA 1YJNI 5FKLA 4QSHA 3L09A 2LY2A 2M0MA 3EDPA 1UHSA 2X6YA 3MKWB 3T0YA 4O6JA 2HU9A 1TT5B 4IXAA 1LE8B 2Q0OA 2QUFA 3PUFA 4HEA2 1B6AA 3OS2A 2V9KA 3GTLJ 2WWYA 3BLYA 3F8MA 1ZLKA 2F4OB 4F3QA 1KQ9A 4YFNF 2L3DA 3GMEA 3SEZA 1Z21A 3U2RA 3HOUJ 2ZMEA 1JXSA 1FT9A 2O0YA 3SEQA 3MZHA 5KAIC 1BI2A 2HOTA 1B4AA 5TRDA 3HJEA 3VSLA 4YELA 1IW7F 1QBJA 1GHCA 5D5XB 2MABA 3LAPA 4G6QA 4I01A 4ZYAA 3BG9A 4I99C 3SZTA 1I6XA 2YPRA 3K4JA 4KMFA 1G3YA 3GZ5A 5HDKA 4RMNA 2EFWA 1HW2A 2KZGA 4KT5C 2CFOA 4MLOA 5E3OA 3E97A 4LD5A 3M9AA 3KFWX 3RPUD 2L2OA 2ACJA 4BJ5C 1VQPI 4JK1X 3OYDA 4EJTA 3HGYA 3D5RC 1TNSA 3TP3A 4IRIA 1U2WA 3GTOJ 1WH5A 4WK8F 4C3JJ 4E7JA 1FOYA 1I3AA 2XAUA 4HF2A 3GVAA 1FTTA 2BOLA 5DV5A 3HSRA 1MDMB 1R1UA 3A01B 3TW7A 4R1HA 3GTMJ 1NK2P 3CCUI 1HKTA 3E0JB 2PMZN 2L5QA 1FMVA 5CPRB 1VI0A 2CJJA 1OLTA 2OZUA 2ICWG 2V79A 5KNLA 2DOEA 2CV1A 1D3YA 2STTA 4LLNA 5IT9Z 3NQOA 3RDIA 4DGWB 1R71A 3TOBA 3V42A 4XIDA 2MBFA 1FX7A 4OMZA 3T8TA 1SD4A 2R7FA 4J00A 1Z9CA 2X4HA 1T08B 2W4SA 2Z99A 4F7ZA 1TC3C 5HLGA 1KQ0A 1HLVA 1E3PA 1ZHFA 3P9CA 2MD5A 2ZNZA 4ZYEA 2XASA 2PBIA 2XGXA 4WWCA 1XS9A 1MBGA 2XKPA 4EJUA 4WF2A 4DQ2A 3O8HA 3BG3A 4EEFG 1APLC 3S16J 1VFCA 4A3GJ 2M9HA 5KVRA 2QQ9A 3AL0C 1RC9A 2XB0X 3CTAA 2G0EA 2L4AA 3IWFA 1CF7A 1T33A 2ELJA 1MJBA 2J5OA 3JREA 2ISYA 2KIUA 3F6VA 3FK6A 1FJLA 2HQAA 3QU3A 4Z6YA 1BIAA 3IC7A 3MN2A 1BR4A 1HA8A 5D4RA 3NEUA 5GAEJ 1IZ1A 1SFUA 1ZK8A 2TCTA 2XIGA 4KDPA 1MMDA 1VQ4I 4HX7A 3DKYA 1E3OC 2JT1A 1SC7A 2VKVA 1IN5A 1PUFA 2H27A 2R7VA 3FXLA 2EV5A 2FQ4A 2QZ8A 1ETKA 1D0XA 2DA7A 5FGMA 3TO6A 3WGIA 1JT6A 2LY9A 1Z05A 3TGNA 2N8GA 1JKRC 1S6LA 3G6EI 4BBSJ 4KYWA 5C3EJ 4AIHA 3CCMI 1ONVA 5BNGA 3QPSA 2DFIA 3Q0WA 4RAZA 5IYCJ 1F1ZA 5J3LA 2L9RA 4GYGA 3BCBA 2R7TA 5ICEA 4V19K 2M4GA 1TT0A 2OBPA 3OYHA 1WJCA 1GVDA 4CCLA 3WG9A 4EV0A 1TWFJ 2DPDA 1VQNI 4WX9A 2DTRA 4P5OA 4CUGA 1S9HA 4HSRA 2Z3YA 3K4KA 2ZB9A 3ZR8X 5HNHA 3KZZA 3CMEI 2IGMA 1IO2A 3Q0VA 1RKWA 5J1UA 4XKWA 5IOZA 4C2TA 2R93J 4LB6B 4DIQA 1IGNA 2XGDA 3K2AA 2K9NA 5CVUA 3Q3SA 1SFKA 2B7EA 2OTJI 5J47A 1YYVA 2DA4A 3PJRA 1QQIA 2LY1A 2R7RA 1BC7C 3MVPA 4M3BA 1KZHA 1S8NA 4HF1A 5FLXZ 5ICFA 2CV0A 2HTJA 5F0HA 5HDNA 1FYMA 2CW7A 3D0SA 4ENJA 2E1OA 3HSEA 3DTKA 3BG6A 4U88A 1WFXA 5B1BH 1FYLA 3CUOA 5ILVA 3HUGB 4PCQA 2MFZA 4XICA 2HDDA 2P81A 2P7CB 2IS4A 2XF5A 2W25A 2WV1A 1IN4A 2G9WA 3TDUC 3PO3J 3EUHC 1OMIA 4I76A 4M9SA 5F1JA 3CMYA 4HX4A 4F93B 3ASOH 3K1NA 3H9QA 2D1HA 1U5TC 3KYLA 1EV7A 9ANTA 4U7BA 2PLYA 1H0MA 1WGXA 3C2GA 2VT2A 4RM3A 4I7HA 4BAYA 3MKYB 2NNNA 3ZQFA 4PJLA 1YQAA 2RDPA 4BE0A 1ZGJA 3F8CA 2K5CA 5IYBJ 5JLXA 3E5XA 1K78A 3BQYA 4MEXF 2V9VA 3CCQI 1IV8A 4AVPA 3SYTA 5LEJA 2AO9A 4B43A 3KP3A 1R4NB 2RREA 3BCAA 2VBWA 4RGUA 4BXUA 3FX3A 5HLTA 1OKRA 4KIGA 5H6RA 5E1ZB 1FOWA 1IRGA 5LFAA 3CDIA 4I0AA 2CQKA 2NAZA 1R6RA 4QWQA 3FXQA 2RKHA 1QNTA 3PFYA 4UXNA 3OWTA 1V54H 2R5ZA 1P2FA 3M3YJ 3OV8A 2HGCA 2EFNA 2DW4A 4W1UA 1R4MB 5J1YA 3EYYA 2CQQA 3E1SA 2DQRA 2MGQA 4IPAA 5EGOB 1X4PA 1XSXA 2I10A 1SANA 4LGWA 2BY3A 2W84A 2EBIA 1VQ8I 4M6YA 2FJ1A 1ZG1A 1QZEA 4ASNA 2VE9A 3CQZJ 4NUBA 1BIBA 3FXRA 2BXYA 1JTYA 3MQ0A 3E5UA 2D45A 4FT8A 4GO1A 4AWXB 1A5JA 5L3DA 2BHYA 3RYPA 3OIQA 1V55H 2ME6A 2FRHA 1WQ2A 2Y30A 2V1NA 3SQNA 3VFZA 4IZZA 3ABKH 3FXJA 4F55A 3VPRA 4QLCU 4DZJA 2OC6A 3ZMZA 3OR2C 3OY9A 3IV5A 3S93A 4PGHA 5J8CA 4X0GA 3WTVC 3GFMA 3AG2H 1GDTA 1D5VA 1S3JA 4OAYA 1KYWA 3Q0UA 1FP2A 5F0CA 2XC7A 3G1LA 5ILSA 4A0ZA 5J4VA 4RBOA 4L5JA 1FSHA 2CUZA 3C7JA 3SFIA 5D6EA 1XCBA 4B3AA 2W57A 1WHUA 4M6VA 1ZELA 4A3BJ 4C2MJ 3QU6A 2F5DA 4A3LJ 5EEAA 2E5ZA 1YTYA 1TL8A 1QRYA 2FUG2 2M30A 2AXTC 2GOXB 2JTVA 4ZDLA 3OYAA 2HI3A 2IA2A 1ZLJA 3A2KA 1Z7UA 1VQLI 3OYJA 2E34A 3KZIC 3LAJA 1B8IB 2JJ7A 1BN5A 2ZNYA 4NB5A 5D5VB 5FKOA 4BBRJ 1IV6A 1I27A 3C3WA 3HG9A 3LSKA 1MIJA 1RESA 3G73A 3VODA 3O3KA 5F64A 2ADUA 4IKFA 1OCRH 3JAMK 2L54A 2XAHA 2M2EA 4IHSA 1KQ8A 1N77A 1ZARA 3AL0B 2KQRA 1GXPA 5IT9K 3HBLA 2ZSHB 2JMWA 3QOEA 4BE2A 3PIPF 1T6SA 2MC4A 1JJ6C 3S2DJ 2DDAA 5H2FC 1U78A 3GLLA 4WXHA 1YI2I 1YIJI 4IQ4A 2G7UA 3CCSI 4GFBA 1R23A 4P9FA 1USSA 4V2GA 4HNTA 2A07F 5HS9A 1JI8A 3GO5A 4LIVA 3RSNA 1N75A 1V4RA 4M9XA 1HKSA 3BZCA 2Y69H 3OSFA 1UB9A 4UB6C 5IT3A 1EA3A 2PX9A 3GXOA 5GTHC 4A3IJ 3SZGA 1NG7A 1WKMA 4Y15A 2M4KA 2KRCA 2O9LA 2QSFX 3NWSA 5LGNA 1W0TA 2LF8A 2XPWA 2FBHA 4LMYA 1SAXA 4M6XA 4E70A 2EWNA 1Z3YA 4HSTA 2WTEA 4A0XA 2DPUA 2GM4A 3HTSB 4JYKA 1FIPA 2A61A 1ETQA 2BW3A 2UV1A 5IP6A 1Z77A 1BA5A 1B9NA 1D1CA 3J80K 4II2A 4CSWA 1BW5A 4NC7A 4CHUA 3B02A 1IN8A 3L2RA 2VOOA 2ZFWA 3H3ZA 2DMTA 3PQJA 2BBYA 3CC7I 5H6QA 2Y0SA 3GF2A 1JJ8C 3HM5A 4HOBA 4KIFA 3KEQA 4E4HA 1W5CC 1QVUA 3JSPA 1HF0A 4OWRB 1O7LA 5IPAA 3HOVJ 3HEFA 2K40A 2QYOA 2CUJA 3WTXC 3ZQLA 1ETYA 3BDDA 3BQZA 5E3NA 3B6CA 2VC0A 1D1BA 2XSJC 2HVQA 1GT0C 2QKMB 5FFZA 4CXFA 4CYCB 3S2HJ 4KIBA 1XD7A 2VODA 4MQVA 3VYRB 5AONA 4ESJA 3OSGA 4L18B 1IUYA 3A0BC 2DTZA 5CQEA 4IOAF 3V8LA 4ZYDA 2B63J 1Y8RB 1U0JA 3KCCA 2BV6A 1K4TA 4RB3C 1JGGA 2JZYA 2X48A 2FXAA 3ONQA 1ZTRA 4BQNA 3GTJJ 3MKZA 3DTEA 1T95A 3I59B 3S8PA 1X1DA 5K5RA 3RQIA 5AIQA 4AC0A 3A1YA 1YJ9I 3BTJA 3G3ZA 2DK8A 1B1BA 1SMYF 2CH0A 3CC2I 3DEWA 1D0YA 4NC8A 3RKQA 4GXOA 1FNNA 4U0YA 2E1MC 1FTZA 3LSMA 2DMUA 3TQNA 1OPCA 2VJ5A 1OYWA 1JHHA 4OINF 2ECBA 2DA6A 2EFOA 1Y0NA 2EPFA 3TL4X 1JTXA 4E6KG 5FRMA 1XGMA 3C2HA 3HOWJ 2GQQA 3LWFA 2H94A 2KDOA 4F92B 5BOXA 1ETWA 4DYQA 1FBUA 4D0PA 3V7CA 3V8KA 1WH7A 3KETA 1E2XA 4UUSA 1UFMA 2BEOA 5C44J 1JKOC 4MNUA 2XRLA 4MTEA 2CFXA 3CUQB 3J81Z 2MSYA 4AU7A 3K4NA 2LYCA 3VYUB 5D5WB 2QSGX 1MMGA 2BZTA 5F04A 3BPVA 1WSUA 1UELB 3HOSA 1VTNC 4ESBA 2L7ZA 4G7OF 1SVOA 3IKVA 2CQ7A 3GBGA 2Q1ZB 1FPQA 3ECOA 5F08A 3WE3A 2IA1A 2CW8A 1MBKA 3VEPA 1FBSA 3BR3A 1TZLA 2DT7B 4ENNA 3IH2A 2EQRA 3PUBA 2EIMH 3CZ6A 3K2ZA 1YW9A 1JHFA 1DU0A 3I4PA 2EZIA 2W1OA 5HDGA 1K7AA 4DNCA 3KE2A 4CGZA 1Y8QB 2O61A 4N9IA 3WHBA 1BOBA 3KZYA 1ZRDA 2Q2EB 4C9YA 3CMMA 1MMNA 4ZZDA 1MNMC 3LSRA 3VYTB 2ZCWA 5DEQA 4L9TA 2QGUA 2ZSIB 3RTRA 3FK7A 1EH6A 3W6JB 5ED4A 3H5RA 4DW6A 3GFIA 3W2VA 3C1DA 2KIQA 1JKPC 2QBYA 2X1EA 3HRUA 3OR1C 4NQWB 2QKLB 4PJJA 3EYIA 1Z6TA 1WI3A 3H3VK 3J7AY 2LTPA 4Y13A 2FBKA 2RC4A 2R5YB 3DFGA 1DQUA 3OYLA 4XKCA 2EH3A 3W6KB 4HLYA 1OFCX 4XLNF 3O8GA 2K9QA 2AXLA 1T56A 3C2BA 4PZJA 4XLAA 3H9JA 1I1GA 2PEXA 2Z33A 2NVXJ 4G9YA 4LG0A 3EUHA 3OIPA 2F6CA 1Z7LA 2HDWA 2RAEA 1RRJA 1U5TA 2HOEA 3OYKA 3X2QH 1RR8C 1OCPA 2PFBA 2ZKZA 4UVCA 4A3JJ 2AS5F 1LVKA 2HTSA 3VYSB 3NARA 4XLEA 4M3GA 2HKOA 3JRGA 3K4LA 5DCMA 2VKHA 4Q4ZF 2JA2A 2DU9A 3DBRB 1D0ZA 1POGA 2FEZA 1F5TA 2H6BA 4ENKA 4DYRA 1IXSB 4BQOA 1AKHA 3R61A 4EGZA 3K0LA 2GZWA 3HPGA 1ACIA 3QYEA 2XPUA 2NS7A 3JRDA 2EA2A 3EUAA 2HOSA 1F36A 1LJ9A 5B3SH 1BI1A 1NH3A 1XDSA 2NNYA 5CQGA 3QWLA 3K70C 1T38A 3JR9A 2DA5A 5JR3A 3P5JA 1VQ5I 1PUFB 3KP6A 2JSPA 5B5EC 3F9KA 4BDYA 1XTAA 3V7RA 3TO9A 3T5XA 2MH9A 4KMUX 2VQGA 3I71A 1IF1A 3Q9VA 1NK3P 1U9OA 2HPIA 2X85A 3W3CA 4GYIA 3PL8A 1YRNB 1GV2A 4IX7A 3LFKA 2CUFA 2JQ7A 1NG6A 5F1RA 2LBFB 4NDLA 4MFDA 3EQLF 3F6OA 2ZXJA 2HXIA 3QQAA 4E7SA 2CWEA 2F2EA 5J4YA 4QPQA 1Y0UA 1OR7C 1X3WB 1ZREA 3A0HC 3WGGA 5K7HA 3BR1A 1H9TA 3M07A 3WHCA 3CESA 3RZDJ 3JAMZ 3OS0A 3RYRA 2KLOA 5D8KB 1HXDA 3ABLH 3WGHA 1WVRA 3H36A 4EJOA 2W7NA 1IDZA 3V7SA 5BMZA 3JTHA 2KDZA 2Z9OA 3AG4H 3DPUA 4ANJA 5DCFA 1YFHA 3ZXSA 2RNGA 1Z6RA 2WB1N 1Z91A 3TOAA 4CICA 5HNFA 3BR5A 3IAS2 2OPTA 4A0YA 5LHIA 2PJRA 1LEBA 4JX4A 3OYFA 2EINH 2X6XA 4BKXA 2ECCA 2M3AA 2ZFUA 3DLAA 3I53A 5JHUA 2NXNB 2M5WA 4UUTA 3SDGA 2DCEA 5BS6A 4B44A 2DFEA 1DDNA 3ZQGA 2P4WA 2OUMA 2R3SA 2DQLA 4A3MJ 3GCMA 4A5MA 1XGNA 5TGTA 3AFHA 2V7FA 1QO0D 1YE9A 1VNDA 3K10A 2DYRH 1XMAA 3F72A 3KP5A 4BEHA 2K4JA 1MW7A 1SVLA 5E8IA 2FBIA 4RA2A 3BG5A 2YUSA 3QPLA 4QPOA 2BGCA 5GP9A 3CC4I 4XLFA 4BHCA 3NWTA 3TW6A 3CCEI 1LE8A 3CP2A 3KP4A 1XDUA 5J40A 3FIWA 3WU2C 3S1MJ 2E5NA 5DD4A 2HEOA 2ISZA 2H09A 3V8JA 1XC5A 5CLSA 3J80Z 3BZKA 1EKEA 1R1TA 3IL2A 1WJDA 3F0CA 2JUGA 3R0AA 4ABZA 2E2HJ 5DM7F 1Y1VJ 4OU0A 2E2IJ 1N25A 2L9VA 3ISPA 1J09A 2E1MB 4IRHA 2X6OA 3QP5A 3RI4A 1BM9A 1MBJA 4A2UA 3AG3H 2COMA 4IOCF 1KU3A 3L1PA 2WAQA 3DF8A 1X58A 2ELKA 5IP7J 3AAFA 4XNFA 2KZVA 3ZQCA 2HVSA 3I0TA 3GTPJ 1I3QJ 3K1PA 5LHGA 1IXRC 4Q5SF 4LG3A 4P1WA 4B4CA 1UMQA 1K6YA 4B48A 1MMSA 4E7LA 2XKOA 3BR2A 3ERMA 1MH4A 3IH4A 2HS5A 3WU0A 1FWZA 3T8RA 3OIOA 4FE4A 2DK5A 1USTA 4BQQA 1FIAA 4ESFA 3SZPA 2XVCA 4U7DA 2LVSA 3DWLE 3LSHA 2DAOA 3OYMA 4R8HA 3W2WA 5HS7A 1TQIA 1X2MA 2GWRA 2L01A 2JA5J 2JN6A 2VXDA 2HXOA 2LKSA 3CP8A 1U3EM 4S0HB 2VUMJ 3VSKA 2OF7A 4Y7NJ 1MGTA 4XLCA 1MDMA 2HQNA 2VQLA 2VLAA 5KCMA 2M34A 3Q9SA 5E1WA 3A01A 4A3FJ 3DP7A 3MD2A 4UVAA 2IS6A 1FZPB 3L7WA 2VE8A 1F9NA 3J81K 1DUXC 5EG0B 1KU7A 1O3RA 2HQ5A 2FF4A 5K5OA 4EM0B 3W6VA 4I6ZA 1X1CA 1MJ9A 4BYYA 5M3FJ 4HDVA 2KRHA 3O6BB 5DUKA 4A93J 3CLQA 4C3IJ 2R7SA 1GXQA 5KAFC 2E19A 1W36C 1E0EA 5F6FA 4CCOA 1F4KA 2M8EA 2IXSA 1WPKA 2W48A 4CZZA 3L2WA 4NNJA 2UXXA 3V4GA 3TEDA 3M1CA 3CO6C 3ZMVA 3R6SA 2OCCH 2HVRA 3DPTA 1SFOJ 3KPHA 2VI6A 3E7LA 1IJWC 2GIVA 4G7HF 2K27A 3JW4A 3K69A 2CS3A 5J6XA 3S1RJ 3D1NI 4D7NA 3M8FA 2L0KA 1ULYA 1O4XA 1LFBA 1X1BA 3UR3C 2V1UA 2WA0A 1Z1DA 5F0FA 4AYBA 3BZ6A 3MMYB 3S2WA 2UXNA 3F23A 2ZXIA 2IS2A 4AIDA 2KMUA 2R7QA 2KFDA 4HA8A 4LIUA 4B3XA 3CUQC 2ZMEC 4RM2A 3R4KA 1DP3A 4M3FA 1BL0A 1MBFA 2IEKA 3MZYA 2R7WA 2MH2A 1VQ9I 1KONA 2JWTA 5HOOA 1WJAA 1DGRM 3GUDA 2O8KA 4XN3A 2P5KA 4RLQA 3HDDA 3F8BA 3WODF 4YRVA 1R1VA 1R49A 1IN6A 4ZYHA 2DYSH 5CVIA 3CDHA 2DOAA 4RLFA 3WTWC 2NVTJ 1TW3A 5FLMJ 1O57A 1MH3A 2R7DA 2D5VA 2YU3A 4MQ9F 3RKWA 1B72B 2PQ8A 3GTGJ 3G71I 5CJ9A 1QA6A 1KU9A 3HL2A 1FY7A 3CCRI 3FBNB 1PDNC 1MSFC 2AQEA 2ZXWH 3DQVC 4DBRA 1IAWA 3LA7A 2GA1A 1W4MA 4BHPA 2R7XA 3K4CA 4ZC3A 4Q48A 5HODA 5E17F 2PMUA 5JHFA 3CJTB 3GTKJ 3ERED 4XRSA 3CMAI 1TWAJ 4CA0A 3TO7A 5B66C 4B1RA 2ME0A 1P7IA 2HYGD 4FETA 1RKTA 2R4GA 3MFKA 4UUVA 3U1KA 2FNPA 4OMYA 4XLHA 3E6MA 3PNVA 4HPQA 2QCOA 4RGXA 3CD6I 3GZNB 4LLGF 2VBZA 4WXCA 4D1QA 3NAUA 2Y2ZA 2LR8A 2PN6A 1V5FA 5CKTA 2EFPA 5L3GA 2BW3B 2EIJH 5JFRA 3KLNA 5LHHA 4G7ZF 3ABTA 3BJ6A 3S32A 3JRBA 4XN0A 1LEAA 2LSOA 3ASNH 1W5TA 3OYIA 3ZCOA 2VASA 2IVMA 1XGOA 3HUGA 2PJPA 2NYXA 2DA3A 2XAFA 1UG0A 1JKQC 3L9FA 2IPQX 3ZPLA 2E2JJ 4OAZA 4II3A 4O5VA 2WC2A 1A6IA 3OYNA 2CYYA 1WRJA 3IWZA 2DO7A 2LFBA 4ETSA 1S7OA 3PSIA 3MCZA 2O7OA 4UNOA 1TQMA 2VBYA 4RB1A 2YR2A 5K7FA 2CGPA 1ON2A 4ZJZA 3QPHA 1YS6A 3MAJA 4JP0A 4A6DA 4BY1J 4XK4A 5LRRA 3OYEA 5DYMA 4FX0A 1ETXA 3CJNA 3HC7A 2DODA 2WADA 1OQYA 4BXXJ 2CQXA 2OTLI 1G3SA 3Q5FA 3CCYA 4KA4A 2LMDA 1J75A 1OYYA 1WJEA 1VF9A 2M1BA 4PFOA 2VJ4A 4KISA 4HQMA 3GTQJ 4XOPA 1P9QC 1K61A 1TW2A 2GBYA 4PSWA 5EEGA 3E6DA 2L9SA 4AIJA 3EPZA 4R79A 2F5EA 4H0EA 3A03A 5GAGJ 1ENHA 2R92J 2ELHA 1FYKA 1K79A 3OYBA 4A12A 4HRIA 1RR7A 2A5YB 2FSWA 2L7KA 5CVRA 5FKMA 2MA3A 2IGKA 2ZJPF 1B59A 1U8RA 3K6GA 4DBQA 3LNQA 2WY8Q 2EK5A 3VB2A 2A6HF 1SD5A 2EFQA 1JT0A 5FO5A 4LK0F 1O3QA 3CO7C 5FLVA 3H3UA 3BY6A 5LGUA 4ZYGA 2R7UA 3U1DA 1OCZH 5F27A 2F5VA 4EQQA 5EGOA 4IHTA 2P6TA 4KUMA 2FOKA 1TWHJ 1BJAA 2BVMA 2LC2A 1PYVA 5CVJA 4BGDA 1FEXA 2MD0A 5E3MA 3L2QA 3KYDB 3IH3A 1PJRA 3VWBA 4I0BA 2NVQJ 1X3ZB 1ZN2A 1WI9A 1BR1A 1WJBA 5GPCA 4RAGA 1R36A 5E20A 4YIFA 3HRSA 3ROUA 4A6EA 3JRIA 1HKQA 2X1CA 4BNCA 3LSPA 2DBBA 3I3LA 2RQPA 2A05A 2COBA 1HW5A 3BP8A 1YG2A 1YIOA 1UCRA 2P7VB 2KP6A 4ENMA 1H89C 4NC6A 2ETHA 4P96A 4RGSA 4IRGA 1W7PB 3T1BA 1IRFA 4PDKA 1P4XA 2E35A 2XF6A 4Q47A 1T0FC 3ESWB 4L5EA 1TWGJ 1ZRCA 3IKTA 4XR6A 4OIRF 5DM6F 4HYEA 4AD9A 3JSOA 4LJZF 2OD5A 3ZGKA 2A6TA 1WCMJ 2TRTA 1K6OA 1E3HA 2LREA 1ZR2A 2DT5A 4L9VA 5M5XJ 1O3SA 1R5HA 1AHDP 3TBIA 2XDVA 3RPQA 1ZAOA 1K83J 1VQ6I 1FOXA 1B8IA 4MIMA 4K2EA 2UUZA 3TKYA 2E7WA 1Y6IA 3FM5A 3PSFA 2KRFA 4E7ZA 3HHHA 1J9IA 3PIOF 1R00A 3BC8A 4CCMA 2F5CA 3WU1B 2O3FA 3A4CA 4EMSA 4CDGA 3UNGC 2JPBA 3D5SC 5GPAA 3FBIB 2AHQA 3B73A 4XORA 2R0QC 2P5VA 4FASD 2M7AA 2GXAA 4LLLA 4IHYA 1LDJA 1GLNA 3K70D 5EZHA 2DN0A 2H6CA 2E1CA 3DV8A 1T39A 1MBHA 3HOYJ 4N9HA 1SD6A 1MBEA 1JGSA 2DT6A 3CCVI 4EATA 1OCCH 1XG1A 1EH7A 2MLKA 2VJIA 5D4SA 3PNTA 4XSZF 4EJWA 1A31A 4KICA 3H5NA 2V6CA 4KJZA 2CMPA 2Y48A 2ZMEB 3M8JA 5EYRA 2K9LA 3M1EA 3BTIA 1L0OC 4OIQF 2O5RA 2ESHA 3ABMH 2VT3A 2K02A 2K85A 3QYBA 2XRNA 4XKVA 1HBXG 1HW1A 2NOGA 2OQRA 3NRVA 2BVLA 5E3LA 4S04A 4D9JA 4AVZA 3FKJA 1GUUA 2CU7A 1X2NA 3HKZA 1ZG3A 3J7YJ 2GIZA 2H1LA 4Y33A 3S17J 2QLZA 1RETA 2M0CA 3RKYA 4QTRA 3H35A 3K1MA 3DKXA 3DKWA 1A04A 1W5SA 1FOKA 2EV0A 3RZOJ 3W2AA 1PUEE 1ODDA 4B8XA 4G94A 1YX5A 3ECHA 2XPVA 4UVBA 5BQTA 3JCUC 3ELKA 1D8JA 2VOPA 1IXCA 4G6TB 2X6WA 2KIFA 1FSEA 4M73A 3FXKA 3DEUA 2CO5A 3M7GA 4OOIA 1VZ0A 5A2QZ 3F21A 3M4OJ 1D1AA 1XMXA 1IUFA 1ON1A 2FMLA 4FX4A 4HZFA 4CCJA 2CV2A 4G8XA 4PSXA 2G7HA 2LG4A 4FCYA 1IRXA 3ZP5A 2QA4I 2GXGA 1Q1HA 4CO8A 4TV7A 4HG2A 3H0DA 2E71A 4L5IA 4L0YB 4BS9A 5HS8A 1UG2A 3GLXA 4PGGA 4M71A 2H8RA 4O3MA 3DPLC 3WTYC 1KYZA 1DPUA 1MD0A 3TMOA 5DDGA 2UZKA 3H0GJ 4KT6A 3IRRA 2LK2A 4A3DJ 1ORKA 1WJFA 2W82A 2FU4A 3LA3A 1TBXA 2FD5A 5KK1A 1G8XA 3VDXA 2V1DA 5FKKA 4P9UA 2H8WA 4BACA 3FMRA 3K4MA 3SDBA 4F52A 4F91B 2TDXA 5ICCA 5EDNA 4BEHB 2FA5A 1X1PA 4Y17A 1RNLA 5E79C 3F8FA 2CG4A 1XX5A 1S29A 1FMWA 1YO5C 2Z16A 1D8KA 4JX5A 1CF7B 2W00A 4IHWA 2VPRA 1S7AA 3TP0A 1VQMI 1PP8F 2Y9YA 2OA4A 4J19A 1O3TA 2L7FP 2ZBKA 4A3CJ 1IDYA 1QPMA 2XB5A 3DXJF 4PK4A 3CUQA 5FRNA 1ZH5A 3M8EA 1IN7A 2JRTA 1RPWA 3CJQB 1XCVA 4B09A 1BI0A 1GV5A 2XGCA 4XM3A 1ZR4A 3FHZA 1W7PD 2A5WA 1R5GA 4LFUA 5D6FA 4GDFA 2NS8A 1P6RA 3K9TA 4MO7A 4RAFA 1EF4A 4U0VA 2A3SA 2RN7A 4DJAA 1G3TA 5JVTA 4BDZA 2V6EA 5ILUA 4KITB 3QP6A 1SVMA 4A3EJ 1JE8A 3CCLI 3L2UA 3HPHA 3WTTC 3ZMUA 5KHDA 1QZYA 4FE7A 4ZTFA 2VB6A 1AU7A 3PO2J 1DU6A 3LOCA 1W36D 1OJLA 3FHNA 4IO9F 1XB4A 4OIPF 2LLKA 3FXMA 5DD8A 3IRQA 4D5FA 3LFUA 2OZ6A 4N4OB 4CZCA 2IA0A 1Z3XA 1N78A 1XMKA 2Q2EA 1ZKGA 4L0ZB 2V9PA 2DFFA 2JRMA 4MHGA 1XN7A 2OAZA 3DU5A 5HVQC 1MSEC 1YS7A 1BOAA 2VXZA 4V2FA 4JX6A 4KN4X 3HGGA 1VQ7I 2VQCA 5GTIC 4KFCA 2WAQN 1BBYA 2IRFG 1R9TJ 3IHUA 2YS9A 4NQWA 6PAXA 2VL8A 4I09A 2WV0A 2A68F 1TNTA 2VN2A 2DLLA 3H5AA 3S1QJ 2R5YA 1Y56A 2ZC2A 3DBLB 3GFLA 3HXLA 3KYCB 5FFXA 3ZMTA 3KEYA 3RQ4A 3COAC 2OJED 3ZMSA 3ZQHA 3GYHX 4E7IA 2VONA 2XAJA 3ZQ7A 3QAHA 1YOVB 3I9V2 1P4WA 3PM1A 1YLFA 1LFPA 4EM1A 4EVIA 3LSGA 3AG1H 3A02A 3H92A 3E3VA 2LDUA 4B47A 2XROA 1IG7A 3LL7A 2E7XA 2GAUA 1U6GA 1I50J 2QM3A 3N05A 2EIKH 5L3CA 3I4MJ 1REPC 3QRFF 1K78B 1G4DA 2V1XA 1X1AA 2CUEA 4GCVA 2L9NA 3BTLA 4HNUA 2PMZA 4IHXA 3HB9A 4XRFA 2L7MP 3RKXA 4AIKA 4UB8C 2JVGA 1U8BA 1JUPA 2MC3A 3FF5A 3OL4A 2Z1DA 2VIXA 4X6AJ 3WTUC 4FQGA 1F43A 2WB1A 1R22A 4RAYA 1WZ2A 2KJCA 3S1NJ 4M9ZA 3P7NA 2Y75A 3TDZC 4HQEA 2PG4A 2JUCA 3F8NA 4BXFA 1LFUP 1ZGWA 2P6SA 2JPCA 4HDUA 1X4OA 1V5GA 2V26A 4A5NA 3ZMDA 4HNVA 1RUOA 3N4MA 2R5ZB 2OU2A 2PI0A 3OOPA 5C4JJ 5LEKA 4XQFA 1IRZA 4QIWN 3LQRA 2IP2A 5TISC 1YRNA 3G2BA 2LNBA 2W85A 1G59A 2LBFA 5TJJA 2LH9A 4C30A 2BYVE 2RGVA 2I5UA 2O6GE 5FKNA 3SXYA 1AA7A 3G1OA 3LSJA 1UJ8A 2D2WA 4UV8A 3ULQB 4AYBN 1S5LC 4LB5A 2Q8KA 1R7JA 4ZH4F 1BJZA 1JUMA 2IGOA 2LKPA 4YEJA 5CYVA 4L9NA 2FNAA 3IUOA 3ZOBA 2YU9J 1AOYA 1YITI 3OOUA 5ERIA 3CF2A 4PJNA 5EEHA 3D5LA 3MWMA 1D5YA 3C18A 4LOCA 4BY7J 2B9SA 1KA8A 4RB2C 3L2CA 5IP9J 1I5ZA 2CW0F 2WAEA 3B6AA 1OCTC 3MEXA 4N4NB 1VQKI 3HIFA 2FOWA 2GOMA 1HCRA 1I6HJ 2E1NA 1V3FA 1EH8A 3HRTA 2M8GX 5EF6A 1AWCA 1HDDC 1ZGAA 5FJ8J 2XAGA 1DP7P 2KPMA 1R5ID 2Y0MA 4G12A 2JA6J 1T0FA 2BXZA 2ID6A 1LNWA 2LKXA 5K7ZA 3OYCA 4XRMA 2JK3A 4M3DA 3E6BA 2DOFA 4IVNA 3N97A 2HPMA 3OS1A 3ZN0A 3HYIA 1UZCA 2LD5A
chains in the Genus database with same CATH topology
1G3WA 4M74A 3GEZA 1RIOH 3VOEA 3FMSA 5FB2A 3F3XA 2KIMA 2XV4S 5A2QK 4BHBA 1STZA 2IJLA 5FD6A 3HRMA 3BJOA 4XBFA 3P9IA 4KN7X 4KNYA 3FZVA 3KP2A 1C0WA 2C6YA 3E6CC 2HQRA 5AIPA 4HV5A 1RUNA 2HZTA 3FM3A 4L9JA 4HV6A 5ICGA 4P55A 2MLGA 2QENA 4IJAA 3LA2A 1G6NA 4HAMA 2ESNA 1MKMA 2KJBA 2W24A 5LRSA 2O8XA 1RI7A 1FBQA 1ZG5A 2QWWA 4ON0A 5D5UB 2UWMA 4I02A 1X3UA 3HTUA 5E8GA 2ZJ2A 4OIOF 5K1YA 1J7KA 4LK1F 1TTYA 2HKXA 2X0LA 3CLOA 3L00A 3WE2A 4IF4A 5LBQA 2KKOA 3P9KA 4S05A 3HSFA 1GVJA 1T2KA 2NRAC 2J5PA 3FXUA 4JQFA 2EA4A 5E18F 4GGGA 1ZYRF 1FC3A 2BE5F 4NHJA 3REOA 1XSVA 4EGYA 2HDCA 1PP7U 2HFHA 3F22A 2YSRA 2B0LA 1MZBA 1BI3A 3BOQA 2D1VA 3KLOA 2EB7A 2O03A 2HWVA 3ML6A 3U9GA 1DPRA 1J5YA 2K4BA 3I58A 1HQCA 3R60A 2A69F 2XAQA 4XSXF 3BWGA 2DI3A 5L3BA 4JBAA 2EJRA 3GW2A 3GWZA 2ZO4A 2XHKA 1FLIA 3LSTA 3RIRA 3I5UA 4M72A 4MGRA 5L3FA 4I2OA 2LF7A 2RVCA 1HSTA 4WCGA 2QVOA 2K86A 2L4MA 1TLHB 5E1XA 3WTZA 5LLQA 4ZZLA 2M87A 3QOPA 4CYDA 5FD5A 1XSDA 4I98B 2XUBA 3LQQA 3WTSC 2QQBA 2NS0A 2FQ3A 1B9MA 1P92A 2GA2A 1SFEA 5BPIA 1WWXA 3BPXA 1OR7A 5HLHA 1YW8A 4HBLA 4N0BA 2F5FA 1L3LA 1YW7A 3E5QA 3GFJA 2STWA 5BPDA 5LGTA 3RJPA 1TQPA 1P4AA 2FMYA 1SFXA 3FMQA 2P8TA 3GZ6A 2QBYB 3FWEA 3R0JA 2L02A 2YX7A 5H20A 1CGPA 1I1SA 5CVVA 3JTGA 3HHGA 4U0WA 3ZN1A 4YIIA 3PQKA 3BROA 4EJVA 4LG0B 1J59A 1LDDA 1LDKB 1U5TB 2RNJA 1QGPA 4YG2F 3QPTA 5FLXK 3KEOA 2CSOA 2OQGA 4HF0A 3BJAA 5DCMB 1J2XA 1FP1D 1QZZA 4HLXA 2RV8A 5D8LB 4RGRA 1UHWA 5JI6A 4MEYF 2A6EF 1KU2A 2GXBA 1UHMA 1HSJA 5K5QA 3I54A 5L3EA 5DUIA 3PFIA 4HX8A 4RS8A 4BH9A 1MJAA 1LB2A 1XGSA 1NHAA 3SFZA 1SMTA 2HR3A 2QQAA 1RZ4A 5HLIA 3GX4X 2IW5A 2PMHA 3O2PE 4UV9A 4BQAA 1KGSA 4EM2A 3EETA 3KP7A 1W7PA 4XLPF 3I64A 4G6DA 4RB0A 1R58A 1T98A 2FE3A 2VBXA 1LQ1A 4MTDA 1BC8C 4HW0A 2P5LC 3RPUA 2HYFA 5J8FA 2JSCA 1ZRFA 4Z2YA 4FHTA 1J0RA 2M45A 1LVAA 3HOTA 4YFXF 4UHTA 1H9GA 2YX4A 3I59A 3ABUA 3SHFA 1E17A 2Z5UA 1O7FA 2VC1A 3J7AO 4YFKF 2EV6A 2K7LA 1SD7A 4WXDA 2IT0A 1OYIA 3L09A 3EDPA 3T0YA 4O6JA 4IXAA 2Q0OA 2QUFA 1B6AA 2WWYA 3F8MA 1ZLKA 1KQ9A 4YFNF 2L3DA 3U2RA 2ZMEA 1JXSA 1FT9A 2O0YA 3MZHA 1BI2A 1B4AA 5TRDA 1QBJA 1IW7F 1GHCA 5D5XB 3LAPA 4G6QA 4I01A 3SZTA 1I6XA 2YPRA 4KMFA 1G3YA 3GZ5A 5HDKA 2EFWA 1HW2A 4KT5C 3E97A 4LD5A 3M9AA 3KFWX 2ACJA 4JK1X 4EJTA 1TNSA 4IRIA 1U2WA 4WK8F 4HF2A 3GVAA 5DV5A 3HSRA 1MDMB 1R1UA 4R1HA 1HKTA 2OZUA 2V79A 1D3YA 2STTA 4LLNA 5IT9Z 3NQOA 3RDIA 3TOBA 2MBFA 1FX7A 4OMZA 3T8TA 1SD4A 2R7FA 1Z9CA 2X4HA 4F7ZA 2Z99A 5HLGA 1KQ0A 1ZHFA 3P9CA 2MD5A 2ZNZA 4ZYEA 2XASA 2PBIA 2XGXA 4WWCA 2XKPA 4EJUA 4WF2A 4DQ2A 5KVRA 2QQ9A 3CTAA 2L4AA 3IWFA 1CF7A 1MJBA 2J5OA 2ISYA 2KIUA 3F6VA 3QU3A 1BIAA 3IC7A 5D4RA 3NEUA 1IZ1A 1SFUA 2XIGA 4KDPA 4HX7A 2JT1A 1IN5A 2H27A 2EV5A 2QZ8A 5FGMA 3TO6A 3WGIA 1Z05A 3TGNA 1S6LA 4KYWA 4AIHA 1ONVA 2DFIA 4RAZA 1F1ZA 4GYGA 5ICEA 2OBPA 2DPDA 3WG9A 4EV0A 4WX9A 2DTRA 4P5OA 2Z3YA 3KZZA 4LB6B 5CVUA 1YYVA 1QQIA 1BC7C 1S8NA 4HF1A 5FLXZ 5ICFA 2HTJA 5HDNA 1FYMA 3D0SA 4ENJA 3HSEA 4U88A 1FYLA 3CUOA 5ILVA 4PCQA 2P7CB 2W25A 1IN4A 2G9WA 3TDUC 1OMIA 4M9SA 4HX4A 3K1NA 2D1HA 1U5TC 1EV7A 4U7BA 2PLYA 1H0MA 2VT2A 4I7HA 4BAYA 2NNNA 1YQAA 2RDPA 1ZGJA 3F8CA 3E5XA 1K78A 4MEXF 2V9VA 4AVPA 5LEJA 3KP3A 2VBWA 4RGUA 4BXUA 3FX3A 1OKRA 4KIGA 5H6RA 5E1ZB 1IRGA 4I0AA 2CQKA 2NAZA 4QWQA 3FXQA 2RKHA 1QNTA 4UXNA 1P2FA 3OV8A 2HGCA 2EFNA 2DW4A 3EYYA 2DQRA 4IPAA 1XSXA 4LGWA 2W84A 4M6YA 1ZG1A 4ASNA 2VE9A 1BIBA 3FXRA 3MQ0A 3E5UA 2D45A 4FT8A 4GO1A 4AWXB 5L3DA 3RYPA 2FRHA 1WQ2A 3SQNA 3VFZA 4QLCU 3ZMZA 4PGHA 5J8CA 3WTVC 3GFMA 1D5VA 1S3JA 1KYWA 1FP2A 5ILSA 1FSHA 4A0ZA 4L5JA 3C7JA 5D6EA 1XCBA 2W57A 3QU6A 2F5DA 1YTYA 2M30A 2JTVA 2IA2A 1ZLJA 1Z7UA 3LAJA 1BN5A 2ZNYA 4NB5A 5D5VB 1I27A 3C3WA 3G73A 3VODA 3O3KA 5F64A 2ADUA 3JAMK 2L54A 2XAHA 4IHSA 1KQ8A 1ZARA 1GXPA 5IT9K 1T6SA 1U78A 4WXHA 2G7UA 1R23A 4P9FA 1USSA 2A07F 5HS9A 3GO5A 1V4RA 4M9XA 1HKSA 1UB9A 5IT3A 3GXOA 1WKMA 4Y15A 5LGNA 2LF8A 4LMYA 2FBHA 1SAXA 4M6XA 4E70A 2EWNA 2WTEA 4A0XA 2DPUA 3HTSB 2A61A 1B9NA 3J80K 4CHUA 3B02A 1IN8A 2VOOA 2ZFWA 3H3ZA 3PQJA 2BBYA 5H6QA 3GF2A 4HOBA 4KIFA 3KEQA 3JSPA 1O7LA 2QYOA 3WTXC 3BDDA 2VC0A 5FFZA 4CXFA 4KIBA 1XD7A 2VODA 4MQVA 4L18B 5AONA 4ESJA 1IUYA 3V8LA 4ZYDA 3KCCA 2BV6A 4RB3C 2JZYA 2FXAA 3I59B 5K5RA 5AIQA 3G3ZA 2DK8A 1B1BA 1SMYF 4GXOA 1FNNA 4U0YA 3TQNA 1OPCA 1OYWA 1JHHA 4OINF 2EFOA 1XGMA 2GQQA 3LWFA 2H94A 5BOXA 1FBUA 4D0PA 3V7CA 3V8KA 3KETA 1E2XA 1UFMA 2BEOA 4MNUA 4MTEA 2CFXA 3CUQB 3J81Z 5D5WB 3BPVA 1WSUA 3HOSA 1VTNC 4ESBA 4G7OF 3IKVA 1FPQA 3ECOA 3WE3A 2IA1A 3VEPA 1FBSA 4ENNA 3K2ZA 1YW9A 1JHFA 3I4PA 5HDGA 1K7AA 4DNCA 3KE2A 4CGZA 2O61A 4N9IA 3KZYA 1ZRDA 4ZZDA 2ZCWA 5DEQA 4L9TA 3RTRA 1EH6A 3W6JB 5ED4A 3GFIA 3C1DA 2QBYA 3HRUA 3EYIA 1Z6TA 4Y13A 2FBKA 2RC4A 3DFGA 3W6KB 4HLYA 4XLNF 2AXLA 4PZJA 1I1GA 2PEXA 2Z33A 4G9YA 4LG0A 3EUHA 1U5TA 2HOEA 2PFBA 2ZKZA 4UVCA 2AS5F 2HTSA 2HKOA 5DCMA 4Q4ZF 2DU9A 1F5TA 2FEZA 2H6BA 4ENKA 1IXSB 3R61A 4EGZA 3K0LA 2GZWA 2EA2A 1LJ9A 1BI1A 1XDSA 2NNYA 1T38A 5JR3A 3KP6A 3V7RA 3TO9A 3T5XA 2MH9A 4KMUX 3I71A 1IF1A 3Q9VA 4GYIA 3LFKA 5F1RA 3EQLF 3F6OA 2ZXJA 2CWEA 2F2EA 1Y0UA 1ZREA 3WGGA 1H9TA 3JAMZ 3RYRA 5D8KB 1HXDA 3WGHA 4EJOA 3V7SA 5BMZA 3JTHA 2Z9OA 5DCFA 1YFHA 1Z6RA 3TOAA 1Z91A 4CICA 4A0YA 5LHIA 1LEBA 3I53A 5JHUA 2M5WA 5BS6A 1DDNA 2P4WA 2R3SA 2DQLA 4A5MA 1XGNA 1QO0D 3KP5A 1XMAA 3F72A 5E8IA 2K4JA 2FBIA 2BGCA 4BHCA 3KP4A 1XDUA 5DD4A 2HEOA 2ISZA 2H09A 3V8JA 5CLSA 3J80Z 1R1TA 3IL2A 3R0AA 4OU0A 3ISPA 4IRHA 3QP5A 3RI4A 1BM9A 4A2UA 2COMA 1KU3A 3DF8A 3AAFA 3I0TA 3K1PA 5LHGA 1IXRC 4Q5SF 2XKOA 2HS5A 3WU0A 1FWZA 3T8RA 2DK5A 1USTA 4ESFA 3SZPA 2XVCA 4U7DA 2DAOA 4R8HA 5HS7A 1TQIA 2GWRA 2L01A 1U3EM 1MGTA 1MDMA 2HQNA 3Q9SA 5E1WA 3DP7A 4UVAA 1FZPB 3L7WA 2VE8A 1F9NA 3J81K 1DUXC 1KU7A 1O3RA 2FF4A 5K5OA 4EM0B 1MJ9A 4BYYA 4HDVA 3O6BB 5DUKA 1GXQA 5F6FA 1F4KA 2M8EA 4CZZA 2UXXA 3V4GA 3CO6C 3ZMVA 3R6SA 3DPTA 2GIVA 4G7HF 2K27A 3JW4A 3K69A 5J6XA 3M8FA 1ULYA 2V1UA 1Z1DA 3BZ6A 3S2WA 2UXNA 3F23A 4HA8A 3CUQC 3R4KA 3MZYA 2MH2A 5HOOA 3GUDA 2P5KA 3WODF 3F8BA 1R1VA 1IN6A 3WTWC 4ZYHA 5CVIA 3CDHA 1TW3A 1O57A 2R7DA 2YU3A 4MQ9F 3RKWA 2PQ8A 5CJ9A 1KU9A 1FY7A 1PDNC 3DQVC 1IAWA 3LA7A 2GA1A 1W4MA 4BHPA 4Q48A 5E17F 2PMUA 3ERED 3TO7A 2HYGD 3MFKA 4UUVA 2FNPA 4OMYA 3E6MA 4RGXA 4LLGF 2VBZA 4WXCA 2PN6A 2EFPA 5L3GA 5JFRA 3KLNA 5LHHA 4G7ZF 3ABTA 3BJ6A 1LEAA 2LSOA 1W5TA 2IVMA 1XGOA 3HUGA 2PJPA 2NYXA 2XAFA 3L9FA 2IPQX 3ZPLA 4O5VA 2WC2A 2CYYA 1WRJA 3IWZA 2DO7A 4ETSA 1S7OA 3MCZA 4UNOA 1TQMA 2VBYA 4RB1A 2YR2A 2CGPA 1ON2A 3QPHA 1YS6A 3MAJA 4A6DA 5LRRA 5DYMA 4FX0A 3CJNA 1G3SA 3Q5FA 4KA4A 1J75A 1OYYA 2M1BA 4HQMA 1TW2A 5EEGA 3E6DA 4AIJA 4R79A 2F5EA 4H0EA 2ELHA 1FYKA 1K79A 4A12A 2A5YB 2FSWA 5CVRA 2MA3A 1B59A 1U8RA 2EK5A 3VB2A 2A6HF 1SD5A 2EFQA 5FO5A 4LK0F 1O3QA 3CO7C 3H3UA 3BY6A 5LGUA 4ZYGA 3U1DA 4EQQA 4IHTA 2P6TA 4KUMA 2FOKA 1BJAA 5CVJA 4I0BA 1ZN2A 1WI9A 5E20A 1R36A 4YIFA 3HRSA 3ROUA 4A6EA 1HKQA 4BNCA 2DBBA 2RQPA 1HW5A 3BP8A 1YG2A 1YIOA 1UCRA 2P7VB 4ENMA 2ETHA 4P96A 4RGSA 4IRGA 1W7PB 3T1BA 1IRFA 4PDKA 1P4XA 4Q47A 1ZRCA 3IKTA 4OIRF 4HYEA 4AD9A 3JSOA 4LJZF 2OD5A 1K6OA 2DT5A 4L9VA 1O3SA 1R5HA 3RPQA 1ZAOA 4K2EA 3TKYA 2E7WA 3FM5A 2KRFA 3HHHA 1J9IA 1R00A 2F5CA 3WU1B 2O3FA 4EMSA 4CDGA 2JPBA 3B73A 2P5VA 4LLLA 1LDJA 2H6CA 2E1CA 3DV8A 1T39A 4N9HA 1SD6A 1JGSA 1EH7A 2MLKA 5D4SA 4XSZF 4EJWA 4KICA 2V6CA 2ZMEB 2Y48A 3M1EA 1L0OC 4OIQF 2ESHA 2VT3A 2K02A 2XRNA 1HBXG 1HW1A 2OQRA 3NRVA 4S04A 1ZG3A 2QLZA 3RKYA 3K1MA 3DKWA 1A04A 1W5SA 1FOKA 2EV0A 1PUEE 1ODDA 4B8XA 4G94A 3ECHA 4UVBA 5BQTA 3ELKA 1D8JA 2VOPA 1IXCA 2KIFA 1FSEA 4M73A 3M7GA 3DEUA 2CO5A 4OOIA 5A2QZ 3F21A 2FMLA 1ON1A 4FX4A 4HZFA 4G8XA 2G7HA 3ZP5A 2GXGA 1Q1HA 4CO8A 4TV7A 4L5IA 4L0YB 5HS8A 3GLXA 4PGGA 4M71A 4O3MA 3DPLC 3WTYC 1KYZA 1DPUA 1MD0A 5DDGA 2UZKA 3IRRA 2FU4A 3LA3A 1TBXA 5KK1A 2V1DA 4P9UA 3FMRA 2TDXA 5ICCA 2FA5A 4Y17A 1RNLA 3F8FA 2CG4A 1S29A 1YO5C 1D8KA 1CF7B 1S7AA 1PP8F 2OA4A 1O3TA 2ZBKA 1QPMA 3DXJF 1ZH5A 3CUQA 3M8EA 1IN7A 2JRTA 1XCVA 4B09A 1BI0A 3FHZA 1W7PD 4LFUA 1R5GA 5D6FA 1P6RA 3K9TA 4U0VA 2A3SA 2RN7A 1G3TA 5JVTA 5ILUA 3QP6A 1JE8A 3WTTC 3ZMUA 1QZYA 1XB4A 4OIPF 5DD8A 3IRQA 2OZ6A 2IA0A 1XMKA 2Q2EA 4L0ZB 4MHGA 1XN7A 2OAZA 5HVQC 1YS7A 1BOAA 2VXZA 4KN4X 4KFCA 1BBYA 2IRFG 3IHUA 4NQWA 6PAXA 4I09A 2WV0A 2A68F 1TNTA 2VN2A 2DLLA 3GFLA 5FFXA 3ZMTA 3COAC 3ZMSA 3GYHX 2VONA 2XAJA 3ZQ7A 3QAHA 1P4WA 1YLFA 4EM1A 4EVIA 3H92A 3E3VA 2LDUA 2XROA 2E7XA 2GAUA 1U6GA 2QM3A 5L3CA 1REPC 3QRFF 1K78B 1G4DA 2V1XA 4GCVA 4XRFA 3RKXA 4AIKA 2MC3A 3FF5A 3WTUC 4RAYA 1R22A 2KJCA 4M9ZA 3P7NA 2Y75A 3TDZC 4HQEA 2PG4A 3F8NA 2P6SA 2JPCA 4HDUA 4A5NA 3ZMDA 1RUOA 3N4MA 2OU2A 2PI0A 3OOPA 5LEKA 3LQRA 2IP2A 2LNBA 2W85A 5TJJA 2BYVE 2RGVA 2O6GE 3SXYA 4UV8A 2D2WA 3ULQB 4LB5A 2Q8KA 1R7JA 4ZH4F 2LKPA 5CYVA 4L9NA 2FNAA 1AOYA 5ERIA 5EEHA 3D5LA 3MWMA 3C18A 1KA8A 4RB2C 3L2CA 1I5ZA 2CW0F 3MEXA 3HIFA 2E1NA 1V3FA 1EH8A 3HRTA 1AWCA 1ZGAA 2XAGA 1DP7P 2Y0MA 1T0FA 1LNWA 3E6BA 4IVNA 3N97A 3ZN0A 3HYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G3W A;  4M74 A;  3GEZ A;  1RIO H;  3VOE A;  3FMS A;  5FB2 A;  3F3X A;  2KIM A;  2XV4 S;  5A2Q K;  4BHB A;  1STZ A;  2IJL A;  5FD6 A;  3HRM A;  3BJO A;  4XBF A;  3P9I A;  4KN7 X;  4KNY A;  3FZV A;  3KP2 A;  1C0W A;  2C6Y A;  3E6C C;  2HQR A;  5AIP A;  4HV5 A;  1RUN A;  2HZT A;  3FM3 A;  4L9J A;  4HV6 A;  5ICG A;  4P55 A;  2MLG A;  2QEN A;  4IJA A;  3LA2 A;  1G6N A;  4HAM A;  2ESN A;  1MKM A;  2KJB A;  2W24 A;  5LRS A;  2O8X A;  1RI7 A;  1FBQ A;  1ZG5 A;  2QWW A;  4ON0 A;  5D5U B;  2UWM A;  4I02 A;  1X3U A;  3HTU A;  5E8G A;  2ZJ2 A;  4OIO F;  5K1Y A;  1J7K A;  4LK1 F;  1TTY A;  2HKX A;  2X0L A;  3CLO A;  3L00 A;  3WE2 A;  4IF4 A;  5LBQ A;  2KKO A;  3P9K A;  4S05 A;  3HSF A;  1GVJ A;  1T2K A;  2NRA C;  2J5P A;  3FXU A;  4JQF A;  2EA4 A;  5E18 F;  4GGG A;  1ZYR F;  1FC3 A;  2BE5 F;  4NHJ A;  3REO A;  1XSV A;  4EGY A;  2HDC A;  1PP7 U;  2HFH A;  3F22 A;  2YSR A;  2B0L A;  1MZB A;  1BI3 A;  3BOQ A;  2D1V A;  3KLO A;  2EB7 A;  2O03 A;  2HWV A;  3ML6 A;  3U9G A;  1DPR A;  1J5Y A;  2K4B A;  3I58 A;  1HQC A;  3R60 A;  2A69 F;  2XAQ A;  4XSX F;  3BWG A;  2DI3 A;  5L3B A;  4JBA A;  2EJR A;  3GW2 A;  3GWZ A;  2ZO4 A;  2XHK A;  1FLI A;  3LST A;  3RIR A;  3I5U A;  4M72 A;  4MGR A;  5L3F A;  4I2O A;  2LF7 A;  2RVC A;  1HST A;  4WCG A;  2QVO A;  2K86 A;  2L4M A;  1TLH B;  5E1X A;  3WTZ A;  5LLQ A;  4ZZL A;  2M87 A;  3QOP A;  4CYD A;  5FD5 A;  1XSD A;  4I98 B;  2XUB A;  3LQQ A;  3WTS C;  2QQB A;  2NS0 A;  2FQ3 A;  1B9M A;  1P92 A;  2GA2 A;  1SFE A;  5BPI A;  1WWX A;  3BPX A;  1OR7 A;  5HLH A;  1YW8 A;  4HBL A;  4N0B A;  2F5F A;  1L3L A;  1YW7 A;  3E5Q A;  3GFJ A;  2STW A;  5BPD A;  5LGT A;  3RJP A;  1TQP A;  1P4A A;  2FMY A;  1SFX A;  3FMQ A;  2P8T A;  3GZ6 A;  2QBY B;  3FWE A;  3R0J A;  2L02 A;  2YX7 A;  5H20 A;  1CGP A;  1I1S A;  5CVV A;  3JTG A;  3HHG A;  4U0W A;  3ZN1 A;  4YII A;  3PQK A;  3BRO A;  4EJV A;  4LG0 B;  1J59 A;  1LDD A;  1LDK B;  1U5T B;  2RNJ A;  1QGP A;  4YG2 F;  3QPT A;  5FLX K;  3KEO A;  2CSO A;  2OQG A;  4HF0 A;  3BJA A;  5DCM B;  1J2X A;  1FP1 D;  1QZZ A;  4HLX A;  2RV8 A;  5D8L B;  4RGR A;  1UHW A;  5JI6 A;  4MEY F;  2A6E F;  1KU2 A;  2GXB A;  1UHM A;  1HSJ A;  5K5Q A;  3I54 A;  5L3E A;  5DUI A;  3PFI A;  4HX8 A;  4RS8 A;  4BH9 A;  1MJA A;  1LB2 A;  1XGS A;  1NHA A;  3SFZ A;  1SMT A;  2HR3 A;  2QQA A;  1RZ4 A;  5HLI A;  3GX4 X;  2IW5 A;  2PMH A;  3O2P E;  4UV9 A;  4BQA A;  1KGS A;  4EM2 A;  3EET A;  3KP7 A;  1W7P A;  4XLP F;  3I64 A;  4G6D A;  4RB0 A;  1R58 A;  1T98 A;  2FE3 A;  2VBX A;  1LQ1 A;  4MTD A;  1BC8 C;  4HW0 A;  2P5L C;  3RPU A;  2HYF A;  5J8F A;  2JSC A;  1ZRF A;  4Z2Y A;  4FHT A;  1J0R A;  2M45 A;  1LVA A;  3HOT A;  4YFX F;  4UHT A;  1H9G A;  2YX4 A;  3I59 A;  3ABU A;  3SHF A;  1E17 A;  2Z5U A;  1O7F A;  2VC1 A;  3J7A O;  4YFK F;  2EV6 A;  2K7L A;  1SD7 A;  4WXD A;  2IT0 A;  1OYI A;  3L09 A;  3EDP A;  3T0Y A;  4O6J A;  4IXA A;  2Q0O A;  2QUF A;  1B6A A;  2WWY A;  3F8M A;  1ZLK A;  1KQ9 A;  4YFN F;  2L3D A;  3U2R A;  2ZME A;  1JXS A;  1FT9 A;  2O0Y A;  3MZH A;  1BI2 A;  1B4A A;  5TRD A;  1QBJ A;  1IW7 F;  1GHC A;  5D5X B;  3LAP A;  4G6Q A;  4I01 A;  3SZT A;  1I6X A;  2YPR A;  4KMF A;  1G3Y A;  3GZ5 A;  5HDK A;  2EFW A;  1HW2 A;  4KT5 C;  3E97 A;  4LD5 A;  3M9A A;  3KFW X;  2ACJ A;  4JK1 X;  4EJT A;  1TNS A;  4IRI A;  1U2W A;  4WK8 F;  4HF2 A;  3GVA A;  5DV5 A;  3HSR A;  1MDM B;  1R1U A;  4R1H A;  1HKT A;  2OZU A;  2V79 A;  1D3Y A;  2STT A;  4LLN A;  5IT9 Z;  3NQO A;  3RDI A;  3TOB A;  2MBF A;  1FX7 A;  4OMZ A;  3T8T A;  1SD4 A;  2R7F A;  1Z9C A;  2X4H A;  4F7Z A;  2Z99 A;  5HLG A;  1KQ0 A;  1ZHF A;  3P9C A;  2MD5 A;  2ZNZ A;  4ZYE A;  2XAS A;  2PBI A;  2XGX A;  4WWC A;  2XKP A;  4EJU A;  4WF2 A;  4DQ2 A;  5KVR A;  2QQ9 A;  3CTA A;  2L4A A;  3IWF A;  1CF7 A;  1MJB A;  2J5O A;  2ISY A;  2KIU A;  3F6V A;  3QU3 A;  1BIA A;  3IC7 A;  5D4R A;  3NEU A;  1IZ1 A;  1SFU A;  2XIG A;  4KDP A;  4HX7 A;  2JT1 A;  1IN5 A;  2H27 A;  2EV5 A;  2QZ8 A;  5FGM A;  3TO6 A;  3WGI A;  1Z05 A;  3TGN A;  1S6L A;  4KYW A;  4AIH A;  1ONV A;  2DFI A;  4RAZ A;  1F1Z A;  4GYG A;  5ICE A;  2OBP A;  2DPD A;  3WG9 A;  4EV0 A;  4WX9 A;  2DTR A;  4P5O A;  2Z3Y A;  3KZZ A;  4LB6 B;  5CVU A;  1YYV A;  1QQI A;  1BC7 C;  1S8N A;  4HF1 A;  5FLX Z;  5ICF A;  2HTJ A;  5HDN A;  1FYM A;  3D0S A;  4ENJ A;  3HSE A;  4U88 A;  1FYL A;  3CUO A;  5ILV A;  4PCQ A;  2P7C B;  2W25 A;  1IN4 A;  2G9W A;  3TDU C;  1OMI A;  4M9S A;  4HX4 A;  3K1N A;  2D1H A;  1U5T C;  1EV7 A;  4U7B A;  2PLY A;  1H0M A;  2VT2 A;  4I7H A;  4BAY A;  2NNN A;  1YQA A;  2RDP A;  1ZGJ A;  3F8C A;  3E5X A;  1K78 A;  4MEX F;  2V9V A;  4AVP A;  5LEJ A;  3KP3 A;  2VBW A;  4RGU A;  4BXU A;  3FX3 A;  1OKR A;  4KIG A;  5H6R A;  5E1Z B;  1IRG A;  4I0A A;  2CQK A;  2NAZ A;  4QWQ A;  3FXQ A;  2RKH A;  1QNT A;  4UXN A;  1P2F A;  3OV8 A;  2HGC A;  2EFN A;  2DW4 A;  3EYY A;  2DQR A;  4IPA A;  1XSX A;  4LGW A;  2W84 A;  4M6Y A;  1ZG1 A;  4ASN A;  2VE9 A;  1BIB A;  3FXR A;  3MQ0 A;  3E5U A;  2D45 A;  4FT8 A;  4GO1 A;  4AWX B;  5L3D A;  3RYP A;  2FRH A;  1WQ2 A;  3SQN A;  3VFZ A;  4QLC U;  3ZMZ A;  4PGH A;  5J8C A;  3WTV C;  3GFM A;  1D5V A;  1S3J A;  1KYW A;  1FP2 A;  5ILS A;  1FSH A;  4A0Z A;  4L5J A;  3C7J A;  5D6E A;  1XCB A;  2W57 A;  3QU6 A;  2F5D A;  1YTY A;  2M30 A;  2JTV A;  2IA2 A;  1ZLJ A;  1Z7U A;  3LAJ A;  1BN5 A;  2ZNY A;  4NB5 A;  5D5V B;  1I27 A;  3C3W A;  3G73 A;  3VOD A;  3O3K A;  5F64 A;  2ADU A;  3JAM K;  2L54 A;  2XAH A;  4IHS A;  1KQ8 A;  1ZAR A;  1GXP A;  5IT9 K;  1T6S A;  1U78 A;  4WXH A;  2G7U A;  1R23 A;  4P9F A;  1USS A;  2A07 F;  5HS9 A;  3GO5 A;  1V4R A;  4M9X A;  1HKS A;  1UB9 A;  5IT3 A;  3GXO A;  1WKM A;  4Y15 A;  5LGN A;  2LF8 A;  4LMY A;  2FBH A;  1SAX A;  4M6X A;  4E70 A;  2EWN A;  2WTE A;  4A0X A;  2DPU A;  3HTS B;  2A61 A;  1B9N A;  3J80 K;  4CHU A;  3B02 A;  1IN8 A;  2VOO A;  2ZFW A;  3H3Z A;  3PQJ A;  2BBY A;  5H6Q A;  3GF2 A;  4HOB A;  4KIF A;  3KEQ A;  3JSP A;  1O7L A;  2QYO A;  3WTX C;  3BDD A;  2VC0 A;  5FFZ A;  4CXF A;  4KIB A;  1XD7 A;  2VOD A;  4MQV A;  4L18 B;  5AON A;  4ESJ A;  1IUY A;  3V8L A;  4ZYD A;  3KCC A;  2BV6 A;  4RB3 C;  2JZY A;  2FXA A;  3I59 B;  5K5R A;  5AIQ A;  3G3Z A;  2DK8 A;  1B1B A;  1SMY F;  4GXO A;  1FNN A;  4U0Y A;  3TQN A;  1OPC A;  1OYW A;  1JHH A;  4OIN F;  2EFO A;  1XGM A;  2GQQ A;  3LWF A;  2H94 A;  5BOX A;  1FBU A;  4D0P A;  3V7C A;  3V8K A;  3KET A;  1E2X A;  1UFM A;  2BEO A;  4MNU A;  4MTE A;  2CFX A;  3CUQ B;  3J81 Z;  5D5W B;  3BPV A;  1WSU A;  3HOS A;  1VTN C;  4ESB A;  4G7O F;  3IKV A;  1FPQ A;  3ECO A;  3WE3 A;  2IA1 A;  3VEP A;  1FBS A;  4ENN A;  3K2Z A;  1YW9 A;  1JHF A;  3I4P A;  5HDG A;  1K7A A;  4DNC A;  3KE2 A;  4CGZ A;  2O61 A;  4N9I A;  3KZY A;  1ZRD A;  4ZZD A;  2ZCW A;  5DEQ A;  4L9T A;  3RTR A;  1EH6 A;  3W6J B;  5ED4 A;  3GFI A;  3C1D A;  2QBY A;  3HRU A;  3EYI A;  1Z6T A;  4Y13 A;  2FBK A;  2RC4 A;  3DFG A;  3W6K B;  4HLY A;  4XLN F;  2AXL A;  4PZJ A;  1I1G A;  2PEX A;  2Z33 A;  4G9Y A;  4LG0 A;  3EUH A;  1U5T A;  2HOE A;  2PFB A;  2ZKZ A;  4UVC A;  2AS5 F;  2HTS A;  2HKO A;  5DCM A;  4Q4Z F;  2DU9 A;  1F5T A;  2FEZ A;  2H6B A;  4ENK A;  1IXS B;  3R61 A;  4EGZ A;  3K0L A;  2GZW A;  2EA2 A;  1LJ9 A;  1BI1 A;  1XDS A;  2NNY A;  1T38 A;  5JR3 A;  3KP6 A;  3V7R A;  3TO9 A;  3T5X A;  2MH9 A;  4KMU X;  3I71 A;  1IF1 A;  3Q9V A;  4GYI A;  3LFK A;  5F1R A;  3EQL F;  3F6O A;  2ZXJ A;  2CWE A;  2F2E A;  1Y0U A;  1ZRE A;  3WGG A;  1H9T A;  3JAM Z;  3RYR A;  5D8K B;  1HXD A;  3WGH A;  4EJO A;  3V7S A;  5BMZ A;  3JTH A;  2Z9O A;  5DCF A;  1YFH A;  1Z6R A;  3TOA A;  1Z91 A;  4CIC A;  4A0Y A;  5LHI A;  1LEB A;  3I53 A;  5JHU A;  2M5W A;  5BS6 A;  1DDN A;  2P4W A;  2R3S A;  2DQL A;  4A5M A;  1XGN A;  1QO0 D;  3KP5 A;  1XMA A;  3F72 A;  5E8I A;  2K4J A;  2FBI A;  2BGC A;  4BHC A;  3KP4 A;  1XDU A;  5DD4 A;  2HEO A;  2ISZ A;  2H09 A;  3V8J A;  5CLS A;  3J80 Z;  1R1T A;  3IL2 A;  3R0A A;  4OU0 A;  3ISP A;  4IRH A;  3QP5 A;  3RI4 A;  1BM9 A;  4A2U A;  2COM A;  1KU3 A;  3DF8 A;  3AAF A;  3I0T A;  3K1P A;  5LHG A;  1IXR C;  4Q5S F;  2XKO A;  2HS5 A;  3WU0 A;  1FWZ A;  3T8R A;  2DK5 A;  1UST A;  4ESF A;  3SZP A;  2XVC A;  4U7D A;  2DAO A;  4R8H A;  5HS7 A;  1TQI A;  2GWR A;  2L01 A;  1U3E M;  1MGT A;  1MDM A;  2HQN A;  3Q9S A;  5E1W A;  3DP7 A;  4UVA A;  1FZP B;  3L7W A;  2VE8 A;  1F9N A;  3J81 K;  1DUX C;  1KU7 A;  1O3R A;  2FF4 A;  5K5O A;  4EM0 B;  1MJ9 A;  4BYY A;  4HDV A;  3O6B B;  5DUK A;  1GXQ A;  5F6F A;  1F4K A;  2M8E A;  4CZZ A;  2UXX A;  3V4G A;  3CO6 C;  3ZMV A;  3R6S A;  3DPT A;  2GIV A;  4G7H F;  2K27 A;  3JW4 A;  3K69 A;  5J6X A;  3M8F A;  1ULY A;  2V1U A;  1Z1D A;  3BZ6 A;  3S2W A;  2UXN A;  3F23 A;  4HA8 A;  3CUQ C;  3R4K A;  3MZY A;  2MH2 A;  5HOO A;  3GUD A;  2P5K A;  3WOD F;  3F8B A;  1R1V A;  1IN6 A;  3WTW C;  4ZYH A;  5CVI A;  3CDH A;  1TW3 A;  1O57 A;  2R7D A;  2YU3 A;  4MQ9 F;  3RKW A;  2PQ8 A;  5CJ9 A;  1KU9 A;  1FY7 A;  1PDN C;  3DQV C;  1IAW A;  3LA7 A;  2GA1 A;  1W4M A;  4BHP A;  4Q48 A;  5E17 F;  2PMU A;  3ERE D;  3TO7 A;  2HYG D;  3MFK A;  4UUV A;  2FNP A;  4OMY A;  3E6M A;  4RGX A;  4LLG F;  2VBZ A;  4WXC A;  2PN6 A;  2EFP A;  5L3G A;  5JFR A;  3KLN A;  5LHH A;  4G7Z F;  3ABT A;  3BJ6 A;  1LEA A;  2LSO A;  1W5T A;  2IVM A;  1XGO A;  3HUG A;  2PJP A;  2NYX A;  2XAF A;  3L9F A;  2IPQ X;  3ZPL A;  4O5V A;  2WC2 A;  2CYY A;  1WRJ A;  3IWZ A;  2DO7 A;  4ETS A;  1S7O A;  3MCZ A;  4UNO A;  1TQM A;  2VBY A;  4RB1 A;  2YR2 A;  2CGP A;  1ON2 A;  3QPH A;  1YS6 A;  3MAJ A;  4A6D A;  5LRR A;  5DYM A;  4FX0 A;  3CJN A;  1G3S A;  3Q5F A;  4KA4 A;  1J75 A;  1OYY A;  2M1B A;  4HQM A;  1TW2 A;  5EEG A;  3E6D A;  4AIJ A;  4R79 A;  2F5E A;  4H0E A;  2ELH A;  1FYK A;  1K79 A;  4A12 A;  2A5Y B;  2FSW A;  5CVR A;  2MA3 A;  1B59 A;  1U8R A;  2EK5 A;  3VB2 A;  2A6H F;  1SD5 A;  2EFQ A;  5FO5 A;  4LK0 F;  1O3Q A;  3CO7 C;  3H3U A;  3BY6 A;  5LGU A;  4ZYG A;  3U1D A;  4EQQ A;  4IHT A;  2P6T A;  4KUM A;  2FOK A;  1BJA A;  5CVJ A;  4I0B A;  1ZN2 A;  1WI9 A;  5E20 A;  1R36 A;  4YIF A;  3HRS A;  3ROU A;  4A6E A;  1HKQ A;  4BNC A;  2DBB A;  2RQP A;  1HW5 A;  3BP8 A;  1YG2 A;  1YIO A;  1UCR A;  2P7V B;  4ENM A;  2ETH A;  4P96 A;  4RGS A;  4IRG A;  1W7P B;  3T1B A;  1IRF A;  4PDK A;  1P4X A;  4Q47 A;  1ZRC A;  3IKT A;  4OIR F;  4HYE A;  4AD9 A;  3JSO A;  4LJZ F;  2OD5 A;  1K6O A;  2DT5 A;  4L9V A;  1O3S A;  1R5H A;  3RPQ A;  1ZAO A;  4K2E A;  3TKY A;  2E7W A;  3FM5 A;  2KRF A;  3HHH A;  1J9I A;  1R00 A;  2F5C A;  3WU1 B;  2O3F A;  4EMS A;  4CDG A;  2JPB A;  3B73 A;  2P5V A;  4LLL A;  1LDJ A;  2H6C A;  2E1C A;  3DV8 A;  1T39 A;  4N9H A;  1SD6 A;  1JGS A;  1EH7 A;  2MLK A;  5D4S A;  4XSZ F;  4EJW A;  4KIC A;  2V6C A;  2ZME B;  2Y48 A;  3M1E A;  1L0O C;  4OIQ F;  2ESH A;  2VT3 A;  2K02 A;  2XRN A;  1HBX G;  1HW1 A;  2OQR A;  3NRV A;  4S04 A;  1ZG3 A;  2QLZ A;  3RKY A;  3K1M A;  3DKW A;  1A04 A;  1W5S A;  1FOK A;  2EV0 A;  1PUE E;  1ODD A;  4B8X A;  4G94 A;  3ECH A;  4UVB A;  5BQT A;  3ELK A;  1D8J A;  2VOP A;  1IXC A;  2KIF A;  1FSE A;  4M73 A;  3M7G A;  3DEU A;  2CO5 A;  4OOI A;  5A2Q Z;  3F21 A;  2FML A;  1ON1 A;  4FX4 A;  4HZF A;  4G8X A;  2G7H A;  3ZP5 A;  2GXG A;  1Q1H A;  4CO8 A;  4TV7 A;  4L5I A;  4L0Y B;  5HS8 A;  3GLX A;  4PGG A;  4M71 A;  4O3M A;  3DPL C;  3WTY C;  1KYZ A;  1DPU A;  1MD0 A;  5DDG A;  2UZK A;  3IRR A;  2FU4 A;  3LA3 A;  1TBX A;  5KK1 A;  2V1D A;  4P9U A;  3FMR A;  2TDX A;  5ICC A;  2FA5 A;  4Y17 A;  1RNL A;  3F8F A;  2CG4 A;  1S29 A;  1YO5 C;  1D8K A;  1CF7 B;  1S7A A;  1PP8 F;  2OA4 A;  1O3T A;  2ZBK A;  1QPM A;  3DXJ F;  1ZH5 A;  3CUQ A;  3M8E A;  1IN7 A;  2JRT A;  1XCV A;  4B09 A;  1BI0 A;  3FHZ A;  1W7P D;  4LFU A;  1R5G A;  5D6F A;  1P6R A;  3K9T A;  4U0V A;  2A3S A;  2RN7 A;  1G3T A;  5JVT A;  5ILU A;  3QP6 A;  1JE8 A;  3WTT C;  3ZMU A;  1QZY A;  1XB4 A;  4OIP F;  5DD8 A;  3IRQ A;  2OZ6 A;  2IA0 A;  1XMK A;  2Q2E A;  4L0Z B;  4MHG A;  1XN7 A;  2OAZ A;  5HVQ C;  1YS7 A;  1BOA A;  2VXZ A;  4KN4 X;  4KFC A;  1BBY A;  2IRF G;  3IHU A;  4NQW A;  6PAX A;  4I09 A;  2WV0 A;  2A68 F;  1TNT A;  2VN2 A;  2DLL A;  3GFL A;  5FFX A;  3ZMT A;  3COA C;  3ZMS A;  3GYH X;  2VON A;  2XAJ A;  3ZQ7 A;  3QAH A;  1P4W A;  1YLF A;  4EM1 A;  4EVI A;  3H92 A;  3E3V A;  2LDU A;  2XRO A;  2E7X A;  2GAU A;  1U6G A;  2QM3 A;  5L3C A;  1REP C;  3QRF F;  1K78 B;  1G4D A;  2V1X A;  4GCV A;  4XRF A;  3RKX A;  4AIK A;  2MC3 A;  3FF5 A;  3WTU C;  4RAY A;  1R22 A;  2KJC A;  4M9Z A;  3P7N A;  2Y75 A;  3TDZ C;  4HQE A;  2PG4 A;  3F8N A;  2P6S A;  2JPC A;  4HDU A;  4A5N A;  3ZMD A;  1RUO A;  3N4M A;  2OU2 A;  2PI0 A;  3OOP A;  5LEK A;  3LQR A;  2IP2 A;  2LNB A;  2W85 A;  5TJJ A;  2BYV E;  2RGV A;  2O6G E;  3SXY A;  4UV8 A;  2D2W A;  3ULQ B;  4LB5 A;  2Q8K A;  1R7J A;  4ZH4 F;  2LKP A;  5CYV A;  4L9N A;  2FNA A;  1AOY A;  5ERI A;  5EEH A;  3D5L A;  3MWM A;  3C18 A;  1KA8 A;  4RB2 C;  3L2C A;  1I5Z A;  2CW0 F;  3MEX A;  3HIF A;  2E1N A;  1V3F A;  1EH8 A;  3HRT A;  1AWC A;  1ZGA A;  2XAG A;  1DP7 P;  2Y0M A;  1T0F A;  1LNW A;  3E6B A;  4IVN A;  3N97 A;  3ZN0 A;  3HYI A; 
#chains in the Genus database with same CATH topology
 1G3W A;  2IAI A;  4M74 A;  4ZDO A;  2CQN A;  3GEZ A;  2VKE A;  2ZXH A;  1RIO H;  3VOE A;  4Y52 J;  3FMS A;  3FXO A;  3RCO A;  2R7O A;  5FB2 A;  3F3X A;  2KIM A;  3CJR B;  2XV4 S;  4XRS G;  4PJ0 C;  5A2Q K;  4BHB A;  1Z67 A;  3LMM A;  1STZ A;  2IJL A;  5FD6 A;  3HRM A;  4Y3O A;  3BJO A;  4XBF A;  3P9I A;  2DXI A;  4KN7 X;  2EZL A;  4KNY A;  3FZV A;  2AQF A;  2ZJR F;  1LKX A;  3KP2 A;  1C0W A;  2C6Y A;  2QEX I;  1Y39 A;  2KIS A;  5JLW A;  1U9N A;  1QPI A;  3SJM A;  3HZJ A;  1LPQ A;  3E6C C;  2HQR A;  5AIP A;  2V4J C;  1ETV A;  4HV5 A;  3JRF A;  3UKG A;  1RUN A;  2HZT A;  3FM3 A;  5GAD J;  1H8A C;  4JOM A;  4L9J A;  4XKB A;  4HV6 A;  1YJW I;  5ICG A;  4P55 A;  2MLG A;  5C4X J;  2HYJ A;  2QEN A;  4DOZ A;  4IJA A;  3LA2 A;  2IGN A;  1G6N A;  4HAM A;  3AKZ A;  2ESN A;  1MKM A;  3S15 J;  2KJB A;  2W24 A;  4PUS A;  5LRS A;  2O8X A;  3QYF A;  4AUX A;  1ETO A;  1RI7 A;  1FBQ A;  5B1A H;  2WAF A;  2K3P A;  1ZG5 A;  2QWW A;  4ON0 A;  2BHZ A;  3H9G A;  3K4B A;  5D5U B;  4I02 A;  1X3U A;  1IC8 A;  2UWM A;  2ID3 A;  3HTU A;  3CCJ I;  5E8G A;  2ZJ2 A;  4OIO F;  1V5E A;  5K1Y A;  1J7K A;  1EJ9 A;  5JVG F;  4LK1 F;  1TTY A;  2HKX A;  5EG0 A;  2X0L A;  4A3K J;  2XF7 A;  3CLO A;  1A35 A;  3L00 A;  3WE2 A;  3DLL F;  2NOJ B;  4IF4 A;  4ZDP A;  1S7E A;  4BU2 A;  5LBQ A;  2HZD A;  2KKO A;  3P9K A;  1MND A;  2LRD A;  4S05 A;  3HSF A;  3OYG A;  5LD2 C;  4IEJ A;  2XSD C;  1GVJ A;  3PNY A;  1T2K A;  4YIR X;  3G4S I;  4CH7 A;  2NRA C;  2Y9Z A;  4XOT A;  2QSH X;  1ITY A;  2J5P A;  3FXU A;  4JQF A;  2EA4 A;  5E18 F;  4GGG A;  4IHV A;  1S72 I;  1ZYR F;  1FC3 A;  2IBD A;  4A69 C;  1YHQ I;  2BE5 F;  4NHJ A;  1ERD A;  3DBH B;  3S3O A;  4C2U A;  1MMA A;  5IY5 H;  3REO A;  3EUK L;  4LIT A;  1G2H A;  4XL9 A;  5FRO A;  1XSV A;  4E7H A;  4EGY A;  2JA8 J;  2OCE A;  2HDC A;  1PP7 U;  4PFP A;  4NBQ A;  2HFH A;  1Y1W J;  3F22 A;  2YSR A;  2MG4 A;  2B0L A;  2P0W A;  1MZB A;  1BI3 A;  1I39 A;  3MKL A;  3BOQ A;  2D1V A;  3KLO A;  2Y0S N;  2EB7 A;  4E7K A;  5M3M J;  4D5C A;  2O03 A;  2HWV A;  3ML6 A;  3U9G A;  4D7M A;  1DPR A;  1J5Y A;  2K4B A;  3I58 A;  2F48 A;  1HQC A;  3KX2 A;  3R60 A;  1Q1V A;  2A69 F;  1HC8 A;  2XAQ A;  4XSX F;  3BWG A;  1X19 A;  2HNH A;  2DI3 A;  5L3B A;  2E60 A;  4JBA A;  2EJR A;  2JVH A;  4FTH A;  1MNE A;  1YX3 A;  2LP0 A;  3GW2 A;  3GWZ A;  2ZO4 A;  3K7A J;  4PJM A;  2XHK A;  1FLI A;  1B72 A;  3CDL A;  3LST A;  3RIR A;  3I5U A;  4M72 A;  4MGR A;  5M5Y J;  4UUS B;  2HOA A;  5L3F A;  4I2O A;  1SAU A;  2LF7 A;  2RVC A;  1HST A;  4ITV A;  4M3E A;  4WCG A;  4XON A;  2QVO A;  2K86 A;  2L4M A;  2MW8 A;  3I55 I;  1TLH B;  5E1X A;  3WTZ A;  5LLQ A;  4ZZL A;  2M87 A;  2EZK A;  3QOP A;  4BUP A;  4CYD A;  4AM3 A;  5FD5 A;  1XSD A;  2KL4 A;  4I98 B;  2DMN A;  2XUB A;  5DTD A;  1VQO I;  1A6Q A;  1TWC J;  1QU3 A;  3JRC A;  3LQQ A;  3BT9 A;  1W1W E;  4CCK A;  3WTS C;  2X9D A;  3MZ8 A;  2QQB A;  5DS9 A;  2NVU B;  2NS0 A;  4BJT A;  2FQ3 A;  2BY0 A;  3FDY A;  1B9M A;  2DJI A;  1P92 A;  2GA2 A;  1TP4 A;  2VQH A;  2IS1 A;  4U87 A;  1SFE A;  2KT0 A;  5BPI A;  1WWX A;  1QVT A;  3BPX A;  1OR7 A;  5HLH A;  1YW8 A;  4HBL A;  4N0B A;  2FX0 A;  1UAA A;  2F5F A;  1L3L A;  3DEE A;  1YW7 A;  2Z2S B;  3E5Q A;  3GFJ A;  4UY8 I;  3HOZ J;  1T8I A;  5IOY A;  2K3F A;  2STW A;  5BPD A;  5LGT A;  3BG7 A;  3RJP A;  1TQP A;  2GLO A;  1P4A A;  1K4S A;  2FMY A;  1SFX A;  3FMQ A;  4RDU A;  2P8T A;  2DMP A;  3OMY A;  3GZ6 A;  2QBY B;  2DMQ A;  3FWE A;  4GRI A;  3R0J A;  2L02 A;  2YX7 A;  5H20 A;  1CGP A;  1I1S A;  3J7Z I;  1Z0X A;  4DZP A;  5CVV A;  3L2V A;  3JTG A;  1QHG A;  3ZQQ A;  3HHG A;  4U0W A;  2CRG A;  3HKZ N;  2DJN A;  3ZN1 A;  3BR6 A;  5EZG A;  4YII A;  1ZQ3 P;  3I4N J;  1WJ5 A;  3PQK A;  1M1E B;  3BRO A;  4EJV A;  2QF7 A;  4LG0 B;  1J59 A;  1LDD A;  1LDK B;  2VKD A;  4Y4R A;  4J01 A;  1NTC A;  5J1R A;  1SEU A;  1U5T B;  1W0U A;  4CCN A;  2RNJ A;  1QGP A;  2NVY J;  4YG2 F;  2X51 A;  3QPT A;  5FLX K;  2M7B A;  3KEO A;  2CSO A;  4BE1 A;  4X1E A;  2H1K A;  1P7J A;  4XMY A;  2OQG A;  4HF0 A;  3BJA A;  2QQ8 A;  5DCM B;  1J2X A;  1HDP A;  2I8D A;  1CQT A;  1FP1 D;  3OL3 A;  1QZZ A;  4HLX A;  3DCF A;  1AKH B;  3S3M A;  2RV8 A;  3ZQI A;  5D8L B;  4RGR A;  3BTC A;  3KIO A;  1UHW A;  5JI6 A;  4MEY F;  1JUS A;  2A6E F;  2LOO A;  1KU2 A;  4IL6 C;  3WG7 H;  4W97 A;  1UHM A;  2GXB A;  1HSJ A;  3H1C A;  5GAH J;  5K5Q A;  3I54 A;  3CF5 F;  5L3E A;  3JRA A;  5DUI A;  3DTI A;  3PFI A;  2X1D A;  4HX8 A;  4RS8 A;  4BH9 A;  1MJA A;  4MFE A;  2XGE A;  1QHH D;  1LB2 A;  3S14 J;  2OV7 A;  1XGS A;  2KHM A;  3JRH A;  1NHA A;  3FIS A;  1BW6 A;  1BR2 A;  3SFZ A;  1SMT A;  2JA7 J;  2F4I A;  3HOX J;  3G1M A;  2HR3 A;  2QQA A;  1RZ4 A;  5HLI A;  3GX4 X;  4BL0 B;  2IW5 A;  3DU6 A;  2PMH A;  2K9S A;  3O2P E;  4UV9 A;  2DFH A;  4BQA A;  1KGS A;  1PVE A;  2K9M A;  3IP4 B;  4EM2 A;  2DA2 A;  3EET A;  3U21 A;  2DDB A;  3KP7 A;  1DGW Y;  1W7P A;  2WBM A;  2BY1 A;  2F4M B;  5IYD J;  4XLP F;  2MYS A;  4CYC A;  3I64 A;  4G6D A;  1HOM A;  1R58 A;  1T98 A;  4RB0 A;  4BJ6 C;  3ZRG A;  2FE3 A;  4ZTJ A;  2VBX A;  4FIS A;  1LQ1 A;  4C3H J;  4MTD A;  1BC8 C;  1XPX A;  4HW0 A;  1OCO H;  2P5L C;  1LUJ B;  4H4K C;  5EJC A;  2DA1 A;  2HYF A;  3RPU A;  5J8F A;  2JSC A;  2E36 A;  1ZRF A;  2PJR B;  4Z2Y A;  4FHT A;  1J0R A;  2M45 A;  1LVA A;  2ZJQ F;  3HOT A;  3LSI A;  2RQQ A;  3IAM 2;  3FKI J;  4UHT A;  1H9G A;  4YFX F;  2R7Z J;  2VJJ A;  2YX4 A;  3I59 A;  5M5W J;  3ABU A;  3SHF A;  1E17 A;  2VPL A;  2Z5U A;  3BR0 A;  1O7F A;  4DYC A;  2VC1 A;  3J7A O;  2WY7 Q;  2BY2 A;  2EIL H;  4YFK F;  2Y31 A;  1OIS A;  2EV6 A;  2EZH A;  2K7L A;  1SD7 A;  3QOD A;  4WXD A;  3I56 I;  1H88 C;  1A36 A;  2IT0 A;  4IQJ A;  3S3N A;  1OYI A;  1YJN I;  5FKL A;  4QSH A;  3L09 A;  2LY2 A;  2M0M A;  3EDP A;  1UHS A;  2X6Y A;  3MKW B;  3T0Y A;  4O6J A;  2HU9 A;  1TT5 B;  4IXA A;  1LE8 B;  2Q0O A;  2QUF A;  3PUF A;  4HEA 2;  1B6A A;  3OS2 A;  2V9K A;  3GTL J;  2WWY A;  3BLY A;  3F8M A;  1ZLK A;  2F4O B;  4F3Q A;  1KQ9 A;  4YFN F;  2L3D A;  3GME A;  3SEZ A;  1Z21 A;  3U2R A;  3HOU J;  2ZME A;  1JXS A;  1FT9 A;  2O0Y A;  3SEQ A;  3MZH A;  5KAI C;  1BI2 A;  2HOT A;  1B4A A;  5TRD A;  3HJE A;  3VSL A;  4YEL A;  1IW7 F;  1QBJ A;  1GHC A;  5D5X B;  2MAB A;  3LAP A;  4G6Q A;  4I01 A;  4ZYA A;  3BG9 A;  4I99 C;  3SZT A;  1I6X A;  2YPR A;  3K4J A;  4KMF A;  1G3Y A;  3GZ5 A;  5HDK A;  4RMN A;  2EFW A;  1HW2 A;  2KZG A;  4KT5 C;  2CFO A;  4MLO A;  5E3O A;  3E97 A;  4LD5 A;  3M9A A;  3KFW X;  3RPU D;  2L2O A;  2ACJ A;  4BJ5 C;  1VQP I;  4JK1 X;  3OYD A;  4EJT A;  3HGY A;  3D5R C;  1TNS A;  3TP3 A;  4IRI A;  1U2W A;  3GTO J;  1WH5 A;  4WK8 F;  4C3J J;  4E7J A;  1FOY A;  1I3A A;  2XAU A;  4HF2 A;  3GVA A;  1FTT A;  2BOL A;  5DV5 A;  3HSR A;  1MDM B;  1R1U A;  3A01 B;  3TW7 A;  4R1H A;  3GTM J;  1NK2 P;  3CCU I;  1HKT A;  3E0J B;  2PMZ N;  2L5Q A;  1FMV A;  5CPR B;  1VI0 A;  2CJJ A;  1OLT A;  2OZU A;  2ICW G;  2V79 A;  5KNL A;  2DOE A;  2CV1 A;  1D3Y A;  2STT A;  4LLN A;  5IT9 Z;  3NQO A;  3RDI A;  4DGW B;  1R71 A;  3TOB A;  3V42 A;  4XID A;  2MBF A;  1FX7 A;  4OMZ A;  3T8T A;  1SD4 A;  2R7F A;  4J00 A;  1Z9C A;  2X4H A;  1T08 B;  2W4S A;  2Z99 A;  4F7Z A;  1TC3 C;  5HLG A;  1KQ0 A;  1HLV A;  1E3P A;  1ZHF A;  3P9C A;  2MD5 A;  2ZNZ A;  4ZYE A;  2XAS A;  2PBI A;  2XGX A;  4WWC A;  1XS9 A;  1MBG A;  2XKP A;  4EJU A;  4WF2 A;  4DQ2 A;  3O8H A;  3BG3 A;  4EEF G;  1APL C;  3S16 J;  1VFC A;  4A3G J;  2M9H A;  5KVR A;  2QQ9 A;  3AL0 C;  1RC9 A;  2XB0 X;  3CTA A;  2G0E A;  2L4A A;  3IWF A;  1CF7 A;  1T33 A;  2ELJ A;  1MJB A;  2J5O A;  3JRE A;  2ISY A;  2KIU A;  3F6V A;  3FK6 A;  1FJL A;  2HQA A;  3QU3 A;  4Z6Y A;  1BIA A;  3IC7 A;  3MN2 A;  1BR4 A;  1HA8 A;  5D4R A;  3NEU A;  5GAE J;  1IZ1 A;  1SFU A;  1ZK8 A;  2TCT A;  2XIG A;  4KDP A;  1MMD A;  1VQ4 I;  4HX7 A;  3DKY A;  1E3O C;  2JT1 A;  1SC7 A;  2VKV A;  1IN5 A;  1PUF A;  2H27 A;  2R7V A;  3FXL A;  2EV5 A;  2FQ4 A;  2QZ8 A;  1ETK A;  1D0X A;  2DA7 A;  5FGM A;  3TO6 A;  3WGI A;  1JT6 A;  2LY9 A;  1Z05 A;  3TGN A;  2N8G A;  1JKR C;  1S6L A;  3G6E I;  4BBS J;  4KYW A;  5C3E J;  4AIH A;  3CCM I;  1ONV A;  5BNG A;  3QPS A;  2DFI A;  3Q0W A;  4RAZ A;  5IYC J;  1F1Z A;  5J3L A;  2L9R A;  4GYG A;  3BCB A;  2R7T A;  5ICE A;  4V19 K;  2M4G A;  1TT0 A;  2OBP A;  3OYH A;  1WJC A;  1GVD A;  4CCL A;  3WG9 A;  4EV0 A;  1TWF J;  2DPD A;  1VQN I;  4WX9 A;  2DTR A;  4P5O A;  4CUG A;  1S9H A;  4HSR A;  2Z3Y A;  3K4K A;  2ZB9 A;  3ZR8 X;  5HNH A;  3KZZ A;  3CME I;  2IGM A;  1IO2 A;  3Q0V A;  1RKW A;  5J1U A;  4XKW A;  5IOZ A;  4C2T A;  2R93 J;  4LB6 B;  4DIQ A;  1IGN A;  2XGD A;  3K2A A;  2K9N A;  5CVU A;  3Q3S A;  1SFK A;  2B7E A;  2OTJ I;  5J47 A;  1YYV A;  2DA4 A;  3PJR A;  1QQI A;  2LY1 A;  2R7R A;  1BC7 C;  3MVP A;  4M3B A;  1KZH A;  1S8N A;  4HF1 A;  5FLX Z;  5ICF A;  2CV0 A;  2HTJ A;  5F0H A;  5HDN A;  1FYM A;  2CW7 A;  3D0S A;  4ENJ A;  2E1O A;  3HSE A;  3DTK A;  3BG6 A;  4U88 A;  1WFX A;  5B1B H;  1FYL A;  3CUO A;  5ILV A;  3HUG B;  4PCQ A;  2MFZ A;  4XIC A;  2HDD A;  2P81 A;  2P7C B;  2IS4 A;  2XF5 A;  2W25 A;  2WV1 A;  1IN4 A;  2G9W A;  3TDU C;  3PO3 J;  3EUH C;  1OMI A;  4I76 A;  4M9S A;  5F1J A;  3CMY A;  4HX4 A;  4F93 B;  3ASO H;  3K1N A;  3H9Q A;  2D1H A;  1U5T C;  3KYL A;  1EV7 A;  9ANT A;  4U7B A;  2PLY A;  1H0M A;  1WGX A;  3C2G A;  2VT2 A;  4RM3 A;  4I7H A;  4BAY A;  3MKY B;  2NNN A;  3ZQF A;  4PJL A;  1YQA A;  2RDP A;  4BE0 A;  1ZGJ A;  3F8C A;  2K5C A;  5IYB J;  5JLX A;  3E5X A;  1K78 A;  3BQY A;  4MEX F;  2V9V A;  3CCQ I;  1IV8 A;  4AVP A;  3SYT A;  5LEJ A;  2AO9 A;  4B43 A;  3KP3 A;  1R4N B;  2RRE A;  3BCA A;  2VBW A;  4RGU A;  4BXU A;  3FX3 A;  5HLT A;  1OKR A;  4KIG A;  5H6R A;  5E1Z B;  1FOW A;  1IRG A;  5LFA A;  3CDI A;  4I0A A;  2CQK A;  2NAZ A;  1R6R A;  4QWQ A;  3FXQ A;  2RKH A;  1QNT A;  3PFY A;  4UXN A;  3OWT A;  1V54 H;  2R5Z A;  1P2F A;  3M3Y J;  3OV8 A;  2HGC A;  2EFN A;  2DW4 A;  4W1U A;  1R4M B;  5J1Y A;  3EYY A;  2CQQ A;  3E1S A;  2DQR A;  2MGQ A;  4IPA A;  5EGO B;  1X4P A;  1XSX A;  2I10 A;  1SAN A;  4LGW A;  2BY3 A;  2W84 A;  2EBI A;  1VQ8 I;  4M6Y A;  2FJ1 A;  1ZG1 A;  1QZE A;  4ASN A;  2VE9 A;  3CQZ J;  4NUB A;  1BIB A;  3FXR A;  2BXY A;  1JTY A;  3MQ0 A;  3E5U A;  2D45 A;  4FT8 A;  4GO1 A;  4AWX B;  1A5J A;  5L3D A;  2BHY A;  3RYP A;  3OIQ A;  1V55 H;  2ME6 A;  2FRH A;  1WQ2 A;  2Y30 A;  2V1N A;  3SQN A;  3VFZ A;  4IZZ A;  3ABK H;  3FXJ A;  4F55 A;  3VPR A;  4QLC U;  4DZJ A;  2OC6 A;  3ZMZ A;  3OR2 C;  3OY9 A;  3IV5 A;  3S93 A;  4PGH A;  5J8C A;  4X0G A;  3WTV C;  3GFM A;  3AG2 H;  1GDT A;  1D5V A;  1S3J A;  4OAY A;  1KYW A;  3Q0U A;  1FP2 A;  5F0C A;  2XC7 A;  3G1L A;  5ILS A;  4A0Z A;  5J4V A;  4RBO A;  4L5J A;  1FSH A;  2CUZ A;  3C7J A;  3SFI A;  5D6E A;  1XCB A;  4B3A A;  2W57 A;  1WHU A;  4M6V A;  1ZEL A;  4A3B J;  4C2M J;  3QU6 A;  2F5D A;  4A3L J;  5EEA A;  2E5Z A;  1YTY A;  1TL8 A;  1QRY A;  2FUG 2;  2M30 A;  2AXT C;  2GOX B;  2JTV A;  4ZDL A;  3OYA A;  2HI3 A;  2IA2 A;  1ZLJ A;  3A2K A;  1Z7U A;  1VQL I;  3OYJ A;  2E34 A;  3KZI C;  3LAJ A;  1B8I B;  2JJ7 A;  1BN5 A;  2ZNY A;  4NB5 A;  5D5V B;  5FKO A;  4BBR J;  1IV6 A;  1I27 A;  3C3W A;  3HG9 A;  3LSK A;  1MIJ A;  1RES A;  3G73 A;  3VOD A;  3O3K A;  5F64 A;  2ADU A;  4IKF A;  1OCR H;  3JAM K;  2L54 A;  2XAH A;  2M2E A;  4IHS A;  1KQ8 A;  1N77 A;  1ZAR A;  3AL0 B;  2KQR A;  1GXP A;  5IT9 K;  3HBL A;  2ZSH B;  2JMW A;  3QOE A;  4BE2 A;  3PIP F;  1T6S A;  2MC4 A;  1JJ6 C;  3S2D J;  2DDA A;  5H2F C;  1U78 A;  3GLL A;  4WXH A;  1YI2 I;  1YIJ I;  4IQ4 A;  2G7U A;  3CCS I;  4GFB A;  1R23 A;  4P9F A;  1USS A;  4V2G A;  4HNT A;  2A07 F;  5HS9 A;  1JI8 A;  3GO5 A;  4LIV A;  3RSN A;  1N75 A;  1V4R A;  4M9X A;  1HKS A;  3BZC A;  2Y69 H;  3OSF A;  1UB9 A;  4UB6 C;  5IT3 A;  1EA3 A;  2PX9 A;  3GXO A;  5GTH C;  4A3I J;  3SZG A;  1NG7 A;  1WKM A;  4Y15 A;  2M4K A;  2KRC A;  2O9L A;  2QSF X;  3NWS A;  5LGN A;  1W0T A;  2LF8 A;  2XPW A;  2FBH A;  4LMY A;  1SAX A;  4M6X A;  4E70 A;  2EWN A;  1Z3Y A;  4HST A;  2WTE A;  4A0X A;  2DPU A;  2GM4 A;  3HTS B;  4JYK A;  1FIP A;  2A61 A;  1ETQ A;  2BW3 A;  2UV1 A;  5IP6 A;  1Z77 A;  1BA5 A;  1B9N A;  1D1C A;  3J80 K;  4II2 A;  4CSW A;  1BW5 A;  4NC7 A;  4CHU A;  3B02 A;  1IN8 A;  3L2R A;  2VOO A;  2ZFW A;  3H3Z A;  2DMT A;  3PQJ A;  2BBY A;  3CC7 I;  5H6Q A;  2Y0S A;  3GF2 A;  1JJ8 C;  3HM5 A;  4HOB A;  4KIF A;  3KEQ A;  4E4H A;  1W5C C;  1QVU A;  3JSP A;  1HF0 A;  4OWR B;  1O7L A;  5IPA A;  3HOV J;  3HEF A;  2K40 A;  2QYO A;  2CUJ A;  3WTX C;  3ZQL A;  1ETY A;  3BDD A;  3BQZ A;  5E3N A;  3B6C A;  2VC0 A;  1D1B A;  2XSJ C;  2HVQ A;  1GT0 C;  2QKM B;  5FFZ A;  4CXF A;  4CYC B;  3S2H J;  4KIB A;  1XD7 A;  2VOD A;  4MQV A;  3VYR B;  5AON A;  4ESJ A;  3OSG A;  4L18 B;  1IUY A;  3A0B C;  2DTZ A;  5CQE A;  4IOA F;  3V8L A;  4ZYD A;  2B63 J;  1Y8R B;  1U0J A;  3KCC A;  2BV6 A;  1K4T A;  4RB3 C;  1JGG A;  2JZY A;  2X48 A;  2FXA A;  3ONQ A;  1ZTR A;  4BQN A;  3GTJ J;  3MKZ A;  3DTE A;  1T95 A;  3I59 B;  3S8P A;  1X1D A;  5K5R A;  3RQI A;  5AIQ A;  4AC0 A;  3A1Y A;  1YJ9 I;  3BTJ A;  3G3Z A;  2DK8 A;  1B1B A;  1SMY F;  2CH0 A;  3CC2 I;  3DEW A;  1D0Y A;  4NC8 A;  3RKQ A;  4GXO A;  1FNN A;  4U0Y A;  2E1M C;  1FTZ A;  3LSM A;  2DMU A;  3TQN A;  1OPC A;  2VJ5 A;  1OYW A;  1JHH A;  4OIN F;  2ECB A;  2DA6 A;  2EFO A;  1Y0N A;  2EPF A;  3TL4 X;  1JTX A;  4E6K G;  5FRM A;  1XGM A;  3C2H A;  3HOW J;  2GQQ A;  3LWF A;  2H94 A;  2KDO A;  4F92 B;  5BOX A;  1ETW A;  4DYQ A;  1FBU A;  4D0P A;  3V7C A;  3V8K A;  1WH7 A;  3KET A;  1E2X A;  4UUS A;  1UFM A;  2BEO A;  5C44 J;  1JKO C;  4MNU A;  2XRL A;  4MTE A;  2CFX A;  3CUQ B;  3J81 Z;  2MSY A;  4AU7 A;  3K4N A;  2LYC A;  3VYU B;  5D5W B;  2QSG X;  1MMG A;  2BZT A;  5F04 A;  3BPV A;  1WSU A;  1UEL B;  3HOS A;  1VTN C;  4ESB A;  2L7Z A;  4G7O F;  1SVO A;  3IKV A;  2CQ7 A;  3GBG A;  2Q1Z B;  1FPQ A;  3ECO A;  5F08 A;  3WE3 A;  2IA1 A;  2CW8 A;  1MBK A;  3VEP A;  1FBS A;  3BR3 A;  1TZL A;  2DT7 B;  4ENN A;  3IH2 A;  2EQR A;  3PUB A;  2EIM H;  3CZ6 A;  3K2Z A;  1YW9 A;  1JHF A;  1DU0 A;  3I4P A;  2EZI A;  2W1O A;  5HDG A;  1K7A A;  4DNC A;  3KE2 A;  4CGZ A;  1Y8Q B;  2O61 A;  4N9I A;  3WHB A;  1BOB A;  3KZY A;  1ZRD A;  2Q2E B;  4C9Y A;  3CMM A;  1MMN A;  4ZZD A;  1MNM C;  3LSR A;  3VYT B;  2ZCW A;  5DEQ A;  4L9T A;  2QGU A;  2ZSI B;  3RTR A;  3FK7 A;  1EH6 A;  3W6J B;  5ED4 A;  3H5R A;  4DW6 A;  3GFI A;  3W2V A;  3C1D A;  2KIQ A;  1JKP C;  2QBY A;  2X1E A;  3HRU A;  3OR1 C;  4NQW B;  2QKL B;  4PJJ A;  3EYI A;  1Z6T A;  1WI3 A;  3H3V K;  3J7A Y;  2LTP A;  4Y13 A;  2FBK A;  2RC4 A;  2R5Y B;  3DFG A;  1DQU A;  3OYL A;  4XKC A;  2EH3 A;  3W6K B;  4HLY A;  1OFC X;  4XLN F;  3O8G A;  2K9Q A;  2AXL A;  1T56 A;  3C2B A;  4PZJ A;  4XLA A;  3H9J A;  1I1G A;  2PEX A;  2Z33 A;  2NVX J;  4G9Y A;  4LG0 A;  3EUH A;  3OIP A;  2F6C A;  1Z7L A;  2HDW A;  2RAE A;  1RRJ A;  1U5T A;  2HOE A;  3OYK A;  3X2Q H;  1RR8 C;  1OCP A;  2PFB A;  2ZKZ A;  4UVC A;  4A3J J;  2AS5 F;  1LVK A;  2HTS A;  3VYS B;  3NAR A;  4XLE A;  4M3G A;  2HKO A;  3JRG A;  3K4L A;  5DCM A;  2VKH A;  4Q4Z F;  2JA2 A;  2DU9 A;  3DBR B;  1D0Z A;  1POG A;  2FEZ A;  1F5T A;  2H6B A;  4ENK A;  4DYR A;  1IXS B;  4BQO A;  1AKH A;  3R61 A;  4EGZ A;  3K0L A;  2GZW A;  3HPG A;  1ACI A;  3QYE A;  2XPU A;  2NS7 A;  3JRD A;  2EA2 A;  3EUA A;  2HOS A;  1F36 A;  1LJ9 A;  5B3S H;  1BI1 A;  1NH3 A;  1XDS A;  2NNY A;  5CQG A;  3QWL A;  3K70 C;  1T38 A;  3JR9 A;  2DA5 A;  5JR3 A;  3P5J A;  1VQ5 I;  1PUF B;  3KP6 A;  2JSP A;  5B5E C;  3F9K A;  4BDY A;  1XTA A;  3V7R A;  3TO9 A;  3T5X A;  2MH9 A;  4KMU X;  2VQG A;  3I71 A;  1IF1 A;  3Q9V A;  1NK3 P;  1U9O A;  2HPI A;  2X85 A;  3W3C A;  4GYI A;  3PL8 A;  1YRN B;  1GV2 A;  4IX7 A;  3LFK A;  2CUF A;  2JQ7 A;  1NG6 A;  5F1R A;  2LBF B;  4NDL A;  4MFD A;  3EQL F;  3F6O A;  2ZXJ A;  2HXI A;  3QQA A;  4E7S A;  2CWE A;  2F2E A;  5J4Y A;  4QPQ A;  1Y0U A;  1OR7 C;  1X3W B;  1ZRE A;  3A0H C;  3WGG A;  5K7H A;  3BR1 A;  1H9T A;  3M07 A;  3WHC A;  3CES A;  3RZD J;  3JAM Z;  3OS0 A;  3RYR A;  2KLO A;  5D8K B;  1HXD A;  3ABL H;  3WGH A;  1WVR A;  3H36 A;  4EJO A;  2W7N A;  1IDZ A;  3V7S A;  5BMZ A;  3JTH A;  2KDZ A;  2Z9O A;  3AG4 H;  3DPU A;  4ANJ A;  5DCF A;  1YFH A;  3ZXS A;  2RNG A;  1Z6R A;  2WB1 N;  1Z91 A;  3TOA A;  4CIC A;  5HNF A;  3BR5 A;  3IAS 2;  2OPT A;  4A0Y A;  5LHI A;  2PJR A;  1LEB A;  4JX4 A;  3OYF A;  2EIN H;  2X6X A;  4BKX A;  2ECC A;  2M3A A;  2ZFU A;  3DLA A;  3I53 A;  5JHU A;  2NXN B;  2M5W A;  4UUT A;  3SDG A;  2DCE A;  5BS6 A;  4B44 A;  2DFE A;  1DDN A;  3ZQG A;  2P4W A;  2OUM A;  2R3S A;  2DQL A;  4A3M J;  3GCM A;  4A5M A;  1XGN A;  5TGT A;  3AFH A;  2V7F A;  1QO0 D;  1YE9 A;  1VND A;  3K10 A;  2DYR H;  1XMA A;  3F72 A;  3KP5 A;  4BEH A;  2K4J A;  1MW7 A;  1SVL A;  5E8I A;  2FBI A;  4RA2 A;  3BG5 A;  2YUS A;  3QPL A;  4QPO A;  2BGC A;  5GP9 A;  3CC4 I;  4XLF A;  4BHC A;  3NWT A;  3TW6 A;  3CCE I;  1LE8 A;  3CP2 A;  3KP4 A;  1XDU A;  5J40 A;  3FIW A;  3WU2 C;  3S1M J;  2E5N A;  5DD4 A;  2HEO A;  2ISZ A;  2H09 A;  3V8J A;  1XC5 A;  5CLS A;  3J80 Z;  3BZK A;  1EKE A;  1R1T A;  3IL2 A;  1WJD A;  3F0C A;  2JUG A;  3R0A A;  4ABZ A;  2E2H J;  5DM7 F;  1Y1V J;  4OU0 A;  2E2I J;  1N25 A;  2L9V A;  3ISP A;  1J09 A;  2E1M B;  4IRH A;  2X6O A;  3QP5 A;  3RI4 A;  1BM9 A;  1MBJ A;  4A2U A;  3AG3 H;  2COM A;  4IOC F;  1KU3 A;  3L1P A;  2WAQ A;  3DF8 A;  1X58 A;  2ELK A;  5IP7 J;  3AAF A;  4XNF A;  2KZV A;  3ZQC A;  2HVS A;  3I0T A;  3GTP J;  1I3Q J;  3K1P A;  5LHG A;  1IXR C;  4Q5S F;  4LG3 A;  4P1W A;  4B4C A;  1UMQ A;  1K6Y A;  4B48 A;  1MMS A;  4E7L A;  2XKO A;  3BR2 A;  3ERM A;  1MH4 A;  3IH4 A;  2HS5 A;  3WU0 A;  1FWZ A;  3T8R A;  3OIO A;  4FE4 A;  2DK5 A;  1UST A;  4BQQ A;  1FIA A;  4ESF A;  3SZP A;  2XVC A;  4U7D A;  2LVS A;  3DWL E;  3LSH A;  2DAO A;  3OYM A;  4R8H A;  3W2W A;  5HS7 A;  1TQI A;  1X2M A;  2GWR A;  2L01 A;  2JA5 J;  2JN6 A;  2VXD A;  2HXO A;  2LKS A;  3CP8 A;  1U3E M;  4S0H B;  2VUM J;  3VSK A;  2OF7 A;  4Y7N J;  1MGT A;  4XLC A;  1MDM A;  2HQN A;  2VQL A;  2VLA A;  5KCM A;  2M34 A;  3Q9S A;  5E1W A;  3A01 A;  4A3F J;  3DP7 A;  3MD2 A;  4UVA A;  2IS6 A;  1FZP B;  3L7W A;  2VE8 A;  1F9N A;  3J81 K;  1DUX C;  5EG0 B;  1KU7 A;  1O3R A;  2HQ5 A;  2FF4 A;  5K5O A;  4EM0 B;  3W6V A;  4I6Z A;  1X1C A;  1MJ9 A;  4BYY A;  5M3F J;  4HDV A;  2KRH A;  3O6B B;  5DUK A;  4A93 J;  3CLQ A;  4C3I J;  2R7S A;  1GXQ A;  5KAF C;  2E19 A;  1W36 C;  1E0E A;  5F6F A;  4CCO A;  1F4K A;  2M8E A;  2IXS A;  1WPK A;  2W48 A;  4CZZ A;  3L2W A;  4NNJ A;  2UXX A;  3V4G A;  3TED A;  3M1C A;  3CO6 C;  3ZMV A;  3R6S A;  2OCC H;  2HVR A;  3DPT A;  1SFO J;  3KPH A;  2VI6 A;  3E7L A;  1IJW C;  2GIV A;  4G7H F;  2K27 A;  3JW4 A;  3K69 A;  2CS3 A;  5J6X A;  3S1R J;  3D1N I;  4D7N A;  3M8F A;  2L0K A;  1ULY A;  1O4X A;  1LFB A;  1X1B A;  3UR3 C;  2V1U A;  2WA0 A;  1Z1D A;  5F0F A;  4AYB A;  3BZ6 A;  3MMY B;  3S2W A;  2UXN A;  3F23 A;  2ZXI A;  2IS2 A;  4AID A;  2KMU A;  2R7Q A;  2KFD A;  4HA8 A;  4LIU A;  4B3X A;  3CUQ C;  2ZME C;  4RM2 A;  3R4K A;  1DP3 A;  4M3F A;  1BL0 A;  1MBF A;  2IEK A;  3MZY A;  2R7W A;  2MH2 A;  1VQ9 I;  1KON A;  2JWT A;  5HOO A;  1WJA A;  1DGR M;  3GUD A;  2O8K A;  4XN3 A;  2P5K A;  4RLQ A;  3HDD A;  3F8B A;  3WOD F;  4YRV A;  1R1V A;  1R49 A;  1IN6 A;  4ZYH A;  2DYS H;  5CVI A;  3CDH A;  2DOA A;  4RLF A;  3WTW C;  2NVT J;  1TW3 A;  5FLM J;  1O57 A;  1MH3 A;  2R7D A;  2D5V A;  2YU3 A;  4MQ9 F;  3RKW A;  1B72 B;  2PQ8 A;  3GTG J;  3G71 I;  5CJ9 A;  1QA6 A;  1KU9 A;  3HL2 A;  1FY7 A;  3CCR I;  3FBN B;  1PDN C;  1MSF C;  2AQE A;  2ZXW H;  3DQV C;  4DBR A;  1IAW A;  3LA7 A;  2GA1 A;  1W4M A;  4BHP A;  2R7X A;  3K4C A;  4ZC3 A;  4Q48 A;  5HOD A;  5E17 F;  2PMU A;  5JHF A;  3CJT B;  3GTK J;  3ERE D;  4XRS A;  3CMA I;  1TWA J;  4CA0 A;  3TO7 A;  5B66 C;  4B1R A;  2ME0 A;  1P7I A;  2HYG D;  4FET A;  1RKT A;  2R4G A;  3MFK A;  4UUV A;  3U1K A;  2FNP A;  4OMY A;  4XLH A;  3E6M A;  3PNV A;  4HPQ A;  2QCO A;  4RGX A;  3CD6 I;  3GZN B;  4LLG F;  2VBZ A;  4WXC A;  4D1Q A;  3NAU A;  2Y2Z A;  2LR8 A;  2PN6 A;  1V5F A;  5CKT A;  2EFP A;  5L3G A;  2BW3 B;  2EIJ H;  5JFR A;  3KLN A;  5LHH A;  4G7Z F;  3ABT A;  3BJ6 A;  3S32 A;  3JRB A;  4XN0 A;  1LEA A;  2LSO A;  3ASN H;  1W5T A;  3OYI A;  3ZCO A;  2VAS A;  2IVM A;  1XGO A;  3HUG A;  2PJP A;  2NYX A;  2DA3 A;  2XAF A;  1UG0 A;  1JKQ C;  3L9F A;  2IPQ X;  3ZPL A;  2E2J J;  4OAZ A;  4II3 A;  4O5V A;  2WC2 A;  1A6I A;  3OYN A;  2CYY A;  1WRJ A;  3IWZ A;  2DO7 A;  2LFB A;  4ETS A;  1S7O A;  3PSI A;  3MCZ A;  2O7O A;  4UNO A;  1TQM A;  2VBY A;  4RB1 A;  2YR2 A;  5K7F A;  2CGP A;  1ON2 A;  4ZJZ A;  3QPH A;  1YS6 A;  3MAJ A;  4JP0 A;  4A6D A;  4BY1 J;  4XK4 A;  5LRR A;  3OYE A;  5DYM A;  4FX0 A;  1ETX A;  3CJN A;  3HC7 A;  2DOD A;  2WAD A;  1OQY A;  4BXX J;  2CQX A;  2OTL I;  1G3S A;  3Q5F A;  3CCY A;  4KA4 A;  2LMD A;  1J75 A;  1OYY A;  1WJE A;  1VF9 A;  2M1B A;  4PFO A;  2VJ4 A;  4KIS A;  4HQM A;  3GTQ J;  4XOP A;  1P9Q C;  1K61 A;  1TW2 A;  2GBY A;  4PSW A;  5EEG A;  3E6D A;  2L9S A;  4AIJ A;  3EPZ A;  4R79 A;  2F5E A;  4H0E A;  3A03 A;  5GAG J;  1ENH A;  2R92 J;  2ELH A;  1FYK A;  1K79 A;  3OYB A;  4A12 A;  4HRI A;  1RR7 A;  2A5Y B;  2FSW A;  2L7K A;  5CVR A;  5FKM A;  2MA3 A;  2IGK A;  2ZJP F;  1B59 A;  1U8R A;  3K6G A;  4DBQ A;  3LNQ A;  2WY8 Q;  2EK5 A;  3VB2 A;  2A6H F;  1SD5 A;  2EFQ A;  1JT0 A;  5FO5 A;  4LK0 F;  1O3Q A;  3CO7 C;  5FLV A;  3H3U A;  3BY6 A;  5LGU A;  4ZYG A;  2R7U A;  3U1D A;  1OCZ H;  5F27 A;  2F5V A;  4EQQ A;  5EGO A;  4IHT A;  2P6T A;  4KUM A;  2FOK A;  1TWH J;  1BJA A;  2BVM A;  2LC2 A;  1PYV A;  5CVJ A;  4BGD A;  1FEX A;  2MD0 A;  5E3M A;  3L2Q A;  3KYD B;  3IH3 A;  1PJR A;  3VWB A;  4I0B A;  2NVQ J;  1X3Z B;  1ZN2 A;  1WI9 A;  1BR1 A;  1WJB A;  5GPC A;  4RAG A;  1R36 A;  5E20 A;  4YIF A;  3HRS A;  3ROU A;  4A6E A;  3JRI A;  1HKQ A;  2X1C A;  4BNC A;  3LSP A;  2DBB A;  3I3L A;  2RQP A;  2A05 A;  2COB A;  1HW5 A;  3BP8 A;  1YG2 A;  1YIO A;  1UCR A;  2P7V B;  2KP6 A;  4ENM A;  1H89 C;  4NC6 A;  2ETH A;  4P96 A;  4RGS A;  4IRG A;  1W7P B;  3T1B A;  1IRF A;  4PDK A;  1P4X A;  2E35 A;  2XF6 A;  4Q47 A;  1T0F C;  3ESW B;  4L5E A;  1TWG J;  1ZRC A;  3IKT A;  4XR6 A;  4OIR F;  5DM6 F;  4HYE A;  4AD9 A;  3JSO A;  4LJZ F;  2OD5 A;  3ZGK A;  2A6T A;  1WCM J;  2TRT A;  1K6O A;  1E3H A;  2LRE A;  1ZR2 A;  2DT5 A;  4L9V A;  5M5X J;  1O3S A;  1R5H A;  1AHD P;  3TBI A;  2XDV A;  3RPQ A;  1ZAO A;  1K83 J;  1VQ6 I;  1FOX A;  1B8I A;  4MIM A;  4K2E A;  2UUZ A;  3TKY A;  2E7W A;  1Y6I A;  3FM5 A;  3PSF A;  2KRF A;  4E7Z A;  3HHH A;  1J9I A;  3PIO F;  1R00 A;  3BC8 A;  4CCM A;  2F5C A;  3WU1 B;  2O3F A;  3A4C A;  4EMS A;  4CDG A;  3UNG C;  2JPB A;  3D5S C;  5GPA A;  3FBI B;  2AHQ A;  3B73 A;  4XOR A;  2R0Q C;  2P5V A;  4FAS D;  2M7A A;  2GXA A;  4LLL A;  4IHY A;  1LDJ A;  1GLN A;  3K70 D;  5EZH A;  2DN0 A;  2H6C A;  2E1C A;  3DV8 A;  1T39 A;  1MBH A;  3HOY J;  4N9H A;  1SD6 A;  1MBE A;  1JGS A;  2DT6 A;  3CCV I;  4EAT A;  1OCC H;  1XG1 A;  1EH7 A;  2MLK A;  2VJI A;  5D4S A;  3PNT A;  4XSZ F;  4EJW A;  1A31 A;  4KIC A;  3H5N A;  2V6C A;  4KJZ A;  2CMP A;  2Y48 A;  2ZME B;  3M8J A;  5EYR A;  2K9L A;  3M1E A;  3BTI A;  1L0O C;  4OIQ F;  2O5R A;  2ESH A;  3ABM H;  2VT3 A;  2K02 A;  2K85 A;  3QYB A;  2XRN A;  4XKV A;  1HBX G;  1HW1 A;  2NOG A;  2OQR A;  3NRV A;  2BVL A;  5E3L A;  4S04 A;  4D9J A;  4AVZ A;  3FKJ A;  1GUU A;  2CU7 A;  1X2N A;  3HKZ A;  1ZG3 A;  3J7Y J;  2GIZ A;  2H1L A;  4Y33 A;  3S17 J;  2QLZ A;  1RET A;  2M0C A;  3RKY A;  4QTR A;  3H35 A;  3K1M A;  3DKX A;  3DKW A;  1A04 A;  1W5S A;  1FOK A;  2EV0 A;  3RZO J;  3W2A A;  1PUE E;  1ODD A;  4B8X A;  4G94 A;  1YX5 A;  3ECH A;  2XPV A;  4UVB A;  5BQT A;  3JCU C;  3ELK A;  1D8J A;  2VOP A;  1IXC A;  4G6T B;  2X6W A;  2KIF A;  1FSE A;  4M73 A;  3FXK A;  3DEU A;  2CO5 A;  3M7G A;  4OOI A;  1VZ0 A;  5A2Q Z;  3F21 A;  3M4O J;  1D1A A;  1XMX A;  1IUF A;  1ON1 A;  2FML A;  4FX4 A;  4HZF A;  4CCJ A;  2CV2 A;  4G8X A;  4PSX A;  2G7H A;  2LG4 A;  4FCY A;  1IRX A;  3ZP5 A;  2QA4 I;  2GXG A;  1Q1H A;  4CO8 A;  4TV7 A;  4HG2 A;  3H0D A;  2E71 A;  4L5I A;  4L0Y B;  4BS9 A;  5HS8 A;  1UG2 A;  3GLX A;  4PGG A;  4M71 A;  2H8R A;  4O3M A;  3DPL C;  3WTY C;  1KYZ A;  1DPU A;  1MD0 A;  3TMO A;  5DDG A;  2UZK A;  3H0G J;  4KT6 A;  3IRR A;  2LK2 A;  4A3D J;  1ORK A;  1WJF A;  2W82 A;  2FU4 A;  3LA3 A;  1TBX A;  2FD5 A;  5KK1 A;  1G8X A;  3VDX A;  2V1D A;  5FKK A;  4P9U A;  2H8W A;  4BAC A;  3FMR A;  3K4M A;  3SDB A;  4F52 A;  4F91 B;  2TDX A;  5ICC A;  5EDN A;  4BEH B;  2FA5 A;  1X1P A;  4Y17 A;  1RNL A;  5E79 C;  3F8F A;  2CG4 A;  1XX5 A;  1S29 A;  1FMW A;  1YO5 C;  2Z16 A;  1D8K A;  4JX5 A;  1CF7 B;  2W00 A;  4IHW A;  2VPR A;  1S7A A;  3TP0 A;  1VQM I;  1PP8 F;  2Y9Y A;  2OA4 A;  4J19 A;  1O3T A;  2L7F P;  2ZBK A;  4A3C J;  1IDY A;  1QPM A;  2XB5 A;  3DXJ F;  4PK4 A;  3CUQ A;  5FRN A;  1ZH5 A;  3M8E A;  1IN7 A;  2JRT A;  1RPW A;  3CJQ B;  1XCV A;  4B09 A;  1BI0 A;  1GV5 A;  2XGC A;  4XM3 A;  1ZR4 A;  3FHZ A;  1W7P D;  2A5W A;  1R5G A;  4LFU A;  5D6F A;  4GDF A;  2NS8 A;  1P6R A;  3K9T A;  4MO7 A;  4RAF A;  1EF4 A;  4U0V A;  2A3S A;  2RN7 A;  4DJA A;  1G3T A;  5JVT A;  4BDZ A;  2V6E A;  5ILU A;  4KIT B;  3QP6 A;  1SVM A;  4A3E J;  1JE8 A;  3CCL I;  3L2U A;  3HPH A;  3WTT C;  3ZMU A;  5KHD A;  1QZY A;  4FE7 A;  4ZTF A;  2VB6 A;  1AU7 A;  3PO2 J;  1DU6 A;  3LOC A;  1W36 D;  1OJL A;  3FHN A;  4IO9 F;  1XB4 A;  4OIP F;  2LLK A;  3FXM A;  5DD8 A;  3IRQ A;  4D5F A;  3LFU A;  2OZ6 A;  4N4O B;  4CZC A;  2IA0 A;  1Z3X A;  1N78 A;  1XMK A;  2Q2E A;  1ZKG A;  4L0Z B;  2V9P A;  2DFF A;  2JRM A;  4MHG A;  1XN7 A;  2OAZ A;  3DU5 A;  5HVQ C;  1MSE C;  1YS7 A;  1BOA A;  2VXZ A;  4V2F A;  4JX6 A;  4KN4 X;  3HGG A;  1VQ7 I;  2VQC A;  5GTI C;  4KFC A;  2WAQ N;  1BBY A;  2IRF G;  1R9T J;  3IHU A;  2YS9 A;  4NQW A;  6PAX A;  2VL8 A;  4I09 A;  2WV0 A;  2A68 F;  1TNT A;  2VN2 A;  2DLL A;  3H5A A;  3S1Q J;  2R5Y A;  1Y56 A;  2ZC2 A;  3DBL B;  3GFL A;  3HXL A;  3KYC B;  5FFX A;  3ZMT A;  3KEY A;  3RQ4 A;  3COA C;  2OJE D;  3ZMS A;  3ZQH A;  3GYH X;  4E7I A;  2VON A;  2XAJ A;  3ZQ7 A;  3QAH A;  1YOV B;  3I9V 2;  1P4W A;  3PM1 A;  1YLF A;  1LFP A;  4EM1 A;  4EVI A;  3LSG A;  3AG1 H;  3A02 A;  3H92 A;  3E3V A;  2LDU A;  4B47 A;  2XRO A;  1IG7 A;  3LL7 A;  2E7X A;  2GAU A;  1U6G A;  1I50 J;  2QM3 A;  3N05 A;  2EIK H;  5L3C A;  3I4M J;  1REP C;  3QRF F;  1K78 B;  1G4D A;  2V1X A;  1X1A A;  2CUE A;  4GCV A;  2L9N A;  3BTL A;  4HNU A;  2PMZ A;  4IHX A;  3HB9 A;  4XRF A;  2L7M P;  3RKX A;  4AIK A;  4UB8 C;  2JVG A;  1U8B A;  1JUP A;  2MC3 A;  3FF5 A;  3OL4 A;  2Z1D A;  2VIX A;  4X6A J;  3WTU C;  4FQG A;  1F43 A;  2WB1 A;  1R22 A;  4RAY A;  1WZ2 A;  2KJC A;  3S1N J;  4M9Z A;  3P7N A;  2Y75 A;  3TDZ C;  4HQE A;  2PG4 A;  2JUC A;  3F8N A;  4BXF A;  1LFU P;  1ZGW A;  2P6S A;  2JPC A;  4HDU A;  1X4O A;  1V5G A;  2V26 A;  4A5N A;  3ZMD A;  4HNV A;  1RUO A;  3N4M A;  2R5Z B;  2OU2 A;  2PI0 A;  3OOP A;  5C4J J;  5LEK A;  4XQF A;  1IRZ A;  4QIW N;  3LQR A;  2IP2 A;  5TIS C;  1YRN A;  3G2B A;  2LNB A;  2W85 A;  1G59 A;  2LBF A;  5TJJ A;  2LH9 A;  4C30 A;  2BYV E;  2RGV A;  2I5U A;  2O6G E;  5FKN A;  3SXY A;  1AA7 A;  3G1O A;  3LSJ A;  1UJ8 A;  2D2W A;  4UV8 A;  3ULQ B;  4AYB N;  1S5L C;  4LB5 A;  2Q8K A;  1R7J A;  4ZH4 F;  1BJZ A;  1JUM A;  2IGO A;  2LKP A;  4YEJ A;  5CYV A;  4L9N A;  2FNA A;  3IUO A;  3ZOB A;  2YU9 J;  1AOY A;  1YIT I;  3OOU A;  5ERI A;  3CF2 A;  4PJN A;  5EEH A;  3D5L A;  3MWM A;  1D5Y A;  3C18 A;  4LOC A;  4BY7 J;  2B9S A;  1KA8 A;  4RB2 C;  3L2C A;  5IP9 J;  1I5Z A;  2CW0 F;  2WAE A;  3B6A A;  1OCT C;  3MEX A;  4N4N B;  1VQK I;  3HIF A;  2FOW A;  2GOM A;  1HCR A;  1I6H J;  2E1N A;  1V3F A;  1EH8 A;  3HRT A;  2M8G X;  5EF6 A;  1AWC A;  1HDD C;  1ZGA A;  5FJ8 J;  2XAG A;  1DP7 P;  2KPM A;  1R5I D;  2Y0M A;  4G12 A;  2JA6 J;  1T0F A;  2BXZ A;  2ID6 A;  1LNW A;  2LKX A;  5K7Z A;  3OYC A;  4XRM A;  2JK3 A;  4M3D A;  3E6B A;  2DOF A;  4IVN A;  3N97 A;  2HPM A;  3OS1 A;  3ZN0 A;  3HYI A;  1UZC A;  2LD5 A; 
#chains in the Genus database with same CATH homology
 1G3W A;  4M74 A;  3GEZ A;  1RIO H;  3VOE A;  3FMS A;  5FB2 A;  3F3X A;  2KIM A;  2XV4 S;  5A2Q K;  4BHB A;  1STZ A;  2IJL A;  5FD6 A;  3HRM A;  3BJO A;  4XBF A;  3P9I A;  4KN7 X;  4KNY A;  3FZV A;  3KP2 A;  1C0W A;  2C6Y A;  3E6C C;  2HQR A;  5AIP A;  4HV5 A;  1RUN A;  2HZT A;  3FM3 A;  4L9J A;  4HV6 A;  5ICG A;  4P55 A;  2MLG A;  2QEN A;  4IJA A;  3LA2 A;  1G6N A;  4HAM A;  2ESN A;  1MKM A;  2KJB A;  2W24 A;  5LRS A;  2O8X A;  1RI7 A;  1FBQ A;  1ZG5 A;  2QWW A;  4ON0 A;  5D5U B;  2UWM A;  4I02 A;  1X3U A;  3HTU A;  5E8G A;  2ZJ2 A;  4OIO F;  5K1Y A;  1J7K A;  4LK1 F;  1TTY A;  2HKX A;  2X0L A;  3CLO A;  3L00 A;  3WE2 A;  4IF4 A;  5LBQ A;  2KKO A;  3P9K A;  4S05 A;  3HSF A;  1GVJ A;  1T2K A;  2NRA C;  2J5P A;  3FXU A;  4JQF A;  2EA4 A;  5E18 F;  4GGG A;  1ZYR F;  1FC3 A;  2BE5 F;  4NHJ A;  3REO A;  1XSV A;  4EGY A;  2HDC A;  1PP7 U;  2HFH A;  3F22 A;  2YSR A;  2B0L A;  1MZB A;  1BI3 A;  3BOQ A;  2D1V A;  3KLO A;  2EB7 A;  2O03 A;  2HWV A;  3ML6 A;  3U9G A;  1DPR A;  1J5Y A;  2K4B A;  3I58 A;  1HQC A;  3R60 A;  2A69 F;  2XAQ A;  4XSX F;  3BWG A;  2DI3 A;  5L3B A;  4JBA A;  2EJR A;  3GW2 A;  3GWZ A;  2ZO4 A;  2XHK A;  1FLI A;  3LST A;  3RIR A;  3I5U A;  4M72 A;  4MGR A;  5L3F A;  4I2O A;  2LF7 A;  2RVC A;  1HST A;  4WCG A;  2QVO A;  2K86 A;  2L4M A;  1TLH B;  5E1X A;  3WTZ A;  5LLQ A;  4ZZL A;  2M87 A;  3QOP A;  4CYD A;  5FD5 A;  1XSD A;  4I98 B;  2XUB A;  3LQQ A;  3WTS C;  2QQB A;  2NS0 A;  2FQ3 A;  1B9M A;  1P92 A;  2GA2 A;  1SFE A;  5BPI A;  1WWX A;  3BPX A;  1OR7 A;  5HLH A;  1YW8 A;  4HBL A;  4N0B A;  2F5F A;  1L3L A;  1YW7 A;  3E5Q A;  3GFJ A;  2STW A;  5BPD A;  5LGT A;  3RJP A;  1TQP A;  1P4A A;  2FMY A;  1SFX A;  3FMQ A;  2P8T A;  3GZ6 A;  2QBY B;  3FWE A;  3R0J A;  2L02 A;  2YX7 A;  5H20 A;  1CGP A;  1I1S A;  5CVV A;  3JTG A;  3HHG A;  4U0W A;  3ZN1 A;  4YII A;  3PQK A;  3BRO A;  4EJV A;  4LG0 B;  1J59 A;  1LDD A;  1LDK B;  1U5T B;  2RNJ A;  1QGP A;  4YG2 F;  3QPT A;  5FLX K;  3KEO A;  2CSO A;  2OQG A;  4HF0 A;  3BJA A;  5DCM B;  1J2X A;  1FP1 D;  1QZZ A;  4HLX A;  2RV8 A;  5D8L B;  4RGR A;  1UHW A;  5JI6 A;  4MEY F;  2A6E F;  1KU2 A;  2GXB A;  1UHM A;  1HSJ A;  5K5Q A;  3I54 A;  5L3E A;  5DUI A;  3PFI A;  4HX8 A;  4RS8 A;  4BH9 A;  1MJA A;  1LB2 A;  1XGS A;  1NHA A;  3SFZ A;  1SMT A;  2HR3 A;  2QQA A;  1RZ4 A;  5HLI A;  3GX4 X;  2IW5 A;  2PMH A;  3O2P E;  4UV9 A;  4BQA A;  1KGS A;  4EM2 A;  3EET A;  3KP7 A;  1W7P A;  4XLP F;  3I64 A;  4G6D A;  4RB0 A;  1R58 A;  1T98 A;  2FE3 A;  2VBX A;  1LQ1 A;  4MTD A;  1BC8 C;  4HW0 A;  2P5L C;  3RPU A;  2HYF A;  5J8F A;  2JSC A;  1ZRF A;  4Z2Y A;  4FHT A;  1J0R A;  2M45 A;  1LVA A;  3HOT A;  4YFX F;  4UHT A;  1H9G A;  2YX4 A;  3I59 A;  3ABU A;  3SHF A;  1E17 A;  2Z5U A;  1O7F A;  2VC1 A;  3J7A O;  4YFK F;  2EV6 A;  2K7L A;  1SD7 A;  4WXD A;  2IT0 A;  1OYI A;  3L09 A;  3EDP A;  3T0Y A;  4O6J A;  4IXA A;  2Q0O A;  2QUF A;  1B6A A;  2WWY A;  3F8M A;  1ZLK A;  1KQ9 A;  4YFN F;  2L3D A;  3U2R A;  2ZME A;  1JXS A;  1FT9 A;  2O0Y A;  3MZH A;  1BI2 A;  1B4A A;  5TRD A;  1QBJ A;  1IW7 F;  1GHC A;  5D5X B;  3LAP A;  4G6Q A;  4I01 A;  3SZT A;  1I6X A;  2YPR A;  4KMF A;  1G3Y A;  3GZ5 A;  5HDK A;  2EFW A;  1HW2 A;  4KT5 C;  3E97 A;  4LD5 A;  3M9A A;  3KFW X;  2ACJ A;  4JK1 X;  4EJT A;  1TNS A;  4IRI A;  1U2W A;  4WK8 F;  4HF2 A;  3GVA A;  5DV5 A;  3HSR A;  1MDM B;  1R1U A;  4R1H A;  1HKT A;  2OZU A;  2V79 A;  1D3Y A;  2STT A;  4LLN A;  5IT9 Z;  3NQO A;  3RDI A;  3TOB A;  2MBF A;  1FX7 A;  4OMZ A;  3T8T A;  1SD4 A;  2R7F A;  1Z9C A;  2X4H A;  4F7Z A;  2Z99 A;  5HLG A;  1KQ0 A;  1ZHF A;  3P9C A;  2MD5 A;  2ZNZ A;  4ZYE A;  2XAS A;  2PBI A;  2XGX A;  4WWC A;  2XKP A;  4EJU A;  4WF2 A;  4DQ2 A;  5KVR A;  2QQ9 A;  3CTA A;  2L4A A;  3IWF A;  1CF7 A;  1MJB A;  2J5O A;  2ISY A;  2KIU A;  3F6V A;  3QU3 A;  1BIA A;  3IC7 A;  5D4R A;  3NEU A;  1IZ1 A;  1SFU A;  2XIG A;  4KDP A;  4HX7 A;  2JT1 A;  1IN5 A;  2H27 A;  2EV5 A;  2QZ8 A;  5FGM A;  3TO6 A;  3WGI A;  1Z05 A;  3TGN A;  1S6L A;  4KYW A;  4AIH A;  1ONV A;  2DFI A;  4RAZ A;  1F1Z A;  4GYG A;  5ICE A;  2OBP A;  2DPD A;  3WG9 A;  4EV0 A;  4WX9 A;  2DTR A;  4P5O A;  2Z3Y A;  3KZZ A;  4LB6 B;  5CVU A;  1YYV A;  1QQI A;  1BC7 C;  1S8N A;  4HF1 A;  5FLX Z;  5ICF A;  2HTJ A;  5HDN A;  1FYM A;  3D0S A;  4ENJ A;  3HSE A;  4U88 A;  1FYL A;  3CUO A;  5ILV A;  4PCQ A;  2P7C B;  2W25 A;  1IN4 A;  2G9W A;  3TDU C;  1OMI A;  4M9S A;  4HX4 A;  3K1N A;  2D1H A;  1U5T C;  1EV7 A;  4U7B A;  2PLY A;  1H0M A;  2VT2 A;  4I7H A;  4BAY A;  2NNN A;  1YQA A;  2RDP A;  1ZGJ A;  3F8C A;  3E5X A;  1K78 A;  4MEX F;  2V9V A;  4AVP A;  5LEJ A;  3KP3 A;  2VBW A;  4RGU A;  4BXU A;  3FX3 A;  1OKR A;  4KIG A;  5H6R A;  5E1Z B;  1IRG A;  4I0A A;  2CQK A;  2NAZ A;  4QWQ A;  3FXQ A;  2RKH A;  1QNT A;  4UXN A;  1P2F A;  3OV8 A;  2HGC A;  2EFN A;  2DW4 A;  3EYY A;  2DQR A;  4IPA A;  1XSX A;  4LGW A;  2W84 A;  4M6Y A;  1ZG1 A;  4ASN A;  2VE9 A;  1BIB A;  3FXR A;  3MQ0 A;  3E5U A;  2D45 A;  4FT8 A;  4GO1 A;  4AWX B;  5L3D A;  3RYP A;  2FRH A;  1WQ2 A;  3SQN A;  3VFZ A;  4QLC U;  3ZMZ A;  4PGH A;  5J8C A;  3WTV C;  3GFM A;  1D5V A;  1S3J A;  1KYW A;  1FP2 A;  5ILS A;  1FSH A;  4A0Z A;  4L5J A;  3C7J A;  5D6E A;  1XCB A;  2W57 A;  3QU6 A;  2F5D A;  1YTY A;  2M30 A;  2JTV A;  2IA2 A;  1ZLJ A;  1Z7U A;  3LAJ A;  1BN5 A;  2ZNY A;  4NB5 A;  5D5V B;  1I27 A;  3C3W A;  3G73 A;  3VOD A;  3O3K A;  5F64 A;  2ADU A;  3JAM K;  2L54 A;  2XAH A;  4IHS A;  1KQ8 A;  1ZAR A;  1GXP A;  5IT9 K;  1T6S A;  1U78 A;  4WXH A;  2G7U A;  1R23 A;  4P9F A;  1USS A;  2A07 F;  5HS9 A;  3GO5 A;  1V4R A;  4M9X A;  1HKS A;  1UB9 A;  5IT3 A;  3GXO A;  1WKM A;  4Y15 A;  5LGN A;  2LF8 A;  4LMY A;  2FBH A;  1SAX A;  4M6X A;  4E70 A;  2EWN A;  2WTE A;  4A0X A;  2DPU A;  3HTS B;  2A61 A;  1B9N A;  3J80 K;  4CHU A;  3B02 A;  1IN8 A;  2VOO A;  2ZFW A;  3H3Z A;  3PQJ A;  2BBY A;  5H6Q A;  3GF2 A;  4HOB A;  4KIF A;  3KEQ A;  3JSP A;  1O7L A;  2QYO A;  3WTX C;  3BDD A;  2VC0 A;  5FFZ A;  4CXF A;  4KIB A;  1XD7 A;  2VOD A;  4MQV A;  4L18 B;  5AON A;  4ESJ A;  1IUY A;  3V8L A;  4ZYD A;  3KCC A;  2BV6 A;  4RB3 C;  2JZY A;  2FXA A;  3I59 B;  5K5R A;  5AIQ A;  3G3Z A;  2DK8 A;  1B1B A;  1SMY F;  4GXO A;  1FNN A;  4U0Y A;  3TQN A;  1OPC A;  1OYW A;  1JHH A;  4OIN F;  2EFO A;  1XGM A;  2GQQ A;  3LWF A;  2H94 A;  5BOX A;  1FBU A;  4D0P A;  3V7C A;  3V8K A;  3KET A;  1E2X A;  1UFM A;  2BEO A;  4MNU A;  4MTE A;  2CFX A;  3CUQ B;  3J81 Z;  5D5W B;  3BPV A;  1WSU A;  3HOS A;  1VTN C;  4ESB A;  4G7O F;  3IKV A;  1FPQ A;  3ECO A;  3WE3 A;  2IA1 A;  3VEP A;  1FBS A;  4ENN A;  3K2Z A;  1YW9 A;  1JHF A;  3I4P A;  5HDG A;  1K7A A;  4DNC A;  3KE2 A;  4CGZ A;  2O61 A;  4N9I A;  3KZY A;  1ZRD A;  4ZZD A;  2ZCW A;  5DEQ A;  4L9T A;  3RTR A;  1EH6 A;  3W6J B;  5ED4 A;  3GFI A;  3C1D A;  2QBY A;  3HRU A;  3EYI A;  1Z6T A;  4Y13 A;  2FBK A;  2RC4 A;  3DFG A;  3W6K B;  4HLY A;  4XLN F;  2AXL A;  4PZJ A;  1I1G A;  2PEX A;  2Z33 A;  4G9Y A;  4LG0 A;  3EUH A;  1U5T A;  2HOE A;  2PFB A;  2ZKZ A;  4UVC A;  2AS5 F;  2HTS A;  2HKO A;  5DCM A;  4Q4Z F;  2DU9 A;  1F5T A;  2FEZ A;  2H6B A;  4ENK A;  1IXS B;  3R61 A;  4EGZ A;  3K0L A;  2GZW A;  2EA2 A;  1LJ9 A;  1BI1 A;  1XDS A;  2NNY A;  1T38 A;  5JR3 A;  3KP6 A;  3V7R A;  3TO9 A;  3T5X A;  2MH9 A;  4KMU X;  3I71 A;  1IF1 A;  3Q9V A;  4GYI A;  3LFK A;  5F1R A;  3EQL F;  3F6O A;  2ZXJ A;  2CWE A;  2F2E A;  1Y0U A;  1ZRE A;  3WGG A;  1H9T A;  3JAM Z;  3RYR A;  5D8K B;  1HXD A;  3WGH A;  4EJO A;  3V7S A;  5BMZ A;  3JTH A;  2Z9O A;  5DCF A;  1YFH A;  1Z6R A;  3TOA A;  1Z91 A;  4CIC A;  4A0Y A;  5LHI A;  1LEB A;  3I53 A;  5JHU A;  2M5W A;  5BS6 A;  1DDN A;  2P4W A;  2R3S A;  2DQL A;  4A5M A;  1XGN A;  1QO0 D;  3KP5 A;  1XMA A;  3F72 A;  5E8I A;  2K4J A;  2FBI A;  2BGC A;  4BHC A;  3KP4 A;  1XDU A;  5DD4 A;  2HEO A;  2ISZ A;  2H09 A;  3V8J A;  5CLS A;  3J80 Z;  1R1T A;  3IL2 A;  3R0A A;  4OU0 A;  3ISP A;  4IRH A;  3QP5 A;  3RI4 A;  1BM9 A;  4A2U A;  2COM A;  1KU3 A;  3DF8 A;  3AAF A;  3I0T A;  3K1P A;  5LHG A;  1IXR C;  4Q5S F;  2XKO A;  2HS5 A;  3WU0 A;  1FWZ A;  3T8R A;  2DK5 A;  1UST A;  4ESF A;  3SZP A;  2XVC A;  4U7D A;  2DAO A;  4R8H A;  5HS7 A;  1TQI A;  2GWR A;  2L01 A;  1U3E M;  1MGT A;  1MDM A;  2HQN A;  3Q9S A;  5E1W A;  3DP7 A;  4UVA A;  1FZP B;  3L7W A;  2VE8 A;  1F9N A;  3J81 K;  1DUX C;  1KU7 A;  1O3R A;  2FF4 A;  5K5O A;  4EM0 B;  1MJ9 A;  4BYY A;  4HDV A;  3O6B B;  5DUK A;  1GXQ A;  5F6F A;  1F4K A;  2M8E A;  4CZZ A;  2UXX A;  3V4G A;  3CO6 C;  3ZMV A;  3R6S A;  3DPT A;  2GIV A;  4G7H F;  2K27 A;  3JW4 A;  3K69 A;  5J6X A;  3M8F A;  1ULY A;  2V1U A;  1Z1D A;  3BZ6 A;  3S2W A;  2UXN A;  3F23 A;  4HA8 A;  3CUQ C;  3R4K A;  3MZY A;  2MH2 A;  5HOO A;  3GUD A;  2P5K A;  3WOD F;  3F8B A;  1R1V A;  1IN6 A;  3WTW C;  4ZYH A;  5CVI A;  3CDH A;  1TW3 A;  1O57 A;  2R7D A;  2YU3 A;  4MQ9 F;  3RKW A;  2PQ8 A;  5CJ9 A;  1KU9 A;  1FY7 A;  1PDN C;  3DQV C;  1IAW A;  3LA7 A;  2GA1 A;  1W4M A;  4BHP A;  4Q48 A;  5E17 F;  2PMU A;  3ERE D;  3TO7 A;  2HYG D;  3MFK A;  4UUV A;  2FNP A;  4OMY A;  3E6M A;  4RGX A;  4LLG F;  2VBZ A;  4WXC A;  2PN6 A;  2EFP A;  5L3G A;  5JFR A;  3KLN A;  5LHH A;  4G7Z F;  3ABT A;  3BJ6 A;  1LEA A;  2LSO A;  1W5T A;  2IVM A;  1XGO A;  3HUG A;  2PJP A;  2NYX A;  2XAF A;  3L9F A;  2IPQ X;  3ZPL A;  4O5V A;  2WC2 A;  2CYY A;  1WRJ A;  3IWZ A;  2DO7 A;  4ETS A;  1S7O A;  3MCZ A;  4UNO A;  1TQM A;  2VBY A;  4RB1 A;  2YR2 A;  2CGP A;  1ON2 A;  3QPH A;  1YS6 A;  3MAJ A;  4A6D A;  5LRR A;  5DYM A;  4FX0 A;  3CJN A;  1G3S A;  3Q5F A;  4KA4 A;  1J75 A;  1OYY A;  2M1B A;  4HQM A;  1TW2 A;  5EEG A;  3E6D A;  4AIJ A;  4R79 A;  2F5E A;  4H0E A;  2ELH A;  1FYK A;  1K79 A;  4A12 A;  2A5Y B;  2FSW A;  5CVR A;  2MA3 A;  1B59 A;  1U8R A;  2EK5 A;  3VB2 A;  2A6H F;  1SD5 A;  2EFQ A;  5FO5 A;  4LK0 F;  1O3Q A;  3CO7 C;  3H3U A;  3BY6 A;  5LGU A;  4ZYG A;  3U1D A;  4EQQ A;  4IHT A;  2P6T A;  4KUM A;  2FOK A;  1BJA A;  5CVJ A;  4I0B A;  1ZN2 A;  1WI9 A;  5E20 A;  1R36 A;  4YIF A;  3HRS A;  3ROU A;  4A6E A;  1HKQ A;  4BNC A;  2DBB A;  2RQP A;  1HW5 A;  3BP8 A;  1YG2 A;  1YIO A;  1UCR A;  2P7V B;  4ENM A;  2ETH A;  4P96 A;  4RGS A;  4IRG A;  1W7P B;  3T1B A;  1IRF A;  4PDK A;  1P4X A;  4Q47 A;  1ZRC A;  3IKT A;  4OIR F;  4HYE A;  4AD9 A;  3JSO A;  4LJZ F;  2OD5 A;  1K6O A;  2DT5 A;  4L9V A;  1O3S A;  1R5H A;  3RPQ A;  1ZAO A;  4K2E A;  3TKY A;  2E7W A;  3FM5 A;  2KRF A;  3HHH A;  1J9I A;  1R00 A;  2F5C A;  3WU1 B;  2O3F A;  4EMS A;  4CDG A;  2JPB A;  3B73 A;  2P5V A;  4LLL A;  1LDJ A;  2H6C A;  2E1C A;  3DV8 A;  1T39 A;  4N9H A;  1SD6 A;  1JGS A;  1EH7 A;  2MLK A;  5D4S A;  4XSZ F;  4EJW A;  4KIC A;  2V6C A;  2ZME B;  2Y48 A;  3M1E A;  1L0O C;  4OIQ F;  2ESH A;  2VT3 A;  2K02 A;  2XRN A;  1HBX G;  1HW1 A;  2OQR A;  3NRV A;  4S04 A;  1ZG3 A;  2QLZ A;  3RKY A;  3K1M A;  3DKW A;  1A04 A;  1W5S A;  1FOK A;  2EV0 A;  1PUE E;  1ODD A;  4B8X A;  4G94 A;  3ECH A;  4UVB A;  5BQT A;  3ELK A;  1D8J A;  2VOP A;  1IXC A;  2KIF A;  1FSE A;  4M73 A;  3M7G A;  3DEU A;  2CO5 A;  4OOI A;  5A2Q Z;  3F21 A;  2FML A;  1ON1 A;  4FX4 A;  4HZF A;  4G8X A;  2G7H A;  3ZP5 A;  2GXG A;  1Q1H A;  4CO8 A;  4TV7 A;  4L5I A;  4L0Y B;  5HS8 A;  3GLX A;  4PGG A;  4M71 A;  4O3M A;  3DPL C;  3WTY C;  1KYZ A;  1DPU A;  1MD0 A;  5DDG A;  2UZK A;  3IRR A;  2FU4 A;  3LA3 A;  1TBX A;  5KK1 A;  2V1D A;  4P9U A;  3FMR A;  2TDX A;  5ICC A;  2FA5 A;  4Y17 A;  1RNL A;  3F8F A;  2CG4 A;  1S29 A;  1YO5 C;  1D8K A;  1CF7 B;  1S7A A;  1PP8 F;  2OA4 A;  1O3T A;  2ZBK A;  1QPM A;  3DXJ F;  1ZH5 A;  3CUQ A;  3M8E A;  1IN7 A;  2JRT A;  1XCV A;  4B09 A;  1BI0 A;  3FHZ A;  1W7P D;  4LFU A;  1R5G A;  5D6F A;  1P6R A;  3K9T A;  4U0V A;  2A3S A;  2RN7 A;  1G3T A;  5JVT A;  5ILU A;  3QP6 A;  1JE8 A;  3WTT C;  3ZMU A;  1QZY A;  1XB4 A;  4OIP F;  5DD8 A;  3IRQ A;  2OZ6 A;  2IA0 A;  1XMK A;  2Q2E A;  4L0Z B;  4MHG A;  1XN7 A;  2OAZ A;  5HVQ C;  1YS7 A;  1BOA A;  2VXZ A;  4KN4 X;  4KFC A;  1BBY A;  2IRF G;  3IHU A;  4NQW A;  6PAX A;  4I09 A;  2WV0 A;  2A68 F;  1TNT A;  2VN2 A;  2DLL A;  3GFL A;  5FFX A;  3ZMT A;  3COA C;  3ZMS A;  3GYH X;  2VON A;  2XAJ A;  3ZQ7 A;  3QAH A;  1P4W A;  1YLF A;  4EM1 A;  4EVI A;  3H92 A;  3E3V A;  2LDU A;  2XRO A;  2E7X A;  2GAU A;  1U6G A;  2QM3 A;  5L3C A;  1REP C;  3QRF F;  1K78 B;  1G4D A;  2V1X A;  4GCV A;  4XRF A;  3RKX A;  4AIK A;  2MC3 A;  3FF5 A;  3WTU C;  4RAY A;  1R22 A;  2KJC A;  4M9Z A;  3P7N A;  2Y75 A;  3TDZ C;  4HQE A;  2PG4 A;  3F8N A;  2P6S A;  2JPC A;  4HDU A;  4A5N A;  3ZMD A;  1RUO A;  3N4M A;  2OU2 A;  2PI0 A;  3OOP A;  5LEK A;  3LQR A;  2IP2 A;  2LNB A;  2W85 A;  5TJJ A;  2BYV E;  2RGV A;  2O6G E;  3SXY A;  4UV8 A;  2D2W A;  3ULQ B;  4LB5 A;  2Q8K A;  1R7J A;  4ZH4 F;  2LKP A;  5CYV A;  4L9N A;  2FNA A;  1AOY A;  5ERI A;  5EEH A;  3D5L A;  3MWM A;  3C18 A;  1KA8 A;  4RB2 C;  3L2C A;  1I5Z A;  2CW0 F;  3MEX A;  3HIF A;  2E1N A;  1V3F A;  1EH8 A;  3HRT A;  1AWC A;  1ZGA A;  2XAG A;  1DP7 P;  2Y0M A;  1T0F A;  1LNW A;  3E6B A;  4IVN A;  3N97 A;  3ZN0 A;  3HYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...