5D5UB

Crystal structure of human hsf1 with hse dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
100
Chain Sequence
SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEERDDTEFQHPCFLRGQEQLLENIKRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock Element DNA
publication title Structure of human heat-shock transcription factor 1 in complex with DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 26
structure length 100
sequence length 107
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d5uB00
1ZARA 1R1VA 4G7ZF 3CUQB 5E8IA 1IW7F 4IHSA 2NAZA 3QAHA 1IXRC 5BPDA 2KIMA 2IJLA 1STZA 4HX4A 2HFHA 5CVIA 3HYIA 2IA2A 1DPRA 1MDMB 3U1DA 2O8XA 4ZYHA 2VONA 3EETA 3VODA 2FU4A 4WF2A 5HS9A 1B9MA 3RYRA 5CLSA 1FNNA 3KZZA 4RB2C 1AWCA 2A61A 1W5TA 2XGXA 3TGNA 4YG2F 4P5OA 2FA5A 4HBLA 3I4PA 3F8NA 2AXLA 3ECHA 1K79A 1XGNA 3MZYA 1YS7A 1WSUA 5ICCA 4N0BA 2HQNA 2A5YB 2RC4A 2EFOA 4PZJA 3ZPLA 5DDGA 4A2UA 2CQKA 2OA4A 3I71A 3HUGA 1ZG1A 2P5VA 2YR2A 4KA4A 4ESFA 2V79A 3J7AO 2HGCA 1XGOA 1IN4A 3FMRA 3I53A 4DQ2A 2GA2A 1YFHA 1IXSB 3GO5A 3SZPA 2PQ8A 4ASNA 4I01A 5CVVA 1R5HA 4BHPA 5LHGA 1MD0A 1O3SA 2M45A 1YTYA 2A68F 2L01A 3E6CC 5E17F 4ENKA 3K1PA 3P7NA 3FM3A 2CW0F 3Q9SA 5ICEA 1LQ1A 3C3WA 3I54A 3EDPA 4HLXA 4KMFA 1S3JA 2GWRA 2FRHA 2KRFA 1XSXA 3QP6A 2IW5A 2M8EA 4RAZA 4HV5A 5BOXA 2IT0A 1MZBA 3GVAA 2JT1A 5DV5A 4L0YB 4BQAA 1QPMA 4AIJA 1YW7A 4O6JA 2HYGD 3L9FA 1BIAA 3D5LA 2CO5A 3KP3A 2GAUA 2EA2A 1U2WA 1F1ZA 2P6SA 2VBWA 2ISYA 2FNPA 1XCVA 1PP7U 1IN7A 1SMYF 4B8XA 5D4RA 4I7HA 1TW2A 4R79A 3WTSC 2P4WA 4WXDA 1RZ4A 1HW5A 2RV8A 5DD4A 1SD7A 3T5XA 3GEZA 2L4AA 4M74A 2A6EF 1FPQA 2V1XA 1SD5A 2H09A 2M30A 1FYKA 3O6BB 1MKMA 5FFXA 2P8TA 3WTUC 1V4RA 1F5TA 5LRRA 3GYHX 3HSRA 4KUMA 3Q5FA 3I0TA 2ZMEB 3RKXA 3RKYA 1AOYA 1OPCA 4KICA 6PAXA 5JI6A 1U5TA 1T2KA 5LHHA 1QZYA 2HYFA 1FP2A 1LDKB 1S6LA 4HV6A 2PEXA 2PBIA 4RAYA 5KK1A 5D4SA 3BJAA 4OIQF 2V1DA 3BWGA 5D8LB 2L4MA 2O6GE 3GW2A 3N97A 1YYVA 4KIBA 5CVUA 3KP6A 2LKPA 4G6DA 3EQLF 1J5YA 3BPXA 4UVAA 4RB3C 2Z5UA 4ZYDA 1O3TA 1GXQA 3MCZA 1FC3A 3ISPA 3FZVA 3WTTC 3IHUA 2PJPA 3ZMDA 1FBUA 5AIPA 5BS6A 2ESHA 2DT5A 5JHUA 2GZWA 5D5WB 2VOPA 2ELHA 3FX3A 2E1CA 1USTA 3EUHA 4PGGA 2YX7A 1FT9A 5CVRA 3KLNA 1ZREA 2MC3A 2ESNA 3RKWA 5HLIA 2ZO4A 2NNYA 4M73A 2ZKZA 3NEUA 4UV9A 3LFKA 3GZ6A 1JHFA 1JXSA 2WV0A 4HF0A 4ESJA 1R23A 3NQOA 4DNCA 4IXAA 3GXOA 1BOAA 4KMUX 4L0ZB 4M9SA 2L02A 1H9GA 4LFUA 3KZYA 1KYZA 3I64A 4IRHA 1QZZA 2OD5A 3PQJA 1TTYA 4RGSA 3ZMZA 1RI7A 5H6RA 1J9IA 4YIIA 5ILUA 5L3EA 3KETA 2VODA 2MH2A 4HAMA 3I59A 3Q9VA 2XASA 1WQ2A 2E7XA 3ZP5A 4G7HF 1KU9A 1BM9A 3F8FA 2NRAC 4CXFA 1HXDA 2DI3A 3IL2A 3DPLC 5H6QA 2G7UA 2DFIA 3WTYC 4UVBA 2K4BA 2GXBA 1LDDA 3KP7A 3NRVA 3JTHA 1G3WA 5F6FA 1XDSA 2K7LA 1KU3A 1YO5C 4JK1X 4LG0A 5L3GA 3M8EA 3DP7A 3ML6A 2D1VA 3F72A 3M7GA 1BI3A 5D6FA 5LGTA 2M87A 1LVAA 3WU0A 2VE9A 1XMKA 3TO7A 3V8JA 2W25A 2OZ6A 5D5VB 4U88A 2RN7A 2XAJA 4OMYA 4BXUA 1W4MA 5A2QK 2P7VB 4L18B 2IVMA 1R22A 3WG9A 3H3ZA 4CYDA 1U8RA 1HW1A 3G3ZA 2FE3A 4GCVA 3U9GA 4MQVA 4L5IA 2XAHA 3J81K 3DF8A 2STTA 1R58A 2P5LC 1QGPA 2UWMA 3HRUA 3C18A 5IT3A 2HKXA 1Z05A 2CWEA 2QBYB 3HTSB 1G3TA 1GVJA 2QVOA 5HLHA 1H0MA 2QQ9A 3KEOA 4GYIA 4UHTA 2VOOA 2VBXA 1XSDA 3LA3A 5JR3A 2MLKA 1HSTA 4KN4X 4D0PA 2QQAA 1T6SA 1U5TC 2ISZA 2KJCA 1XSVA 4HF1A 1W7PD 1GXPA 1Z9CA 3RYPA 4GXOA 4I0AA 3FXRA 2ZJ2A 2XV4S 3F8MA 5ILVA 3CJNA 3IKTA 2YPRA 2HWVA 4EJWA 5BPIA 4FHTA 2RNJA 3GZ5A 3LSTA 1YIOA 2PLYA 1KGSA 3FMSA 4LB5A 2Y48A 3REOA 2GQQA 4AD9A 1YQAA 4MNUA 3H92A 2FF4A 1K78A 1B59A 4XLNF 2VT2A 5IT9K 4LLLA 4ENNA 2JPBA 2KJBA 5L3CA 3F8BA 4ENMA 4P9UA 3HRTA 2XKPA 2A69F 1ZG5A 4EVIA 2KKOA 3ZMVA 5FLXZ 3RPQA 2VC0A 4MHGA 4IRIA 1MJAA 1W7PA 1WRJA 1J59A 1L3LA 4LK1F 3MAJA 2BEOA 1XGSA 3ABUA 3T1BA 3K9TA 3N4MA 2RDPA 3GF2A 1IRFA 3MFKA 1HKQA 3DXJF 2NYXA 3K2ZA 1ZAOA 5LBQA 1LDJA 3BDDA 3F8CA 2AS5F 4GO1A 2FEZA 4HLYA 2PN6A 4WXHA 4WCGA 5CJ9A 2J5PA 1K6OA 2A3SA 4ZYGA 4A5NA 1DDNA 3CTAA 1FY7A 3GFMA 1CF7A 3KE2A 4YFXF 5J8FA 2DQLA 3WTZA 2FBIA 1FX7A 3TO6A 1DPUA 4HX8A 2M5WA 2HR3A 2VBYA 3JAMZ 4XSZF 4MTDA 3R6SA 2V6CA 2O61A 2CGPA 4R8HA 2JZYA 2DBBA 4UV8A 4YFNF 4EMSA 1Z1DA 3K1MA 1SD6A 3ZN0A 2EFPA 2XAFA 2H94A 2GIVA 3D0SA 4I09A 2TDXA 3LA2A 3J80Z 5K5QA 2FMYA 1R1UA 1IN8A 2WTEA 4FT8A 4Y15A 5LGUA 5HDNA 3SXYA 3KEQA 1KQ0A 1G6NA 1UCRA 3HSEA 4HW0A 5HDKA 1ZH5A 1QO0D 3E97A 2WC2A 2HS5A 3V8KA 1IF1A 3W6JB 4EM1A 5BMZA 1I6XA 4EV0A 2PMHA 1MJ9A 2EK5A 3E6MA 5CYVA 4MQ9F 4KIGA 4E70A 5D5UB 3FXQA 2L3DA 1ZG3A 3FHZA 1B4AA 1FOKA 2ETHA 4L9TA 2HTSA 4BYYA 4HYEA 4M72A 3CLOA 3DFGA 1DUXC 3W6KB 3JW4A 4EGZA 2EV0A 2K4JA 4G94A 1BI0A 2Z9OA 5ED4A 2MLGA 1KQ9A 2DW4A 2YU3A 4M71A 3QRFF 4OU0A 1TNTA 4M6YA 1XN7A 4HDUA 1I1SA 2BGCA 5KVRA 1FBQA 4NB5A 1PUEE 1T98A 2UXXA 4CGZA 4HOBA 3ECOA 3U2RA 4YIFA 1YLFA 3CUOA 1YS6A 2COMA 4S05A 3RI4A 2EFQA 2Q2EA 2XIGA 1O7LA 4EJVA 1T38A 4QLCU 4B09A 5LGNA 3DQVC 2V1UA 3WTXC 1XMAA 2O03A 2XUBA 1P6RA 1U5TB 5EEGA 1I1GA 1RUOA 1BI2A 1R5GA 1OR7A 2F5FA 3RDIA 1B1BA 3WGIA 3V8LA 2R3SA 5TRDA 2XRNA 3SQNA 3PFIA 2F5CA 2XAQA 4I0BA 4OINF 1W5SA 2L54A 1X3UA 4P9FA 4WK8F 4EGYA 1RIOH 2XAGA 4A0ZA 4P96A 3DKWA 1KYWA 2KIFA 3I58A 3F22A 1B9NA 1P92A 2DK8A 1HBXG 4XLPF 2F5DA 1D5VA 4BHCA 3S2WA 1P4WA 1R7JA 1XD7A 3FMQA 1MGTA 2FMLA 3QP5A 2LF7A 4ON0A 4Y17A 4EM0B 1ZN2A 4K2EA 1TQIA 1HKSA 2LF8A 2PG4A 3P9KA 4O5VA 4P55A 5HDGA 2EWNA 4UUVA 1EV7A 4MTEA 5DUKA 3ULQB 4UXNA 1LEAA 5J6XA 3EYIA 1O7FA 1CGPA 1ULYA 4S04A 5E1ZB 3P9IA 2LSOA 4IRGA 5TJJA 1R00A 4LJZF 2M1BA 4U0YA 1Y0UA 3GLXA 1WWXA 3C7JA 5AONA 1HQCA 1S29A 3F6OA 3GFLA 4U7BA 1BBYA 3L00A 1MJBA 1EH6A 3R4KA 1Z91A 5L3DA 2DPUA 1IN6A 3WTVC 4WWCA 2RVCA 2FSWA 3I59B 3K0LA 1FP1D 1QNTA 3HOTA 4N9IA 2QZ8A 1IUYA 3CO6C 1ODDA 2IRFG 4KYWA 4OIPF 3JSPA 3ZN1A 1IRGA 4G7OF 4BHBA 1P4XA 3IWZA 2HQRA 2Y75A 1ZGJA 3C1DA 3LAPA 1SFUA 3R60A 4XRFA 4IPAA 2BBYA 1U78A 5D5XB 2G9WA 1IAWA 4LG0B 2VXZA 4HDVA 3F23A 2F2EA 4KFCA 4TV7A 5LRSA 5ILSA 1Z6RA 2PFBA 5HLGA 2FOKA 4RB0A 3E5QA 5K5RA 2QENA 1BC8C 5CVJA 3SFZA 5HVQC 2OU2A 2ZCWA 3IWFA 3DPTA 4A0XA 5DCMA 3CO7C 1IZ1A 3IRRA 4L9JA 4XBFA 3WGHA 4G9YA 2EJRA 1HSJA 2IA1A 4CHUA 2W57A 3LA7A 3L2CA 4EJOA 3E3VA 1B6AA 3KP5A 4R1HA 2JSCA 2EB7A 1J7KA 4L9VA 2O3FA 5AIQA 1FBSA 1PDNC 1S7OA 4A12A 2E1NA 3V7RA 1BC7C 2P7CB 4MEYF 3E6BA 2VT3A 1TLHB 2CFXA 2ADUA 3K69A 3L7WA 1RUNA 1Z6TA 3G73A 1WKMA 3M9AA 4I2OA 4NHJA 3KP4A 4N9HA 3WE3A 4CDGA 3TO9A 3QOPA 1TQMA 4NQWA 2R7FA 1OYIA 4A6DA 2NNNA 2W84A 1BJAA 1KQ8A 2EV5A 1P2FA 3JTGA 3ABTA 1F4KA 4ZYEA 3P9CA 2JPCA 2FQ3A 3BP8A 3WODF 1OYWA 1R1TA 3HRSA 2VBZA 3CUQA 2OQGA 4EQQA 2W85A 4OMZA 2OQRA 3BPVA 4ENJA 4XSXF 3V7CA 2HKOA 2YX4A 3ROUA 3HHGA 1FWZA 1MDMA 2PI0A 1G3SA 1UHMA 2D1HA 1K78B 2MA3A 5E1WA 3ZMUA 2RQPA 2EFNA 3MWMA 3OOPA 5DYMA 3GX4X 1EH8A 3TDZC 1T39A 2W24A 1JGSA 1S7AA 3SHFA 2O0YA 3R0AA 4FX4A 1ZGAA 3KLOA 3FXUA 2EV6A 4ZZDA 1OMIA 4A0YA 1W7PB 2DTRA 1UB9A 2HTJA 4MGRA 2XVCA 5D6EA 2ZNYA 1LNWA 3RJPA 5H20A 1BI1A 4ETSA 2MBFA 1IN5A 1UFMA 4HQEA 2GXGA 1KU7A 5FD6A 5L3BA 2QLZA 5JFRA 3BZ6A 4GGGA 3F21A 4U7DA 2ACJA 2BE5F 2HDCA 4Q4ZF 1P4AA 3CDHA 2BV6A 4HA8A 3V4GA 5K5OA 3LAJA 4F7ZA 2LNBA 3MEXA 4PCQA 3JSOA 3VOEA 4KN7X 3ELKA 1QQIA 2Z33A 5ICFA 4IHTA 1ZLJA 2FBHA 3FM5A 5HS8A 1I27A 1TBXA 2CSOA 3QU3A 2DPDA 1CF7B 1O57A 3F6VA 3R0JA 2IPQX 4IVNA 2Y0MA 5F1RA 4PGHA 2KIUA 1ZHFA 4RGUA 5JVTA 2ZFWA 3GFIA 3T0YA 1D8KA 3TOBA 1FLIA 1E2XA 2Z99A 4I98B 5HOOA 1HKTA 2MD5A 5FLXK 1KU2A 5FD5A 4KDPA 3F3XA 2RGVA 1S8NA 3WTWC 1FSHA 4OIOF 4M9ZA 1ONVA 1USSA 4L9NA 2OZUA 2IP2A 5ICGA 4IF4A 3GWZA 2DU9A 2MH9A 4Q48A 2DQRA 3T8RA 1IXCA 1NHAA 2VC1A 1SAXA 1FYLA 5EEHA 2ZMEA 3EYYA 4M6XA 4I02A 1U6GA 3QPHA 3GUDA 1SFXA 3DV8A 3KCCA 2GA1A 4CICA 5E1XA 4EJUA 3JAMK 3MQ0A 4G6QA 4Q47A 4Z2YA 4RS8A 1SFEA 3OV8A 5FGMA 1ZRFA 3IKVA 3ERED 5BQTA 2QYOA 4HX7A 5D8KB 3O3KA 2D45A 1PP8F 1U3EM 1E17A 2XKOA 2UZKA 1TNSA 4BNCA 3COAC 2DLLA 3WU1B 4Q5SF 2PMUA 3TOAA 2E7WA 1YW8A 3TQNA 2HZTA 2C6YA 1FZPB 1J0RA 3J80K 5LEJA 4A5MA 3LQQA 1V3FA 1C0WA 4O3MA 2JRTA 4AWXB 3VFZA 3CUQC 2FNAA 5FB2A 3FWEA 4WX9A 2RKHA 1YG2A 2QQBA 2B0LA 3TKYA 2DAOA 3T8TA 1TQPA 3AAFA 3B02A 3E6DA 3VB2A 3SZTA 4BAYA 1G3YA 2FBKA 4QWQA 3FF5A 4U0VA 1KA8A 3ZQ7A 3LWFA 3M1EA 1VTNC 2ZXJA 4G8XA 1JHHA 3IC7A 5A2QZ 1SD4A 3KFWX 2D2WA 1ON1A 2STWA 1JE8A 5LEKA 2P5KA 1XB4A 1OKRA 2EFWA 4ESBA 5LLQA 2EA4A 1WI9A 3QU6A 4LLNA 2FXAA 3RIRA 1D8JA 3J81Z 1F9NA 1BIBA 4HQMA 3ZMSA 3BJOA 4LLGF 4LB6B 3M8FA 2A6HF 1OYYA 3RPUA 1REPC 4M9XA 1SMTA 2XHKA 5DCFA 2LDUA 2A07F 2ZBKA 1TW3A 2CG4A 2P6TA 3I5UA 1O3QA 4GYGA 2ZNZA 5DEQA 3RTRA 3WE2A 2NS0A 1UHWA 1ZRCA 4JQFA 1I5ZA 3BY6A 4LMYA 1Q1HA 1XDUA 4Y13A 3BJ6A 3HIFA 4FX0A 1XGMA 3GFJA 5K1YA 5HS7A 3VEPA 4LGWA 1R36A 3K1NA 3QPTA 3KP2A 1LB2A 4UNOA 1G4DA 1L0OC 2XROA 4HF2A 3E5UA 1D3YA 1LEBA 1LJ9A 3L09A 1J2XA 2WWYA 3H3UA 2UXNA 5DD8A 5FO5A 3E5XA 2H6BA 3HTUA 2Z3YA 5IT9Z 4U0WA 3BROA 1YW9A 1H9TA 1T0FA 3WGGA 3BOQA 4UVCA 1RNLA 4LK0F 2V9VA 2DK5A 2YSRA 4YFKF 3LQRA 4A6EA 1FSEA 1ZLKA 2QBYA 3IRQA 1Z7UA 5F64A 4ZH4F 3HRMA 4MEXF 5E18F 3ZMTA 1GHCA 1ON2A 2K27A 4KT5C 2HEOA 2H27A 1ZYRF 4AVPA 5L3FA 5ERIA 4KNYA 4AIKA 3PQKA 2H6CA 5J8CA 3R61A 2QM3A 3MZHA 1BN5A 2BYVE 2K86A 4L5JA 2Q0OA 3B73A 2G7HA 2OAZA 5DCMB 4H0EA 5E20A 3DEUA 2VN2A 4IJAA 4CZZA 1EH7A 4BH9A 2X0LA 5LHIA 4OOIA 4EJTA 4ZZLA 1K7AA 2DO7A 4RGXA 2VE8A 4PDKA 2R7DA 3HSFA 1ZRDA 4OIRF 4WXCA 2F5EA 1HW2A 4RB1A 1FYMA 2OBPA 5DUIA 3O2PE 2QUFA 2HOEA 3V7SA 2K02A 4EM2A 4JBAA 2QWWA 1DP7P 2JTVA 4KIFA 1J75A 1A04A 4RGRA 4CO8A 1O3RA 4HZFA 1QBJA 2J5OA 3HHHA 4AIHA 4LD5A 3HOSA 2Q8KA 1XCBA 2IA0A 5E8GA 5FFZA 2CYYA 2X4HA 3TDUC
chains in the Genus database with same CATH superfamily
1VQMI 1D0XA 1MMNA 1ZARA 1OISA 1QHHD 3U21A 4PSWA 3OYGA 2IGNA 5F0FA 1R1VA 2HOSA 2GOXB 1R71A 4G7ZF 3CUQB 5E8IA 1IW7F 5FKOA 3TP0A 1ENHA 4IHSA 1OLTA 2PX9A 3DWLE 4NDLA 2NAZA 3QAHA 1IXRC 5BPDA 2K9NA 3BTCA 1XX5A 2KIMA 2IJLA 3CF5F 1STZA 4ABZA 4HX4A 3OYBA 2HFHA 2KZVA 3I56I 2ZXHA 5CVIA 1I3QJ 1GLNA 1WH5A 3FXKA 2IA2A 3HYIA 3DTIA 1DPRA 4XNFA 3S3NA 4C3HJ 1MDMB 3U1DA 2O8XA 4ZYHA 2VPLA 2VONA 3EETA 2CUJA 2KFDA 3VODA 2FU4A 1U9OA 3EUAA 1IDYA 3ABMH 4WF2A 1WJAA 3BCAA 3CJQB 2VL8A 5HS9A 1B9MA 3RYRA 5CLSA 5IOYA 2EILH 3OSFA 1GV5A 1FNNA 3KZZA 4RB2C 1AWCA 3W2AA 2A61A 1W5TA 2XGXA 4AIDA 4DGWB 5J40A 3TGNA 4P5OA 2FA5A 3HC7A 4HBLA 4BJ5C 3I4PA 4YG2F 3CESA 3F8NA 2AXLA 1N77A 1VQ8I 3ECHA 1K4TA 1K79A 1XGNA 5FKKA 2HU9A 4V2GA 3MZYA 1YS7A 1WSUA 1TWFJ 5ICCA 4N0BA 2XB0X 2HQNA 1ETVA 3H1CA 2A5YB 2DA5A 2RC4A 2K3FA 4DYQA 2EFOA 1H8AC 4PZJA 3ZPLA 5DDGA 2GXAA 4A2UA 1MMGA 2CQKA 2OA4A 4HPQA 2ME0A 2LVSA 3I71A 3HUGA 1ZG1A 2E5NA 2P5VA 2YR2A 1WJBA 4KA4A 4ESFA 2LH9A 1HDDC 3KZIC 2V79A 3RKQA 3J7AO 2HGCA 1BR4A 1XGOA 2UUZA 4YEJA 1IN4A 4B3AA 2CQNA 1V5GA 2CUZA 4C3IJ 3FMRA 4I99C 3I53A 4DQ2A 3S1RJ 3CJTB 2GA2A 3CCUI 1YFHA 1IXSB 3GO5A 4RMNA 2R93J 3LSHA 2A05A 2R7XA 4C2MJ 3SZPA 2CV1A 2PQ8A 4ASNA 3I55I 2K5CA 2HVQA 2P0WA 4I01A 5CVVA 2DXIA 1R5HA 2K85A 4BHPA 5LHGA 3WHBA 1MD0A 2JMWA 4BXXJ 2DCEA 1O3SA 2M45A 1YTYA 2FUG2 2A68F 2AXTC 4F91B 5EF6A 2L01A 1X4OA 3K70D 3E6CC 5E17F 1TL8A 4ENKA 2QCOA 2V7FA 2VQGA 3K1PA 3P7NA 2LD5A 1S9HA 3FM3A 2CW0F 2OCEA 3VSKA 3CC2I 3HPHA 1D1CA 5M3MJ 3Q9SA 1X4PA 5ICEA 1LQ1A 1FEXA 2RQQA 2IS2A 2XF5A 1NTCA 3C3WA 3I54A 4KJZA 2DMQA 1W5CC 2DT7B 3EDPA 1HF0A 3WU2C 4HLXA 1HDPA 4JOMA 4KMFA 1S3JA 2DOFA 2I8DA 2GWRA 1T0FC 2FRHA 2M7BA 3SYTA 2KRFA 1XSXA 3QP6A 3JREA 3FDYA 1XMXA 2IW5A 2M8EA 3AG4H 5K7FA 4RAZA 3G2BA 4HV5A 5BOXA 2DA7A 2IT0A 1MZBA 3GVAA 3K4NA 4BBRJ 3AL0C 2JT1A 5DV5A 4L0YB 4UY8I 2LP0A 4BQAA 4FQGA 5B66C 3QPSA 1QPMA 4AIJA 1YW7A 3CD6I 2NVYJ 2HYGD 3DEWA 1BIAA 3D5LA 3L9FA 2CO5A 2DJIA 4O6JA 2OTLI 5GP9A 3KP3A 1T56A 3ASNH 2GAUA 2KIQA 4X0GA 5JLXA 2EA2A 3S17J 4E7SA 2KMUA 1U2WA 4BQOA 3HOVJ 5IOZA 4IZZA 1F1ZA 2P6SA 2VBWA 1H89C 2ISYA 2FNPA 4PUSA 1XCVA 1PP7U 2YUSA 3CCVI 1MBHA 3S3MA 1IN7A 2Z1DA 3KYCB 1SMYF 4B8XA 5GPCA 5D4RA 1A36A 3CDIA 4I7HA 1TW2A 4R79A 4GRIA 2ME6A 3WTSC 2P4WA 4WXDA 1RZ4A 1HW5A 2RV8A 2IS4A 5DD4A 1SD7A 2BY1A 2L4AA 3GEZA 4II2A 4M74A 3T5XA 2A6EF 2XPVA 2EPFA 1FPQA 4QPQA 3PSFA 4IHWA 1DU0A 1LFBA 1X2NA 5M5YJ 2V1XA 4UUSB 1SD5A 2H09A 2M30A 1FYKA 3O6BB 1RKWA 1MKMA 4CUGA 1NK2P 5FFXA 1MMAA 3CQZJ 2P8TA 3S32A 3WTUC 1V4RA 4DBRA 3IUOA 1F5TA 5LRRA 1YJ9I 4BJTA 3HSRA 3GYHX 1U0JA 2WV1A 4KUMA 3Q5FA 2W00A 3I0TA 2ZMEB 3RKXA 3RKYA 1AOYA 5M5XJ 1OPCA 4KICA 6PAXA 3PO3J 1FOWA 1DGWY 5FROA 5JI6A 1A6IA 1JUPA 2L9RA 1F36A 1U5TA 1T2KA 2LYCA 4PJ0C 5LHHA 3GTQJ 1AU7A 2HVSA 4II3A 1QZYA 2X48A 2DDBA 4B1RA 2VPRA 3FK7A 2ECCA 2HYFA 3I9V2 3BR3A 1FP2A 1LDKB 1S6LA 4HV6A 2MW8A 2PEXA 3CCEI 2E2HJ 2PBIA 4RAYA 4B47A 5KK1A 5D4SA 4MLOA 1YJNI 1UG2A 3BJAA 4OIQF 2V1DA 3BWGA 5D8LB 2L4MA 2O6GE 3GW2A 1RKTA 4E7JA 3N97A 2DOAA 5KNLA 1YYVA 4KIBA 4L5EA 2B9SA 5CVUA 4ZDPA 3KP6A 2LKPA 1B8IA 5C4XJ 4PFOA 4G6DA 3EQLF 1J5YA 4BY1J 3BPXA 1W36C 4ZDOA 1WGXA 4UVAA 4RB3C 2EQRA 1Z67A 3QYEA 2Z5UA 4G6TB 4ZYDA 1LPQA 2HQAA 1O3TA 4C30A 1GXQA 3A4CA 3GTPJ 3L2QA 3MCZA 3L2WA 1FC3A 3ISPA 3FZVA 2VJ5A 3IHUA 3WTTC 3ZMDA 2PJPA 1MH4A 1FBUA 5AIPA 2LKXA 4FCYA 5BS6A 2ESHA 2DT5A 2ELJA 3Q0VA 2GZWA 5B1BH 5JHUA 2IS6A 2E36A 4Z6YA 5D5WB 2VOPA 1R49A 2ELHA 2CU7A 3FX3A 4F93B 3CLQA 3LSPA 2E1CA 2DYSH 1ZGWA 4CCJA 3U1KA 3M1CA 1USTA 2MYSA 1ETWA 1UAAA 2IAIA 4AC0A 3EUHA 3H3VK 2DOEA 4PGGA 2YX7A 1FT9A 3FBNB 2MG4A 5CVRA 3KLNA 3TW7A 2BW3A 1ZREA 2E1MB 2MC3A 2ESNA 3RKWA 3S3OA 5HLIA 3Q0UA 2ZO4A 3UR3C 4M73A 2NNYA 3A03A 2ZSHB 3OMYA 3JCUC 2ZJQF 4BXFA 2ZKZA 1GT0C 3NEUA 4UV9A 2JUGA 3G1OA 3LFKA 4E7KA 3GZ6A 1JHFA 1JXSA 2WV0A 4HF0A 4ESJA 1MBGA 1R23A 3LSIA 3NQOA 4DNCA 4IXAA 3GXOA 1WVRA 1BOAA 4KMUX 4L0ZB 4M9SA 2L02A 3WG7H 4A3MJ 1OQYA 3PNYA 2FJ1A 1H9GA 4LFUA 3KZYA 4IQJA 3OS2A 3A0HC 1KYZA 3I64A 4IRHA 5J1RA 1QZZA 5J3LA 5B5EC 4IL6C 2OD5A 3QYBA 3PQJA 1TTYA 2IGKA 4RGSA 3L2VA 4BBSJ 3ZMZA 4AUXA 1RI7A 4JX6A 5H6RA 2JRMA 1J9IA 5J47A 4YIIA 2M8GX 5ILUA 1VNDA 1ZKGA 3VYTB 5L3EA 3KETA 2VODA 2MH2A 2M34A 2VIXA 4DZPA 3HJEA 4HAMA 3I59A 3Q9VA 2JUCA 2XASA 2Z2SB 4M3DA 2CH0A 1WQ2A 2E7XA 3ZP5A 4XRSA 4G7HF 1KU9A 1BM9A 3F8FA 5GTIC 2YS9A 2NRAC 1GUUA 4CXFA 3SDBA 1HXDA 2DI3A 3IL2A 3DPLC 5H6QA 2MABA 2G7UA 3K4KA 3K4JA 2DFIA 3WTYC 2OTJI 4XR6A 4UVBA 3BQZA 4DW6A 2R0QC 2K4BA 2GXBA 1LDDA 1FMVA 3CCMI 3KP7A 1J09A 3NRVA 3X2QH 3JTHA 1G3WA 5F6FA 1S72I 1XDSA 2K7LA 2CQXA 1KU3A 4ZTJA 1ZQ3P 1PVEA 1YO5C 2OCCH 1NG7A 2VKDA 2F5VA 4JK1X 4LG0A 5L3GA 3M8EA 1MBEA 3ZQHA 3DP7A 2R5ZB 4A3LJ 1VQ9I 1EKEA 3ML6A 2D1VA 1VI0A 3F72A 2LG4A 3VPRA 2LY1A 3M7GA 4XIDA 1OCTC 1DU6A 2WY7Q 1BI3A 3CCQI 5D6FA 2W1OA 5LGTA 4U87A 2O7OA 4XN0A 2M87A 3OSGA 3M4OJ 1YOVB 1LVAA 4RDUA 2WB1N 3AG1H 3WU0A 3JRFA 2VE9A 1XMKA 3TO7A 3ZQFA 4HNUA 1BW5A 2QGUA 2W25A 3V8JA 2OZ6A 5D5VB 2DMNA 1WI3A 2R7RA 2Y30A 3O8GA 4U88A 3OIQA 1MMDA 3PUBA 2RN7A 2DMTA 1R9TJ 1Z7LA 2XAJA 4OMYA 4BXUA 1W4MA 5A2QK 2P7VB 4L18B 2JA8J 2PJRB 2IVMA 1R22A 5F08A 3WG9A 3H3ZA 3MKYB 4CYDA 1G2HA 3PIOF 1E3PA 4QTRA 2DA4A 4C2UA 3G1LA 4HSTA 4RBOA 3PIPF 5C4JJ 5EGOA 1D1AA 1U8RA 1HW1A 2KRHA 2ELKA 3G3ZA 5F0CA 4MIMA 2BY2A 2FE3A 2EZHA 2CQ7A 2KRCA 4GCVA 3U9GA 5HNHA 4MQVA 4L5IA 2XAHA 2HQ5A 2A6TA 3J81K 3DF8A 1UMQA 3BTJA 3DLAA 2STTA 1R58A 2P5LC 1QGPA 2UWMA 2E34A 3HRUA 4FE7A 3C18A 1MBKA 1Y1VJ 5IT3A 2HKXA 3KX2A 1Z05A 4E4HA 3AL0B 2CWEA 4CCMA 4A3IJ 2QBYB 4XM3A 4E7ZA 1ZK8A 1S7EA 3HTSB 1A6QA 1G3TA 1GVJA 5C3EJ 2QVOA 2CW8A 5HLHA 2ID6A 2QQ9A 1H0MA 1FOXA 3KEOA 4GYIA 4UHTA 1I50J 2VOOA 2E60A 2VKVA 3FIWA 2VBXA 1XSDA 3Q3SA 2IGMA 2VQCA 2QSGX 3LA3A 5JR3A 2VKEA 3W6VA 2MLKA 4XLAA 3IP4B 1RESA 2H8RA 2LY9A 1HSTA 4KN4X 1JKOC 1TWCJ 4D0PA 1V5FA 2QSHX 2QF7A 2QQAA 2K9MA 1T6SA 1U5TC 3SFIA 2XPUA 1AKHA 2ISZA 2KJCA 1XSVA 4HF1A 2E5ZA 3CMAI 3HM5A 1W7PD 1GXPA 1Z9CA 2OF7A 3RYPA 4GXOA 2VKHA 1W1WE 3GTGJ 2M2EA 4I0AA 3FXRA 4W1UA 2ZJ2A 2XV4S 3F8MA 1QHGA 3CJNA 5ILVA 3IKTA 4AYBA 1VQOI 2YPRA 2HWVA 4BEHB 4EJWA 5BPIA 4RAFA 3MKWB 1D0ZA 4FHTA 3N05A 2RNJA 4IEJA 3GZ5A 3LSTA 1YIOA 2PLYA 1Y6IA 1KGSA 1XC5A 2M0CA 3FMSA 4S0HB 4LB5A 2Y48A 1EJ9A 3REOA 2GQQA 4AD9A 5KHDA 3PUFA 2VLAA 1YQAA 4MNUA 3H92A 4NC6A 3G4SI 2FF4A 1K78A 3P5JA 1B59A 4XLNF 2VT2A 3GTMJ 5IT9K 1LE8A 2Y9ZA 4LLLA 1WH7A 2JPBA 4KT6A 4ENNA 2KJBA 3TMOA 3S1MJ 5L3CA 4BE0A 2CV2A 4Y4RA 3F8BA 2XGCA 4ENMA 4CYCB 4P9UA 3HRTA 2XKPA 3A0BC 3OYEA 2V26A 1TT0A 4B3XA 4F55A 2A69F 3JRAA 1ZG5A 2VQLA 5E3OA 4EVIA 1XS9A 3HG9A 3WHCA 3H5NA 2KKOA 3ZMVA 2EIJH 2NVUB 3DBRB 5FLXZ 3K7AJ 1T08B 2XSDC 3RPQA 2VC0A 3LSGA 4MHGA 4IRIA 1MJAA 2KP6A 3E7LA 1W7PA 3OYKA 1WRJA 1J59A 3EUHC 4CH7A 3RQIA 5EG0A 1L3LA 4LK1F 3PFYA 3MAJA 3DBLB 2BEOA 1Z0XA 1XGSA 3ABUA 3T1BA 1YRNA 1RR8C 1GDTA 3K9TA 2XC7A 3N4MA 1RRJA 1PUFA 2RDPA 3GF2A 1IRFA 3MFKA 2L9NA 1HKQA 3DXJF 2NYXA 2R7VA 1NH3A 2XPWA 3K2ZA 2F6CA 5CQEA 2K9LA 1MMSA 2CUEA 1ZAOA 2M0MA 1LDJA 3BDDA 5LBQA 1OCPA 5K7HA 1K4SA 2LFBA 3F8CA 2VJJA 1N75A 3DTEA 2AS5F 1VFCA 4XKBA 1IV8A 4GO1A 1F43A 2KPMA 2XDVA 4NUBA 5H2FC 2NS8A 2FEZA 4HLYA 2PN6A 5FRMA 3SEZA 1FIPA 4WXHA 3FXLA 1G59A 1IGNA 4XMYA 4WCGA 3HOXJ 5CJ9A 2HDDA 2J5PA 3UKGA 1A35A 4MO7A 1K6OA 2MSYA 5F27A 3ZQLA 2VJ4A 2KLOA 2R7QA 2KDZA 2A3SA 4ZYGA 4A5NA 1DDNA 3W3CA 3CTAA 1FY7A 3GFMA 3SJMA 1CF7A 3KE2A 4YFXF 5J8FA 5LD2C 3NARA 1T95A 2DQLA 3OL4A 2FBIA 3WTZA 1FX7A 4E7IA 3TO6A 3SZGA 4XICA 1DPUA 1B72A 3OR1C 4HX8A 4F92B 3HBLA 2M5WA 3FBIB 2HR3A 2VBYA 3JAMZ 4XSZF 2LLKA 3BQYA 4MTDA 3ZQGA 2LBFA 3R6SA 2V6CA 2O61A 4EATA 1AHDP 2CGPA 4R8HA 1Z3XA 2JZYA 4CCNA 2DBBA 1OFCX 3DEEA 4UV8A 4YFNF 2DN0A 4EMSA 2ZJPF 4M3BA 2L5QA 1Z1DA 1MIJA 3S8PA 4PFPA 4D7NA 3OYJA 2CV0A 2XGEA 3SDGA 3CCLI 3C2GA 2BOLA 3K1MA 1SD6A 1VZ0A 3JR9A 3BG7A 2MD0A 3ZN0A 2TCTA 2EFPA 2XAFA 2H94A 3BT9A 3HUGB 2JA7J 2GIVA 1YX5A 2W4SA 3D0SA 4D5FA 3CC7I 2I5UA 1IRZA 2Y31A 4I09A 3CC4I 2LREA 2TDXA 5DM6F 2V9KA 3RZOJ 3LA2A 2JA2A 3HGYA 2HXIA 4W97A 1H88C 2NVTJ 3DKXA 3S15J 2BVLA 2W7NA 5IPAA 3BTIA 3J80Z 3DLLF 5K5QA 2FMYA 1R1UA 3HOWJ 1IN8A 2WTEA 4FT8A 4ITVA 1IUFA 4ZJZA 2DA2A 1FMWA 4Y15A 5LGUA 1BW6A 4JP0A 5HDNA 3SXYA 2HYJA 5EDNA 2G0EA 4Y52J 1OCZH 2BXYA 3KEQA 1KQ0A 1G6NA 1JJ6C 1UCRA 2EH3A 3HSEA 4HW0A 5HDKA 2V4JC 1ZH5A 1QO0D 3E97A 2WC2A 4BU2A 2HS5A 3D1NI 2Q1ZB 1YIJI 3V8KA 4NC7A 3OYIA 3B6CA 3G71I 2ZJRF 3A1YA 3HZJA 1IF1A 3W6JB 2O9LA 4EM1A 5BMZA 1I6XA 1BL0A 4EV0A 1ITYA 5C44J 2PMHA 1MJ9A 2R5YA 2EK5A 3E6MA 1IG7A 3PM1A 1EA3A 5CYVA 4MQ9F 4KIGA 3OYHA 3MD2A 4E70A 1APLC 2O8KA 5D5UB 3FXQA 3H36A 2H1LA 3OYAA 1ZR4A 2L3DA 1ZG3A 1XTAA 3FHZA 3FKJA 1B4AA 1FOKA 4QSHA 2ETHA 4L9TA 2HTSA 2P81A 3ZXSA 4BYYA 2JSPA 4HYEA 4M72A 3CLOA 4P1WA 5EJCA 3DFGA 3GMEA 1DUXC 3W6KB 3JW4A 4EGZA 1HA8A 2EV0A 2L9VA 3CCYA 2K4JA 4E7LA 4G94A 1BI0A 2Z9OA 1EF4A 2MLGA 5ED4A 1SC7A 3UNGC 1WHUA 2MGQA 3PJRA 1KQ9A 2DW4A 2YU3A 2KL4A 4M71A 3QRFF 4XLCA 2L0KA 4OU0A 1TNTA 4AVZA 4RA2A 3FXOA 1BR1A 3OYFA 4M6YA 2ZXWH 3Q0WA 1XN7A 4HDUA 1I1SA 1W0TA 2BGCA 4PJJA 1FBQA 5KVRA 4BDYA 1TWGJ 4NB5A 4HNTA 3L1PA 1PUEE 1Y1WJ 1T98A 1WJCA 2WAEA 2UXXA 4CGZA 4HOBA 3ECOA 3U2RA 1JKPC 4XLHA 2RREA 4YIFA 1YLFA 3CUOA 1YS6A 2COMA 5F1JA 2GOMA 3BG9A 4S05A 2ZFUA 3RI4A 2EFQA 2Q2EA 2XIGA 1O7LA 2DTZA 4EJVA 1T38A 4ZTFA 4QLCU 2R7WA 4B09A 5LGNA 2BVMA 3VWBA 3E1SA 3DQVC 1DP3A 2V1UA 3WTXC 2FQ4A 1XMAA 2O03A 3GCMA 2Z16A 2EZLA 2LC2A 4D7MA 2CJJA 1P6RA 2XUBA 1U5TB 5EEGA 1OJLA 2N8GA 1I1GA 1RUOA 1BI2A 4HRIA 5KAFC 1R5GA 1OR7A 4RLFA 4XLEA 1MH3A 2F5FA 3RDIA 5HNFA 4XKVA 4KISA 1B1BA 3ERMA 2R7OA 3GTKJ 3WGIA 3CCRI 3V8LA 4C2TA 2R3SA 5TRDA 2X85A 5E3NA 1LFPA 2XRNA 3SQNA 2HVRA 3PFIA 4XLFA 2F5CA 1OCOH 2XAQA 5FKMA 2YU9J 4I0BA 3CP2A 1B8IB 4OINF 3RPUD 1W5SA 2L54A 1X3UA 3KEYA 4P9FA 4WK8F 4PJMA 4EGYA 3I3LA 2VUMJ 4I6ZA 4IKFA 1RIOH 2XAGA 2E2JJ 2FD5A 4A0ZA 4P96A 3DKWA 1KYWA 4LITA 2KIFA 3FXJA 3I58A 3F22A 1YITI 1B9NA 1P92A 4A3FJ 4BGDA 2DK8A 1U9NA 3K6GA 1HBXG 3QPLA 1Y39A 2JVHA 4XLPF 2F5DA 5J1UA 1D5VA 4BHCA 2A5WA 2M3AA 3LOCA 3S2WA 1A5JA 3BC8A 1P4WA 1R7JA 2ZC2A 5FKNA 1XD7A 1IC8A 2IBDA 3FMQA 1ETQA 1QA6A 2DDAA 3ABKH 2B63J 1MGTA 2FMLA 3QP5A 3FHNA 4AU7A 2L7ZA 3MVPA 1SVOA 1VQKI 2LF7A 3LL7A 4ON0A 2R4GA 4Y17A 1SANA 1D5YA 4EM0B 1ZN2A 4K2EA 1TQIA 1HKSA 1V54H 1YE9A 2DA6A 2LF8A 3C2BA 2PG4A 3P9KA 2BW3B 4O5VA 4P55A 5HDGA 2EWNA 4UUVA 4CCOA 1EV7A 2AQFA 3CCJI 1JGGA 4MTEA 5DUKA 3ULQB 1YI2I 4UXNA 1LEAA 5J6XA 2NVXJ 3S1QJ 3TBIA 2L9SA 3EYIA 1O7FA 1CGPA 9ANTA 2L7MP 1ULYA 4YIRX 1WZ2A 3JRIA 1MSFC 2AHQA 3ESWB 4S04A 3RSNA 4I76A 5E1ZB 1MW7A 2LR8A 3P9IA 2LSOA 3HKZN 4IRGA 2LKSA 2CS3A 5TJJA 1R00A 1T8IA 4LJZF 2M1BA 4U0YA 1QZEA 4IQ4A 1Y0UA 3GLXA 1WWXA 3C7JA 5AONA 1XPXA 2UV1A 5DTDA 1Z3YA 1HQCA 2QSFX 4CZCA 1S29A 3F6OA 1X1DA 3ZR8X 3GFLA 4U7BA 2XF6A 1BBYA 1VQ5I 3L00A 1MJBA 1EH6A 3R4KA 2VJIA 1KZHA 1P9QC 1Z91A 5L3DA 2DPUA 1IN6A 3H9JA 3WTVC 4LIUA 4WWCA 2RVCA 1BA5A 2FSWA 4X6AJ 3I59B 3BZKA 3K0LA 1FP1D 2W82A 1QNTA 3HOTA 4N9IA 1T33A 3ZQCA 3CF2A 3ZQQA 3M8JA 3BR6A 4J19A 2QZ8A 3AG2H 2LOOA 1IUYA 3CO6C 1ODDA 3QWLA 2IRFG 2JQ7A 2JVGA 1W0UA 4KYWA 2HXOA 4ZYAA 2QQ8A 4OIPF 2MC4A 3JSPA 3ZN1A 5FKLA 4A93J 1IRGA 2WY8Q 4CCKA 4G7OF 3KIOA 3FXMA 4BHBA 1P4XA 3IWZA 2WBMA 2HQRA 5E3MA 1X2MA 1ZGJA 2Y75A 3C1DA 5IP6A 3LAPA 1SFUA 2DFEA 3R60A 4XRFA 2Y0SN 4IPAA 2BBYA 5F0HA 4XORA 1U78A 5D5XB 2G9WA 4NC8A 5J4YA 1Q1VA 1IAWA 4LG0B 2VXZA 4HDVA 3F23A 1TWHJ 3A01A 4DBQA 2F2EA 4KFCA 4TV7A 5LRSA 3ZCOA 5ILSA 1R6RA 1Z6RA 2PFBA 5HLGA 2V9PA 2FOKA 1X19A 1VQ4I 4RB0A 3E5QA 5K5RA 4OAYA 3K70C 3GZNB 2QENA 4PJNA 1BC8C 5CVJA 3SFZA 2DT6A 3QODA 4JYKA 5HVQC 1FTZA 1ETOA 2OU2A 2ZCWA 3GTLJ 3IWFA 3DPTA 4A0XA 4XRMA 2GM4A 2Y2ZA 5DCMA 5J1YA 2B7EA 3CO7C 1IZ1A 1WCMJ 4QPOA 3LFUA 3ZGKA 3IRRA 2WB1A 3J7YJ 4L9JA 3ZQIA 4XBFA 1FJLA 4PK4A 3WGHA 5KCMA 4G9YA 2EJRA 2V6EA 3NWTA 1HSJA 2IA1A 4CHUA 2W57A 1P7IA 3LA7A 2KQRA 3HL2A 3L2CA 2E71A 3M3YJ 1JTYA 3VYUB 4EJOA 3E3VA 1B6AA 1R4MB 2WADA 4RM2A 3KP5A 5HLTA 3A2KA 2VASA 2WAQN 4OWRB 3B6AA 5EGOB 4R1HA 2JSCA 2EB7A 1TC3C 1J7KA 4G12A 4L9VA 3VYSB 2O3FA 1MSEC 4BY7J 5AIQA 3H5AA 1FBSA 1PDNC 2M9HA 3K4MA 4BQQA 1S7OA 3DU6A 3BR2A 3HDDA 2L7KA 5EEAA 4A12A 2E1NA 3V7RA 1BC7C 2P7CB 4MEYF 3E6BA 2VT3A 1TLHB 2CFXA 2ADUA 4M3EA 3K69A 3L7WA 1RUNA 4DIQA 1QU3A 5GAGJ 1Z6TA 4PJLA 5IYDJ 3TP3A 3G73A 1WKMA 3M9AA 5B1AH 5HODA 3JRGA 4I2OA 4NHJA 3KP4A 2HZDA 4N9HA 5LFAA 4MFEA 4XL9A 1X3ZB 3WE3A 1LFUP 1JKQC 4CDGA 1BJZA 3TO9A 4UB6C 3QOPA 2EIMH 2COBA 2L7FP 1TQMA 3CP8A 2M4GA 4NQWA 2R7FA 2K9QA 1UHSA 3OL3A 1D1BA 1OYIA 4A6DA 2NNNA 3DTKA 1X1AA 2W84A 4YRVA 1BJAA 3IV5A 2EV5A 1IDZA 1KQ8A 1P2FA 1MNEA 2OPTA 2LMDA 3JTGA 4BKXA 3ABTA 1MBJA 1POGA 1F4KA 4BUPA 4ZYEA 3W2VA 3P9CA 2Y9YA 2JPCA 1AKHB 1NG6A 2FQ3A 3BP8A 3WODF 1OR7C 1OYWA 1R1TA 3HRSA 1MNMC 1ZR2A 1RETA 2R7UA 2VBZA 3CUQA 2OQGA 4EQQA 2W85A 4DYRA 5FRNA 4OMZA 4Y3OA 1TZLA 2H1KA 2OQRA 3BPVA 4ENJA 4XSXF 2QA4I 3MKLA 4N4NB 3PNTA 2XRLA 2KDOA 2M7AA 5CPRB 3V7CA 2X6YA 2QKLB 3IAS2 3FK6A 2HKOA 2YX4A 4UUTA 3ROUA 3RCOA 2E19A 1OCCH 4M3GA 1UG0A 1FWZA 3HHGA 1U8BA 1MDMA 2PI0A 1DQUA 1BOBA 1G3SA 2EZKA 1UHMA 4A69C 3BG5A 2D1HA 1K78B 2MA3A 1YHQI 2LK2A 3F9KA 5E1WA 3ZMUA 4IHXA 2RQPA 1JTXA 1LE8B 2EFNA 3MWMA 4A3GJ 4BDZA 2X51A 3DU5A 3OOPA 5DYMA 3GX4X 3H9GA 3CZ6A 1JT0A 2HOAA 1EH8A 4RAGA 3IH2A 2F4OB 3LSJA 1R4NB 2OJED 3D5SC 3TDZC 1T39A 2H8WA 2W24A 1JGSA 1S7AA 2X6OA 1UZCA 4C9YA 3SHFA 2JA5J 2O0YA 3R0AA 4FX4A 1ZGAA 1S5LC 2E2IJ 3KLOA 2XAUA 2D5VA 1IO2A 3FXUA 3PL8A 2EV6A 4ZZDA 1OMIA 1VQ6I 4A0YA 3PNVA 1W7PB 2DTRA 1UB9A 5FLVA 2HTJA 4MGRA 2XVCA 5D6EA 2ZNYA 5EG0B 1LNWA 3RJPA 3QOEA 1I3AA 5H20A 4YELA 1BI1A 2I10A 4ETSA 2MBFA 4NBQA 1JKRC 1IN5A 1YRNB 4C3JJ 4F52A 1UFMA 4HQEA 3HOZJ 2GXGA 3ZRGA 1KU7A 1PUFB 1PJRA 5FD6A 5L3BA 2QLZA 4BACA 3PO2J 1GVDA 5JFRA 3BZ6A 4GGGA 3CMYA 3F21A 4U7DA 2ACJA 1O4XA 2BE5F 5CQGA 4QIWN 3HB9A 5FJ8J 2LRDA 2JJ7A 2HDCA 4FASD 1FOYA 4BS9A 1P4AA 4Q4ZF 4BL0B 2PMZN 3DCFA 3CDHA 2BZTA 2ZXIA 4D5CA 1X3WB 1RC9A 2BV6A 4HA8A 2CFOA 2DMUA 3K10A 3V4GA 5K5OA 3LAJA 4F7ZA 3BG3A 2LNBA 3MEXA 4PCQA 2MFZA 3JSOA 3VOEA 4KN7X 3H9QA 2BXZA 5GPAA 2RNGA 3ELKA 1NK3P 2NS7A 3S14J 1QQIA 3VDXA 2Z33A 1P7JA 3MMYB 5ICFA 4IHTA 1ZLJA 2KHMA 3CCSI 2FBHA 2CQQA 3AFHA 3FM5A 5HS8A 1I27A 1TBXA 2CSOA 3BLYA 3QU3A 2JWTA 2DPDA 3L2UA 1CF7B 1O57A 1K6YA 3F6VA 1ZELA 2XB5A 3R0JA 3GLLA 3C2HA 2AQEA 1B72B 2IPQX 4IVNA 2Y0MA 2EZIA 2FX0A 5F1RA 1ERDA 4PGHA 2KIUA 3S2HJ 3AKZA 3F0CA 2LBFB 1ZHFA 1IV6A 4RGUA 5JVTA 3OIPA 2ZFWA 1FIAA 3GFIA 4XN3A 3T0YA 1D8KA 3TOBA 1FLIA 4D9JA 1JUMA 1WJFA 1E2XA 3OYNA 2Z99A 4I98B 4B4CA 5HOOA 1VQPI 3K4CA 2TRTA 3OS1A 1Y56A 2MD5A 2PMZA 1PYVA 1GV2A 2QKMB 1HKTA 5FLXK 3MN2A 1KU2A 3G1MA 5FD5A 4XK4A 3S93A 4KDPA 2NVQJ 3F3XA 2RGVA 4DZJA 1S8NA 3WTWC 2XF7A 5M5WJ 1FSHA 2R7ZJ 1UJ8A 4OIOF 4M9ZA 3H0DA 1ONVA 1YJWI 2DA1A 1USSA 1ETYA 4L9NA 2HI3A 5E3LA 3OR2C 1SVMA 2OZUA 2IP2A 4IHVA 1IJWC 4XOPA 5ICGA 3M07A 2HNHA 4IF4A 5CKTA 3GWZA 4A3JJ 2VI6A 4HEA2 3I4NJ 4Y7NJ 3LNQA 2V1NA 4F3QA 2DU9A 4UUSA 4XRSG 1ZTRA 2MH9A 4Q48A 1Z77A 1JJ8C 2GLOA 2DQRA 2X6XA 1JUSA 3LSMA 5E79C 2CMPA 2BY3A 1X58A 3T8RA 1IXCA 3CJRB 3LSKA 1NHAA 2DJNA 4XKCA 2VC1A 1SAXA 1FYLA 1JI8A 5EEHA 2ZMEA 3EYYA 3H35A 1R5ID 1VQNI 1TP4A 3W2WA 5KAIC 4M6XA 4FETA 4I02A 3A02A 4NNJA 3GTJJ 1U6GA 5M3FJ 4A3CJ 2IS1A 3QPHA 3GUDA 2R5YB 1SFXA 3DV8A 3KCCA 2GA1A 3BR5A 4OAZA 4CICA 5E1XA 2DFFA 4IHYA 2OV7A 1RPWA 2ZB9A 4EJUA 3JAMK 2R7TA 3MQ0A 4G6QA 4Q47A 5F04A 1RR7A 4Z2YA 4RS8A 1SFEA 3OV8A 5FGMA 1ZRFA 1HOMA 3IKVA 3ERED 5GTHC 1SFOJ 5BQTA 2QYOA 4HX7A 2OUMA 4LIVA 5D8KB 5GAEJ 3OYCA 3O3KA 5IP9J 1FTTA 2D45A 1PP8F 1U3EM 1E17A 2XKOA 2UZKA 1TNSA 4BNCA 3D5RC 3COAC 2DLLA 3WU1B 1N78A 1CQTA 4Q5SF 2PMUA 4LOCA 1WJEA 4D1QA 3TOAA 3ZOBA 2E7WA 1YW8A 4MFDA 3TQNA 4HNVA 2HZTA 2C6YA 2LY2A 1FZPB 3S16J 2K40A 1J0RA 3J80K 5LEJA 4ANJA 4A5MA 3LQQA 2BHYA 2JA6J 1V3FA 1ETXA 1C0WA 4O3MA 2JRTA 4XKWA 4AWXB 3ABLH 1YX3A 2BHZA 5EZHA 3MKZA 1SAUA 1VF9A 3CUQC 3VFZA 4KITB 2FNAA 5FB2A 3RZDJ 3FWEA 4M3FA 4BQNA 3K4LA 1ORKA 2Q2EB 4WX9A 2EIKH 5GAHJ 3TW6A 1E0EA 2RKHA 1YG2A 2QQBA 4X1EA 2B0LA 3TKYA 2DAOA 3T8TA 1TQPA 3AAFA 3DKYA 3B02A 3E6DA 1HC8A 3VB2A 1UELB 3SZTA 4CSWA 4BAYA 1G3YA 2FBKA 4QWQA 2OC6A 4GDFA 2HOTA 3I4MJ 1SFKA 3FF5A 3AG3H 3OS0A 2M4KA 1VQ7I 2QEXI 4U0VA 4J01A 4IOCF 1KA8A 3ZQ7A 3OYLA 3LWFA 2NOGA 1K61A 1ETKA 4AM3A 1LUJB 2AO9A 4CA0A 4LG3A 3M1EA 4ZDLA 3KYLA 1VTNC 2E1OA 2ZXJA 4BE1A 4G8XA 1JHHA 2JN6A 1VQLI 1HLVA 3IC7A 5A2QZ 4BJ6C 1SD4A 3KFWX 2D2WA 3SEQA 1ON1A 5IY5H 2L2OA 2KZGA 2IGOA 3G6EI 3J7ZI 2STWA 1JE8A 3NAUA 4EEFG 2K3PA 5IYBJ 5LEKA 2P5KA 2W48A 1XB4A 3ASOH 1OKRA 4V2FA 2EFWA 4J00A 1WPKA 2VB6A 4ESBA 3DPUA 5LLQA 2EA4A 1WI9A 3QU6A 1BR2A 1QPIA 4LLNA 2FXAA 3RIRA 1D8JA 1ACIA 3J81Z 1TWAJ 1Y8RB 1F9NA 1V55H 1JT6A 1BIBA 2CUFA 3H0GJ 2DMPA 4HQMA 3BR0A 2WAFA 3ZMSA 2WA0A 3BJOA 4LLGF 2VXDA 4LB6B 4ZC3A 3M8FA 4CCLA 3CMEI 5EZGA 2X9DA 4H4KC 1QVTA 4XQFA 2A6HF 1OYYA 3RPUA 1REPC 4M9XA 1SMTA 2XHKA 5JHFA 2ZSIB 2LDUA 5DCFA 2ZBKA 1QVUA 2A07F 4GFBA 1TW3A 2CG4A 2P6TA 1X1BA 2IEKA 3I5UA 1O3QA 4GYGA 2ZNZA 5DEQA 3J7AY 3RTRA 3WE2A 2NS0A 1UHWA 1ZRCA 4JQFA 1I5ZA 3MZ8A 3BY6A 3QYFA 3JRCA 4LMYA 1Q1HA 1XDUA 4Y13A 3BJ6A 3HIFA 4FX0A 2R5ZA 2XSJC 1XGMA 3EUKL 1I39A 3GFJA 1WFXA 3TEDA 1TT5B 1M1EB 5K1YA 1X1CA 3GBGA 4DYCA 5HS7A 5FLMJ 4FTHA 3VEPA 4LGWA 1SEUA 2ID3A 1R36A 3K1NA 3QPTA 3KP2A 1LB2A 4UNOA 1G4DA 3HOYJ 5B3SH 1L0OC 1OCRH 2XROA 4HF2A 3S1NJ 5DS9A 3HXLA 1SVLA 2NOJB 4DJAA 2LTPA 3E5UA 1D3YA 3OIOA 1LEBA 2X6WA 1LJ9A 4HG2A 1A31A 3RQ4A 2PJRA 3L09A 1J2XA 1LVKA 2GIZA 3TL4X 2WWYA 3H3UA 2RAEA 2UXNA 5DD8A 4Y33A 3HKZA 3E5XA 2DFHA 5FO5A 4HSRA 2H6BA 4A3EJ 3HTUA 2Z3YA 3OOUA 1MNDA 1G8XA 2X1EA 5IT9Z 2JK3A 4U0WA 2Y69H 3BROA 1YW9A 1H9TA 1T0FA 3LMMA 3WGGA 3HGGA 3BOQA 4UVCA 1RNLA 3K2AA 4LK0F 4B48A 3VYRB 3L2RA 3OWTA 5J4VA 4A3BJ 2V9VA 2DK5A 2YSRA 4YFKF 3LQRA 4A6EA 1FSEA 1MBFA 4M6VA 5JLWA 1ZLKA 2QBYA 3IRQA 3LSRA 1Z7UA 1WJDA 5F64A 4ZH4F 3HRMA 5TGTA 4XONA 4MEXF 5E18F 3ZMTA 1GHCA 4IX7A 1ON2A 3PSIA 5EYRA 1QRYA 2DYRH 2X1DA 2R92J 2F4IA 3OYDA 1X1PA 1DGRM 3VSLA 5GADJ 2K27A 2DA3A 4KT5C 2HEOA 2H27A 4A3KJ 3JRBA 1ZYRF 4AVPA 2ZMEC 4JX4A 3BTLA 3EPZA 3QQAA 3NWSA 4N4OB 4XOTA 1V5EA 1Y0NA 5L3FA 1AA7A 5ERIA 4KNYA 3A01B 5TISC 3IAM2 3ONQA 1HCRA 3V42A 3BZCA 2Y0SA 3H5RA 4AYBN 4FISA 2BY0A 4AIKA 3BR1A 2KT0A 3PQKA 1LKXA 2H6CA 1W36D 4JX5A 3BCBA 5J8CA 5BNGA 3R61A 2QM3A 4IO9F 3MZHA 3OY9A 3CMMA 1IRXA 1BN5A 2BYVE 2K86A 1N25A 3GTOJ 4L5JA 2Q0OA 3K4BA 3B73A 4BEHA 2G7HA 5K7ZA 2OAZA 3IH4A 5DCMB 4H0EA 4V19K 4E6KG 5E20A 3DEUA 2VN2A 4IJAA 1D0YA 4CZZA 1EH7A 4BH9A 3S2DJ 2HPIA 1I6HJ 2X0LA 4A3DJ 1E3OC 3HOUJ 1XG1A 2IXSA 3BG6A 5LHIA 3JRHA 4OOIA 4EJTA 4ZZLA 1K7AA 2ECBA 2DO7A 2EINH 2K9SA 2O5RA 3E0JB 4B43A 1Z21A 4UB8C 4RGXA 2VE8A 3FISA 4PDKA 2VQHA 2HDWA 2R7DA 3HSFA 1ZRDA 4OIRF 4WXCA 3IH3A 2F5EA 5IP7J 2DODA 1E3HA 1HW2A 4RB1A 4CYCA 3CDLA 1FYMA 2KISA 3HPGA 2CRGA 2OBPA 5DUIA 3O2PE 2WAQA 2QUFA 2HPMA 2HOEA 3V7SA 4IOAF 2K02A 4EM2A 2XGDA 3O8HA 4JBAA 4B44A 2QWWA 1DP7P 4RM3A 2JTVA 4KIFA 4BE2A 2F48A 3FKIJ 1J75A 1A04A 2FOWA 4RGRA 4CO8A 2E35A 1O3RA 4HZFA 1QBJA 2J5OA 3HHHA 2NXNB 3JRDA 2ICWG 4AIHA 1Y8QB 3KYDB 1K83J 4NQWB 4LD5A 3HOSA 2Q8KA 1XCBA 4PSXA 2IA0A 2GBYA 5E8GA 3KPHA 5JVGF 4DOZA 2E1MC 4FE4A 1WJ5A 3DBHB 2F4MB 4E7HA 5FFZA 2X1CA 2CYYA 2X4HA 2R7SA 1KONA 5IYCJ 3TDUC 3OYMA 2EBIA 5DM7F 3HEFA 2CW7A 4RLQA
chains in the Genus database with same CATH topology
1ZARA 1R1VA 4G7ZF 3CUQB 5E8IA 1IW7F 4IHSA 2NAZA 3QAHA 1IXRC 5BPDA 2KIMA 2IJLA 1STZA 4HX4A 2HFHA 5CVIA 3HYIA 2IA2A 1DPRA 1MDMB 3U1DA 2O8XA 4ZYHA 2VONA 3EETA 3VODA 2FU4A 4WF2A 5HS9A 1B9MA 3RYRA 5CLSA 1FNNA 3KZZA 4RB2C 1AWCA 2A61A 1W5TA 2XGXA 3TGNA 4YG2F 4P5OA 2FA5A 4HBLA 3I4PA 3F8NA 2AXLA 3ECHA 1K79A 1XGNA 3MZYA 1YS7A 1WSUA 5ICCA 4N0BA 2HQNA 2A5YB 2RC4A 2EFOA 4PZJA 3ZPLA 5DDGA 4A2UA 2CQKA 2OA4A 3I71A 3HUGA 1ZG1A 2P5VA 2YR2A 4KA4A 4ESFA 2V79A 3J7AO 2HGCA 1XGOA 1IN4A 3FMRA 3I53A 4DQ2A 2GA2A 1YFHA 1IXSB 3GO5A 3SZPA 2PQ8A 4ASNA 4I01A 5CVVA 1R5HA 4BHPA 5LHGA 1MD0A 1O3SA 2M45A 1YTYA 2A68F 2L01A 3E6CC 5E17F 4ENKA 3K1PA 3P7NA 3FM3A 2CW0F 3Q9SA 5ICEA 1LQ1A 3C3WA 3I54A 3EDPA 4HLXA 4KMFA 1S3JA 2GWRA 2FRHA 2KRFA 1XSXA 3QP6A 2IW5A 2M8EA 4RAZA 4HV5A 5BOXA 2IT0A 1MZBA 3GVAA 2JT1A 5DV5A 4L0YB 4BQAA 1QPMA 4AIJA 1YW7A 4O6JA 2HYGD 3L9FA 1BIAA 3D5LA 2CO5A 3KP3A 2GAUA 2EA2A 1U2WA 1F1ZA 2P6SA 2VBWA 2ISYA 2FNPA 1XCVA 1PP7U 1IN7A 1SMYF 4B8XA 5D4RA 4I7HA 1TW2A 4R79A 3WTSC 2P4WA 4WXDA 1RZ4A 1HW5A 2RV8A 5DD4A 1SD7A 3T5XA 3GEZA 2L4AA 4M74A 2A6EF 1FPQA 2V1XA 1SD5A 2H09A 2M30A 1FYKA 3O6BB 1MKMA 5FFXA 2P8TA 3WTUC 1V4RA 1F5TA 5LRRA 3GYHX 3HSRA 4KUMA 3Q5FA 3I0TA 2ZMEB 3RKXA 3RKYA 1AOYA 1OPCA 4KICA 6PAXA 5JI6A 1U5TA 1T2KA 5LHHA 1QZYA 2HYFA 1FP2A 1LDKB 1S6LA 4HV6A 2PEXA 2PBIA 4RAYA 5KK1A 5D4SA 3BJAA 4OIQF 2V1DA 3BWGA 5D8LB 2L4MA 2O6GE 3GW2A 3N97A 1YYVA 4KIBA 5CVUA 3KP6A 2LKPA 4G6DA 3EQLF 1J5YA 3BPXA 4UVAA 4RB3C 2Z5UA 4ZYDA 1O3TA 1GXQA 3MCZA 1FC3A 3ISPA 3FZVA 3WTTC 3IHUA 2PJPA 3ZMDA 1FBUA 5AIPA 5BS6A 2ESHA 2DT5A 5JHUA 2GZWA 5D5WB 2VOPA 2ELHA 3FX3A 2E1CA 1USTA 3EUHA 4PGGA 2YX7A 1FT9A 5CVRA 3KLNA 1ZREA 2MC3A 2ESNA 3RKWA 5HLIA 2ZO4A 2NNYA 4M73A 2ZKZA 3NEUA 4UV9A 3LFKA 3GZ6A 1JHFA 1JXSA 2WV0A 4HF0A 4ESJA 1R23A 3NQOA 4DNCA 4IXAA 3GXOA 1BOAA 4KMUX 4L0ZB 4M9SA 2L02A 1H9GA 4LFUA 3KZYA 1KYZA 3I64A 4IRHA 1QZZA 2OD5A 3PQJA 1TTYA 4RGSA 3ZMZA 1RI7A 5H6RA 1J9IA 4YIIA 5ILUA 5L3EA 3KETA 2VODA 2MH2A 4HAMA 3I59A 3Q9VA 2XASA 1WQ2A 2E7XA 3ZP5A 4G7HF 1KU9A 1BM9A 3F8FA 2NRAC 4CXFA 1HXDA 2DI3A 3IL2A 3DPLC 5H6QA 2G7UA 2DFIA 3WTYC 4UVBA 2K4BA 2GXBA 1LDDA 3KP7A 3NRVA 3JTHA 1G3WA 5F6FA 1XDSA 2K7LA 1KU3A 1YO5C 4JK1X 4LG0A 5L3GA 3M8EA 3DP7A 3ML6A 2D1VA 3F72A 3M7GA 1BI3A 5D6FA 5LGTA 2M87A 1LVAA 3WU0A 2VE9A 1XMKA 3TO7A 3V8JA 2W25A 2OZ6A 5D5VB 4U88A 2RN7A 2XAJA 4OMYA 4BXUA 1W4MA 5A2QK 2P7VB 4L18B 2IVMA 1R22A 3WG9A 3H3ZA 4CYDA 1U8RA 1HW1A 3G3ZA 2FE3A 4GCVA 3U9GA 4MQVA 4L5IA 2XAHA 3J81K 3DF8A 2STTA 1R58A 2P5LC 1QGPA 2UWMA 3HRUA 3C18A 5IT3A 2HKXA 1Z05A 2CWEA 2QBYB 3HTSB 1G3TA 1GVJA 2QVOA 5HLHA 1H0MA 2QQ9A 3KEOA 4GYIA 4UHTA 2VOOA 2VBXA 1XSDA 3LA3A 5JR3A 2MLKA 1HSTA 4KN4X 4D0PA 2QQAA 1T6SA 1U5TC 2ISZA 2KJCA 1XSVA 4HF1A 1W7PD 1GXPA 1Z9CA 3RYPA 4GXOA 4I0AA 3FXRA 2ZJ2A 2XV4S 3F8MA 5ILVA 3CJNA 3IKTA 2YPRA 2HWVA 4EJWA 5BPIA 4FHTA 2RNJA 3GZ5A 3LSTA 1YIOA 2PLYA 1KGSA 3FMSA 4LB5A 2Y48A 3REOA 2GQQA 4AD9A 1YQAA 4MNUA 3H92A 2FF4A 1K78A 1B59A 4XLNF 2VT2A 5IT9K 4LLLA 4ENNA 2JPBA 2KJBA 5L3CA 3F8BA 4ENMA 4P9UA 3HRTA 2XKPA 2A69F 1ZG5A 4EVIA 2KKOA 3ZMVA 5FLXZ 3RPQA 2VC0A 4MHGA 4IRIA 1MJAA 1W7PA 1WRJA 1J59A 1L3LA 4LK1F 3MAJA 2BEOA 1XGSA 3ABUA 3T1BA 3K9TA 3N4MA 2RDPA 3GF2A 1IRFA 3MFKA 1HKQA 3DXJF 2NYXA 3K2ZA 1ZAOA 5LBQA 1LDJA 3BDDA 3F8CA 2AS5F 4GO1A 2FEZA 4HLYA 2PN6A 4WXHA 4WCGA 5CJ9A 2J5PA 1K6OA 2A3SA 4ZYGA 4A5NA 1DDNA 3CTAA 1FY7A 3GFMA 1CF7A 3KE2A 4YFXF 5J8FA 2DQLA 3WTZA 2FBIA 1FX7A 3TO6A 1DPUA 4HX8A 2M5WA 2HR3A 2VBYA 3JAMZ 4XSZF 4MTDA 3R6SA 2V6CA 2O61A 2CGPA 4R8HA 2JZYA 2DBBA 4UV8A 4YFNF 4EMSA 1Z1DA 3K1MA 1SD6A 3ZN0A 2EFPA 2XAFA 2H94A 2GIVA 3D0SA 4I09A 2TDXA 3LA2A 3J80Z 5K5QA 2FMYA 1R1UA 1IN8A 2WTEA 4FT8A 4Y15A 5LGUA 5HDNA 3SXYA 3KEQA 1KQ0A 1G6NA 1UCRA 3HSEA 4HW0A 5HDKA 1ZH5A 1QO0D 3E97A 2WC2A 2HS5A 3V8KA 1IF1A 3W6JB 4EM1A 5BMZA 1I6XA 4EV0A 2PMHA 1MJ9A 2EK5A 3E6MA 5CYVA 4MQ9F 4KIGA 4E70A 5D5UB 3FXQA 2L3DA 1ZG3A 3FHZA 1B4AA 1FOKA 2ETHA 4L9TA 2HTSA 4BYYA 4HYEA 4M72A 3CLOA 3DFGA 1DUXC 3W6KB 3JW4A 4EGZA 2EV0A 2K4JA 4G94A 1BI0A 2Z9OA 5ED4A 2MLGA 1KQ9A 2DW4A 2YU3A 4M71A 3QRFF 4OU0A 1TNTA 4M6YA 1XN7A 4HDUA 1I1SA 2BGCA 5KVRA 1FBQA 4NB5A 1PUEE 1T98A 2UXXA 4CGZA 4HOBA 3ECOA 3U2RA 4YIFA 1YLFA 3CUOA 1YS6A 2COMA 4S05A 3RI4A 2EFQA 2Q2EA 2XIGA 1O7LA 4EJVA 1T38A 4QLCU 4B09A 5LGNA 3DQVC 2V1UA 3WTXC 1XMAA 2O03A 2XUBA 1P6RA 1U5TB 5EEGA 1I1GA 1RUOA 1BI2A 1R5GA 1OR7A 2F5FA 3RDIA 1B1BA 3WGIA 3V8LA 2R3SA 5TRDA 2XRNA 3SQNA 3PFIA 2F5CA 2XAQA 4I0BA 4OINF 1W5SA 2L54A 1X3UA 4P9FA 4WK8F 4EGYA 1RIOH 2XAGA 4A0ZA 4P96A 3DKWA 1KYWA 2KIFA 3I58A 3F22A 1B9NA 1P92A 2DK8A 1HBXG 4XLPF 2F5DA 1D5VA 4BHCA 3S2WA 1P4WA 1R7JA 1XD7A 3FMQA 1MGTA 2FMLA 3QP5A 2LF7A 4ON0A 4Y17A 4EM0B 1ZN2A 4K2EA 1TQIA 1HKSA 2LF8A 2PG4A 3P9KA 4O5VA 4P55A 5HDGA 2EWNA 4UUVA 1EV7A 4MTEA 5DUKA 3ULQB 4UXNA 1LEAA 5J6XA 3EYIA 1O7FA 1CGPA 1ULYA 4S04A 5E1ZB 3P9IA 2LSOA 4IRGA 5TJJA 1R00A 4LJZF 2M1BA 4U0YA 1Y0UA 3GLXA 1WWXA 3C7JA 5AONA 1HQCA 1S29A 3F6OA 3GFLA 4U7BA 1BBYA 3L00A 1MJBA 1EH6A 3R4KA 1Z91A 5L3DA 2DPUA 1IN6A 3WTVC 4WWCA 2RVCA 2FSWA 3I59B 3K0LA 1FP1D 1QNTA 3HOTA 4N9IA 2QZ8A 1IUYA 3CO6C 1ODDA 2IRFG 4KYWA 4OIPF 3JSPA 3ZN1A 1IRGA 4G7OF 4BHBA 1P4XA 3IWZA 2HQRA 2Y75A 1ZGJA 3C1DA 3LAPA 1SFUA 3R60A 4XRFA 4IPAA 2BBYA 1U78A 5D5XB 2G9WA 1IAWA 4LG0B 2VXZA 4HDVA 3F23A 2F2EA 4KFCA 4TV7A 5LRSA 5ILSA 1Z6RA 2PFBA 5HLGA 2FOKA 4RB0A 3E5QA 5K5RA 2QENA 1BC8C 5CVJA 3SFZA 5HVQC 2OU2A 2ZCWA 3IWFA 3DPTA 4A0XA 5DCMA 3CO7C 1IZ1A 3IRRA 4L9JA 4XBFA 3WGHA 4G9YA 2EJRA 1HSJA 2IA1A 4CHUA 2W57A 3LA7A 3L2CA 4EJOA 3E3VA 1B6AA 3KP5A 4R1HA 2JSCA 2EB7A 1J7KA 4L9VA 2O3FA 5AIQA 1FBSA 1PDNC 1S7OA 4A12A 2E1NA 3V7RA 1BC7C 2P7CB 4MEYF 3E6BA 2VT3A 1TLHB 2CFXA 2ADUA 3K69A 3L7WA 1RUNA 1Z6TA 3G73A 1WKMA 3M9AA 4I2OA 4NHJA 3KP4A 4N9HA 3WE3A 4CDGA 3TO9A 3QOPA 1TQMA 4NQWA 2R7FA 1OYIA 4A6DA 2NNNA 2W84A 1BJAA 1KQ8A 2EV5A 1P2FA 3JTGA 3ABTA 1F4KA 4ZYEA 3P9CA 2JPCA 2FQ3A 3BP8A 3WODF 1OYWA 1R1TA 3HRSA 2VBZA 3CUQA 2OQGA 4EQQA 2W85A 4OMZA 2OQRA 3BPVA 4ENJA 4XSXF 3V7CA 2HKOA 2YX4A 3ROUA 3HHGA 1FWZA 1MDMA 2PI0A 1G3SA 1UHMA 2D1HA 1K78B 2MA3A 5E1WA 3ZMUA 2RQPA 2EFNA 3MWMA 3OOPA 5DYMA 3GX4X 1EH8A 3TDZC 1T39A 2W24A 1JGSA 1S7AA 3SHFA 2O0YA 3R0AA 4FX4A 1ZGAA 3KLOA 3FXUA 2EV6A 4ZZDA 1OMIA 4A0YA 1W7PB 2DTRA 1UB9A 2HTJA 4MGRA 2XVCA 5D6EA 2ZNYA 1LNWA 3RJPA 5H20A 1BI1A 4ETSA 2MBFA 1IN5A 1UFMA 4HQEA 2GXGA 1KU7A 5FD6A 5L3BA 2QLZA 5JFRA 3BZ6A 4GGGA 3F21A 4U7DA 2ACJA 2BE5F 2HDCA 4Q4ZF 1P4AA 3CDHA 2BV6A 4HA8A 3V4GA 5K5OA 3LAJA 4F7ZA 2LNBA 3MEXA 4PCQA 3JSOA 3VOEA 4KN7X 3ELKA 1QQIA 2Z33A 5ICFA 4IHTA 1ZLJA 2FBHA 3FM5A 5HS8A 1I27A 1TBXA 2CSOA 3QU3A 2DPDA 1CF7B 1O57A 3F6VA 3R0JA 2IPQX 4IVNA 2Y0MA 5F1RA 4PGHA 2KIUA 1ZHFA 4RGUA 5JVTA 2ZFWA 3GFIA 3T0YA 1D8KA 3TOBA 1FLIA 1E2XA 2Z99A 4I98B 5HOOA 1HKTA 2MD5A 5FLXK 1KU2A 5FD5A 4KDPA 3F3XA 2RGVA 1S8NA 3WTWC 1FSHA 4OIOF 4M9ZA 1ONVA 1USSA 4L9NA 2OZUA 2IP2A 5ICGA 4IF4A 3GWZA 2DU9A 2MH9A 4Q48A 2DQRA 3T8RA 1IXCA 1NHAA 2VC1A 1SAXA 1FYLA 5EEHA 2ZMEA 3EYYA 4M6XA 4I02A 1U6GA 3QPHA 3GUDA 1SFXA 3DV8A 3KCCA 2GA1A 4CICA 5E1XA 4EJUA 3JAMK 3MQ0A 4G6QA 4Q47A 4Z2YA 4RS8A 1SFEA 3OV8A 5FGMA 1ZRFA 3IKVA 3ERED 5BQTA 2QYOA 4HX7A 5D8KB 3O3KA 2D45A 1PP8F 1U3EM 1E17A 2XKOA 2UZKA 1TNSA 4BNCA 3COAC 2DLLA 3WU1B 4Q5SF 2PMUA 3TOAA 2E7WA 1YW8A 3TQNA 2HZTA 2C6YA 1FZPB 1J0RA 3J80K 5LEJA 4A5MA 3LQQA 1V3FA 1C0WA 4O3MA 2JRTA 4AWXB 3VFZA 3CUQC 2FNAA 5FB2A 3FWEA 4WX9A 2RKHA 1YG2A 2QQBA 2B0LA 3TKYA 2DAOA 3T8TA 1TQPA 3AAFA 3B02A 3E6DA 3VB2A 3SZTA 4BAYA 1G3YA 2FBKA 4QWQA 3FF5A 4U0VA 1KA8A 3ZQ7A 3LWFA 3M1EA 1VTNC 2ZXJA 4G8XA 1JHHA 3IC7A 5A2QZ 1SD4A 3KFWX 2D2WA 1ON1A 2STWA 1JE8A 5LEKA 2P5KA 1XB4A 1OKRA 2EFWA 4ESBA 5LLQA 2EA4A 1WI9A 3QU6A 4LLNA 2FXAA 3RIRA 1D8JA 3J81Z 1F9NA 1BIBA 4HQMA 3ZMSA 3BJOA 4LLGF 4LB6B 3M8FA 2A6HF 1OYYA 3RPUA 1REPC 4M9XA 1SMTA 2XHKA 5DCFA 2LDUA 2A07F 2ZBKA 1TW3A 2CG4A 2P6TA 3I5UA 1O3QA 4GYGA 2ZNZA 5DEQA 3RTRA 3WE2A 2NS0A 1UHWA 1ZRCA 4JQFA 1I5ZA 3BY6A 4LMYA 1Q1HA 1XDUA 4Y13A 3BJ6A 3HIFA 4FX0A 1XGMA 3GFJA 5K1YA 5HS7A 3VEPA 4LGWA 1R36A 3K1NA 3QPTA 3KP2A 1LB2A 4UNOA 1G4DA 1L0OC 2XROA 4HF2A 3E5UA 1D3YA 1LEBA 1LJ9A 3L09A 1J2XA 2WWYA 3H3UA 2UXNA 5DD8A 5FO5A 3E5XA 2H6BA 3HTUA 2Z3YA 5IT9Z 4U0WA 3BROA 1YW9A 1H9TA 1T0FA 3WGGA 3BOQA 4UVCA 1RNLA 4LK0F 2V9VA 2DK5A 2YSRA 4YFKF 3LQRA 4A6EA 1FSEA 1ZLKA 2QBYA 3IRQA 1Z7UA 5F64A 4ZH4F 3HRMA 4MEXF 5E18F 3ZMTA 1GHCA 1ON2A 2K27A 4KT5C 2HEOA 2H27A 1ZYRF 4AVPA 5L3FA 5ERIA 4KNYA 4AIKA 3PQKA 2H6CA 5J8CA 3R61A 2QM3A 3MZHA 1BN5A 2BYVE 2K86A 4L5JA 2Q0OA 3B73A 2G7HA 2OAZA 5DCMB 4H0EA 5E20A 3DEUA 2VN2A 4IJAA 4CZZA 1EH7A 4BH9A 2X0LA 5LHIA 4OOIA 4EJTA 4ZZLA 1K7AA 2DO7A 4RGXA 2VE8A 4PDKA 2R7DA 3HSFA 1ZRDA 4OIRF 4WXCA 2F5EA 1HW2A 4RB1A 1FYMA 2OBPA 5DUIA 3O2PE 2QUFA 2HOEA 3V7SA 2K02A 4EM2A 4JBAA 2QWWA 1DP7P 2JTVA 4KIFA 1J75A 1A04A 4RGRA 4CO8A 1O3RA 4HZFA 1QBJA 2J5OA 3HHHA 4AIHA 4LD5A 3HOSA 2Q8KA 1XCBA 2IA0A 5E8GA 5FFZA 2CYYA 2X4HA 3TDUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAR A;  1R1V A;  4G7Z F;  3CUQ B;  5E8I A;  1IW7 F;  4IHS A;  2NAZ A;  3QAH A;  1IXR C;  5BPD A;  2KIM A;  2IJL A;  1STZ A;  4HX4 A;  2HFH A;  5CVI A;  3HYI A;  2IA2 A;  1DPR A;  1MDM B;  3U1D A;  2O8X A;  4ZYH A;  2VON A;  3EET A;  3VOD A;  2FU4 A;  4WF2 A;  5HS9 A;  1B9M A;  3RYR A;  5CLS A;  1FNN A;  3KZZ A;  4RB2 C;  1AWC A;  2A61 A;  1W5T A;  2XGX A;  3TGN A;  4YG2 F;  4P5O A;  2FA5 A;  4HBL A;  3I4P A;  3F8N A;  2AXL A;  3ECH A;  1K79 A;  1XGN A;  3MZY A;  1YS7 A;  1WSU A;  5ICC A;  4N0B A;  2HQN A;  2A5Y B;  2RC4 A;  2EFO A;  4PZJ A;  3ZPL A;  5DDG A;  4A2U A;  2CQK A;  2OA4 A;  3I71 A;  3HUG A;  1ZG1 A;  2P5V A;  2YR2 A;  4KA4 A;  4ESF A;  2V79 A;  3J7A O;  2HGC A;  1XGO A;  1IN4 A;  3FMR A;  3I53 A;  4DQ2 A;  2GA2 A;  1YFH A;  1IXS B;  3GO5 A;  3SZP A;  2PQ8 A;  4ASN A;  4I01 A;  5CVV A;  1R5H A;  4BHP A;  5LHG A;  1MD0 A;  1O3S A;  2M45 A;  1YTY A;  2A68 F;  2L01 A;  3E6C C;  5E17 F;  4ENK A;  3K1P A;  3P7N A;  3FM3 A;  2CW0 F;  3Q9S A;  5ICE A;  1LQ1 A;  3C3W A;  3I54 A;  3EDP A;  4HLX A;  4KMF A;  1S3J A;  2GWR A;  2FRH A;  2KRF A;  1XSX A;  3QP6 A;  2IW5 A;  2M8E A;  4RAZ A;  4HV5 A;  5BOX A;  2IT0 A;  1MZB A;  3GVA A;  2JT1 A;  5DV5 A;  4L0Y B;  4BQA A;  1QPM A;  4AIJ A;  1YW7 A;  4O6J A;  2HYG D;  3L9F A;  1BIA A;  3D5L A;  2CO5 A;  3KP3 A;  2GAU A;  2EA2 A;  1U2W A;  1F1Z A;  2P6S A;  2VBW A;  2ISY A;  2FNP A;  1XCV A;  1PP7 U;  1IN7 A;  1SMY F;  4B8X A;  5D4R A;  4I7H A;  1TW2 A;  4R79 A;  3WTS C;  2P4W A;  4WXD A;  1RZ4 A;  1HW5 A;  2RV8 A;  5DD4 A;  1SD7 A;  3T5X A;  3GEZ A;  2L4A A;  4M74 A;  2A6E F;  1FPQ A;  2V1X A;  1SD5 A;  2H09 A;  2M30 A;  1FYK A;  3O6B B;  1MKM A;  5FFX A;  2P8T A;  3WTU C;  1V4R A;  1F5T A;  5LRR A;  3GYH X;  3HSR A;  4KUM A;  3Q5F A;  3I0T A;  2ZME B;  3RKX A;  3RKY A;  1AOY A;  1OPC A;  4KIC A;  6PAX A;  5JI6 A;  1U5T A;  1T2K A;  5LHH A;  1QZY A;  2HYF A;  1FP2 A;  1LDK B;  1S6L A;  4HV6 A;  2PEX A;  2PBI A;  4RAY A;  5KK1 A;  5D4S A;  3BJA A;  4OIQ F;  2V1D A;  3BWG A;  5D8L B;  2L4M A;  2O6G E;  3GW2 A;  3N97 A;  1YYV A;  4KIB A;  5CVU A;  3KP6 A;  2LKP A;  4G6D A;  3EQL F;  1J5Y A;  3BPX A;  4UVA A;  4RB3 C;  2Z5U A;  4ZYD A;  1O3T A;  1GXQ A;  3MCZ A;  1FC3 A;  3ISP A;  3FZV A;  3WTT C;  3IHU A;  2PJP A;  3ZMD A;  1FBU A;  5AIP A;  5BS6 A;  2ESH A;  2DT5 A;  5JHU A;  2GZW A;  5D5W B;  2VOP A;  2ELH A;  3FX3 A;  2E1C A;  1UST A;  3EUH A;  4PGG A;  2YX7 A;  1FT9 A;  5CVR A;  3KLN A;  1ZRE A;  2MC3 A;  2ESN A;  3RKW A;  5HLI A;  2ZO4 A;  2NNY A;  4M73 A;  2ZKZ A;  3NEU A;  4UV9 A;  3LFK A;  3GZ6 A;  1JHF A;  1JXS A;  2WV0 A;  4HF0 A;  4ESJ A;  1R23 A;  3NQO A;  4DNC A;  4IXA A;  3GXO A;  1BOA A;  4KMU X;  4L0Z B;  4M9S A;  2L02 A;  1H9G A;  4LFU A;  3KZY A;  1KYZ A;  3I64 A;  4IRH A;  1QZZ A;  2OD5 A;  3PQJ A;  1TTY A;  4RGS A;  3ZMZ A;  1RI7 A;  5H6R A;  1J9I A;  4YII A;  5ILU A;  5L3E A;  3KET A;  2VOD A;  2MH2 A;  4HAM A;  3I59 A;  3Q9V A;  2XAS A;  1WQ2 A;  2E7X A;  3ZP5 A;  4G7H F;  1KU9 A;  1BM9 A;  3F8F A;  2NRA C;  4CXF A;  1HXD A;  2DI3 A;  3IL2 A;  3DPL C;  5H6Q A;  2G7U A;  2DFI A;  3WTY C;  4UVB A;  2K4B A;  2GXB A;  1LDD A;  3KP7 A;  3NRV A;  3JTH A;  1G3W A;  5F6F A;  1XDS A;  2K7L A;  1KU3 A;  1YO5 C;  4JK1 X;  4LG0 A;  5L3G A;  3M8E A;  3DP7 A;  3ML6 A;  2D1V A;  3F72 A;  3M7G A;  1BI3 A;  5D6F A;  5LGT A;  2M87 A;  1LVA A;  3WU0 A;  2VE9 A;  1XMK A;  3TO7 A;  3V8J A;  2W25 A;  2OZ6 A;  5D5V B;  4U88 A;  2RN7 A;  2XAJ A;  4OMY A;  4BXU A;  1W4M A;  5A2Q K;  2P7V B;  4L18 B;  2IVM A;  1R22 A;  3WG9 A;  3H3Z A;  4CYD A;  1U8R A;  1HW1 A;  3G3Z A;  2FE3 A;  4GCV A;  3U9G A;  4MQV A;  4L5I A;  2XAH A;  3J81 K;  3DF8 A;  2STT A;  1R58 A;  2P5L C;  1QGP A;  2UWM A;  3HRU A;  3C18 A;  5IT3 A;  2HKX A;  1Z05 A;  2CWE A;  2QBY B;  3HTS B;  1G3T A;  1GVJ A;  2QVO A;  5HLH A;  1H0M A;  2QQ9 A;  3KEO A;  4GYI A;  4UHT A;  2VOO A;  2VBX A;  1XSD A;  3LA3 A;  5JR3 A;  2MLK A;  1HST A;  4KN4 X;  4D0P A;  2QQA A;  1T6S A;  1U5T C;  2ISZ A;  2KJC A;  1XSV A;  4HF1 A;  1W7P D;  1GXP A;  1Z9C A;  3RYP A;  4GXO A;  4I0A A;  3FXR A;  2ZJ2 A;  2XV4 S;  3F8M A;  5ILV A;  3CJN A;  3IKT A;  2YPR A;  2HWV A;  4EJW A;  5BPI A;  4FHT A;  2RNJ A;  3GZ5 A;  3LST A;  1YIO A;  2PLY A;  1KGS A;  3FMS A;  4LB5 A;  2Y48 A;  3REO A;  2GQQ A;  4AD9 A;  1YQA A;  4MNU A;  3H92 A;  2FF4 A;  1K78 A;  1B59 A;  4XLN F;  2VT2 A;  5IT9 K;  4LLL A;  4ENN A;  2JPB A;  2KJB A;  5L3C A;  3F8B A;  4ENM A;  4P9U A;  3HRT A;  2XKP A;  2A69 F;  1ZG5 A;  4EVI A;  2KKO A;  3ZMV A;  5FLX Z;  3RPQ A;  2VC0 A;  4MHG A;  4IRI A;  1MJA A;  1W7P A;  1WRJ A;  1J59 A;  1L3L A;  4LK1 F;  3MAJ A;  2BEO A;  1XGS A;  3ABU A;  3T1B A;  3K9T A;  3N4M A;  2RDP A;  3GF2 A;  1IRF A;  3MFK A;  1HKQ A;  3DXJ F;  2NYX A;  3K2Z A;  1ZAO A;  5LBQ A;  1LDJ A;  3BDD A;  3F8C A;  2AS5 F;  4GO1 A;  2FEZ A;  4HLY A;  2PN6 A;  4WXH A;  4WCG A;  5CJ9 A;  2J5P A;  1K6O A;  2A3S A;  4ZYG A;  4A5N A;  1DDN A;  3CTA A;  1FY7 A;  3GFM A;  1CF7 A;  3KE2 A;  4YFX F;  5J8F A;  2DQL A;  3WTZ A;  2FBI A;  1FX7 A;  3TO6 A;  1DPU A;  4HX8 A;  2M5W A;  2HR3 A;  2VBY A;  3JAM Z;  4XSZ F;  4MTD A;  3R6S A;  2V6C A;  2O61 A;  2CGP A;  4R8H A;  2JZY A;  2DBB A;  4UV8 A;  4YFN F;  4EMS A;  1Z1D A;  3K1M A;  1SD6 A;  3ZN0 A;  2EFP A;  2XAF A;  2H94 A;  2GIV A;  3D0S A;  4I09 A;  2TDX A;  3LA2 A;  3J80 Z;  5K5Q A;  2FMY A;  1R1U A;  1IN8 A;  2WTE A;  4FT8 A;  4Y15 A;  5LGU A;  5HDN A;  3SXY A;  3KEQ A;  1KQ0 A;  1G6N A;  1UCR A;  3HSE A;  4HW0 A;  5HDK A;  1ZH5 A;  1QO0 D;  3E97 A;  2WC2 A;  2HS5 A;  3V8K A;  1IF1 A;  3W6J B;  4EM1 A;  5BMZ A;  1I6X A;  4EV0 A;  2PMH A;  1MJ9 A;  2EK5 A;  3E6M A;  5CYV A;  4MQ9 F;  4KIG A;  4E70 A;  5D5U B;  3FXQ A;  2L3D A;  1ZG3 A;  3FHZ A;  1B4A A;  1FOK A;  2ETH A;  4L9T A;  2HTS A;  4BYY A;  4HYE A;  4M72 A;  3CLO A;  3DFG A;  1DUX C;  3W6K B;  3JW4 A;  4EGZ A;  2EV0 A;  2K4J A;  4G94 A;  1BI0 A;  2Z9O A;  5ED4 A;  2MLG A;  1KQ9 A;  2DW4 A;  2YU3 A;  4M71 A;  3QRF F;  4OU0 A;  1TNT A;  4M6Y A;  1XN7 A;  4HDU A;  1I1S A;  2BGC A;  5KVR A;  1FBQ A;  4NB5 A;  1PUE E;  1T98 A;  2UXX A;  4CGZ A;  4HOB A;  3ECO A;  3U2R A;  4YIF A;  1YLF A;  3CUO A;  1YS6 A;  2COM A;  4S05 A;  3RI4 A;  2EFQ A;  2Q2E A;  2XIG A;  1O7L A;  4EJV A;  1T38 A;  4QLC U;  4B09 A;  5LGN A;  3DQV C;  2V1U A;  3WTX C;  1XMA A;  2O03 A;  2XUB A;  1P6R A;  1U5T B;  5EEG A;  1I1G A;  1RUO A;  1BI2 A;  1R5G A;  1OR7 A;  2F5F A;  3RDI A;  1B1B A;  3WGI A;  3V8L A;  2R3S A;  5TRD A;  2XRN A;  3SQN A;  3PFI A;  2F5C A;  2XAQ A;  4I0B A;  4OIN F;  1W5S A;  2L54 A;  1X3U A;  4P9F A;  4WK8 F;  4EGY A;  1RIO H;  2XAG A;  4A0Z A;  4P96 A;  3DKW A;  1KYW A;  2KIF A;  3I58 A;  3F22 A;  1B9N A;  1P92 A;  2DK8 A;  1HBX G;  4XLP F;  2F5D A;  1D5V A;  4BHC A;  3S2W A;  1P4W A;  1R7J A;  1XD7 A;  3FMQ A;  1MGT A;  2FML A;  3QP5 A;  2LF7 A;  4ON0 A;  4Y17 A;  4EM0 B;  1ZN2 A;  4K2E A;  1TQI A;  1HKS A;  2LF8 A;  2PG4 A;  3P9K A;  4O5V A;  4P55 A;  5HDG A;  2EWN A;  4UUV A;  1EV7 A;  4MTE A;  5DUK A;  3ULQ B;  4UXN A;  1LEA A;  5J6X A;  3EYI A;  1O7F A;  1CGP A;  1ULY A;  4S04 A;  5E1Z B;  3P9I A;  2LSO A;  4IRG A;  5TJJ A;  1R00 A;  4LJZ F;  2M1B A;  4U0Y A;  1Y0U A;  3GLX A;  1WWX A;  3C7J A;  5AON A;  1HQC A;  1S29 A;  3F6O A;  3GFL A;  4U7B A;  1BBY A;  3L00 A;  1MJB A;  1EH6 A;  3R4K A;  1Z91 A;  5L3D A;  2DPU A;  1IN6 A;  3WTV C;  4WWC A;  2RVC A;  2FSW A;  3I59 B;  3K0L A;  1FP1 D;  1QNT A;  3HOT A;  4N9I A;  2QZ8 A;  1IUY A;  3CO6 C;  1ODD A;  2IRF G;  4KYW A;  4OIP F;  3JSP A;  3ZN1 A;  1IRG A;  4G7O F;  4BHB A;  1P4X A;  3IWZ A;  2HQR A;  2Y75 A;  1ZGJ A;  3C1D A;  3LAP A;  1SFU A;  3R60 A;  4XRF A;  4IPA A;  2BBY A;  1U78 A;  5D5X B;  2G9W A;  1IAW A;  4LG0 B;  2VXZ A;  4HDV A;  3F23 A;  2F2E A;  4KFC A;  4TV7 A;  5LRS A;  5ILS A;  1Z6R A;  2PFB A;  5HLG A;  2FOK A;  4RB0 A;  3E5Q A;  5K5R A;  2QEN A;  1BC8 C;  5CVJ A;  3SFZ A;  5HVQ C;  2OU2 A;  2ZCW A;  3IWF A;  3DPT A;  4A0X A;  5DCM A;  3CO7 C;  1IZ1 A;  3IRR A;  4L9J A;  4XBF A;  3WGH A;  4G9Y A;  2EJR A;  1HSJ A;  2IA1 A;  4CHU A;  2W57 A;  3LA7 A;  3L2C A;  4EJO A;  3E3V A;  1B6A A;  3KP5 A;  4R1H A;  2JSC A;  2EB7 A;  1J7K A;  4L9V A;  2O3F A;  5AIQ A;  1FBS A;  1PDN C;  1S7O A;  4A12 A;  2E1N A;  3V7R A;  1BC7 C;  2P7C B;  4MEY F;  3E6B A;  2VT3 A;  1TLH B;  2CFX A;  2ADU A;  3K69 A;  3L7W A;  1RUN A;  1Z6T A;  3G73 A;  1WKM A;  3M9A A;  4I2O A;  4NHJ A;  3KP4 A;  4N9H A;  3WE3 A;  4CDG A;  3TO9 A;  3QOP A;  1TQM A;  4NQW A;  2R7F A;  1OYI A;  4A6D A;  2NNN A;  2W84 A;  1BJA A;  1KQ8 A;  2EV5 A;  1P2F A;  3JTG A;  3ABT A;  1F4K A;  4ZYE A;  3P9C A;  2JPC A;  2FQ3 A;  3BP8 A;  3WOD F;  1OYW A;  1R1T A;  3HRS A;  2VBZ A;  3CUQ A;  2OQG A;  4EQQ A;  2W85 A;  4OMZ A;  2OQR A;  3BPV A;  4ENJ A;  4XSX F;  3V7C A;  2HKO A;  2YX4 A;  3ROU A;  3HHG A;  1FWZ A;  1MDM A;  2PI0 A;  1G3S A;  1UHM A;  2D1H A;  1K78 B;  2MA3 A;  5E1W A;  3ZMU A;  2RQP A;  2EFN A;  3MWM A;  3OOP A;  5DYM A;  3GX4 X;  1EH8 A;  3TDZ C;  1T39 A;  2W24 A;  1JGS A;  1S7A A;  3SHF A;  2O0Y A;  3R0A A;  4FX4 A;  1ZGA A;  3KLO A;  3FXU A;  2EV6 A;  4ZZD A;  1OMI A;  4A0Y A;  1W7P B;  2DTR A;  1UB9 A;  2HTJ A;  4MGR A;  2XVC A;  5D6E A;  2ZNY A;  1LNW A;  3RJP A;  5H20 A;  1BI1 A;  4ETS A;  2MBF A;  1IN5 A;  1UFM A;  4HQE A;  2GXG A;  1KU7 A;  5FD6 A;  5L3B A;  2QLZ A;  5JFR A;  3BZ6 A;  4GGG A;  3F21 A;  4U7D A;  2ACJ A;  2BE5 F;  2HDC A;  4Q4Z F;  1P4A A;  3CDH A;  2BV6 A;  4HA8 A;  3V4G A;  5K5O A;  3LAJ A;  4F7Z A;  2LNB A;  3MEX A;  4PCQ A;  3JSO A;  3VOE A;  4KN7 X;  3ELK A;  1QQI A;  2Z33 A;  5ICF A;  4IHT A;  1ZLJ A;  2FBH A;  3FM5 A;  5HS8 A;  1I27 A;  1TBX A;  2CSO A;  3QU3 A;  2DPD A;  1CF7 B;  1O57 A;  3F6V A;  3R0J A;  2IPQ X;  4IVN A;  2Y0M A;  5F1R A;  4PGH A;  2KIU A;  1ZHF A;  4RGU A;  5JVT A;  2ZFW A;  3GFI A;  3T0Y A;  1D8K A;  3TOB A;  1FLI A;  1E2X A;  2Z99 A;  4I98 B;  5HOO A;  1HKT A;  2MD5 A;  5FLX K;  1KU2 A;  5FD5 A;  4KDP A;  3F3X A;  2RGV A;  1S8N A;  3WTW C;  1FSH A;  4OIO F;  4M9Z A;  1ONV A;  1USS A;  4L9N A;  2OZU A;  2IP2 A;  5ICG A;  4IF4 A;  3GWZ A;  2DU9 A;  2MH9 A;  4Q48 A;  2DQR A;  3T8R A;  1IXC A;  1NHA A;  2VC1 A;  1SAX A;  1FYL A;  5EEH A;  2ZME A;  3EYY A;  4M6X A;  4I02 A;  1U6G A;  3QPH A;  3GUD A;  1SFX A;  3DV8 A;  3KCC A;  2GA1 A;  4CIC A;  5E1X A;  4EJU A;  3JAM K;  3MQ0 A;  4G6Q A;  4Q47 A;  4Z2Y A;  4RS8 A;  1SFE A;  3OV8 A;  5FGM A;  1ZRF A;  3IKV A;  3ERE D;  5BQT A;  2QYO A;  4HX7 A;  5D8K B;  3O3K A;  2D45 A;  1PP8 F;  1U3E M;  1E17 A;  2XKO A;  2UZK A;  1TNS A;  4BNC A;  3COA C;  2DLL A;  3WU1 B;  4Q5S F;  2PMU A;  3TOA A;  2E7W A;  1YW8 A;  3TQN A;  2HZT A;  2C6Y A;  1FZP B;  1J0R A;  3J80 K;  5LEJ A;  4A5M A;  3LQQ A;  1V3F A;  1C0W A;  4O3M A;  2JRT A;  4AWX B;  3VFZ A;  3CUQ C;  2FNA A;  5FB2 A;  3FWE A;  4WX9 A;  2RKH A;  1YG2 A;  2QQB A;  2B0L A;  3TKY A;  2DAO A;  3T8T A;  1TQP A;  3AAF A;  3B02 A;  3E6D A;  3VB2 A;  3SZT A;  4BAY A;  1G3Y A;  2FBK A;  4QWQ A;  3FF5 A;  4U0V A;  1KA8 A;  3ZQ7 A;  3LWF A;  3M1E A;  1VTN C;  2ZXJ A;  4G8X A;  1JHH A;  3IC7 A;  5A2Q Z;  1SD4 A;  3KFW X;  2D2W A;  1ON1 A;  2STW A;  1JE8 A;  5LEK A;  2P5K A;  1XB4 A;  1OKR A;  2EFW A;  4ESB A;  5LLQ A;  2EA4 A;  1WI9 A;  3QU6 A;  4LLN A;  2FXA A;  3RIR A;  1D8J A;  3J81 Z;  1F9N A;  1BIB A;  4HQM A;  3ZMS A;  3BJO A;  4LLG F;  4LB6 B;  3M8F A;  2A6H F;  1OYY A;  3RPU A;  1REP C;  4M9X A;  1SMT A;  2XHK A;  5DCF A;  2LDU A;  2A07 F;  2ZBK A;  1TW3 A;  2CG4 A;  2P6T A;  3I5U A;  1O3Q A;  4GYG A;  2ZNZ A;  5DEQ A;  3RTR A;  3WE2 A;  2NS0 A;  1UHW A;  1ZRC A;  4JQF A;  1I5Z A;  3BY6 A;  4LMY A;  1Q1H A;  1XDU A;  4Y13 A;  3BJ6 A;  3HIF A;  4FX0 A;  1XGM A;  3GFJ A;  5K1Y A;  5HS7 A;  3VEP A;  4LGW A;  1R36 A;  3K1N A;  3QPT A;  3KP2 A;  1LB2 A;  4UNO A;  1G4D A;  1L0O C;  2XRO A;  4HF2 A;  3E5U A;  1D3Y A;  1LEB A;  1LJ9 A;  3L09 A;  1J2X A;  2WWY A;  3H3U A;  2UXN A;  5DD8 A;  5FO5 A;  3E5X A;  2H6B A;  3HTU A;  2Z3Y A;  5IT9 Z;  4U0W A;  3BRO A;  1YW9 A;  1H9T A;  1T0F A;  3WGG A;  3BOQ A;  4UVC A;  1RNL A;  4LK0 F;  2V9V A;  2DK5 A;  2YSR A;  4YFK F;  3LQR A;  4A6E A;  1FSE A;  1ZLK A;  2QBY A;  3IRQ A;  1Z7U A;  5F64 A;  4ZH4 F;  3HRM A;  4MEX F;  5E18 F;  3ZMT A;  1GHC A;  1ON2 A;  2K27 A;  4KT5 C;  2HEO A;  2H27 A;  1ZYR F;  4AVP A;  5L3F A;  5ERI A;  4KNY A;  4AIK A;  3PQK A;  2H6C A;  5J8C A;  3R61 A;  2QM3 A;  3MZH A;  1BN5 A;  2BYV E;  2K86 A;  4L5J A;  2Q0O A;  3B73 A;  2G7H A;  2OAZ A;  5DCM B;  4H0E A;  5E20 A;  3DEU A;  2VN2 A;  4IJA A;  4CZZ A;  1EH7 A;  4BH9 A;  2X0L A;  5LHI A;  4OOI A;  4EJT A;  4ZZL A;  1K7A A;  2DO7 A;  4RGX A;  2VE8 A;  4PDK A;  2R7D A;  3HSF A;  1ZRD A;  4OIR F;  4WXC A;  2F5E A;  1HW2 A;  4RB1 A;  1FYM A;  2OBP A;  5DUI A;  3O2P E;  2QUF A;  2HOE A;  3V7S A;  2K02 A;  4EM2 A;  4JBA A;  2QWW A;  1DP7 P;  2JTV A;  4KIF A;  1J75 A;  1A04 A;  4RGR A;  4CO8 A;  1O3R A;  4HZF A;  1QBJ A;  2J5O A;  3HHH A;  4AIH A;  4LD5 A;  3HOS A;  2Q8K A;  1XCB A;  2IA0 A;  5E8G A;  5FFZ A;  2CYY A;  2X4H A;  3TDU C; 
#chains in the Genus database with same CATH topology
 1VQM I;  1D0X A;  1MMN A;  1ZAR A;  1OIS A;  1QHH D;  3U21 A;  4PSW A;  3OYG A;  2IGN A;  5F0F A;  1R1V A;  2HOS A;  2GOX B;  1R71 A;  4G7Z F;  3CUQ B;  5E8I A;  1IW7 F;  5FKO A;  3TP0 A;  1ENH A;  4IHS A;  1OLT A;  2PX9 A;  3DWL E;  4NDL A;  2NAZ A;  3QAH A;  1IXR C;  5BPD A;  2K9N A;  3BTC A;  1XX5 A;  2KIM A;  2IJL A;  3CF5 F;  1STZ A;  4ABZ A;  4HX4 A;  3OYB A;  2HFH A;  2KZV A;  3I56 I;  2ZXH A;  5CVI A;  1I3Q J;  1GLN A;  1WH5 A;  3FXK A;  2IA2 A;  3HYI A;  3DTI A;  1DPR A;  4XNF A;  3S3N A;  4C3H J;  1MDM B;  3U1D A;  2O8X A;  4ZYH A;  2VPL A;  2VON A;  3EET A;  2CUJ A;  2KFD A;  3VOD A;  2FU4 A;  1U9O A;  3EUA A;  1IDY A;  3ABM H;  4WF2 A;  1WJA A;  3BCA A;  3CJQ B;  2VL8 A;  5HS9 A;  1B9M A;  3RYR A;  5CLS A;  5IOY A;  2EIL H;  3OSF A;  1GV5 A;  1FNN A;  3KZZ A;  4RB2 C;  1AWC A;  3W2A A;  2A61 A;  1W5T A;  2XGX A;  4AID A;  4DGW B;  5J40 A;  3TGN A;  4P5O A;  2FA5 A;  3HC7 A;  4HBL A;  4BJ5 C;  3I4P A;  4YG2 F;  3CES A;  3F8N A;  2AXL A;  1N77 A;  1VQ8 I;  3ECH A;  1K4T A;  1K79 A;  1XGN A;  5FKK A;  2HU9 A;  4V2G A;  3MZY A;  1YS7 A;  1WSU A;  1TWF J;  5ICC A;  4N0B A;  2XB0 X;  2HQN A;  1ETV A;  3H1C A;  2A5Y B;  2DA5 A;  2RC4 A;  2K3F A;  4DYQ A;  2EFO A;  1H8A C;  4PZJ A;  3ZPL A;  5DDG A;  2GXA A;  4A2U A;  1MMG A;  2CQK A;  2OA4 A;  4HPQ A;  2ME0 A;  2LVS A;  3I71 A;  3HUG A;  1ZG1 A;  2E5N A;  2P5V A;  2YR2 A;  1WJB A;  4KA4 A;  4ESF A;  2LH9 A;  1HDD C;  3KZI C;  2V79 A;  3RKQ A;  3J7A O;  2HGC A;  1BR4 A;  1XGO A;  2UUZ A;  4YEJ A;  1IN4 A;  4B3A A;  2CQN A;  1V5G A;  2CUZ A;  4C3I J;  3FMR A;  4I99 C;  3I53 A;  4DQ2 A;  3S1R J;  3CJT B;  2GA2 A;  3CCU I;  1YFH A;  1IXS B;  3GO5 A;  4RMN A;  2R93 J;  3LSH A;  2A05 A;  2R7X A;  4C2M J;  3SZP A;  2CV1 A;  2PQ8 A;  4ASN A;  3I55 I;  2K5C A;  2HVQ A;  2P0W A;  4I01 A;  5CVV A;  2DXI A;  1R5H A;  2K85 A;  4BHP A;  5LHG A;  3WHB A;  1MD0 A;  2JMW A;  4BXX J;  2DCE A;  1O3S A;  2M45 A;  1YTY A;  2FUG 2;  2A68 F;  2AXT C;  4F91 B;  5EF6 A;  2L01 A;  1X4O A;  3K70 D;  3E6C C;  5E17 F;  1TL8 A;  4ENK A;  2QCO A;  2V7F A;  2VQG A;  3K1P A;  3P7N A;  2LD5 A;  1S9H A;  3FM3 A;  2CW0 F;  2OCE A;  3VSK A;  3CC2 I;  3HPH A;  1D1C A;  5M3M J;  3Q9S A;  1X4P A;  5ICE A;  1LQ1 A;  1FEX A;  2RQQ A;  2IS2 A;  2XF5 A;  1NTC A;  3C3W A;  3I54 A;  4KJZ A;  2DMQ A;  1W5C C;  2DT7 B;  3EDP A;  1HF0 A;  3WU2 C;  4HLX A;  1HDP A;  4JOM A;  4KMF A;  1S3J A;  2DOF A;  2I8D A;  2GWR A;  1T0F C;  2FRH A;  2M7B A;  3SYT A;  2KRF A;  1XSX A;  3QP6 A;  3JRE A;  3FDY A;  1XMX A;  2IW5 A;  2M8E A;  3AG4 H;  5K7F A;  4RAZ A;  3G2B A;  4HV5 A;  5BOX A;  2DA7 A;  2IT0 A;  1MZB A;  3GVA A;  3K4N A;  4BBR J;  3AL0 C;  2JT1 A;  5DV5 A;  4L0Y B;  4UY8 I;  2LP0 A;  4BQA A;  4FQG A;  5B66 C;  3QPS A;  1QPM A;  4AIJ A;  1YW7 A;  3CD6 I;  2NVY J;  2HYG D;  3DEW A;  1BIA A;  3D5L A;  3L9F A;  2CO5 A;  2DJI A;  4O6J A;  2OTL I;  5GP9 A;  3KP3 A;  1T56 A;  3ASN H;  2GAU A;  2KIQ A;  4X0G A;  5JLX A;  2EA2 A;  3S17 J;  4E7S A;  2KMU A;  1U2W A;  4BQO A;  3HOV J;  5IOZ A;  4IZZ A;  1F1Z A;  2P6S A;  2VBW A;  1H89 C;  2ISY A;  2FNP A;  4PUS A;  1XCV A;  1PP7 U;  2YUS A;  3CCV I;  1MBH A;  3S3M A;  1IN7 A;  2Z1D A;  3KYC B;  1SMY F;  4B8X A;  5GPC A;  5D4R A;  1A36 A;  3CDI A;  4I7H A;  1TW2 A;  4R79 A;  4GRI A;  2ME6 A;  3WTS C;  2P4W A;  4WXD A;  1RZ4 A;  1HW5 A;  2RV8 A;  2IS4 A;  5DD4 A;  1SD7 A;  2BY1 A;  2L4A A;  3GEZ A;  4II2 A;  4M74 A;  3T5X A;  2A6E F;  2XPV A;  2EPF A;  1FPQ A;  4QPQ A;  3PSF A;  4IHW A;  1DU0 A;  1LFB A;  1X2N A;  5M5Y J;  2V1X A;  4UUS B;  1SD5 A;  2H09 A;  2M30 A;  1FYK A;  3O6B B;  1RKW A;  1MKM A;  4CUG A;  1NK2 P;  5FFX A;  1MMA A;  3CQZ J;  2P8T A;  3S32 A;  3WTU C;  1V4R A;  4DBR A;  3IUO A;  1F5T A;  5LRR A;  1YJ9 I;  4BJT A;  3HSR A;  3GYH X;  1U0J A;  2WV1 A;  4KUM A;  3Q5F A;  2W00 A;  3I0T A;  2ZME B;  3RKX A;  3RKY A;  1AOY A;  5M5X J;  1OPC A;  4KIC A;  6PAX A;  3PO3 J;  1FOW A;  1DGW Y;  5FRO A;  5JI6 A;  1A6I A;  1JUP A;  2L9R A;  1F36 A;  1U5T A;  1T2K A;  2LYC A;  4PJ0 C;  5LHH A;  3GTQ J;  1AU7 A;  2HVS A;  4II3 A;  1QZY A;  2X48 A;  2DDB A;  4B1R A;  2VPR A;  3FK7 A;  2ECC A;  2HYF A;  3I9V 2;  3BR3 A;  1FP2 A;  1LDK B;  1S6L A;  4HV6 A;  2MW8 A;  2PEX A;  3CCE I;  2E2H J;  2PBI A;  4RAY A;  4B47 A;  5KK1 A;  5D4S A;  4MLO A;  1YJN I;  1UG2 A;  3BJA A;  4OIQ F;  2V1D A;  3BWG A;  5D8L B;  2L4M A;  2O6G E;  3GW2 A;  1RKT A;  4E7J A;  3N97 A;  2DOA A;  5KNL A;  1YYV A;  4KIB A;  4L5E A;  2B9S A;  5CVU A;  4ZDP A;  3KP6 A;  2LKP A;  1B8I A;  5C4X J;  4PFO A;  4G6D A;  3EQL F;  1J5Y A;  4BY1 J;  3BPX A;  1W36 C;  4ZDO A;  1WGX A;  4UVA A;  4RB3 C;  2EQR A;  1Z67 A;  3QYE A;  2Z5U A;  4G6T B;  4ZYD A;  1LPQ A;  2HQA A;  1O3T A;  4C30 A;  1GXQ A;  3A4C A;  3GTP J;  3L2Q A;  3MCZ A;  3L2W A;  1FC3 A;  3ISP A;  3FZV A;  2VJ5 A;  3IHU A;  3WTT C;  3ZMD A;  2PJP A;  1MH4 A;  1FBU A;  5AIP A;  2LKX A;  4FCY A;  5BS6 A;  2ESH A;  2DT5 A;  2ELJ A;  3Q0V A;  2GZW A;  5B1B H;  5JHU A;  2IS6 A;  2E36 A;  4Z6Y A;  5D5W B;  2VOP A;  1R49 A;  2ELH A;  2CU7 A;  3FX3 A;  4F93 B;  3CLQ A;  3LSP A;  2E1C A;  2DYS H;  1ZGW A;  4CCJ A;  3U1K A;  3M1C A;  1UST A;  2MYS A;  1ETW A;  1UAA A;  2IAI A;  4AC0 A;  3EUH A;  3H3V K;  2DOE A;  4PGG A;  2YX7 A;  1FT9 A;  3FBN B;  2MG4 A;  5CVR A;  3KLN A;  3TW7 A;  2BW3 A;  1ZRE A;  2E1M B;  2MC3 A;  2ESN A;  3RKW A;  3S3O A;  5HLI A;  3Q0U A;  2ZO4 A;  3UR3 C;  4M73 A;  2NNY A;  3A03 A;  2ZSH B;  3OMY A;  3JCU C;  2ZJQ F;  4BXF A;  2ZKZ A;  1GT0 C;  3NEU A;  4UV9 A;  2JUG A;  3G1O A;  3LFK A;  4E7K A;  3GZ6 A;  1JHF A;  1JXS A;  2WV0 A;  4HF0 A;  4ESJ A;  1MBG A;  1R23 A;  3LSI A;  3NQO A;  4DNC A;  4IXA A;  3GXO A;  1WVR A;  1BOA A;  4KMU X;  4L0Z B;  4M9S A;  2L02 A;  3WG7 H;  4A3M J;  1OQY A;  3PNY A;  2FJ1 A;  1H9G A;  4LFU A;  3KZY A;  4IQJ A;  3OS2 A;  3A0H C;  1KYZ A;  3I64 A;  4IRH A;  5J1R A;  1QZZ A;  5J3L A;  5B5E C;  4IL6 C;  2OD5 A;  3QYB A;  3PQJ A;  1TTY A;  2IGK A;  4RGS A;  3L2V A;  4BBS J;  3ZMZ A;  4AUX A;  1RI7 A;  4JX6 A;  5H6R A;  2JRM A;  1J9I A;  5J47 A;  4YII A;  2M8G X;  5ILU A;  1VND A;  1ZKG A;  3VYT B;  5L3E A;  3KET A;  2VOD A;  2MH2 A;  2M34 A;  2VIX A;  4DZP A;  3HJE A;  4HAM A;  3I59 A;  3Q9V A;  2JUC A;  2XAS A;  2Z2S B;  4M3D A;  2CH0 A;  1WQ2 A;  2E7X A;  3ZP5 A;  4XRS A;  4G7H F;  1KU9 A;  1BM9 A;  3F8F A;  5GTI C;  2YS9 A;  2NRA C;  1GUU A;  4CXF A;  3SDB A;  1HXD A;  2DI3 A;  3IL2 A;  3DPL C;  5H6Q A;  2MAB A;  2G7U A;  3K4K A;  3K4J A;  2DFI A;  3WTY C;  2OTJ I;  4XR6 A;  4UVB A;  3BQZ A;  4DW6 A;  2R0Q C;  2K4B A;  2GXB A;  1LDD A;  1FMV A;  3CCM I;  3KP7 A;  1J09 A;  3NRV A;  3X2Q H;  3JTH A;  1G3W A;  5F6F A;  1S72 I;  1XDS A;  2K7L A;  2CQX A;  1KU3 A;  4ZTJ A;  1ZQ3 P;  1PVE A;  1YO5 C;  2OCC H;  1NG7 A;  2VKD A;  2F5V A;  4JK1 X;  4LG0 A;  5L3G A;  3M8E A;  1MBE A;  3ZQH A;  3DP7 A;  2R5Z B;  4A3L J;  1VQ9 I;  1EKE A;  3ML6 A;  2D1V A;  1VI0 A;  3F72 A;  2LG4 A;  3VPR A;  2LY1 A;  3M7G A;  4XID A;  1OCT C;  1DU6 A;  2WY7 Q;  1BI3 A;  3CCQ I;  5D6F A;  2W1O A;  5LGT A;  4U87 A;  2O7O A;  4XN0 A;  2M87 A;  3OSG A;  3M4O J;  1YOV B;  1LVA A;  4RDU A;  2WB1 N;  3AG1 H;  3WU0 A;  3JRF A;  2VE9 A;  1XMK A;  3TO7 A;  3ZQF A;  4HNU A;  1BW5 A;  2QGU A;  2W25 A;  3V8J A;  2OZ6 A;  5D5V B;  2DMN A;  1WI3 A;  2R7R A;  2Y30 A;  3O8G A;  4U88 A;  3OIQ A;  1MMD A;  3PUB A;  2RN7 A;  2DMT A;  1R9T J;  1Z7L A;  2XAJ A;  4OMY A;  4BXU A;  1W4M A;  5A2Q K;  2P7V B;  4L18 B;  2JA8 J;  2PJR B;  2IVM A;  1R22 A;  5F08 A;  3WG9 A;  3H3Z A;  3MKY B;  4CYD A;  1G2H A;  3PIO F;  1E3P A;  4QTR A;  2DA4 A;  4C2U A;  3G1L A;  4HST A;  4RBO A;  3PIP F;  5C4J J;  5EGO A;  1D1A A;  1U8R A;  1HW1 A;  2KRH A;  2ELK A;  3G3Z A;  5F0C A;  4MIM A;  2BY2 A;  2FE3 A;  2EZH A;  2CQ7 A;  2KRC A;  4GCV A;  3U9G A;  5HNH A;  4MQV A;  4L5I A;  2XAH A;  2HQ5 A;  2A6T A;  3J81 K;  3DF8 A;  1UMQ A;  3BTJ A;  3DLA A;  2STT A;  1R58 A;  2P5L C;  1QGP A;  2UWM A;  2E34 A;  3HRU A;  4FE7 A;  3C18 A;  1MBK A;  1Y1V J;  5IT3 A;  2HKX A;  3KX2 A;  1Z05 A;  4E4H A;  3AL0 B;  2CWE A;  4CCM A;  4A3I J;  2QBY B;  4XM3 A;  4E7Z A;  1ZK8 A;  1S7E A;  3HTS B;  1A6Q A;  1G3T A;  1GVJ A;  5C3E J;  2QVO A;  2CW8 A;  5HLH A;  2ID6 A;  2QQ9 A;  1H0M A;  1FOX A;  3KEO A;  4GYI A;  4UHT A;  1I50 J;  2VOO A;  2E60 A;  2VKV A;  3FIW A;  2VBX A;  1XSD A;  3Q3S A;  2IGM A;  2VQC A;  2QSG X;  3LA3 A;  5JR3 A;  2VKE A;  3W6V A;  2MLK A;  4XLA A;  3IP4 B;  1RES A;  2H8R A;  2LY9 A;  1HST A;  4KN4 X;  1JKO C;  1TWC J;  4D0P A;  1V5F A;  2QSH X;  2QF7 A;  2QQA A;  2K9M A;  1T6S A;  1U5T C;  3SFI A;  2XPU A;  1AKH A;  2ISZ A;  2KJC A;  1XSV A;  4HF1 A;  2E5Z A;  3CMA I;  3HM5 A;  1W7P D;  1GXP A;  1Z9C A;  2OF7 A;  3RYP A;  4GXO A;  2VKH A;  1W1W E;  3GTG J;  2M2E A;  4I0A A;  3FXR A;  4W1U A;  2ZJ2 A;  2XV4 S;  3F8M A;  1QHG A;  3CJN A;  5ILV A;  3IKT A;  4AYB A;  1VQO I;  2YPR A;  2HWV A;  4BEH B;  4EJW A;  5BPI A;  4RAF A;  3MKW B;  1D0Z A;  4FHT A;  3N05 A;  2RNJ A;  4IEJ A;  3GZ5 A;  3LST A;  1YIO A;  2PLY A;  1Y6I A;  1KGS A;  1XC5 A;  2M0C A;  3FMS A;  4S0H B;  4LB5 A;  2Y48 A;  1EJ9 A;  3REO A;  2GQQ A;  4AD9 A;  5KHD A;  3PUF A;  2VLA A;  1YQA A;  4MNU A;  3H92 A;  4NC6 A;  3G4S I;  2FF4 A;  1K78 A;  3P5J A;  1B59 A;  4XLN F;  2VT2 A;  3GTM J;  5IT9 K;  1LE8 A;  2Y9Z A;  4LLL A;  1WH7 A;  2JPB A;  4KT6 A;  4ENN A;  2KJB A;  3TMO A;  3S1M J;  5L3C A;  4BE0 A;  2CV2 A;  4Y4R A;  3F8B A;  2XGC A;  4ENM A;  4CYC B;  4P9U A;  3HRT A;  2XKP A;  3A0B C;  3OYE A;  2V26 A;  1TT0 A;  4B3X A;  4F55 A;  2A69 F;  3JRA A;  1ZG5 A;  2VQL A;  5E3O A;  4EVI A;  1XS9 A;  3HG9 A;  3WHC A;  3H5N A;  2KKO A;  3ZMV A;  2EIJ H;  2NVU B;  3DBR B;  5FLX Z;  3K7A J;  1T08 B;  2XSD C;  3RPQ A;  2VC0 A;  3LSG A;  4MHG A;  4IRI A;  1MJA A;  2KP6 A;  3E7L A;  1W7P A;  3OYK A;  1WRJ A;  1J59 A;  3EUH C;  4CH7 A;  3RQI A;  5EG0 A;  1L3L A;  4LK1 F;  3PFY A;  3MAJ A;  3DBL B;  2BEO A;  1Z0X A;  1XGS A;  3ABU A;  3T1B A;  1YRN A;  1RR8 C;  1GDT A;  3K9T A;  2XC7 A;  3N4M A;  1RRJ A;  1PUF A;  2RDP A;  3GF2 A;  1IRF A;  3MFK A;  2L9N A;  1HKQ A;  3DXJ F;  2NYX A;  2R7V A;  1NH3 A;  2XPW A;  3K2Z A;  2F6C A;  5CQE A;  2K9L A;  1MMS A;  2CUE A;  1ZAO A;  2M0M A;  1LDJ A;  3BDD A;  5LBQ A;  1OCP A;  5K7H A;  1K4S A;  2LFB A;  3F8C A;  2VJJ A;  1N75 A;  3DTE A;  2AS5 F;  1VFC A;  4XKB A;  1IV8 A;  4GO1 A;  1F43 A;  2KPM A;  2XDV A;  4NUB A;  5H2F C;  2NS8 A;  2FEZ A;  4HLY A;  2PN6 A;  5FRM A;  3SEZ A;  1FIP A;  4WXH A;  3FXL A;  1G59 A;  1IGN A;  4XMY A;  4WCG A;  3HOX J;  5CJ9 A;  2HDD A;  2J5P A;  3UKG A;  1A35 A;  4MO7 A;  1K6O A;  2MSY A;  5F27 A;  3ZQL A;  2VJ4 A;  2KLO A;  2R7Q A;  2KDZ A;  2A3S A;  4ZYG A;  4A5N A;  1DDN A;  3W3C A;  3CTA A;  1FY7 A;  3GFM A;  3SJM A;  1CF7 A;  3KE2 A;  4YFX F;  5J8F A;  5LD2 C;  3NAR A;  1T95 A;  2DQL A;  3OL4 A;  2FBI A;  3WTZ A;  1FX7 A;  4E7I A;  3TO6 A;  3SZG A;  4XIC A;  1DPU A;  1B72 A;  3OR1 C;  4HX8 A;  4F92 B;  3HBL A;  2M5W A;  3FBI B;  2HR3 A;  2VBY A;  3JAM Z;  4XSZ F;  2LLK A;  3BQY A;  4MTD A;  3ZQG A;  2LBF A;  3R6S A;  2V6C A;  2O61 A;  4EAT A;  1AHD P;  2CGP A;  4R8H A;  1Z3X A;  2JZY A;  4CCN A;  2DBB A;  1OFC X;  3DEE A;  4UV8 A;  4YFN F;  2DN0 A;  4EMS A;  2ZJP F;  4M3B A;  2L5Q A;  1Z1D A;  1MIJ A;  3S8P A;  4PFP A;  4D7N A;  3OYJ A;  2CV0 A;  2XGE A;  3SDG A;  3CCL I;  3C2G A;  2BOL A;  3K1M A;  1SD6 A;  1VZ0 A;  3JR9 A;  3BG7 A;  2MD0 A;  3ZN0 A;  2TCT A;  2EFP A;  2XAF A;  2H94 A;  3BT9 A;  3HUG B;  2JA7 J;  2GIV A;  1YX5 A;  2W4S A;  3D0S A;  4D5F A;  3CC7 I;  2I5U A;  1IRZ A;  2Y31 A;  4I09 A;  3CC4 I;  2LRE A;  2TDX A;  5DM6 F;  2V9K A;  3RZO J;  3LA2 A;  2JA2 A;  3HGY A;  2HXI A;  4W97 A;  1H88 C;  2NVT J;  3DKX A;  3S15 J;  2BVL A;  2W7N A;  5IPA A;  3BTI A;  3J80 Z;  3DLL F;  5K5Q A;  2FMY A;  1R1U A;  3HOW J;  1IN8 A;  2WTE A;  4FT8 A;  4ITV A;  1IUF A;  4ZJZ A;  2DA2 A;  1FMW A;  4Y15 A;  5LGU A;  1BW6 A;  4JP0 A;  5HDN A;  3SXY A;  2HYJ A;  5EDN A;  2G0E A;  4Y52 J;  1OCZ H;  2BXY A;  3KEQ A;  1KQ0 A;  1G6N A;  1JJ6 C;  1UCR A;  2EH3 A;  3HSE A;  4HW0 A;  5HDK A;  2V4J C;  1ZH5 A;  1QO0 D;  3E97 A;  2WC2 A;  4BU2 A;  2HS5 A;  3D1N I;  2Q1Z B;  1YIJ I;  3V8K A;  4NC7 A;  3OYI A;  3B6C A;  3G71 I;  2ZJR F;  3A1Y A;  3HZJ A;  1IF1 A;  3W6J B;  2O9L A;  4EM1 A;  5BMZ A;  1I6X A;  1BL0 A;  4EV0 A;  1ITY A;  5C44 J;  2PMH A;  1MJ9 A;  2R5Y A;  2EK5 A;  3E6M A;  1IG7 A;  3PM1 A;  1EA3 A;  5CYV A;  4MQ9 F;  4KIG A;  3OYH A;  3MD2 A;  4E70 A;  1APL C;  2O8K A;  5D5U B;  3FXQ A;  3H36 A;  2H1L A;  3OYA A;  1ZR4 A;  2L3D A;  1ZG3 A;  1XTA A;  3FHZ A;  3FKJ A;  1B4A A;  1FOK A;  4QSH A;  2ETH A;  4L9T A;  2HTS A;  2P81 A;  3ZXS A;  4BYY A;  2JSP A;  4HYE A;  4M72 A;  3CLO A;  4P1W A;  5EJC A;  3DFG A;  3GME A;  1DUX C;  3W6K B;  3JW4 A;  4EGZ A;  1HA8 A;  2EV0 A;  2L9V A;  3CCY A;  2K4J A;  4E7L A;  4G94 A;  1BI0 A;  2Z9O A;  1EF4 A;  2MLG A;  5ED4 A;  1SC7 A;  3UNG C;  1WHU A;  2MGQ A;  3PJR A;  1KQ9 A;  2DW4 A;  2YU3 A;  2KL4 A;  4M71 A;  3QRF F;  4XLC A;  2L0K A;  4OU0 A;  1TNT A;  4AVZ A;  4RA2 A;  3FXO A;  1BR1 A;  3OYF A;  4M6Y A;  2ZXW H;  3Q0W A;  1XN7 A;  4HDU A;  1I1S A;  1W0T A;  2BGC A;  4PJJ A;  1FBQ A;  5KVR A;  4BDY A;  1TWG J;  4NB5 A;  4HNT A;  3L1P A;  1PUE E;  1Y1W J;  1T98 A;  1WJC A;  2WAE A;  2UXX A;  4CGZ A;  4HOB A;  3ECO A;  3U2R A;  1JKP C;  4XLH A;  2RRE A;  4YIF A;  1YLF A;  3CUO A;  1YS6 A;  2COM A;  5F1J A;  2GOM A;  3BG9 A;  4S05 A;  2ZFU A;  3RI4 A;  2EFQ A;  2Q2E A;  2XIG A;  1O7L A;  2DTZ A;  4EJV A;  1T38 A;  4ZTF A;  4QLC U;  2R7W A;  4B09 A;  5LGN A;  2BVM A;  3VWB A;  3E1S A;  3DQV C;  1DP3 A;  2V1U A;  3WTX C;  2FQ4 A;  1XMA A;  2O03 A;  3GCM A;  2Z16 A;  2EZL A;  2LC2 A;  4D7M A;  2CJJ A;  1P6R A;  2XUB A;  1U5T B;  5EEG A;  1OJL A;  2N8G A;  1I1G A;  1RUO A;  1BI2 A;  4HRI A;  5KAF C;  1R5G A;  1OR7 A;  4RLF A;  4XLE A;  1MH3 A;  2F5F A;  3RDI A;  5HNF A;  4XKV A;  4KIS A;  1B1B A;  3ERM A;  2R7O A;  3GTK J;  3WGI A;  3CCR I;  3V8L A;  4C2T A;  2R3S A;  5TRD A;  2X85 A;  5E3N A;  1LFP A;  2XRN A;  3SQN A;  2HVR A;  3PFI A;  4XLF A;  2F5C A;  1OCO H;  2XAQ A;  5FKM A;  2YU9 J;  4I0B A;  3CP2 A;  1B8I B;  4OIN F;  3RPU D;  1W5S A;  2L54 A;  1X3U A;  3KEY A;  4P9F A;  4WK8 F;  4PJM A;  4EGY A;  3I3L A;  2VUM J;  4I6Z A;  4IKF A;  1RIO H;  2XAG A;  2E2J J;  2FD5 A;  4A0Z A;  4P96 A;  3DKW A;  1KYW A;  4LIT A;  2KIF A;  3FXJ A;  3I58 A;  3F22 A;  1YIT I;  1B9N A;  1P92 A;  4A3F J;  4BGD A;  2DK8 A;  1U9N A;  3K6G A;  1HBX G;  3QPL A;  1Y39 A;  2JVH A;  4XLP F;  2F5D A;  5J1U A;  1D5V A;  4BHC A;  2A5W A;  2M3A A;  3LOC A;  3S2W A;  1A5J A;  3BC8 A;  1P4W A;  1R7J A;  2ZC2 A;  5FKN A;  1XD7 A;  1IC8 A;  2IBD A;  3FMQ A;  1ETQ A;  1QA6 A;  2DDA A;  3ABK H;  2B63 J;  1MGT A;  2FML A;  3QP5 A;  3FHN A;  4AU7 A;  2L7Z A;  3MVP A;  1SVO A;  1VQK I;  2LF7 A;  3LL7 A;  4ON0 A;  2R4G A;  4Y17 A;  1SAN A;  1D5Y A;  4EM0 B;  1ZN2 A;  4K2E A;  1TQI A;  1HKS A;  1V54 H;  1YE9 A;  2DA6 A;  2LF8 A;  3C2B A;  2PG4 A;  3P9K A;  2BW3 B;  4O5V A;  4P55 A;  5HDG A;  2EWN A;  4UUV A;  4CCO A;  1EV7 A;  2AQF A;  3CCJ I;  1JGG A;  4MTE A;  5DUK A;  3ULQ B;  1YI2 I;  4UXN A;  1LEA A;  5J6X A;  2NVX J;  3S1Q J;  3TBI A;  2L9S A;  3EYI A;  1O7F A;  1CGP A;  9ANT A;  2L7M P;  1ULY A;  4YIR X;  1WZ2 A;  3JRI A;  1MSF C;  2AHQ A;  3ESW B;  4S04 A;  3RSN A;  4I76 A;  5E1Z B;  1MW7 A;  2LR8 A;  3P9I A;  2LSO A;  3HKZ N;  4IRG A;  2LKS A;  2CS3 A;  5TJJ A;  1R00 A;  1T8I A;  4LJZ F;  2M1B A;  4U0Y A;  1QZE A;  4IQ4 A;  1Y0U A;  3GLX A;  1WWX A;  3C7J A;  5AON A;  1XPX A;  2UV1 A;  5DTD A;  1Z3Y A;  1HQC A;  2QSF X;  4CZC A;  1S29 A;  3F6O A;  1X1D A;  3ZR8 X;  3GFL A;  4U7B A;  2XF6 A;  1BBY A;  1VQ5 I;  3L00 A;  1MJB A;  1EH6 A;  3R4K A;  2VJI A;  1KZH A;  1P9Q C;  1Z91 A;  5L3D A;  2DPU A;  1IN6 A;  3H9J A;  3WTV C;  4LIU A;  4WWC A;  2RVC A;  1BA5 A;  2FSW A;  4X6A J;  3I59 B;  3BZK A;  3K0L A;  1FP1 D;  2W82 A;  1QNT A;  3HOT A;  4N9I A;  1T33 A;  3ZQC A;  3CF2 A;  3ZQQ A;  3M8J A;  3BR6 A;  4J19 A;  2QZ8 A;  3AG2 H;  2LOO A;  1IUY A;  3CO6 C;  1ODD A;  3QWL A;  2IRF G;  2JQ7 A;  2JVG A;  1W0U A;  4KYW A;  2HXO A;  4ZYA A;  2QQ8 A;  4OIP F;  2MC4 A;  3JSP A;  3ZN1 A;  5FKL A;  4A93 J;  1IRG A;  2WY8 Q;  4CCK A;  4G7O F;  3KIO A;  3FXM A;  4BHB A;  1P4X A;  3IWZ A;  2WBM A;  2HQR A;  5E3M A;  1X2M A;  1ZGJ A;  2Y75 A;  3C1D A;  5IP6 A;  3LAP A;  1SFU A;  2DFE A;  3R60 A;  4XRF A;  2Y0S N;  4IPA A;  2BBY A;  5F0H A;  4XOR A;  1U78 A;  5D5X B;  2G9W A;  4NC8 A;  5J4Y A;  1Q1V A;  1IAW A;  4LG0 B;  2VXZ A;  4HDV A;  3F23 A;  1TWH J;  3A01 A;  4DBQ A;  2F2E A;  4KFC A;  4TV7 A;  5LRS A;  3ZCO A;  5ILS A;  1R6R A;  1Z6R A;  2PFB A;  5HLG A;  2V9P A;  2FOK A;  1X19 A;  1VQ4 I;  4RB0 A;  3E5Q A;  5K5R A;  4OAY A;  3K70 C;  3GZN B;  2QEN A;  4PJN A;  1BC8 C;  5CVJ A;  3SFZ A;  2DT6 A;  3QOD A;  4JYK A;  5HVQ C;  1FTZ A;  1ETO A;  2OU2 A;  2ZCW A;  3GTL J;  3IWF A;  3DPT A;  4A0X A;  4XRM A;  2GM4 A;  2Y2Z A;  5DCM A;  5J1Y A;  2B7E A;  3CO7 C;  1IZ1 A;  1WCM J;  4QPO A;  3LFU A;  3ZGK A;  3IRR A;  2WB1 A;  3J7Y J;  4L9J A;  3ZQI A;  4XBF A;  1FJL A;  4PK4 A;  3WGH A;  5KCM A;  4G9Y A;  2EJR A;  2V6E A;  3NWT A;  1HSJ A;  2IA1 A;  4CHU A;  2W57 A;  1P7I A;  3LA7 A;  2KQR A;  3HL2 A;  3L2C A;  2E71 A;  3M3Y J;  1JTY A;  3VYU B;  4EJO A;  3E3V A;  1B6A A;  1R4M B;  2WAD A;  4RM2 A;  3KP5 A;  5HLT A;  3A2K A;  2VAS A;  2WAQ N;  4OWR B;  3B6A A;  5EGO B;  4R1H A;  2JSC A;  2EB7 A;  1TC3 C;  1J7K A;  4G12 A;  4L9V A;  3VYS B;  2O3F A;  1MSE C;  4BY7 J;  5AIQ A;  3H5A A;  1FBS A;  1PDN C;  2M9H A;  3K4M A;  4BQQ A;  1S7O A;  3DU6 A;  3BR2 A;  3HDD A;  2L7K A;  5EEA A;  4A12 A;  2E1N A;  3V7R A;  1BC7 C;  2P7C B;  4MEY F;  3E6B A;  2VT3 A;  1TLH B;  2CFX A;  2ADU A;  4M3E A;  3K69 A;  3L7W A;  1RUN A;  4DIQ A;  1QU3 A;  5GAG J;  1Z6T A;  4PJL A;  5IYD J;  3TP3 A;  3G73 A;  1WKM A;  3M9A A;  5B1A H;  5HOD A;  3JRG A;  4I2O A;  4NHJ A;  3KP4 A;  2HZD A;  4N9H A;  5LFA A;  4MFE A;  4XL9 A;  1X3Z B;  3WE3 A;  1LFU P;  1JKQ C;  4CDG A;  1BJZ A;  3TO9 A;  4UB6 C;  3QOP A;  2EIM H;  2COB A;  2L7F P;  1TQM A;  3CP8 A;  2M4G A;  4NQW A;  2R7F A;  2K9Q A;  1UHS A;  3OL3 A;  1D1B A;  1OYI A;  4A6D A;  2NNN A;  3DTK A;  1X1A A;  2W84 A;  4YRV A;  1BJA A;  3IV5 A;  2EV5 A;  1IDZ A;  1KQ8 A;  1P2F A;  1MNE A;  2OPT A;  2LMD A;  3JTG A;  4BKX A;  3ABT A;  1MBJ A;  1POG A;  1F4K A;  4BUP A;  4ZYE A;  3W2V A;  3P9C A;  2Y9Y A;  2JPC A;  1AKH B;  1NG6 A;  2FQ3 A;  3BP8 A;  3WOD F;  1OR7 C;  1OYW A;  1R1T A;  3HRS A;  1MNM C;  1ZR2 A;  1RET A;  2R7U A;  2VBZ A;  3CUQ A;  2OQG A;  4EQQ A;  2W85 A;  4DYR A;  5FRN A;  4OMZ A;  4Y3O A;  1TZL A;  2H1K A;  2OQR A;  3BPV A;  4ENJ A;  4XSX F;  2QA4 I;  3MKL A;  4N4N B;  3PNT A;  2XRL A;  2KDO A;  2M7A A;  5CPR B;  3V7C A;  2X6Y A;  2QKL B;  3IAS 2;  3FK6 A;  2HKO A;  2YX4 A;  4UUT A;  3ROU A;  3RCO A;  2E19 A;  1OCC H;  4M3G A;  1UG0 A;  1FWZ A;  3HHG A;  1U8B A;  1MDM A;  2PI0 A;  1DQU A;  1BOB A;  1G3S A;  2EZK A;  1UHM A;  4A69 C;  3BG5 A;  2D1H A;  1K78 B;  2MA3 A;  1YHQ I;  2LK2 A;  3F9K A;  5E1W A;  3ZMU A;  4IHX A;  2RQP A;  1JTX A;  1LE8 B;  2EFN A;  3MWM A;  4A3G J;  4BDZ A;  2X51 A;  3DU5 A;  3OOP A;  5DYM A;  3GX4 X;  3H9G A;  3CZ6 A;  1JT0 A;  2HOA A;  1EH8 A;  4RAG A;  3IH2 A;  2F4O B;  3LSJ A;  1R4N B;  2OJE D;  3D5S C;  3TDZ C;  1T39 A;  2H8W A;  2W24 A;  1JGS A;  1S7A A;  2X6O A;  1UZC A;  4C9Y A;  3SHF A;  2JA5 J;  2O0Y A;  3R0A A;  4FX4 A;  1ZGA A;  1S5L C;  2E2I J;  3KLO A;  2XAU A;  2D5V A;  1IO2 A;  3FXU A;  3PL8 A;  2EV6 A;  4ZZD A;  1OMI A;  1VQ6 I;  4A0Y A;  3PNV A;  1W7P B;  2DTR A;  1UB9 A;  5FLV A;  2HTJ A;  4MGR A;  2XVC A;  5D6E A;  2ZNY A;  5EG0 B;  1LNW A;  3RJP A;  3QOE A;  1I3A A;  5H20 A;  4YEL A;  1BI1 A;  2I10 A;  4ETS A;  2MBF A;  4NBQ A;  1JKR C;  1IN5 A;  1YRN B;  4C3J J;  4F52 A;  1UFM A;  4HQE A;  3HOZ J;  2GXG A;  3ZRG A;  1KU7 A;  1PUF B;  1PJR A;  5FD6 A;  5L3B A;  2QLZ A;  4BAC A;  3PO2 J;  1GVD A;  5JFR A;  3BZ6 A;  4GGG A;  3CMY A;  3F21 A;  4U7D A;  2ACJ A;  1O4X A;  2BE5 F;  5CQG A;  4QIW N;  3HB9 A;  5FJ8 J;  2LRD A;  2JJ7 A;  2HDC A;  4FAS D;  1FOY A;  4BS9 A;  1P4A A;  4Q4Z F;  4BL0 B;  2PMZ N;  3DCF A;  3CDH A;  2BZT A;  2ZXI A;  4D5C A;  1X3W B;  1RC9 A;  2BV6 A;  4HA8 A;  2CFO A;  2DMU A;  3K10 A;  3V4G A;  5K5O A;  3LAJ A;  4F7Z A;  3BG3 A;  2LNB A;  3MEX A;  4PCQ A;  2MFZ A;  3JSO A;  3VOE A;  4KN7 X;  3H9Q A;  2BXZ A;  5GPA A;  2RNG A;  3ELK A;  1NK3 P;  2NS7 A;  3S14 J;  1QQI A;  3VDX A;  2Z33 A;  1P7J A;  3MMY B;  5ICF A;  4IHT A;  1ZLJ A;  2KHM A;  3CCS I;  2FBH A;  2CQQ A;  3AFH A;  3FM5 A;  5HS8 A;  1I27 A;  1TBX A;  2CSO A;  3BLY A;  3QU3 A;  2JWT A;  2DPD A;  3L2U A;  1CF7 B;  1O57 A;  1K6Y A;  3F6V A;  1ZEL A;  2XB5 A;  3R0J A;  3GLL A;  3C2H A;  2AQE A;  1B72 B;  2IPQ X;  4IVN A;  2Y0M A;  2EZI A;  2FX0 A;  5F1R A;  1ERD A;  4PGH A;  2KIU A;  3S2H J;  3AKZ A;  3F0C A;  2LBF B;  1ZHF A;  1IV6 A;  4RGU A;  5JVT A;  3OIP A;  2ZFW A;  1FIA A;  3GFI A;  4XN3 A;  3T0Y A;  1D8K A;  3TOB A;  1FLI A;  4D9J A;  1JUM A;  1WJF A;  1E2X A;  3OYN A;  2Z99 A;  4I98 B;  4B4C A;  5HOO A;  1VQP I;  3K4C A;  2TRT A;  3OS1 A;  1Y56 A;  2MD5 A;  2PMZ A;  1PYV A;  1GV2 A;  2QKM B;  1HKT A;  5FLX K;  3MN2 A;  1KU2 A;  3G1M A;  5FD5 A;  4XK4 A;  3S93 A;  4KDP A;  2NVQ J;  3F3X A;  2RGV A;  4DZJ A;  1S8N A;  3WTW C;  2XF7 A;  5M5W J;  1FSH A;  2R7Z J;  1UJ8 A;  4OIO F;  4M9Z A;  3H0D A;  1ONV A;  1YJW I;  2DA1 A;  1USS A;  1ETY A;  4L9N A;  2HI3 A;  5E3L A;  3OR2 C;  1SVM A;  2OZU A;  2IP2 A;  4IHV A;  1IJW C;  4XOP A;  5ICG A;  3M07 A;  2HNH A;  4IF4 A;  5CKT A;  3GWZ A;  4A3J J;  2VI6 A;  4HEA 2;  3I4N J;  4Y7N J;  3LNQ A;  2V1N A;  4F3Q A;  2DU9 A;  4UUS A;  4XRS G;  1ZTR A;  2MH9 A;  4Q48 A;  1Z77 A;  1JJ8 C;  2GLO A;  2DQR A;  2X6X A;  1JUS A;  3LSM A;  5E79 C;  2CMP A;  2BY3 A;  1X58 A;  3T8R A;  1IXC A;  3CJR B;  3LSK A;  1NHA A;  2DJN A;  4XKC A;  2VC1 A;  1SAX A;  1FYL A;  1JI8 A;  5EEH A;  2ZME A;  3EYY A;  3H35 A;  1R5I D;  1VQN I;  1TP4 A;  3W2W A;  5KAI C;  4M6X A;  4FET A;  4I02 A;  3A02 A;  4NNJ A;  3GTJ J;  1U6G A;  5M3F J;  4A3C J;  2IS1 A;  3QPH A;  3GUD A;  2R5Y B;  1SFX A;  3DV8 A;  3KCC A;  2GA1 A;  3BR5 A;  4OAZ A;  4CIC A;  5E1X A;  2DFF A;  4IHY A;  2OV7 A;  1RPW A;  2ZB9 A;  4EJU A;  3JAM K;  2R7T A;  3MQ0 A;  4G6Q A;  4Q47 A;  5F04 A;  1RR7 A;  4Z2Y A;  4RS8 A;  1SFE A;  3OV8 A;  5FGM A;  1ZRF A;  1HOM A;  3IKV A;  3ERE D;  5GTH C;  1SFO J;  5BQT A;  2QYO A;  4HX7 A;  2OUM A;  4LIV A;  5D8K B;  5GAE J;  3OYC A;  3O3K A;  5IP9 J;  1FTT A;  2D45 A;  1PP8 F;  1U3E M;  1E17 A;  2XKO A;  2UZK A;  1TNS A;  4BNC A;  3D5R C;  3COA C;  2DLL A;  3WU1 B;  1N78 A;  1CQT A;  4Q5S F;  2PMU A;  4LOC A;  1WJE A;  4D1Q A;  3TOA A;  3ZOB A;  2E7W A;  1YW8 A;  4MFD A;  3TQN A;  4HNV A;  2HZT A;  2C6Y A;  2LY2 A;  1FZP B;  3S16 J;  2K40 A;  1J0R A;  3J80 K;  5LEJ A;  4ANJ A;  4A5M A;  3LQQ A;  2BHY A;  2JA6 J;  1V3F A;  1ETX A;  1C0W A;  4O3M A;  2JRT A;  4XKW A;  4AWX B;  3ABL H;  1YX3 A;  2BHZ A;  5EZH A;  3MKZ A;  1SAU A;  1VF9 A;  3CUQ C;  3VFZ A;  4KIT B;  2FNA A;  5FB2 A;  3RZD J;  3FWE A;  4M3F A;  4BQN A;  3K4L A;  1ORK A;  2Q2E B;  4WX9 A;  2EIK H;  5GAH J;  3TW6 A;  1E0E A;  2RKH A;  1YG2 A;  2QQB A;  4X1E A;  2B0L A;  3TKY A;  2DAO A;  3T8T A;  1TQP A;  3AAF A;  3DKY A;  3B02 A;  3E6D A;  1HC8 A;  3VB2 A;  1UEL B;  3SZT A;  4CSW A;  4BAY A;  1G3Y A;  2FBK A;  4QWQ A;  2OC6 A;  4GDF A;  2HOT A;  3I4M J;  1SFK A;  3FF5 A;  3AG3 H;  3OS0 A;  2M4K A;  1VQ7 I;  2QEX I;  4U0V A;  4J01 A;  4IOC F;  1KA8 A;  3ZQ7 A;  3OYL A;  3LWF A;  2NOG A;  1K61 A;  1ETK A;  4AM3 A;  1LUJ B;  2AO9 A;  4CA0 A;  4LG3 A;  3M1E A;  4ZDL A;  3KYL A;  1VTN C;  2E1O A;  2ZXJ A;  4BE1 A;  4G8X A;  1JHH A;  2JN6 A;  1VQL I;  1HLV A;  3IC7 A;  5A2Q Z;  4BJ6 C;  1SD4 A;  3KFW X;  2D2W A;  3SEQ A;  1ON1 A;  5IY5 H;  2L2O A;  2KZG A;  2IGO A;  3G6E I;  3J7Z I;  2STW A;  1JE8 A;  3NAU A;  4EEF G;  2K3P A;  5IYB J;  5LEK A;  2P5K A;  2W48 A;  1XB4 A;  3ASO H;  1OKR A;  4V2F A;  2EFW A;  4J00 A;  1WPK A;  2VB6 A;  4ESB A;  3DPU A;  5LLQ A;  2EA4 A;  1WI9 A;  3QU6 A;  1BR2 A;  1QPI A;  4LLN A;  2FXA A;  3RIR A;  1D8J A;  1ACI A;  3J81 Z;  1TWA J;  1Y8R B;  1F9N A;  1V55 H;  1JT6 A;  1BIB A;  2CUF A;  3H0G J;  2DMP A;  4HQM A;  3BR0 A;  2WAF A;  3ZMS A;  2WA0 A;  3BJO A;  4LLG F;  2VXD A;  4LB6 B;  4ZC3 A;  3M8F A;  4CCL A;  3CME I;  5EZG A;  2X9D A;  4H4K C;  1QVT A;  4XQF A;  2A6H F;  1OYY A;  3RPU A;  1REP C;  4M9X A;  1SMT A;  2XHK A;  5JHF A;  2ZSI B;  2LDU A;  5DCF A;  2ZBK A;  1QVU A;  2A07 F;  4GFB A;  1TW3 A;  2CG4 A;  2P6T A;  1X1B A;  2IEK A;  3I5U A;  1O3Q A;  4GYG A;  2ZNZ A;  5DEQ A;  3J7A Y;  3RTR A;  3WE2 A;  2NS0 A;  1UHW A;  1ZRC A;  4JQF A;  1I5Z A;  3MZ8 A;  3BY6 A;  3QYF A;  3JRC A;  4LMY A;  1Q1H A;  1XDU A;  4Y13 A;  3BJ6 A;  3HIF A;  4FX0 A;  2R5Z A;  2XSJ C;  1XGM A;  3EUK L;  1I39 A;  3GFJ A;  1WFX A;  3TED A;  1TT5 B;  1M1E B;  5K1Y A;  1X1C A;  3GBG A;  4DYC A;  5HS7 A;  5FLM J;  4FTH A;  3VEP A;  4LGW A;  1SEU A;  2ID3 A;  1R36 A;  3K1N A;  3QPT A;  3KP2 A;  1LB2 A;  4UNO A;  1G4D A;  3HOY J;  5B3S H;  1L0O C;  1OCR H;  2XRO A;  4HF2 A;  3S1N J;  5DS9 A;  3HXL A;  1SVL A;  2NOJ B;  4DJA A;  2LTP A;  3E5U A;  1D3Y A;  3OIO A;  1LEB A;  2X6W A;  1LJ9 A;  4HG2 A;  1A31 A;  3RQ4 A;  2PJR A;  3L09 A;  1J2X A;  1LVK A;  2GIZ A;  3TL4 X;  2WWY A;  3H3U A;  2RAE A;  2UXN A;  5DD8 A;  4Y33 A;  3HKZ A;  3E5X A;  2DFH A;  5FO5 A;  4HSR A;  2H6B A;  4A3E J;  3HTU A;  2Z3Y A;  3OOU A;  1MND A;  1G8X A;  2X1E A;  5IT9 Z;  2JK3 A;  4U0W A;  2Y69 H;  3BRO A;  1YW9 A;  1H9T A;  1T0F A;  3LMM A;  3WGG A;  3HGG A;  3BOQ A;  4UVC A;  1RNL A;  3K2A A;  4LK0 F;  4B48 A;  3VYR B;  3L2R A;  3OWT A;  5J4V A;  4A3B J;  2V9V A;  2DK5 A;  2YSR A;  4YFK F;  3LQR A;  4A6E A;  1FSE A;  1MBF A;  4M6V A;  5JLW A;  1ZLK A;  2QBY A;  3IRQ A;  3LSR A;  1Z7U A;  1WJD A;  5F64 A;  4ZH4 F;  3HRM A;  5TGT A;  4XON A;  4MEX F;  5E18 F;  3ZMT A;  1GHC A;  4IX7 A;  1ON2 A;  3PSI A;  5EYR A;  1QRY A;  2DYR H;  2X1D A;  2R92 J;  2F4I A;  3OYD A;  1X1P A;  1DGR M;  3VSL A;  5GAD J;  2K27 A;  2DA3 A;  4KT5 C;  2HEO A;  2H27 A;  4A3K J;  3JRB A;  1ZYR F;  4AVP A;  2ZME C;  4JX4 A;  3BTL A;  3EPZ A;  3QQA A;  3NWS A;  4N4O B;  4XOT A;  1V5E A;  1Y0N A;  5L3F A;  1AA7 A;  5ERI A;  4KNY A;  3A01 B;  5TIS C;  3IAM 2;  3ONQ A;  1HCR A;  3V42 A;  3BZC A;  2Y0S A;  3H5R A;  4AYB N;  4FIS A;  2BY0 A;  4AIK A;  3BR1 A;  2KT0 A;  3PQK A;  1LKX A;  2H6C A;  1W36 D;  4JX5 A;  3BCB A;  5J8C A;  5BNG A;  3R61 A;  2QM3 A;  4IO9 F;  3MZH A;  3OY9 A;  3CMM A;  1IRX A;  1BN5 A;  2BYV E;  2K86 A;  1N25 A;  3GTO J;  4L5J A;  2Q0O A;  3K4B A;  3B73 A;  4BEH A;  2G7H A;  5K7Z A;  2OAZ A;  3IH4 A;  5DCM B;  4H0E A;  4V19 K;  4E6K G;  5E20 A;  3DEU A;  2VN2 A;  4IJA A;  1D0Y A;  4CZZ A;  1EH7 A;  4BH9 A;  3S2D J;  2HPI A;  1I6H J;  2X0L A;  4A3D J;  1E3O C;  3HOU J;  1XG1 A;  2IXS A;  3BG6 A;  5LHI A;  3JRH A;  4OOI A;  4EJT A;  4ZZL A;  1K7A A;  2ECB A;  2DO7 A;  2EIN H;  2K9S A;  2O5R A;  3E0J B;  4B43 A;  1Z21 A;  4UB8 C;  4RGX A;  2VE8 A;  3FIS A;  4PDK A;  2VQH A;  2HDW A;  2R7D A;  3HSF A;  1ZRD A;  4OIR F;  4WXC A;  3IH3 A;  2F5E A;  5IP7 J;  2DOD A;  1E3H A;  1HW2 A;  4RB1 A;  4CYC A;  3CDL A;  1FYM A;  2KIS A;  3HPG A;  2CRG A;  2OBP A;  5DUI A;  3O2P E;  2WAQ A;  2QUF A;  2HPM A;  2HOE A;  3V7S A;  4IOA F;  2K02 A;  4EM2 A;  2XGD A;  3O8H A;  4JBA A;  4B44 A;  2QWW A;  1DP7 P;  4RM3 A;  2JTV A;  4KIF A;  4BE2 A;  2F48 A;  3FKI J;  1J75 A;  1A04 A;  2FOW A;  4RGR A;  4CO8 A;  2E35 A;  1O3R A;  4HZF A;  1QBJ A;  2J5O A;  3HHH A;  2NXN B;  3JRD A;  2ICW G;  4AIH A;  1Y8Q B;  3KYD B;  1K83 J;  4NQW B;  4LD5 A;  3HOS A;  2Q8K A;  1XCB A;  4PSX A;  2IA0 A;  2GBY A;  5E8G A;  3KPH A;  5JVG F;  4DOZ A;  2E1M C;  4FE4 A;  1WJ5 A;  3DBH B;  2F4M B;  4E7H A;  5FFZ A;  2X1C A;  2CYY A;  2X4H A;  2R7S A;  1KON A;  5IYC J;  3TDU C;  3OYM A;  2EBI A;  5DM7 F;  3HEF A;  2CW7 A;  4RLQ A; 
#chains in the Genus database with same CATH homology
 1ZAR A;  1R1V A;  4G7Z F;  3CUQ B;  5E8I A;  1IW7 F;  4IHS A;  2NAZ A;  3QAH A;  1IXR C;  5BPD A;  2KIM A;  2IJL A;  1STZ A;  4HX4 A;  2HFH A;  5CVI A;  3HYI A;  2IA2 A;  1DPR A;  1MDM B;  3U1D A;  2O8X A;  4ZYH A;  2VON A;  3EET A;  3VOD A;  2FU4 A;  4WF2 A;  5HS9 A;  1B9M A;  3RYR A;  5CLS A;  1FNN A;  3KZZ A;  4RB2 C;  1AWC A;  2A61 A;  1W5T A;  2XGX A;  3TGN A;  4YG2 F;  4P5O A;  2FA5 A;  4HBL A;  3I4P A;  3F8N A;  2AXL A;  3ECH A;  1K79 A;  1XGN A;  3MZY A;  1YS7 A;  1WSU A;  5ICC A;  4N0B A;  2HQN A;  2A5Y B;  2RC4 A;  2EFO A;  4PZJ A;  3ZPL A;  5DDG A;  4A2U A;  2CQK A;  2OA4 A;  3I71 A;  3HUG A;  1ZG1 A;  2P5V A;  2YR2 A;  4KA4 A;  4ESF A;  2V79 A;  3J7A O;  2HGC A;  1XGO A;  1IN4 A;  3FMR A;  3I53 A;  4DQ2 A;  2GA2 A;  1YFH A;  1IXS B;  3GO5 A;  3SZP A;  2PQ8 A;  4ASN A;  4I01 A;  5CVV A;  1R5H A;  4BHP A;  5LHG A;  1MD0 A;  1O3S A;  2M45 A;  1YTY A;  2A68 F;  2L01 A;  3E6C C;  5E17 F;  4ENK A;  3K1P A;  3P7N A;  3FM3 A;  2CW0 F;  3Q9S A;  5ICE A;  1LQ1 A;  3C3W A;  3I54 A;  3EDP A;  4HLX A;  4KMF A;  1S3J A;  2GWR A;  2FRH A;  2KRF A;  1XSX A;  3QP6 A;  2IW5 A;  2M8E A;  4RAZ A;  4HV5 A;  5BOX A;  2IT0 A;  1MZB A;  3GVA A;  2JT1 A;  5DV5 A;  4L0Y B;  4BQA A;  1QPM A;  4AIJ A;  1YW7 A;  4O6J A;  2HYG D;  3L9F A;  1BIA A;  3D5L A;  2CO5 A;  3KP3 A;  2GAU A;  2EA2 A;  1U2W A;  1F1Z A;  2P6S A;  2VBW A;  2ISY A;  2FNP A;  1XCV A;  1PP7 U;  1IN7 A;  1SMY F;  4B8X A;  5D4R A;  4I7H A;  1TW2 A;  4R79 A;  3WTS C;  2P4W A;  4WXD A;  1RZ4 A;  1HW5 A;  2RV8 A;  5DD4 A;  1SD7 A;  3T5X A;  3GEZ A;  2L4A A;  4M74 A;  2A6E F;  1FPQ A;  2V1X A;  1SD5 A;  2H09 A;  2M30 A;  1FYK A;  3O6B B;  1MKM A;  5FFX A;  2P8T A;  3WTU C;  1V4R A;  1F5T A;  5LRR A;  3GYH X;  3HSR A;  4KUM A;  3Q5F A;  3I0T A;  2ZME B;  3RKX A;  3RKY A;  1AOY A;  1OPC A;  4KIC A;  6PAX A;  5JI6 A;  1U5T A;  1T2K A;  5LHH A;  1QZY A;  2HYF A;  1FP2 A;  1LDK B;  1S6L A;  4HV6 A;  2PEX A;  2PBI A;  4RAY A;  5KK1 A;  5D4S A;  3BJA A;  4OIQ F;  2V1D A;  3BWG A;  5D8L B;  2L4M A;  2O6G E;  3GW2 A;  3N97 A;  1YYV A;  4KIB A;  5CVU A;  3KP6 A;  2LKP A;  4G6D A;  3EQL F;  1J5Y A;  3BPX A;  4UVA A;  4RB3 C;  2Z5U A;  4ZYD A;  1O3T A;  1GXQ A;  3MCZ A;  1FC3 A;  3ISP A;  3FZV A;  3WTT C;  3IHU A;  2PJP A;  3ZMD A;  1FBU A;  5AIP A;  5BS6 A;  2ESH A;  2DT5 A;  5JHU A;  2GZW A;  5D5W B;  2VOP A;  2ELH A;  3FX3 A;  2E1C A;  1UST A;  3EUH A;  4PGG A;  2YX7 A;  1FT9 A;  5CVR A;  3KLN A;  1ZRE A;  2MC3 A;  2ESN A;  3RKW A;  5HLI A;  2ZO4 A;  2NNY A;  4M73 A;  2ZKZ A;  3NEU A;  4UV9 A;  3LFK A;  3GZ6 A;  1JHF A;  1JXS A;  2WV0 A;  4HF0 A;  4ESJ A;  1R23 A;  3NQO A;  4DNC A;  4IXA A;  3GXO A;  1BOA A;  4KMU X;  4L0Z B;  4M9S A;  2L02 A;  1H9G A;  4LFU A;  3KZY A;  1KYZ A;  3I64 A;  4IRH A;  1QZZ A;  2OD5 A;  3PQJ A;  1TTY A;  4RGS A;  3ZMZ A;  1RI7 A;  5H6R A;  1J9I A;  4YII A;  5ILU A;  5L3E A;  3KET A;  2VOD A;  2MH2 A;  4HAM A;  3I59 A;  3Q9V A;  2XAS A;  1WQ2 A;  2E7X A;  3ZP5 A;  4G7H F;  1KU9 A;  1BM9 A;  3F8F A;  2NRA C;  4CXF A;  1HXD A;  2DI3 A;  3IL2 A;  3DPL C;  5H6Q A;  2G7U A;  2DFI A;  3WTY C;  4UVB A;  2K4B A;  2GXB A;  1LDD A;  3KP7 A;  3NRV A;  3JTH A;  1G3W A;  5F6F A;  1XDS A;  2K7L A;  1KU3 A;  1YO5 C;  4JK1 X;  4LG0 A;  5L3G A;  3M8E A;  3DP7 A;  3ML6 A;  2D1V A;  3F72 A;  3M7G A;  1BI3 A;  5D6F A;  5LGT A;  2M87 A;  1LVA A;  3WU0 A;  2VE9 A;  1XMK A;  3TO7 A;  3V8J A;  2W25 A;  2OZ6 A;  5D5V B;  4U88 A;  2RN7 A;  2XAJ A;  4OMY A;  4BXU A;  1W4M A;  5A2Q K;  2P7V B;  4L18 B;  2IVM A;  1R22 A;  3WG9 A;  3H3Z A;  4CYD A;  1U8R A;  1HW1 A;  3G3Z A;  2FE3 A;  4GCV A;  3U9G A;  4MQV A;  4L5I A;  2XAH A;  3J81 K;  3DF8 A;  2STT A;  1R58 A;  2P5L C;  1QGP A;  2UWM A;  3HRU A;  3C18 A;  5IT3 A;  2HKX A;  1Z05 A;  2CWE A;  2QBY B;  3HTS B;  1G3T A;  1GVJ A;  2QVO A;  5HLH A;  1H0M A;  2QQ9 A;  3KEO A;  4GYI A;  4UHT A;  2VOO A;  2VBX A;  1XSD A;  3LA3 A;  5JR3 A;  2MLK A;  1HST A;  4KN4 X;  4D0P A;  2QQA A;  1T6S A;  1U5T C;  2ISZ A;  2KJC A;  1XSV A;  4HF1 A;  1W7P D;  1GXP A;  1Z9C A;  3RYP A;  4GXO A;  4I0A A;  3FXR A;  2ZJ2 A;  2XV4 S;  3F8M A;  5ILV A;  3CJN A;  3IKT A;  2YPR A;  2HWV A;  4EJW A;  5BPI A;  4FHT A;  2RNJ A;  3GZ5 A;  3LST A;  1YIO A;  2PLY A;  1KGS A;  3FMS A;  4LB5 A;  2Y48 A;  3REO A;  2GQQ A;  4AD9 A;  1YQA A;  4MNU A;  3H92 A;  2FF4 A;  1K78 A;  1B59 A;  4XLN F;  2VT2 A;  5IT9 K;  4LLL A;  4ENN A;  2JPB A;  2KJB A;  5L3C A;  3F8B A;  4ENM A;  4P9U A;  3HRT A;  2XKP A;  2A69 F;  1ZG5 A;  4EVI A;  2KKO A;  3ZMV A;  5FLX Z;  3RPQ A;  2VC0 A;  4MHG A;  4IRI A;  1MJA A;  1W7P A;  1WRJ A;  1J59 A;  1L3L A;  4LK1 F;  3MAJ A;  2BEO A;  1XGS A;  3ABU A;  3T1B A;  3K9T A;  3N4M A;  2RDP A;  3GF2 A;  1IRF A;  3MFK A;  1HKQ A;  3DXJ F;  2NYX A;  3K2Z A;  1ZAO A;  5LBQ A;  1LDJ A;  3BDD A;  3F8C A;  2AS5 F;  4GO1 A;  2FEZ A;  4HLY A;  2PN6 A;  4WXH A;  4WCG A;  5CJ9 A;  2J5P A;  1K6O A;  2A3S A;  4ZYG A;  4A5N A;  1DDN A;  3CTA A;  1FY7 A;  3GFM A;  1CF7 A;  3KE2 A;  4YFX F;  5J8F A;  2DQL A;  3WTZ A;  2FBI A;  1FX7 A;  3TO6 A;  1DPU A;  4HX8 A;  2M5W A;  2HR3 A;  2VBY A;  3JAM Z;  4XSZ F;  4MTD A;  3R6S A;  2V6C A;  2O61 A;  2CGP A;  4R8H A;  2JZY A;  2DBB A;  4UV8 A;  4YFN F;  4EMS A;  1Z1D A;  3K1M A;  1SD6 A;  3ZN0 A;  2EFP A;  2XAF A;  2H94 A;  2GIV A;  3D0S A;  4I09 A;  2TDX A;  3LA2 A;  3J80 Z;  5K5Q A;  2FMY A;  1R1U A;  1IN8 A;  2WTE A;  4FT8 A;  4Y15 A;  5LGU A;  5HDN A;  3SXY A;  3KEQ A;  1KQ0 A;  1G6N A;  1UCR A;  3HSE A;  4HW0 A;  5HDK A;  1ZH5 A;  1QO0 D;  3E97 A;  2WC2 A;  2HS5 A;  3V8K A;  1IF1 A;  3W6J B;  4EM1 A;  5BMZ A;  1I6X A;  4EV0 A;  2PMH A;  1MJ9 A;  2EK5 A;  3E6M A;  5CYV A;  4MQ9 F;  4KIG A;  4E70 A;  5D5U B;  3FXQ A;  2L3D A;  1ZG3 A;  3FHZ A;  1B4A A;  1FOK A;  2ETH A;  4L9T A;  2HTS A;  4BYY A;  4HYE A;  4M72 A;  3CLO A;  3DFG A;  1DUX C;  3W6K B;  3JW4 A;  4EGZ A;  2EV0 A;  2K4J A;  4G94 A;  1BI0 A;  2Z9O A;  5ED4 A;  2MLG A;  1KQ9 A;  2DW4 A;  2YU3 A;  4M71 A;  3QRF F;  4OU0 A;  1TNT A;  4M6Y A;  1XN7 A;  4HDU A;  1I1S A;  2BGC A;  5KVR A;  1FBQ A;  4NB5 A;  1PUE E;  1T98 A;  2UXX A;  4CGZ A;  4HOB A;  3ECO A;  3U2R A;  4YIF A;  1YLF A;  3CUO A;  1YS6 A;  2COM A;  4S05 A;  3RI4 A;  2EFQ A;  2Q2E A;  2XIG A;  1O7L A;  4EJV A;  1T38 A;  4QLC U;  4B09 A;  5LGN A;  3DQV C;  2V1U A;  3WTX C;  1XMA A;  2O03 A;  2XUB A;  1P6R A;  1U5T B;  5EEG A;  1I1G A;  1RUO A;  1BI2 A;  1R5G A;  1OR7 A;  2F5F A;  3RDI A;  1B1B A;  3WGI A;  3V8L A;  2R3S A;  5TRD A;  2XRN A;  3SQN A;  3PFI A;  2F5C A;  2XAQ A;  4I0B A;  4OIN F;  1W5S A;  2L54 A;  1X3U A;  4P9F A;  4WK8 F;  4EGY A;  1RIO H;  2XAG A;  4A0Z A;  4P96 A;  3DKW A;  1KYW A;  2KIF A;  3I58 A;  3F22 A;  1B9N A;  1P92 A;  2DK8 A;  1HBX G;  4XLP F;  2F5D A;  1D5V A;  4BHC A;  3S2W A;  1P4W A;  1R7J A;  1XD7 A;  3FMQ A;  1MGT A;  2FML A;  3QP5 A;  2LF7 A;  4ON0 A;  4Y17 A;  4EM0 B;  1ZN2 A;  4K2E A;  1TQI A;  1HKS A;  2LF8 A;  2PG4 A;  3P9K A;  4O5V A;  4P55 A;  5HDG A;  2EWN A;  4UUV A;  1EV7 A;  4MTE A;  5DUK A;  3ULQ B;  4UXN A;  1LEA A;  5J6X A;  3EYI A;  1O7F A;  1CGP A;  1ULY A;  4S04 A;  5E1Z B;  3P9I A;  2LSO A;  4IRG A;  5TJJ A;  1R00 A;  4LJZ F;  2M1B A;  4U0Y A;  1Y0U A;  3GLX A;  1WWX A;  3C7J A;  5AON A;  1HQC A;  1S29 A;  3F6O A;  3GFL A;  4U7B A;  1BBY A;  3L00 A;  1MJB A;  1EH6 A;  3R4K A;  1Z91 A;  5L3D A;  2DPU A;  1IN6 A;  3WTV C;  4WWC A;  2RVC A;  2FSW A;  3I59 B;  3K0L A;  1FP1 D;  1QNT A;  3HOT A;  4N9I A;  2QZ8 A;  1IUY A;  3CO6 C;  1ODD A;  2IRF G;  4KYW A;  4OIP F;  3JSP A;  3ZN1 A;  1IRG A;  4G7O F;  4BHB A;  1P4X A;  3IWZ A;  2HQR A;  2Y75 A;  1ZGJ A;  3C1D A;  3LAP A;  1SFU A;  3R60 A;  4XRF A;  4IPA A;  2BBY A;  1U78 A;  5D5X B;  2G9W A;  1IAW A;  4LG0 B;  2VXZ A;  4HDV A;  3F23 A;  2F2E A;  4KFC A;  4TV7 A;  5LRS A;  5ILS A;  1Z6R A;  2PFB A;  5HLG A;  2FOK A;  4RB0 A;  3E5Q A;  5K5R A;  2QEN A;  1BC8 C;  5CVJ A;  3SFZ A;  5HVQ C;  2OU2 A;  2ZCW A;  3IWF A;  3DPT A;  4A0X A;  5DCM A;  3CO7 C;  1IZ1 A;  3IRR A;  4L9J A;  4XBF A;  3WGH A;  4G9Y A;  2EJR A;  1HSJ A;  2IA1 A;  4CHU A;  2W57 A;  3LA7 A;  3L2C A;  4EJO A;  3E3V A;  1B6A A;  3KP5 A;  4R1H A;  2JSC A;  2EB7 A;  1J7K A;  4L9V A;  2O3F A;  5AIQ A;  1FBS A;  1PDN C;  1S7O A;  4A12 A;  2E1N A;  3V7R A;  1BC7 C;  2P7C B;  4MEY F;  3E6B A;  2VT3 A;  1TLH B;  2CFX A;  2ADU A;  3K69 A;  3L7W A;  1RUN A;  1Z6T A;  3G73 A;  1WKM A;  3M9A A;  4I2O A;  4NHJ A;  3KP4 A;  4N9H A;  3WE3 A;  4CDG A;  3TO9 A;  3QOP A;  1TQM A;  4NQW A;  2R7F A;  1OYI A;  4A6D A;  2NNN A;  2W84 A;  1BJA A;  1KQ8 A;  2EV5 A;  1P2F A;  3JTG A;  3ABT A;  1F4K A;  4ZYE A;  3P9C A;  2JPC A;  2FQ3 A;  3BP8 A;  3WOD F;  1OYW A;  1R1T A;  3HRS A;  2VBZ A;  3CUQ A;  2OQG A;  4EQQ A;  2W85 A;  4OMZ A;  2OQR A;  3BPV A;  4ENJ A;  4XSX F;  3V7C A;  2HKO A;  2YX4 A;  3ROU A;  3HHG A;  1FWZ A;  1MDM A;  2PI0 A;  1G3S A;  1UHM A;  2D1H A;  1K78 B;  2MA3 A;  5E1W A;  3ZMU A;  2RQP A;  2EFN A;  3MWM A;  3OOP A;  5DYM A;  3GX4 X;  1EH8 A;  3TDZ C;  1T39 A;  2W24 A;  1JGS A;  1S7A A;  3SHF A;  2O0Y A;  3R0A A;  4FX4 A;  1ZGA A;  3KLO A;  3FXU A;  2EV6 A;  4ZZD A;  1OMI A;  4A0Y A;  1W7P B;  2DTR A;  1UB9 A;  2HTJ A;  4MGR A;  2XVC A;  5D6E A;  2ZNY A;  1LNW A;  3RJP A;  5H20 A;  1BI1 A;  4ETS A;  2MBF A;  1IN5 A;  1UFM A;  4HQE A;  2GXG A;  1KU7 A;  5FD6 A;  5L3B A;  2QLZ A;  5JFR A;  3BZ6 A;  4GGG A;  3F21 A;  4U7D A;  2ACJ A;  2BE5 F;  2HDC A;  4Q4Z F;  1P4A A;  3CDH A;  2BV6 A;  4HA8 A;  3V4G A;  5K5O A;  3LAJ A;  4F7Z A;  2LNB A;  3MEX A;  4PCQ A;  3JSO A;  3VOE A;  4KN7 X;  3ELK A;  1QQI A;  2Z33 A;  5ICF A;  4IHT A;  1ZLJ A;  2FBH A;  3FM5 A;  5HS8 A;  1I27 A;  1TBX A;  2CSO A;  3QU3 A;  2DPD A;  1CF7 B;  1O57 A;  3F6V A;  3R0J A;  2IPQ X;  4IVN A;  2Y0M A;  5F1R A;  4PGH A;  2KIU A;  1ZHF A;  4RGU A;  5JVT A;  2ZFW A;  3GFI A;  3T0Y A;  1D8K A;  3TOB A;  1FLI A;  1E2X A;  2Z99 A;  4I98 B;  5HOO A;  1HKT A;  2MD5 A;  5FLX K;  1KU2 A;  5FD5 A;  4KDP A;  3F3X A;  2RGV A;  1S8N A;  3WTW C;  1FSH A;  4OIO F;  4M9Z A;  1ONV A;  1USS A;  4L9N A;  2OZU A;  2IP2 A;  5ICG A;  4IF4 A;  3GWZ A;  2DU9 A;  2MH9 A;  4Q48 A;  2DQR A;  3T8R A;  1IXC A;  1NHA A;  2VC1 A;  1SAX A;  1FYL A;  5EEH A;  2ZME A;  3EYY A;  4M6X A;  4I02 A;  1U6G A;  3QPH A;  3GUD A;  1SFX A;  3DV8 A;  3KCC A;  2GA1 A;  4CIC A;  5E1X A;  4EJU A;  3JAM K;  3MQ0 A;  4G6Q A;  4Q47 A;  4Z2Y A;  4RS8 A;  1SFE A;  3OV8 A;  5FGM A;  1ZRF A;  3IKV A;  3ERE D;  5BQT A;  2QYO A;  4HX7 A;  5D8K B;  3O3K A;  2D45 A;  1PP8 F;  1U3E M;  1E17 A;  2XKO A;  2UZK A;  1TNS A;  4BNC A;  3COA C;  2DLL A;  3WU1 B;  4Q5S F;  2PMU A;  3TOA A;  2E7W A;  1YW8 A;  3TQN A;  2HZT A;  2C6Y A;  1FZP B;  1J0R A;  3J80 K;  5LEJ A;  4A5M A;  3LQQ A;  1V3F A;  1C0W A;  4O3M A;  2JRT A;  4AWX B;  3VFZ A;  3CUQ C;  2FNA A;  5FB2 A;  3FWE A;  4WX9 A;  2RKH A;  1YG2 A;  2QQB A;  2B0L A;  3TKY A;  2DAO A;  3T8T A;  1TQP A;  3AAF A;  3B02 A;  3E6D A;  3VB2 A;  3SZT A;  4BAY A;  1G3Y A;  2FBK A;  4QWQ A;  3FF5 A;  4U0V A;  1KA8 A;  3ZQ7 A;  3LWF A;  3M1E A;  1VTN C;  2ZXJ A;  4G8X A;  1JHH A;  3IC7 A;  5A2Q Z;  1SD4 A;  3KFW X;  2D2W A;  1ON1 A;  2STW A;  1JE8 A;  5LEK A;  2P5K A;  1XB4 A;  1OKR A;  2EFW A;  4ESB A;  5LLQ A;  2EA4 A;  1WI9 A;  3QU6 A;  4LLN A;  2FXA A;  3RIR A;  1D8J A;  3J81 Z;  1F9N A;  1BIB A;  4HQM A;  3ZMS A;  3BJO A;  4LLG F;  4LB6 B;  3M8F A;  2A6H F;  1OYY A;  3RPU A;  1REP C;  4M9X A;  1SMT A;  2XHK A;  5DCF A;  2LDU A;  2A07 F;  2ZBK A;  1TW3 A;  2CG4 A;  2P6T A;  3I5U A;  1O3Q A;  4GYG A;  2ZNZ A;  5DEQ A;  3RTR A;  3WE2 A;  2NS0 A;  1UHW A;  1ZRC A;  4JQF A;  1I5Z A;  3BY6 A;  4LMY A;  1Q1H A;  1XDU A;  4Y13 A;  3BJ6 A;  3HIF A;  4FX0 A;  1XGM A;  3GFJ A;  5K1Y A;  5HS7 A;  3VEP A;  4LGW A;  1R36 A;  3K1N A;  3QPT A;  3KP2 A;  1LB2 A;  4UNO A;  1G4D A;  1L0O C;  2XRO A;  4HF2 A;  3E5U A;  1D3Y A;  1LEB A;  1LJ9 A;  3L09 A;  1J2X A;  2WWY A;  3H3U A;  2UXN A;  5DD8 A;  5FO5 A;  3E5X A;  2H6B A;  3HTU A;  2Z3Y A;  5IT9 Z;  4U0W A;  3BRO A;  1YW9 A;  1H9T A;  1T0F A;  3WGG A;  3BOQ A;  4UVC A;  1RNL A;  4LK0 F;  2V9V A;  2DK5 A;  2YSR A;  4YFK F;  3LQR A;  4A6E A;  1FSE A;  1ZLK A;  2QBY A;  3IRQ A;  1Z7U A;  5F64 A;  4ZH4 F;  3HRM A;  4MEX F;  5E18 F;  3ZMT A;  1GHC A;  1ON2 A;  2K27 A;  4KT5 C;  2HEO A;  2H27 A;  1ZYR F;  4AVP A;  5L3F A;  5ERI A;  4KNY A;  4AIK A;  3PQK A;  2H6C A;  5J8C A;  3R61 A;  2QM3 A;  3MZH A;  1BN5 A;  2BYV E;  2K86 A;  4L5J A;  2Q0O A;  3B73 A;  2G7H A;  2OAZ A;  5DCM B;  4H0E A;  5E20 A;  3DEU A;  2VN2 A;  4IJA A;  4CZZ A;  1EH7 A;  4BH9 A;  2X0L A;  5LHI A;  4OOI A;  4EJT A;  4ZZL A;  1K7A A;  2DO7 A;  4RGX A;  2VE8 A;  4PDK A;  2R7D A;  3HSF A;  1ZRD A;  4OIR F;  4WXC A;  2F5E A;  1HW2 A;  4RB1 A;  1FYM A;  2OBP A;  5DUI A;  3O2P E;  2QUF A;  2HOE A;  3V7S A;  2K02 A;  4EM2 A;  4JBA A;  2QWW A;  1DP7 P;  2JTV A;  4KIF A;  1J75 A;  1A04 A;  4RGR A;  4CO8 A;  1O3R A;  4HZF A;  1QBJ A;  2J5O A;  3HHH A;  4AIH A;  4LD5 A;  3HOS A;  2Q8K A;  1XCB A;  2IA0 A;  5E8G A;  5FFZ A;  2CYY A;  2X4H A;  3TDU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...