5D5VB

Crystal structure of human hsf1 with satellite iii repeat dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
96
Chain Sequence
NVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHDDTEFQHPCFLRGQEQLLENIKRKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human heat-shock transcription factor 1 in complex with DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Heat shock factor protein 1
total genus 26
structure length 96
sequence length 107
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d5vB00
1ZRCA 1K7AA 1TW2A 1BIBA 3I5UA 1XCBA 3E5XA 3E6BA 4DQ2A 5HDNA 5A2QZ 1P4WA 2MLKA 3W6KB 1BC8C 2XASA 3O3KA 5HLIA 1A04A 4LLLA 2FOKA 3TOBA 3DP7A 1Z6RA 2DTRA 2HYGD 4L5JA 1WQ2A 4KMFA 3F3XA 4G6DA 3BWGA 5K5RA 4BQAA 1GHCA 1KQ8A 2VBXA 5CVRA 4EM1A 1FBQA 4R79A 1LDKB 1MJ9A 2GWRA 4ZZDA 5FB2A 1YW9A 2VODA 2MC3A 3ERED 2P5VA 4BYYA 2G7HA 4RB1A 1HXDA 2JZYA 2W25A 1OPCA 1XGSA 4ON0A 3GFLA 2K4BA 3MWMA 1SD5A 4HZFA 4UXNA 1IN4A 1Z6TA 4AWXB 1MD0A 3F8NA 3S2WA 1F9NA 3BJ6A 1SFXA 3JTHA 4LMYA 4TV7A 3K0LA 2GA2A 2EB7A 1R00A 3TDZC 1EH8A 4BHBA 5HLHA 1R36A 3T5XA 5JFRA 2FE3A 1NHAA 1RZ4A 3RPUA 1D8JA 2M30A 3WTTC 4IRGA 2V79A 1HSJA 3R61A 2AXLA 1UCRA 5LHHA 2XHKA 2BV6A 4BHPA 3G73A 2HQRA 3H92A 3FM3A 5DD8A 3BP8A 5FLXK 4P96A 5JHUA 4A5MA 2JPBA 4ESFA 1W7PA 1KU7A 2WC2A 2P5LC 4JQFA 1G3WA 5L3CA 4LD5A 3OV8A 1H9GA 1SAXA 5DUKA 1U3EM 3WE3A 3WU0A 1I1GA 4Q5SF 2HGCA 1RNLA 3R0JA 5HDGA 2HTJA 4E70A 3E6MA 4GYGA 2QENA 5D6EA 1KU3A 4OOIA 5E17F 2K4JA 2VOPA 3WU1B 4MTEA 2Z5UA 2QBYB 4P55A 1D3YA 3KP2A 3IC7A 1HW1A 1RUOA 3ZMZA 1DUXC 5DV5A 3IRRA 2OD5A 1D8KA 1FBSA 3L2CA 3QRFF 2XAFA 1J7KA 1YS7A 1HKTA 3I58A 4Q48A 1Z05A 3R0AA 4HF0A 2CSOA 2XAQA 1XDUA 2V1UA 3F8MA 5LHIA 3LQQA 4JBAA 1H9TA 1ZN2A 1T0FA 5DCFA 3RDIA 5TJJA 4KT5C 5HS7A 2VC0A 2EWNA 2DW4A 3CDHA 1IN8A 4GCVA 2PMUA 3QU6A 1YW7A 2IW5A 1QPMA 4LLGF 2A6HF 1ZYRF 2DBBA 2FU4A 1LNWA 4ENKA 3ZQ7A 2ISZA 1IUYA 3V7RA 1B6AA 1X3UA 4UVBA 3JAMK 4GO1A 3AAFA 1MJAA 3TO7A 2W57A 3EDPA 4HW0A 2A69F 2ZNZA 2ZKZA 4M6XA 5IT3A 3ZP5A 3DFGA 2ZMEA 1QQIA 2HQNA 2XUBA 2Z9OA 4OIRF 3P9KA 5L3FA 2CO5A 1U2WA 1Z7UA 3QP6A 2IP2A 5JVTA 5E18F 1JXSA 4WXCA 1YLFA 4P9UA 1USSA 4EGYA 2BYVE 4U88A 4LGWA 1HW2A 3L9FA 1KQ9A 1JE8A 3BROA 2H27A 4EGZA 2GXBA 3DPTA 4KNYA 5K1YA 1I27A 2DU9A 3F8CA 3VB2A 3BOQA 4CHUA 3T1BA 1FBUA 1HKSA 5J6XA 3DKWA 3FM5A 2DFIA 1G3SA 1FPQA 1TQPA 3IKTA 5AIPA 4U7DA 1P2FA 3FMRA 1R1TA 1IW7F 2EFNA 2HR3A 2CWEA 1F1ZA 3T8TA 1IN7A 2IA0A 1YG2A 1ZREA 1AWCA 1F4KA 3V7SA 2QM3A 2RQPA 4L5IA 4KMUX 2UXXA 5AONA 1CGPA 3E6CC 4ZH4F 1TNTA 3KEOA 3R4KA 2EFPA 3BJAA 4G9YA 4YFNF 1YO5C 2V9VA 1E2XA 4ENJA 3V7CA 3HTSB 1UB9A 1MZBA 3DF8A 3ML6A 2XROA 5FFZA 1IF1A 4BHCA 1Z1DA 3LQRA 1RIOH 3PQJA 1BI0A 2HWVA 1WI9A 1U5TC 1ZG3A 4PZJA 1R5HA 1O3TA 1WKMA 1TQMA 1G4DA 3GX4X 1BBYA 4MNUA 2FBIA 2ZFWA 1O57A 3N97A 3O6BB 2ELHA 5FD5A 2UWMA 2XV4S 4D0PA 4LG0B 3GFMA 3KP7A 3MFKA 2RV8A 1KYWA 1QO0D 2STWA 4RAZA 2ZNYA 2PEXA 4Y17A 2UXNA 2OBPA 5DCMB 3RJPA 3WTWC 4DNCA 3WG9A 4YG2F 4MEXF 3LAPA 4OIOF 3GO5A 2F5DA 1XB4A 3I4PA 3DQVC 3P9IA 3J81K 2Q8KA 1J9IA 1HKQA 5H6RA 4EJUA 1FLIA 3RTRA 4KIFA 1O7FA 5CVJA 3Q5FA 3E5UA 2A6EF 2R3SA 2VBZA 3MCZA 1HQCA 5E1WA 4A12A 2PI0A 4CDGA 3ABTA 4AIHA 1B59A 3SZTA 3CUOA 1JHFA 1ZG5A 4ZZLA 4MGRA 1IRFA 4UVAA 4WCGA 2FRHA 3VEPA 4EVIA 4G94A 3H3UA 3KETA 3DPLC 4LLNA 5LEJA 3K2ZA 3LAJA 2EA4A 1UHMA 1V3FA 3RYRA 4LK0F 1S3JA 2K86A 4HDUA 1K6OA 1MDMB 2P6TA 1SFEA 3K1NA 3H3ZA 3K1MA 1E17A 3SQNA 3VFZA 5CYVA 2XAJA 1LQ1A 4WX9A 1WWXA 2QBYA 3NEUA 2KJCA 3SXYA 3T8RA 2M5WA 2GZWA 3I64A 4UVCA 1DPRA 3EQLF 2WWYA 1O3RA 2UZKA 5FO5A 1TQIA 4ENMA 1YTYA 3QPTA 4GXOA 2VE9A 2Y48A 3COAC 2EV6A 3C1DA 4UNOA 4LFUA 4WF2A 2DPDA 4BXUA 2QZ8A 4OU0A 1IN5A 4I09A 5BPIA 2FBKA 1O7LA 2EV0A 5L3EA 4ASNA 1W5TA 3BPXA 3TGNA 3RKWA 1FY7A 4GYIA 1T39A 5LGNA 4IRIA 3RYPA 2P4WA 1QNTA 2KJBA 1CF7A 1ZLJA 2X4HA 2IVMA 4IJAA 4BNCA 1U5TB 3IKVA 4A0XA 1HBXG 1YYVA 4KIBA 1H0MA 2HS5A 2L4MA 2AS5F 1R22A 4MTDA 5JR3A 3KLNA 5LRRA 5K5OA 2EK5A 1TLHB 2DT5A 1P6RA 1I1SA 3FMQA 1W4MA 4KDPA 4RGRA 4CYDA 3MZYA 4G7HF 2RC4A 1U6GA 3NQOA 4EM0B 2QLZA 5ILVA 5F64A 2YU3A 4QLCU 1ZLKA 4BAYA 3NRVA 5D4SA 2FSWA 2Z99A 4K2EA 2F5CA 5E8IA 5H6QA 1FYMA 2LDUA 5ERIA 2ACJA 2P8TA 3F8FA 2ZCWA 2PFBA 2M45A 1G6NA 1BI3A 3I53A 2RN7A 1Z91A 1I5ZA 1R5GA 1W5SA 2ZO4A 3F6OA 1BN5A 1R7JA 2XRNA 1LEBA 3HHGA 3ELKA 3C3WA 4S05A 1TNSA 3SZPA 4WWCA 3CUQC 1J0RA 4M9SA 3WGHA 3KLOA 2JSCA 1DPUA 3V8LA 3L00A 5E8GA 5FD6A 5FGMA 3IL2A 4UUVA 1J5YA 4I0BA 1XD7A 2NNNA 1OR7A 3KP6A 1VTNC 4MEYF 2B0LA 3SFZA 2L01A 2P7VB 1C0WA 2Y75A 1S29A 5ILSA 3MEXA 4OIQF 2F5EA 2G7UA 2W84A 2QWWA 3WE2A 1U5TA 3IWZA 5IT9K 4O5VA 3WGIA 2JRTA 2M8EA 2NS0A 2A3SA 1SMTA 2ISYA 3GFJA 5K5QA 3EETA 3N4MA 3KP3A 5D5VB 4L9JA 1O3QA 2EFWA 3Q9VA 2D45A 4RB3C 1U8RA 3E97A 5DEQA 1ONVA 2LNBA 1WSUA 4RGUA 2RDPA 5HS9A 2ZJ2A 5D4RA 4ESBA 3LA7A 3TDUC 3RKYA 1P4AA 2OQGA 4WXHA 2VBYA 4KFCA 3CJNA 2D1VA 2LSOA 1IXSB 1LVAA 4UV8A 3JTGA 4YIFA 1ZARA 1IN6A 1FC3A 3GZ6A 4FT8A 4YFXF 5JI6A 2MH2A 3GEZA 5J8FA 1DP7P 3U9GA 2A68F 2IA1A 1JGSA 3GXOA 2COMA 4XLNF 2H09A 4A0YA 1FOKA 5ED4A 4U7BA 2XIGA 3HRTA 1FWZA 3KZZA 4F7ZA 2HZTA 4UV9A 2OAZA 3BZ6A 1ZGAA 2KIUA 1OMIA 4HLXA 2FMLA 4Z2YA 1XGOA 1R23A 4AIJA 4YFKF 3TQNA 3GW2A 5EEGA 4KYWA 3E5QA 1FT9A 4LB5A 2YPRA 5D5UB 4M72A 1FNNA 4LJZF 4IHSA 1SD4A 3F22A 1ULYA 2W24A 2IA2A 2L02A 3C7JA 1HW5A 2PN6A 2FMYA 5CJ9A 3GZ5A 1IZ1A 5ICEA 4HQEA 4S04A 2L4AA 2YSRA 5AIQA 5D5WB 1UFMA 1T2KA 4FHTA 2NYXA 1BI2A 1PUEE 4EMSA 4AIKA 4B09A 1XSVA 4IRHA 1PP8F 5HS8A 4JK1X 5E1XA 2XKOA 4NHJA 2P6SA 4CXFA 4L18B 3V4GA 4L0YB 3CUQA 3WTUC 4HDVA 3ZPLA 3FXUA 4XLPF 1WRJA 3D5LA 3FF5A 4B8XA 3C18A 2EFOA 2J5OA 3J80K 1ON2A 1ZRDA 1U78A 2VT2A 3O2PE 2HFHA 2BEOA 4P9FA 2GIVA 5H20A 2HDCA 4LG0A 4KN4X 4CGZA 2H94A 2Q0OA 1IXRC 4HX8A 1LB2A 1YW8A 1ZRFA 3QU3A 5L3BA 2VXZA 2MA3A 5E1ZB 2M87A 1OKRA 4U0WA 2E1CA 2D2WA 4ZYDA 1SMYF 3B73A 3BPVA 2CFXA 4M74A 3EYYA 5CLSA 4Y13A 2DAOA 3I59B 4A6DA 1OYWA 5J8CA 1K78A 3ISPA 1ZHFA 2CGPA 4XBFA 1R1UA 4M71A 4ETSA 1S6LA 3TOAA 4EJVA 2FBHA 4HQMA 2KKOA 3B02A 4MHGA 4HX4A 1YFHA 4ZYGA 3I0TA 4G8XA 5A2QK 4AVPA 4H0EA 3DEUA 3CO6C 2VC1A 3GFIA 4HX7A 1D5VA 3JAMZ 3KP5A 2O3FA 2OA4A 5L3GA 5ICCA 5DCMA 3GF2A 5HVQC 1XN7A 2MBFA 2E7XA 2RNJA 3DXJF 3ZN1A 3RKXA 4AD9A 1HSTA 3RI4A 1KU2A 1L0OC 1B1BA 2IT0A 1MDMA 2Y0MA 2FEZA 1ZAOA 1BIAA 1LDDA 2QVOA 2CQKA 4Q4ZF 4A5NA 3CO7C 1XGNA 2F5FA 3BY6A 1RI7A 4HYEA 4HBLA 4RB0A 5BPDA 5BQTA 3RPQA 3U1DA 2ADUA 2JTVA 2VOOA 5ICGA 2BBYA 2DK5A 2L3DA 3BDDA 2JPCA 4OINF 1ON1A 2GAUA 2G9WA 4U0YA 3HOSA 2EV5A 4M9ZA 2KIFA 4A6EA 4N9HA 4KA4A 3ULQB 2OZUA 2QUFA 2QQBA 1EH7A 4O3MA 1V4RA 2IJLA 2KIMA 4RGXA 1BM9A 2W85A 2XAGA 4HOBA 3GLXA 2FXAA 5LEKA 3HOTA 2OU2A 4KUMA 3KP4A 2DO7A 4G7ZF 3GUDA 4I7HA 2IPQX 3TO6A 2PG4A 1OYIA 2A5YB 4IHTA 3ZMDA 3W6JB 3IHUA 1T38A 2FNAA 3KCCA 1S7AA 2M1BA 2C6YA 4HV5A 3M9AA 4KIGA 4P5OA 1R58A 2KRFA 3HTUA 4IF4A 1EV7A 4EJWA 4EQQA 4HLYA 3IRQA 3I54A 1QZYA 4HV6A 4HA8A 3SHFA 2P7CB 1YS6A 4FX4A 2DPUA 5HLGA 1ZGJA 3D0SA 4A2UA 2GA1A 3REOA 3IWFA 1F5TA 3JW4A 2YX7A 1GXQA 1B9NA 3GWZA 3KFWX 3EUHA 3KEQA 1RUNA 2V1DA 4M9XA 1MJBA 3J80Z 2XVCA 3EYIA 3FX3A 5L3DA 3BJOA 1Z9CA 2DI3A 1ZG1A 1JHHA 3FWEA 5FLXZ 3F72A 3LSTA 1BOAA 3M1EA 2VBWA 4GGGA 2GXGA 4L9NA 3WTSC 4I0AA 1LJ9A 2BE5F 5E20A 2E1NA 5LRSA 3M8FA 3DV8A 1SD7A 2MH9A 2D1HA 1P92A 3ZMTA 5DYMA 2FF4A 1REPC 4I02A 3MZHA 5BMZA 3M8EA 3L7WA 2HKOA 4LB6B 1I6XA 6PAXA 1IRGA 1FYLA 1MKMA 3MAJA 3CUQB 3T0YA 1SD6A 4A0ZA 5ICFA 3KE2A 1TW3A 2QQAA 4NQWA 4MQ9F 3HIFA 4QWQA 2O03A 1USTA 4XRFA 3WTZA 1T98A 1FSHA 2Z3YA 1KU9A 1EH6A 1CF7B 2HTSA 5HOOA 1J2XA 1BJAA 4IXAA 1AOYA 1TBXA 3K1PA 4L0ZB 2YX4A 2PBIA 5KK1A 4R8HA 5F1RA 3ZMSA 4RGSA 5BS6A 1GXPA 3VOEA 3FZVA 2H6BA 2FQ3A 2Z33A 3PFIA 2DQLA 2BGCA 2O0YA 3QPHA 3HSFA 4CO8A 3ZMVA 2XAHA 1LDJA 1PDNC 3QP5A 2O6GE 3E6DA 5F6FA 2IRFG 2CW0F 1KGSA 2E7WA 1TTYA 1W7PD 4N9IA 2ZXJA 4I98B 2V6CA 3PQKA 2LKPA 2HKXA 4KN7X 5D8LB 2K27A 5CVUA 1KA8A 3J7AO 2XKPA 1XSDA 4EJTA 4ZYHA 4XSXF 2P5KA 1LEAA 2WTEA 1G3YA 3ZMUA 1SFUA 2MD5A 4RAYA 3HRUA 4CICA 2RVCA 4HF2A 2GQQA 1KQ0A 4FX0A 3WTVC 2O8XA 2YR2A 2PJPA 2FA5A 3F6VA 3J81Z 1YIOA 1XMAA 4NB5A 5ILUA 1O3SA 3WODF 5DUIA 5D6FA 1DDNA 5CVIA 3WTYC 1B9MA 4I01A 3KZYA 1R1VA 5FFXA 2ETHA 3TO9A 3HSRA 4O6JA 4ESJA 1XGMA 4PGGA 3WGGA 2HEOA 5DD4A 4CZZA 3FMSA 2H6CA 3JSOA 1S8NA 2MLGA 4L9VA 1FSEA 4G7OF 4R1HA 2F2EA 2J5PA 3P9CA 2XGXA 5KVRA 2ESHA 4ENNA 3FHZA 4MQVA 1G3TA 4PGHA 3V8KA 2TDXA 1IXCA 5EEHA 1FYKA 3E3VA 3GYHX 3K69A 3MQ0A 2DQRA 2ESNA 3FXQA 3HUGA 3I59A 2OQRA 2EJRA 3TKYA 4OIPF 3F8BA 2X0LA 4M6YA 1S7OA 3CLOA 3L09A 1J59A 1T6SA 5HDKA 2A61A 2V1XA 3ABUA 1FX7A 4EM2A 2FNPA 5LLQA 2PMHA 3LFKA 2O61A 5TRDA 2DLLA 1FP2A 1W7PB 1UHWA 3F23A 2WV0A 3WTXC 3QOPA 1ZH5A 3Q9SA 3CTAA 1Q1HA 4IPAA 1K79A 2LF8A 1L3LA 3OOPA 3ROUA 2VE8A 4EV0A 2OZ6A 3HRSA 4OMYA 4G6QA 3RIRA 3V8JA 4PCQA 3HRMA 1YQAA 4RB2C 2A07F 3K9TA 3LA3A 4HF1A 3ZN0A 2VONA 4I2OA 3I71A 2HOEA 4EJOA 2NNYA 1QZZA 3ECHA 5LBQA 5LHGA 3HHHA 4RS8A 2JT1A 4BH9A 1ODDA 2EFQA 1MGTA 3HSEA 2QYOA 1P4XA 4PDKA 1FZPB 1XSXA 2PQ8A 4N0BA 2LF7A 2ZBKA 2CG4A 1B4AA 3LWFA 4U0VA 4LK1F 4OMZA 3VODA 2HYFA 2K02A 4IVNA 1XMKA 2Q2EA 3G3ZA 4L9TA 1FP1D 4UHTA 3QAHA 2VN2A 3F21A 1STZA 1Y0UA 2NRAC 1KYZA 5CVVA 2L54A 4WXDA 1XCVA 1BI1A 4ZYEA 4YIIA 5D8KB 5IT9Z 1GVJA 5DDGA 1PP7U 3HYIA 3ECOA 4WK8F 1J75A 3R60A 3R6SA 2QQ9A 2RGVA 1BC7C 3GVAA 4HAMA 2K7LA 2STTA 4KICA 2CYYA 3M7GA 2DK8A 2R7FA 1QBJA 3FXRA 4M73A 4Q47A 2VT3A 5D5XB 2NAZA 5LGTA 2PLYA 1OYYA 1XDSA 5BOXA 1K78B 2ZMEB 3JSPA 4XSZF 5LGUA 3P7NA 2RKHA 2EA2A 3U2RA 1QGPA 1IAWA 4Y15A 3LA2A 2R7DA
chains in the Genus database with same CATH superfamily
1ZRCA 1K7AA 2C6YA 4F93B 1TW2A 1TWHJ 1BIBA 4A3KJ 1OISA 1XCBA 3I5UA 2V7FA 2Y31A 3E5XA 3E6BA 1N78A 1OJLA 4RLQA 4DQ2A 1FOWA 2K9SA 4M3DA 2HDDA 5HDNA 3KZIC 5A2QZ 3FKJA 3PNVA 2R7WA 4II2A 1P4WA 2MLKA 2DA7A 3W6KB 3HL2A 1BC8C 2JA5J 2XASA 3DLLF 2M4GA 1TWAJ 3O3KA 1YX5A 1T95A 2OF7A 3BTIA 1Y1WJ 1AKHA 5HLIA 1A04A 4LLLA 2FOKA 3TOBA 3DP7A 1K6YA 1Z6RA 2DTRA 3CF5F 2B9SA 3Q0VA 1HDDC 2R7OA 1MMGA 1WJFA 2HYGD 3LSIA 4L5JA 1WQ2A 3G71I 4KMFA 3F3XA 3O8HA 4G6DA 3BWGA 1PJRA 2QCOA 5GAGJ 5K5RA 2LKXA 4BQAA 2K9MA 1GHCA 1KQ8A 3CMAI 3SDGA 2VBXA 1WJCA 2BW3B 5CVRA 4EM1A 2NXNB 2E2IJ 1FBQA 2HU9A 4R79A 1LDKB 4BL0B 1MJ9A 2GWRA 4ZZDA 1JI8A 5E3OA 5FB2A 1YW9A 2VODA 2MC3A 1LFPA 3AL0B 3PL8A 2LBFA 2P5VA 4BYYA 2G7HA 3ERED 3U21A 4RB1A 3FISA 1HXDA 1EF4A 2JZYA 2W25A 2CQ7A 1OPCA 1XGSA 4ON0A 2Q2EB 3GFLA 2K4BA 3MWMA 5FKNA 4G6TB 1SD5A 1Y39A 1YRNB 1ETKA 4HZFA 2ZMEC 2ZSHB 2M7AA 4G12A 4UXNA 1IN4A 2L5QA 1Z6TA 2RNGA 3DBLB 3FDYA 2VJ4A 2DOFA 4AWXB 1MD0A 3F8NA 3S2WA 3PJRA 1S72I 1F9NA 3BJ6A 1SFXA 3JTHA 5B5EC 4LMYA 2CQQA 1IGNA 2VASA 4N4NB 4TV7A 3K0LA 4FE4A 2GA2A 2EB7A 3ZQIA 2OJED 3ASOH 1H88C 2EIKH 3G1LA 2QF7A 3CP2A 1R00A 3TDZC 1EH8A 4BHBA 4DYRA 4BJ5C 5HLHA 5FKKA 1R36A 3K4JA 3T5XA 5JFRA 2R7ZJ 2FE3A 1DQUA 1NHAA 1RZ4A 4DGWB 2LD5A 3RPUA 1LE8B 2M30A 2VPLA 3WTTC 1D8JA 4IRGA 1JJ6C 2V79A 4HPQA 1E3PA 4PFOA 3BG7A 1QZEA 4IKFA 4CZCA 1HSJA 4BDZA 3R61A 2AXLA 1UCRA 5LHHA 4X6AJ 2XHKA 2BV6A 1DGWY 2IEKA 3HJEA 1ERDA 4BHPA 3G73A 1H89C 2HQRA 3H92A 1IV6A 3FM3A 1IV8A 3BP8A 5DD8A 4P96A 5FLXK 5JHUA 3HPHA 3L2VA 4A5MA 2JPBA 4ESFA 1W7PA 4XKWA 2P0WA 2WC2A 1KU7A 2P5LC 3OIOA 2XB5A 4JQFA 4XKCA 3UR3C 1G3WA 2NVTJ 5L3CA 5IP9J 4LD5A 3OV8A 1H9GA 2XDVA 1MSEC 1SAXA 1A35A 5DUKA 1U3EM 5E79C 3WE3A 3I4MJ 3WU0A 1I1GA 4Q5SF 2HGCA 1RNLA 3R0JA 5HDGA 3BR3A 2HTJA 2ZXWH 3K4LA 3HM5A 4E70A 2GOXB 1YJWI 2DMUA 1MBJA 1Y8QB 2VKHA 3E6MA 2A5WA 4GYGA 4LG3A 1R71A 2R92J 2QENA 5D6EA 3HGGA 1XG1A 4A3FJ 5CPRB 1KU3A 5LFAA 3HXLA 4PJ0C 4OOIA 5E17F 4CCOA 2M9HA 2K4JA 4XR6A 2Q1ZB 4UUSB 4C2MJ 2VOPA 1I39A 3WU1B 3S8PA 2R5ZA 1LPQA 2VLAA 4MTEA 2AQFA 4QSHA 1ZK8A 4LITA 3CCEI 4FISA 2Z5UA 2QBYB 4P55A 1D3YA 3KP2A 2KRHA 3IC7A 2EZIA 1HW1A 1RUOA 3ZMZA 1DUXC 5DV5A 3IRRA 2OD5A 1D8KA 1FBSA 2Z1DA 4HNUA 3L2CA 3QRFF 3FXKA 2HQ5A 2XAFA 3CJTB 1J7KA 1YS7A 3A01A 1HKTA 1VF9A 3I58A 1XS9A 4Q48A 1SVLA 4XK4A 3Q0WA 2DA1A 2KFDA 1Z05A 2UUZA 4YIRX 3R0AA 1YRNA 4HF0A 2H1LA 3H3VK 2MSYA 2CSOA 2XAQA 1XDUA 2V1UA 3F8MA 3CMYA 1BOBA 5LHIA 3LQQA 3G2BA 4JBAA 1UJ8A 4EEFG 1H9TA 2DOAA 1LKXA 1ZN2A 1R4NB 2JVGA 5FKMA 2EPFA 1T0FA 1VQ8I 3GTKJ 1M1EB 5DCFA 3RDIA 1VZ0A 5TJJA 1VQPI 4MIMA 3GTOJ 4KT5C 4HNVA 2KL4A 5HS7A 2VC0A 2EWNA 4XLFA 1BA5A 2M34A 2DW4A 4YEJA 4RM2A 3H5RA 3CDHA 3GTJJ 1IN8A 4GCVA 4BGDA 2PMUA 3QU6A 1YW7A 1KONA 2IW5A 2QSFX 4V19K 2CUZA 1QPMA 1S7EA 2OTJI 2DMNA 4LLGF 4UB8C 2A6HF 1RC9A 1ZYRF 2HVRA 3H5NA 2DFFA 3IAM2 1ZELA 3CMEI 3N05A 2DBBA 2FU4A 1LNWA 2KHMA 4IHVA 3CESA 4ENKA 3ZQ7A 4DJAA 3DEWA 1WCMJ 1Y1VJ 1HDPA 3OYFA 2ISZA 3DKXA 3V7RA 1IUYA 1B6AA 2XRLA 5M3MJ 3OR1C 1X3UA 4UVBA 3JAMK 4GO1A 3AAFA 1MJAA 5E3MA 2OUMA 1VQ6I 3TO7A 2M8GX 3EDPA 1FOYA 2W57A 3ERMA 1MMDA 3JRCA 5F08A 1QPIA 4XRSA 4HW0A 2DJIA 5IYCJ 2A69F 2IXSA 2ZNZA 2ZKZA 2FX0A 2JWTA 2EZLA 4DBRA 4Y7NJ 4M6XA 5IT3A 4BY7J 2KDOA 3ZP5A 3DFGA 2ZMEA 1QQIA 2HQNA 3RCOA 5C4JJ 1TWGJ 4E7SA 1R49A 2XUBA 2Z9OA 2WB1A 3ASNH 4OIRF 2AXTC 3P9KA 5L3FA 2CO5A 1U2WA 1Z7UA 3QP6A 2IP2A 5JVTA 2W1OA 1VQNI 5E18F 3KYLA 2Y9ZA 1HF0A 2KIQA 2HDWA 1A5JA 3H5AA 5K7FA 1JXSA 4WXCA 2OTLI 1YLFA 4P9UA 1USSA 5JLXA 2BYVE 4EGYA 1ZR4A 4U88A 4LGWA 1HW2A 3L9FA 1KQ9A 1JE8A 4XQFA 3BROA 2H27A 1Q1VA 1JTXA 2E1MB 4EGZA 3BQYA 2GXBA 5K7ZA 3DPTA 4XLEA 3MVPA 2XF6A 1ETYA 2X6OA 3FK6A 4KNYA 5K1YA 1I27A 2VQGA 3BG5A 4AIDA 1SC7A 2DU9A 3ZOBA 3F8CA 3VB2A 3BOQA 4CHUA 3M4OJ 1FEXA 3T1BA 3BG3A 1A31A 1FBUA 2K85A 1HKSA 2HNHA 2HI3A 5J6XA 3PO3J 3DKWA 1JKQC 3FM5A 2OC6A 3H9JA 2DFIA 1H8AC 3VYUB 1G3SA 2JA6J 1FPQA 1TQPA 1W36D 1HC8A 2ZB9A 5AIPA 3NARA 3IKTA 4MFEA 3RKQA 2DCEA 3FHNA 5E3NA 4U7DA 1P2FA 3FMRA 3OIQA 1R1TA 1IW7F 3C2GA 1PUFA 3CF2A 2EFNA 3AG2H 5GTIC 2HR3A 2EIMH 3DKYA 2CWEA 3VYRB 5M3FJ 1F1ZA 4PK4A 3CC7I 4XORA 3T8TA 3S32A 3DEEA 1IN7A 2IA0A 1YG2A 1R9TJ 1ZREA 1AWCA 3M07A 2CJJA 1U9OA 4XNFA 3V7SA 1K4TA 1F4KA 2O8KA 2QM3A 2RQPA 4L5IA 3EUAA 4KMUX 2UXXA 2E2HJ 5AONA 1CGPA 4JX6A 3E6CC 4YRVA 2QGUA 4ZH4F 1TNTA 3KEOA 4BBSJ 3R4KA 1XMXA 2EFPA 3BJAA 3A4CA 4DOZA 3E1SA 1Y56A 4G9YA 4YFNF 1YO5C 2V9VA 4DZJA 4E7HA 1E2XA 2R0QC 4ENJA 3V7CA 3HTSB 1MMSA 1UB9A 1MZBA 5J1RA 3DF8A 3ML6A 2XROA 2MGQA 2MFZA 5FFZA 2DN0A 2XF7A 3PIPF 5J3LA 1OCZH 1IF1A 2XGCA 2QQ8A 4BHCA 1Z1DA 3LQRA 1RIOH 5LD2C 3PQJA 3CCUI 1BI0A 2HWVA 1WI9A 4OAYA 1U5TC 1T33A 1ZG3A 4BXXJ 4PZJA 1R5HA 5IOZA 4BE0A 2X6XA 4F91B 3HOWJ 2COBA 1O3TA 1WKMA 1TQMA 2UV1A 1G4DA 3GX4X 3J7ZI 2LR8A 1VFCA 4XOPA 1BBYA 3CCLI 2IS4A 3ABLH 4MNUA 2FBIA 1WH5A 3FXMA 1MIJA 1OR7C 2ZFWA 3ONQA 3G1MA 3CP8A 1D0YA 1O57A 2WBMA 4NC8A 3N97A 4XLCA 4IL6C 3O6BB 2ELHA 5FD5A 2UWMA 2XV4S 2XSJC 4D0PA 4RBOA 2E1OA 3WU2C 4LG0B 2KDZA 3GFMA 1DGRM 2B7EA 1YOVB 3KP7A 2BHZA 4IEJA 4ZDPA 4BQNA 3MFKA 2RV8A 1KYWA 1QO0D 4FASD 2STWA 4RAZA 2ZNYA 2PEXA 3ZQQA 2IGMA 2ZXIA 4Y17A 2UXNA 2V4JC 5TISC 2OBPA 3AL0C 5DCMB 3RJPA 3WTWC 1MH4A 4DNCA 5M5YJ 1I50J 3WG9A 3OYNA 4YG2F 3S93A 4MEXF 5TGTA 3LAPA 4OIOF 3GO5A 2F5DA 1XB4A 3I4PA 4DYQA 2WB1N 3DQVC 5K7HA 2BVMA 3P9IA 3J81K 2Q8KA 1J9IA 5IOYA 1HKQA 4V2FA 5H6RA 4EJUA 1FLIA 3RTRA 4W97A 4KIFA 1O7FA 5CVJA 4XRSG 1D1BA 2XGDA 3E5UA 1X4PA 2GOMA 3Q5FA 1UHSA 2A6EF 2R3SA 2VBZA 1OCOH 1TP4A 3F0CA 3MCZA 1HQCA 5E1WA 4A12A 2PI0A 4CDGA 3D5RC 3ABTA 4AIHA 3L2WA 3GTGJ 1B59A 3SZTA 3CUOA 5IP7J 3BC8A 3OS2A 2IGOA 1UELB 1JHFA 3IUOA 5F04A 3BTJA 1ZG5A 4ZZLA 1E0EA 2H8WA 4N4OB 2V26A 4MGRA 2V1NA 1IRFA 4UVAA 4H4KC 4WCGA 3I4NJ 2FRHA 3M8JA 3FIWA 3VEPA 3QODA 4EVIA 4G94A 1IO2A 3H3UA 4AC0A 3G6EI 2ELKA 3KETA 3DPLC 5LEJA 2ELJA 4LLNA 3K2ZA 1X4OA 3LAJA 1LVKA 2EA4A 1UHMA 4QPOA 3TMOA 1V3FA 3IH2A 3RYRA 1QA6A 4LK0F 1S3JA 4NC7A 3JR9A 2GXAA 2K86A 4HDUA 1K6OA 1WJAA 2X48A 1MDMB 2ID6A 2P6TA 3MN2A 1SFEA 3K1NA 3H3ZA 1APLC 3K1MA 2CMPA 3DLAA 1E17A 3DTKA 2ID3A 2L7KA 3DPUA 3SQNA 3BR5A 3SEZA 3VFZA 5CYVA 2XAJA 5DS9A 1LQ1A 1D5YA 5JHFA 4WX9A 1WWXA 3SFIA 1GV5A 2QBYA 3NEUA 1BW6A 2KJCA 3SXYA 1V5GA 3T8RA 2M5WA 2GZWA 3I64A 3PSIA 4MO7A 4FE7A 4UVCA 1DPRA 3EQLF 2WWYA 3S3NA 1O3RA 1QU3A 2UZKA 5HODA 3Q0UA 1T0FC 1YIJI 1X58A 3HEFA 5FO5A 1TQIA 2BW3A 3FBNB 1WJBA 4ENMA 4IQ4A 1YTYA 2F48A 3TEDA 3QPTA 2K9QA 4GXOA 2VE9A 2Y48A 3COAC 2EV6A 3BT9A 3C1DA 3AG4H 2BY0A 2K40A 3GMEA 3KX2A 4UNOA 4LFUA 4WF2A 2DPDA 3K70D 5FROA 1UG2A 2QZ8A 3EPZA 4OU0A 4BXUA 4CCJA 2QA4I 1IN5A 3HDDA 1OQYA 4I09A 3SZGA 2LFBA 5BPIA 2FBKA 1O7LA 2EV0A 5L3EA 2KZGA 4ASNA 1W5TA 3BPXA 2E71A 3BCAA 3TGNA 4I6ZA 3RKWA 3ABKH 1FY7A 1IRXA 1UG0A 4GYIA 1T39A 5LGNA 4IRIA 3RPUD 4XIDA 3RYPA 4IHXA 3A0HC 3S3MA 5B66C 2P4WA 1QNTA 2KJBA 1CF7A 1ZLJA 2X4HA 5DM6F 2IVMA 4IJAA 4BNCA 2JA2A 2R5YB 4X0GA 1U5TB 3IKVA 4E7LA 4A0XA 2DA4A 2GBYA 5F1JA 1HBXG 3SEQA 3LSGA 1X1CA 3SDBA 1J09A 3GTPJ 1FIPA 4B43A 3OR2C 3S2HJ 3MD2A 4IQJA 4J19A 3HOZJ 4XL9A 4IHYA 3CDIA 1HOMA 1YYVA 4KIBA 1H0MA 2HS5A 2L4MA 2AS5F 1R22A 4AYBA 4Y3OA 3K10A 3NAUA 1P9QC 5JR3A 4MTDA 3MKLA 1MBHA 2DJNA 5IY5H 3KLNA 2LP0A 5LRRA 4DYCA 5K5OA 2EK5A 4NDLA 4RLFA 1TLHB 2DT5A 1YJNI 1P6RA 1I1SA 3QPLA 3FMQA 1W4MA 4KDPA 3JRAA 4RGRA 4CYDA 2M7BA 1TWFJ 3MZYA 4G7HF 1X3WB 2O5RA 2KMUA 2RC4A 1U6GA 1RKTA 2A6TA 3NQOA 4CH7A 4EM0B 2QLZA 5ILVA 5F64A 5IPAA 3CMMA 2YU3A 4C3JJ 4QLCU 1ZLKA 4DBQA 1VQ5I 3TP3A 4BAYA 3NRVA 5D4SA 2FSWA 2DA6A 2Z99A 4K2EA 2F5CA 3S1NJ 5E8IA 5H6QA 1FYMA 2LDUA 3Q3SA 5ERIA 2HOAA 5CQGA 2ACJA 3CQZJ 1W5CC 3K4CA 1VQ7I 2P8TA 3F8FA 2ZCWA 3DCFA 1PVEA 1Z3XA 2PFBA 2PMZN 3MKYB 1JT0A 4XOTA 1TC3C 2M45A 3LMMA 4XICA 4PJLA 2R7UA 2M0MA 1G6NA 4BXFA 1BI3A 3I53A 1GVDA 2RN7A 1Z91A 5HNFA 1I5ZA 1R5GA 4PJJA 1W5SA 2I10A 4XONA 4CCKA 2ZO4A 2E2JJ 3F6OA 2V6EA 2LH9A 3LOCA 1BN5A 1R7JA 2WAFA 3BZKA 5F0CA 4C9YA 2XRNA 1LEBA 3TP0A 3HHGA 3A03A 3ELKA 3C3WA 3ZQCA 4S05A 2E1MC 1TNSA 3SZPA 4XN3A 4WWCA 3OY9A 3CUQC 4C3IJ 2FOWA 3ZGKA 3RZDJ 4C30A 3A01B 1TWCJ 5KCMA 1J0RA 2XB0X 2BOLA 2TRTA 4M9SA 1XTAA 4BDYA 2EILH 3WGHA 3KLOA 2JSCA 5KHDA 2Y0SN 1WHUA 1X19A 1DPUA 3V8LA 3IH3A 3LSRA 3L00A 3HOYJ 5E8GA 5FD6A 5FGMA 4E7KA 1Y8RB 5EF6A 1GT0C 3IL2A 4UUVA 1J5YA 3MMYB 4I0BA 1XD7A 3QWLA 2NNNA 1OR7A 5HNHA 3KP6A 1VTNC 3LL7A 4MEYF 1MBFA 2B0LA 1BJZA 2VQLA 4Y33A 2DDBA 3SFZA 3I9V2 1XX5A 2L01A 2P7VB 1C0WA 2Y75A 4XKVA 4A3IJ 1MH3A 1S29A 5ILSA 4FQGA 3MEXA 3S1RJ 4OIQF 1PYVA 2F5EA 2G7UA 4RAFA 2DFHA 4CSWA 3OOUA 4B4CA 2W84A 2WY8Q 2QWWA 3WE2A 1U5TA 3IWZA 2LREA 3L2QA 1Z67A 5IT9K 5BNGA 2M4KA 3I56I 4O5VA 3WGIA 2JRTA 2K3PA 2M8EA 2NS0A 2YU9J 2A3SA 1SMTA 2DYSH 2ISYA 3GFJA 5K5QA 1IC8A 3EETA 1FMWA 2LC2A 3KP3A 5D5VB 3N4MA 5GTHC 3H35A 3S14J 4L9JA 1O3QA 1TL8A 2EFWA 1X1PA 3Q9VA 2D45A 3K4MA 2X9DA 3FK7A 4RB3C 3VSKA 1U8RA 3E97A 5DEQA 3TBIA 1ONVA 2LNBA 1WSUA 5FRNA 4RGUA 2RDPA 5HS9A 2X1DA 3S1QJ 2ZJ2A 3OYIA 2W7NA 5D4RA 1ETWA 4ESBA 3HOUJ 3LA7A 2HVQA 3TDUC 2VB6A 3VSLA 4IHWA 1QVTA 3RKYA 1P4AA 2OQGA 4WXHA 2VBYA 4KFCA 3HB9A 3RSNA 3WHBA 1RKWA 3CJNA 4A3CJ 2E35A 4ANJA 2D1VA 2LSOA 1IXSB 3J7AY 1LVAA 4UV8A 3JTGA 4YIFA 1ZARA 1FJLA 4C2UA 4A93J 1RESA 3JRBA 1IN6A 3L1PA 1FC3A 4A3DJ 3GZ6A 4FT8A 1JUMA 4YFXF 5JI6A 2MH2A 3GEZA 5J8FA 1DP7P 3BCBA 3U9GA 1WJDA 2A68F 2IA1A 2M2EA 1JGSA 3GXOA 2COMA 2VJIA 4XLNF 5J4YA 2HXIA 2H09A 5GADJ 5IYBJ 4A0YA 3PIOF 1FOKA 4GFBA 2A05A 2JUGA 4HEA2 5ED4A 4U7BA 2XIGA 1G2HA 3HRTA 2WAQN 1FWZA 3KZZA 1VQ4I 4F7ZA 2HZTA 4BJ6C 4UV9A 2GM4A 4XLHA 2OAZA 3BZ6A 3H36A 1ZGAA 2KIUA 5B1BH 1OMIA 4HLXA 3DU5A 2FMLA 3BQZA 4Z2YA 1XGOA 2MG4A 5EGOA 1R23A 3W2VA 3H0DA 4AIJA 4YFKF 3ZRGA 3TQNA 3GW2A 3I3LA 5EEGA 4KYWA 2F6CA 4ZYAA 1A6QA 3ZQGA 3E5QA 5EEAA 3JRGA 1FT9A 1VQOI 4LB5A 2ICWG 3OWTA 3RZOJ 2YPRA 3PM1A 5D5UB 4BEHA 2KQRA 3CDLA 3D1NI 4M72A 4AU7A 1FNNA 2X85A 4LJZF 3VWBA 4IHSA 1SD4A 3F22A 1RR7A 1ULYA 5E3LA 1OFCX 2W24A 2DYRH 2IA2A 2L02A 1K61A 3C7JA 1HW5A 3VPRA 4DIQA 1V54H 2KZVA 2PN6A 5C3EJ 2FMYA 4BS9A 5CJ9A 4PSXA 3GZ5A 3VYSB 1WH7A 3BZCA 3ZXSA 1IZ1A 5ICEA 4HQEA 4S04A 3IP4B 2L4AA 2YSRA 5AIQA 4PJMA 5D5WB 1UFMA 3S16J 3MZ8A 3OYEA 2F4MB 1T2KA 2VJ5A 4ABZA 4A3GJ 3RQ4A 4FHTA 2VKVA 1ETOA 2NYXA 1G8XA 1BI2A 1PUEE 4EMSA 2XC7A 2HOSA 2HYJA 2L9NA 3LNQA 4AIKA 5FRMA 4V2GA 1YI2I 1EKEA 4B09A 1XSVA 4IRHA 1PP8F 1ENHA 5HS8A 4CYCB 1MW7A 3OYMA 4JK1X 1B8IB 5E1XA 1SANA 3W6VA 1DP3A 3W2WA 2EZKA 3LSMA 2XKOA 1XPXA 2HZDA 4NHJA 2P6SA 4CXFA 3FXJA 4L18B 4DW6A 3V4GA 4L0YB 3CUQA 3WTUC 2H8RA 4HDVA 3ZPLA 2PX9A 3FXUA 4XLPF 1WGXA 1WRJA 2IBDA 3D5LA 3FF5A 4ZC3A 4B8XA 4KISA 3O8GA 4CUGA 2WA0A 3CLQA 1FTTA 3C18A 2EFOA 2YUSA 2J5OA 3J80K 1ON2A 5B1AH 2HOTA 1ZRDA 4E4HA 3V42A 4HNTA 4PUSA 3BTLA 1K4SA 5GAHJ 1U78A 2YS9A 2VT2A 2NOGA 3O2PE 2HFHA 1YE9A 5FLMJ 1WFXA 2BEOA 4P9FA 2GIVA 3A02A 3IV5A 3NWSA 2R4GA 5H20A 2HDCA 4LG0A 4KN4X 4A3MJ 2DTZA 4CGZA 2H94A 2Q0OA 3SJMA 2VIXA 1IXRC 4HX8A 2L9SA 1YW8A 1LB2A 1ZRFA 3QU3A 3BG9A 1V5FA 5L3BA 2K9NA 3W2AA 2VXZA 3CC2I 2MA3A 4PFPA 2Y30A 3W3CA 2KPMA 2W4SA 5E1ZB 3LSJA 2CW7A 2M87A 2PMZA 2IS1A 3QYEA 2R7RA 1NK2P 1OKRA 4ZDOA 4U0WA 2E1CA 2D2WA 2H1KA 3GZNB 3HC7A 4ZYDA 5F0HA 2E34A 1SMYF 3B73A 1OCTC 3BPVA 2CFXA 2LY9A 5EGOB 4M74A 3EYYA 5CLSA 4Y13A 2DAOA 3I59B 2OCEA 4A6DA 1OYWA 5J8CA 1K78A 1ZQ3P 3ISPA 4ZDLA 3DTEA 2XSDC 1JT6A 1ZHFA 2CGPA 4XBFA 1R1UA 4M71A 1W36C 2VQHA 4ETSA 1S6LA 4GRIA 3TOAA 2ZC2A 4EJVA 2FBHA 4HQMA 2KKOA 4II3A 3B02A 4MHGA 4HX4A 1YFHA 3CCQI 1N77A 2BVLA 2PJRA 5B3SH 2CQNA 3HUGB 3I0TA 4G8XA 4ZYGA 4PSWA 5A2QK 4AVPA 5EG0A 3BG6A 3DEUA 1YX3A 4H0EA 3CO6C 1U8BA 1R6RA 2VC1A 4BE1A 3GFIA 4HX7A 1D5VA 3AG1H 3JAMZ 3KP5A 2L7ZA 2O3FA 2OA4A 3AFHA 5L3GA 5ICCA 2EQRA 2EIJH 5DCMA 3GF2A 5HVQC 1JJ8C 1XN7A 2MBFA 2E7XA 2RNJA 3OYCA 3DXJF 3ZN1A 2R7TA 3RKXA 4AD9A 1HSTA 1D0ZA 3RI4A 1KU2A 1DU0A 3PNYA 4RMNA 2LY1A 2HQAA 2LOOA 1L0OC 1OCPA 1BR2A 4CA0A 1B1BA 2IT0A 4BY1J 3L2RA 1MDMA 2Y0MA 3B6CA 3CJRB 2JQ7A 2F4IA 1ZAOA 2FEZA 1BIAA 1LDDA 3AG3H 2NOJB 2QVOA 2CQKA 2LK2A 4Q4ZF 4A5NA 3GTMJ 2NVUB 2NVYJ 2LBFB 3CO7C 4BBRJ 1XGNA 4D1QA 1SFOJ 2F5FA 1BR1A 3BY6A 4XKBA 3CCRI 1RI7A 3CC4I 1NG7A 4HYEA 1WPKA 4HBLA 4RB0A 5BPDA 2CS3A 2KP6A 5BQTA 2L2OA 4C2TA 4Y52J 3RPQA 3U1DA 2ADUA 2JTVA 2VOOA 5ICGA 3S3OA 2BBYA 4ZTJA 2DK5A 2L3DA 2HVSA 3BDDA 2ZFUA 4E7IA 2JPCA 2LKSA 4OINF 1ON1A 2GAUA 3KYDB 3DBHB 1VQKI 1VQ9I 4KT6A 4D7NA 2G9WA 4U0YA 3HOSA 3DU6A 1UMQA 2MC4A 3WG7H 2EV5A 4M9ZA 3QPSA 4UY8I 2KIFA 4A6EA 4N9HA 4KA4A 4HSRA 2EZHA 3ULQB 2OZUA 2QUFA 2QQBA 4RAGA 1EH7A 4O3MA 1FIAA 1V4RA 3OYBA 3X2QH 2IJLA 1BL0A 2KIMA 3CJQB 4RGXA 1Z3YA 4F3QA 2R7VA 1BM9A 2W85A 2XAGA 3BR2A 3NWTA 4HOBA 3GLXA 2FXAA 5LEKA 3HOTA 2OU2A 4KUMA 1IUFA 3KP4A 1R4MB 2DO7A 3PUFA 5KAFC 4G7ZF 2CUJA 3GUDA 2K9LA 4D9JA 2F5VA 3TL4X 4I7HA 2IPQX 1HCRA 3LSPA 3TO6A 2PG4A 1Z0XA 4E6KG 1OYIA 2A5YB 4IHTA 3ZMDA 3W6JB 3IHUA 1T38A 1YITI 2FNAA 2GIZA 3KCCA 1S7AA 5C44J 4B3XA 2M1BA 4ZJZA 2BZTA 4IO9F 1I3QJ 1VI0A 1I3AA 1JUSA 5J40A 4HV5A 3M9AA 4KIGA 4D5CA 4P5OA 1R58A 5M5WJ 2KRFA 3HTUA 4IF4A 1EV7A 5J1UA 4EJWA 4EQQA 4HLYA 5J4VA 4M3EA 3I54A 3IRQA 1QZYA 4HV6A 4HA8A 4F92B 2MW8A 3SHFA 2L7FP 2P7CB 1YS6A 2N8GA 3KIOA 4FX4A 2JN6A 4BACA 2B63J 4AUXA 2DPUA 1G59A 2MABA 2I8DA 1X1BA 1B72B 5HLGA 1ZGJA 3FXOA 3OYDA 3D0SA 4A2UA 5J1YA 2JRMA 3OS1A 3MKZA 1A36A 2QEXI 1BW5A 4BEHB 4AM3A 1XC5A 2GA1A 1R5ID 5EJCA 4EATA 2DT7B 4A3JJ 3REOA 5FJ8J 5IP6A 3IWFA 1F5TA 3HPGA 2WAEA 2WY7Q 2X1EA 3JW4A 2VQCA 2YX7A 2IGKA 1GXQA 1B9NA 3GWZA 1LFBA 3KFWX 3K6GA 3EUHA 3KEQA 1DU6A 3BLYA 4J01A 1RUNA 2V1DA 4M9XA 1MJBA 2HPIA 1V55H 1Y6IA 3J80Z 3JCUC 2CH0A 2XVCA 4UB6C 2CV0A 3EYIA 3FX3A 1RETA 5KNLA 3OMYA 3HOXJ 5L3DA 1POGA 3BJOA 3H1CA 1Z9CA 2DI3A 2EINH 2ZJRF 3JRDA 3KEYA 2R7QA 1ZG1A 4QTRA 1JHHA 3FWEA 5FLVA 5FLXZ 3F72A 3GLLA 1WI3A 3DTIA 2DXIA 2CUFA 2ZJPF 3LSTA 1BOAA 3A2KA 3QYFA 3M1EA 3GTQJ 4D7MA 2F4OB 4X1EA 4CCLA 2VBWA 3S1MJ 1MBGA 1WZ2A 2AHQA 4GGGA 2GXGA 4GDFA 1MSFC 4L9NA 1ETVA 1YHQI 3WTSC 1K83J 1ZKGA 4JX4A 3OYAA 4I0AA 3AKZA 2Y0SA 1LJ9A 2BE5F 5E20A 4E7ZA 2E1NA 2QKMB 5LRSA 3OYHA 1OCRH 2AO9A 4AVZA 4C3HJ 1Z21A 3M8FA 2MD0A 2DMTA 2E36A 2RAEA 3DV8A 4NNJA 2JA7J 1SD7A 2MH9A 2D1HA 2EH3A 3M3YJ 2G0EA 1P92A 3ZMTA 5DYMA 2K5CA 2XF5A 2FF4A 1NH3A 3QYBA 1REPC 5EDNA 3OYGA 4I02A 2V9PA 3A1YA 3MZHA 5BMZA 3M8EA 3IAS2 1HLVA 3L7WA 2W48A 4FCYA 4XRMA 2QSHX 2HKOA 2Y9YA 4LB6B 3HKZA 1IRZA 1I6XA 4FTHA 6PAXA 1IRGA 1FYLA 2E5ZA 4LOCA 2RQQA 1MKMA 3G1OA 3MAJA 3CUQB 3QOEA 1IDZA 3T0YA 1SD6A 2AQEA 1GV2A 4A0ZA 2Z16A 1S5LC 3ZQLA 5ICFA 3KE2A 1TW3A 2QQAA 4HG2A 4NQWA 4I99C 4MQ9F 4M3GA 3HIFA 5C4XJ 4QWQA 1EA3A 2O03A 4U87A 1RRJA 1MBKA 1B72A 1USTA 1QHHD 4XRFA 3WTZA 1T98A 1FSHA 2KRCA 4B3AA 2Z3YA 5DM7F 1SFKA 1KU9A 3GTLJ 1EH6A 1CF7B 2HTSA 3PNTA 2Z2SB 1X2NA 5HOOA 3CZ6A 4LIVA 1Z7LA 2R5YA 1J2XA 2O9LA 1BJAA 2M3AA 4IXAA 3CD6I 1AOYA 5HLTA 3E7LA 2K3FA 5JVGF 3PSFA 1TBXA 3K1PA 4L0ZB 2OCCH 2YX4A 2JMWA 2PBIA 1SEUA 1X2MA 2CW8A 3C2BA 4Y4RA 5KK1A 4R8HA 5F1RA 3EUKL 3ZMSA 3HG9A 2DODA 1GLNA 4RGSA 3BR0A 5BS6A 1GXPA 3VOEA 1X3ZB 3FZVA 2H6BA 1UZCA 2FQ3A 4M6VA 1MNDA 5GP9A 4QPQA 1A6IA 2Z33A 3PFIA 2DQLA 2XAUA 2BGCA 2O0YA 3QPHA 3HSFA 4NBQA 4CO8A 1QHGA 1D0XA 2VPRA 1LUJB 3ZMVA 1ZR2A 3B6AA 2XAHA 1LDJA 1T56A 1PDNC 2WADA 2Y2ZA 1ITYA 3LFUA 5CKTA 3QP5A 2O6GE 3E6DA 5F6FA 2IRFG 2I5UA 2BXYA 2PJRB 2CW0F 1KGSA 2E7WA 2DT6A 1IJWC 1TTYA 1SAUA 1AKHB 1W7PD 4IX7A 2JVHA 2ME0A 4JYKA 4N9IA 3OL3A 2ZXJA 3FXLA 4JOMA 4I98B 1CQTA 2V6CA 3PQKA 2LKPA 2NS7A 3TW7A 2VKEA 2OPTA 2M0CA 2HKXA 1U0JA 1MNMC 5IYDJ 4KN7X 3JRHA 2CV1A 2ECCA 2DOEA 5D8LB 2K27A 2HXOA 2QKLB 5CVUA 1KA8A 1BR4A 1TZLA 2HPMA 4UUSA 3J7AO 2XKPA 1XSDA 4IOAF 4EJTA 2XGEA 4ZYHA 4XSXF 2P5KA 1LEAA 1N25A 1SVMA 3IH4A 2WTEA 1G3YA 3ZMUA 3BR1A 1SFUA 1KZHA 2MD5A 4F55A 1QRYA 4RAYA 1B8IA 3HRUA 2BHYA 1O4XA 3OSGA 4CICA 2RVCA 1AA7A 3C2HA 4HF2A 3G4SI 2GQQA 1KQ0A 2ZXHA 3SYTA 4FX0A 5GPCA 3WTVC 2O8XA 3CCYA 2YR2A 2PJPA 2FA5A 3F6VA 3J81Z 1YIOA 1T08B 1XMAA 4NB5A 2BY2A 2LLKA 3HZJA 5ILUA 1E3HA 1O3SA 1UAAA 3WODF 1JKOC 3D5SC 5DUIA 4CYCA 4B47A 5D6FA 4M3FA 1T8IA 4JX5A 1DDNA 5CVIA 2VKDA 3WTYC 1B9MA 2Y69H 4I01A 3KZYA 1NK3P 1MMNA 1R1VA 2WV1A 5FFXA 1W0UA 2ETHA 2LTPA 2RREA 3TO9A 1D1AA 3HSRA 3QQAA 4O6JA 4OAZA 2NVXJ 1VQMI 1JKRC 2GLOA 1E3OC 1N75A 2FUG2 4ESJA 2FD5A 2LVSA 1XGMA 2ME6A 4J00A 4BKXA 3S17J 4PGGA 3JREA 2V9KA 5EZHA 4XMYA 3WGGA 2HEOA 3PO2J 5DD4A 4MFDA 4CZZA 3FMSA 2KT0A 4NUBA 3UKGA 3KYCB 2H6CA 2ZJQF 3JSOA 1S8NA 2R7XA 2MLGA 4L9VA 4FETA 2DA2A 2LG4A 4B1RA 3UNGC 1FSEA 4G7OF 2CUEA 2VXDA 3K4KA 1WJEA 2F2EA 3LSKA 4R1HA 2X51A 2NVQJ 1D1CA 2J5PA 3P9CA 2R93J 2CQXA 2XGXA 5KVRA 1LFUP 2ESHA 4ENNA 1FOXA 4MLOA 3S2DJ 2FJ1A 3ZCOA 2JA8J 3OYKA 1YJ9I 3H9QA 4P1WA 1LE8A 3FHZA 1MBEA 4MQVA 4IZZA 1G3TA 4PGHA 3V8KA 1Z77A 2FQ4A 2TDXA 4B48A 2X6YA 2VUMJ 1JUPA 4M3BA 1IXCA 3ESWB 1Y0NA 3OS0A 5EEHA 1F43A 1FYKA 2BXZA 2DA5A 3E3VA 3K2AA 5J47A 3GYHX 3K69A 3EUHC 3MKWB 2DQRA 2ESNA 3HUGA 3FXQA 3I59A 3MQ0A 3VYTB 1RR8C 4A69C 1MMAA 2OQRA 2EJRA 4ITVA 3TKYA 3OIPA 2L0KA 4OIPF 3ZR8X 3ABMH 3F8BA 1GDTA 2IAIA 1EJ9A 3OL4A 2X0LA 4M6YA 1S7OA 3CLOA 2LY2A 3L09A 1J59A 4Z6YA 5FKLA 2WAQA 1T6SA 2L9VA 2DMPA 3HKZN 1P7IA 2W82A 3JRFA 5HDKA 4XLAA 2A61A 2V1XA 4HRIA 1AHDP 3ABUA 1FX7A 5F27A 2FNPA 3BR6A 4EM2A 5LLQA 2PMHA 3LFKA 4CCNA 3K4BA 2O61A 1SVOA 4AYBN 5TRDA 3KPHA 2ZSIB 2DLLA 1FP2A 3L2UA 3GCMA 1S9HA 3GBGA 5EYRA 1W7PB 1UHWA 3OYLA 3F23A 2D5VA 1ZTRA 4JP0A 2WV0A 3WTXC 3QOPA 1JTYA 1ZH5A 1IG7A 1I6HJ 2DMQA 3Q9SA 3CTAA 1Q1HA 1NG6A 5F0FA 4IPAA 2LRDA 1K79A 2JK3A 2LF8A 3RQIA 3M1CA 2P81A 2LMDA 1L3LA 3CCSI 3K7AJ 4W1UA 3OOPA 2BY3A 2NS8A 5EG0B 3ROUA 4F52A 2VE8A 5H2FC 4EV0A 2OZ6A 2TCTA 3HRSA 3CCVI 3WHCA 4OMYA 4G6QA 3RIRA 4D5FA 3V8JA 4PCQA 4BE2A 1PUFB 1NTCA 4RA2A 3HOVJ 3HRMA 1YQAA 2CFOA 2XPVA 2KLOA 4RB2C 1X1AA 4RDUA 2A07F 2L7MP 3K9TA 3LA3A 4HF1A 3ZN0A 4L5EA 3FKIJ 3HGYA 4S0HB 2VONA 2X1CA 3HBLA 2R5ZB 3I55I 1JGGA 1VQLI 2IGNA 4I2OA 2W00A 4NQWB 3I71A 1ZGWA 2HOEA 4BUPA 4EJOA 4A3EJ 3U1KA 2NNYA 3H9GA 1MNEA 1QZZA 3ECHA 1WJ5A 5LBQA 3CCJI 4OWRB 5LHGA 4B44A 1ETXA 3HHHA 4RS8A 5GAEJ 2EBIA 2JT1A 1HA8A 3H0GJ 9ANTA 1WVRA 2VL8A 4BH9A 4IOCF 1ODDA 3BTCA 3ZQFA 2EFQA 3PUBA 4KITB 3OYJA 5DTDA 1MGTA 3HSEA 2QYOA 2JUCA 1ETQA 1P4XA 2LYCA 4PDKA 4ZTFA 1FZPB 1XSXA 4DZPA 3JRIA 2PQ8A 4N0BA 2VJJA 2DA3A 2DDAA 2LF7A 1FMVA 2ZBKA 2CG4A 1B4AA 1W1WE 4A3LJ 2O7OA 2XPUA 3DBRB 3LWFA 2OV7A 4YELA 1F36A 2E5NA 4U0VA 5CQEA 4LK1F 2CRGA 4OMZA 1ORKA 2JJ7A 3VODA 4E7JA 2HYFA 3OSFA 1TT5B 2K02A 4IVNA 2E60A 5FKOA 1XMKA 2Q2EA 2CU7A 2IS6A 3G3ZA 4BJTA 4L9TA 1FP1D 4I76A 1GUUA 3LSHA 4UHTA 4HSTA 3PFYA 3QAHA 3K70C 2VN2A 2XPWA 1STZA 3F21A 4BQOA 1Y0UA 1IDYA 2NRAC 1KYZA 5CVVA 2L54A 4WXDA 5EZGA 2QSGX 4KJZA 4XM3A 1V5EA 1XCVA 1BI1A 4ZYEA 4CCMA 2X6WA 4NC6A 1QVUA 1X1DA 4YIIA 1RPWA 5D8KB 4QIWN 2CV2A 5IT9Z 3A0BC 5M5XJ 1P7JA 3S15J 3E0JB 1GVJA 5DDGA 1PP7U 1OCCH 3HYIA 3P5JA 3ECOA 4WK8F 3VDXA 1J75A 3R60A 3K4NA 2L9RA 1TT0A 3R6SA 2QQ9A 2RGVA 2DFEA 3FBIB 1BC7C 4A3BJ 3GVAA 2IS2A 1JKPC 4HAMA 2K7LA 1AU7A 2STTA 4KICA 1OLTA 2BY1A 2CYYA 3M7GA 5KAIC 4BU2A 2DK8A 2R7FA 2ECBA 1QBJA 3FXRA 2R7SA 4M73A 5JLWA 1FTZA 4Q47A 3ZQHA 2VT3A 2MYSA 3TW6A 2VI6A 2NAZA 5D5XB 1VNDA 5LGTA 2PLYA 4RM3A 4UUTA 1W0TA 3DWLE 1OYYA 1XDSA 4PJNA 5BOXA 4LIUA 2JSPA 4XN0A 2KISA 3CCMI 1ACIA 3F9KA 5GPAA 1U9NA 1K78B 2ZMEB 3JSPA 4XSZF 5LGUA 3P7NA 3J7YJ 4BQQA 2RKHA 2EA2A 3U2RA 1QGPA 1IAWA 4Y15A 2E19A 3LA2A 2R7DA
chains in the Genus database with same CATH topology
1ZRCA 1K7AA 1TW2A 1BIBA 3I5UA 1XCBA 3E5XA 3E6BA 4DQ2A 5HDNA 5A2QZ 1P4WA 2MLKA 3W6KB 1BC8C 2XASA 3O3KA 5HLIA 1A04A 4LLLA 2FOKA 3TOBA 3DP7A 1Z6RA 2DTRA 2HYGD 4L5JA 1WQ2A 4KMFA 3F3XA 4G6DA 3BWGA 5K5RA 4BQAA 1GHCA 1KQ8A 2VBXA 5CVRA 4EM1A 1FBQA 4R79A 1LDKB 1MJ9A 2GWRA 4ZZDA 5FB2A 1YW9A 2VODA 2MC3A 3ERED 2P5VA 4BYYA 2G7HA 4RB1A 1HXDA 2JZYA 2W25A 1OPCA 1XGSA 4ON0A 3GFLA 2K4BA 3MWMA 1SD5A 4HZFA 4UXNA 1IN4A 1Z6TA 4AWXB 1MD0A 3F8NA 3S2WA 1F9NA 3BJ6A 1SFXA 3JTHA 4LMYA 4TV7A 3K0LA 2GA2A 2EB7A 1R00A 3TDZC 1EH8A 4BHBA 5HLHA 1R36A 3T5XA 5JFRA 2FE3A 1NHAA 1RZ4A 3RPUA 1D8JA 2M30A 3WTTC 4IRGA 2V79A 1HSJA 3R61A 2AXLA 1UCRA 5LHHA 2XHKA 2BV6A 4BHPA 3G73A 2HQRA 3H92A 3FM3A 5DD8A 3BP8A 5FLXK 4P96A 5JHUA 4A5MA 2JPBA 4ESFA 1W7PA 1KU7A 2WC2A 2P5LC 4JQFA 1G3WA 5L3CA 4LD5A 3OV8A 1H9GA 1SAXA 5DUKA 1U3EM 3WE3A 3WU0A 1I1GA 4Q5SF 2HGCA 1RNLA 3R0JA 5HDGA 2HTJA 4E70A 3E6MA 4GYGA 2QENA 5D6EA 1KU3A 4OOIA 5E17F 2K4JA 2VOPA 3WU1B 4MTEA 2Z5UA 2QBYB 4P55A 1D3YA 3KP2A 3IC7A 1HW1A 1RUOA 3ZMZA 1DUXC 5DV5A 3IRRA 2OD5A 1D8KA 1FBSA 3L2CA 3QRFF 2XAFA 1J7KA 1YS7A 1HKTA 3I58A 4Q48A 1Z05A 3R0AA 4HF0A 2CSOA 2XAQA 1XDUA 2V1UA 3F8MA 5LHIA 3LQQA 4JBAA 1H9TA 1ZN2A 1T0FA 5DCFA 3RDIA 5TJJA 4KT5C 5HS7A 2VC0A 2EWNA 2DW4A 3CDHA 1IN8A 4GCVA 2PMUA 3QU6A 1YW7A 2IW5A 1QPMA 4LLGF 2A6HF 1ZYRF 2DBBA 2FU4A 1LNWA 4ENKA 3ZQ7A 2ISZA 1IUYA 3V7RA 1B6AA 1X3UA 4UVBA 3JAMK 4GO1A 3AAFA 1MJAA 3TO7A 2W57A 3EDPA 4HW0A 2A69F 2ZNZA 2ZKZA 4M6XA 5IT3A 3ZP5A 3DFGA 2ZMEA 1QQIA 2HQNA 2XUBA 2Z9OA 4OIRF 3P9KA 5L3FA 2CO5A 1U2WA 1Z7UA 3QP6A 2IP2A 5JVTA 5E18F 1JXSA 4WXCA 1YLFA 4P9UA 1USSA 4EGYA 2BYVE 4U88A 4LGWA 1HW2A 3L9FA 1KQ9A 1JE8A 3BROA 2H27A 4EGZA 2GXBA 3DPTA 4KNYA 5K1YA 1I27A 2DU9A 3F8CA 3VB2A 3BOQA 4CHUA 3T1BA 1FBUA 1HKSA 5J6XA 3DKWA 3FM5A 2DFIA 1G3SA 1FPQA 1TQPA 3IKTA 5AIPA 4U7DA 1P2FA 3FMRA 1R1TA 1IW7F 2EFNA 2HR3A 2CWEA 1F1ZA 3T8TA 1IN7A 2IA0A 1YG2A 1ZREA 1AWCA 1F4KA 3V7SA 2QM3A 2RQPA 4L5IA 4KMUX 2UXXA 5AONA 1CGPA 3E6CC 4ZH4F 1TNTA 3KEOA 3R4KA 2EFPA 3BJAA 4G9YA 4YFNF 1YO5C 2V9VA 1E2XA 4ENJA 3V7CA 3HTSB 1UB9A 1MZBA 3DF8A 3ML6A 2XROA 5FFZA 1IF1A 4BHCA 1Z1DA 3LQRA 1RIOH 3PQJA 1BI0A 2HWVA 1WI9A 1U5TC 1ZG3A 4PZJA 1R5HA 1O3TA 1WKMA 1TQMA 1G4DA 3GX4X 1BBYA 4MNUA 2FBIA 2ZFWA 1O57A 3N97A 3O6BB 2ELHA 5FD5A 2UWMA 2XV4S 4D0PA 4LG0B 3GFMA 3KP7A 3MFKA 2RV8A 1KYWA 1QO0D 2STWA 4RAZA 2ZNYA 2PEXA 4Y17A 2UXNA 2OBPA 5DCMB 3RJPA 3WTWC 4DNCA 3WG9A 4YG2F 4MEXF 3LAPA 4OIOF 3GO5A 2F5DA 1XB4A 3I4PA 3DQVC 3P9IA 3J81K 2Q8KA 1J9IA 1HKQA 5H6RA 4EJUA 1FLIA 3RTRA 4KIFA 1O7FA 5CVJA 3Q5FA 3E5UA 2A6EF 2R3SA 2VBZA 3MCZA 1HQCA 5E1WA 4A12A 2PI0A 4CDGA 3ABTA 4AIHA 1B59A 3SZTA 3CUOA 1JHFA 1ZG5A 4ZZLA 4MGRA 1IRFA 4UVAA 4WCGA 2FRHA 3VEPA 4EVIA 4G94A 3H3UA 3KETA 3DPLC 4LLNA 5LEJA 3K2ZA 3LAJA 2EA4A 1UHMA 1V3FA 3RYRA 4LK0F 1S3JA 2K86A 4HDUA 1K6OA 1MDMB 2P6TA 1SFEA 3K1NA 3H3ZA 3K1MA 1E17A 3SQNA 3VFZA 5CYVA 2XAJA 1LQ1A 4WX9A 1WWXA 2QBYA 3NEUA 2KJCA 3SXYA 3T8RA 2M5WA 2GZWA 3I64A 4UVCA 1DPRA 3EQLF 2WWYA 1O3RA 2UZKA 5FO5A 1TQIA 4ENMA 1YTYA 3QPTA 4GXOA 2VE9A 2Y48A 3COAC 2EV6A 3C1DA 4UNOA 4LFUA 4WF2A 2DPDA 4BXUA 2QZ8A 4OU0A 1IN5A 4I09A 5BPIA 2FBKA 1O7LA 2EV0A 5L3EA 4ASNA 1W5TA 3BPXA 3TGNA 3RKWA 1FY7A 4GYIA 1T39A 5LGNA 4IRIA 3RYPA 2P4WA 1QNTA 2KJBA 1CF7A 1ZLJA 2X4HA 2IVMA 4IJAA 4BNCA 1U5TB 3IKVA 4A0XA 1HBXG 1YYVA 4KIBA 1H0MA 2HS5A 2L4MA 2AS5F 1R22A 4MTDA 5JR3A 3KLNA 5LRRA 5K5OA 2EK5A 1TLHB 2DT5A 1P6RA 1I1SA 3FMQA 1W4MA 4KDPA 4RGRA 4CYDA 3MZYA 4G7HF 2RC4A 1U6GA 3NQOA 4EM0B 2QLZA 5ILVA 5F64A 2YU3A 4QLCU 1ZLKA 4BAYA 3NRVA 5D4SA 2FSWA 2Z99A 4K2EA 2F5CA 5E8IA 5H6QA 1FYMA 2LDUA 5ERIA 2ACJA 2P8TA 3F8FA 2ZCWA 2PFBA 2M45A 1G6NA 1BI3A 3I53A 2RN7A 1Z91A 1I5ZA 1R5GA 1W5SA 2ZO4A 3F6OA 1BN5A 1R7JA 2XRNA 1LEBA 3HHGA 3ELKA 3C3WA 4S05A 1TNSA 3SZPA 4WWCA 3CUQC 1J0RA 4M9SA 3WGHA 3KLOA 2JSCA 1DPUA 3V8LA 3L00A 5E8GA 5FD6A 5FGMA 3IL2A 4UUVA 1J5YA 4I0BA 1XD7A 2NNNA 1OR7A 3KP6A 1VTNC 4MEYF 2B0LA 3SFZA 2L01A 2P7VB 1C0WA 2Y75A 1S29A 5ILSA 3MEXA 4OIQF 2F5EA 2G7UA 2W84A 2QWWA 3WE2A 1U5TA 3IWZA 5IT9K 4O5VA 3WGIA 2JRTA 2M8EA 2NS0A 2A3SA 1SMTA 2ISYA 3GFJA 5K5QA 3EETA 3N4MA 3KP3A 5D5VB 4L9JA 1O3QA 2EFWA 3Q9VA 2D45A 4RB3C 1U8RA 3E97A 5DEQA 1ONVA 2LNBA 1WSUA 4RGUA 2RDPA 5HS9A 2ZJ2A 5D4RA 4ESBA 3LA7A 3TDUC 3RKYA 1P4AA 2OQGA 4WXHA 2VBYA 4KFCA 3CJNA 2D1VA 2LSOA 1IXSB 1LVAA 4UV8A 3JTGA 4YIFA 1ZARA 1IN6A 1FC3A 3GZ6A 4FT8A 4YFXF 5JI6A 2MH2A 3GEZA 5J8FA 1DP7P 3U9GA 2A68F 2IA1A 1JGSA 3GXOA 2COMA 4XLNF 2H09A 4A0YA 1FOKA 5ED4A 4U7BA 2XIGA 3HRTA 1FWZA 3KZZA 4F7ZA 2HZTA 4UV9A 2OAZA 3BZ6A 1ZGAA 2KIUA 1OMIA 4HLXA 2FMLA 4Z2YA 1XGOA 1R23A 4AIJA 4YFKF 3TQNA 3GW2A 5EEGA 4KYWA 3E5QA 1FT9A 4LB5A 2YPRA 5D5UB 4M72A 1FNNA 4LJZF 4IHSA 1SD4A 3F22A 1ULYA 2W24A 2IA2A 2L02A 3C7JA 1HW5A 2PN6A 2FMYA 5CJ9A 3GZ5A 1IZ1A 5ICEA 4HQEA 4S04A 2L4AA 2YSRA 5AIQA 5D5WB 1UFMA 1T2KA 4FHTA 2NYXA 1BI2A 1PUEE 4EMSA 4AIKA 4B09A 1XSVA 4IRHA 1PP8F 5HS8A 4JK1X 5E1XA 2XKOA 4NHJA 2P6SA 4CXFA 4L18B 3V4GA 4L0YB 3CUQA 3WTUC 4HDVA 3ZPLA 3FXUA 4XLPF 1WRJA 3D5LA 3FF5A 4B8XA 3C18A 2EFOA 2J5OA 3J80K 1ON2A 1ZRDA 1U78A 2VT2A 3O2PE 2HFHA 2BEOA 4P9FA 2GIVA 5H20A 2HDCA 4LG0A 4KN4X 4CGZA 2H94A 2Q0OA 1IXRC 4HX8A 1LB2A 1YW8A 1ZRFA 3QU3A 5L3BA 2VXZA 2MA3A 5E1ZB 2M87A 1OKRA 4U0WA 2E1CA 2D2WA 4ZYDA 1SMYF 3B73A 3BPVA 2CFXA 4M74A 3EYYA 5CLSA 4Y13A 2DAOA 3I59B 4A6DA 1OYWA 5J8CA 1K78A 3ISPA 1ZHFA 2CGPA 4XBFA 1R1UA 4M71A 4ETSA 1S6LA 3TOAA 4EJVA 2FBHA 4HQMA 2KKOA 3B02A 4MHGA 4HX4A 1YFHA 4ZYGA 3I0TA 4G8XA 5A2QK 4AVPA 4H0EA 3DEUA 3CO6C 2VC1A 3GFIA 4HX7A 1D5VA 3JAMZ 3KP5A 2O3FA 2OA4A 5L3GA 5ICCA 5DCMA 3GF2A 5HVQC 1XN7A 2MBFA 2E7XA 2RNJA 3DXJF 3ZN1A 3RKXA 4AD9A 1HSTA 3RI4A 1KU2A 1L0OC 1B1BA 2IT0A 1MDMA 2Y0MA 2FEZA 1ZAOA 1BIAA 1LDDA 2QVOA 2CQKA 4Q4ZF 4A5NA 3CO7C 1XGNA 2F5FA 3BY6A 1RI7A 4HYEA 4HBLA 4RB0A 5BPDA 5BQTA 3RPQA 3U1DA 2ADUA 2JTVA 2VOOA 5ICGA 2BBYA 2DK5A 2L3DA 3BDDA 2JPCA 4OINF 1ON1A 2GAUA 2G9WA 4U0YA 3HOSA 2EV5A 4M9ZA 2KIFA 4A6EA 4N9HA 4KA4A 3ULQB 2OZUA 2QUFA 2QQBA 1EH7A 4O3MA 1V4RA 2IJLA 2KIMA 4RGXA 1BM9A 2W85A 2XAGA 4HOBA 3GLXA 2FXAA 5LEKA 3HOTA 2OU2A 4KUMA 3KP4A 2DO7A 4G7ZF 3GUDA 4I7HA 2IPQX 3TO6A 2PG4A 1OYIA 2A5YB 4IHTA 3ZMDA 3W6JB 3IHUA 1T38A 2FNAA 3KCCA 1S7AA 2M1BA 2C6YA 4HV5A 3M9AA 4KIGA 4P5OA 1R58A 2KRFA 3HTUA 4IF4A 1EV7A 4EJWA 4EQQA 4HLYA 3IRQA 3I54A 1QZYA 4HV6A 4HA8A 3SHFA 2P7CB 1YS6A 4FX4A 2DPUA 5HLGA 1ZGJA 3D0SA 4A2UA 2GA1A 3REOA 3IWFA 1F5TA 3JW4A 2YX7A 1GXQA 1B9NA 3GWZA 3KFWX 3EUHA 3KEQA 1RUNA 2V1DA 4M9XA 1MJBA 3J80Z 2XVCA 3EYIA 3FX3A 5L3DA 3BJOA 1Z9CA 2DI3A 1ZG1A 1JHHA 3FWEA 5FLXZ 3F72A 3LSTA 1BOAA 3M1EA 2VBWA 4GGGA 2GXGA 4L9NA 3WTSC 4I0AA 1LJ9A 2BE5F 5E20A 2E1NA 5LRSA 3M8FA 3DV8A 1SD7A 2MH9A 2D1HA 1P92A 3ZMTA 5DYMA 2FF4A 1REPC 4I02A 3MZHA 5BMZA 3M8EA 3L7WA 2HKOA 4LB6B 1I6XA 6PAXA 1IRGA 1FYLA 1MKMA 3MAJA 3CUQB 3T0YA 1SD6A 4A0ZA 5ICFA 3KE2A 1TW3A 2QQAA 4NQWA 4MQ9F 3HIFA 4QWQA 2O03A 1USTA 4XRFA 3WTZA 1T98A 1FSHA 2Z3YA 1KU9A 1EH6A 1CF7B 2HTSA 5HOOA 1J2XA 1BJAA 4IXAA 1AOYA 1TBXA 3K1PA 4L0ZB 2YX4A 2PBIA 5KK1A 4R8HA 5F1RA 3ZMSA 4RGSA 5BS6A 1GXPA 3VOEA 3FZVA 2H6BA 2FQ3A 2Z33A 3PFIA 2DQLA 2BGCA 2O0YA 3QPHA 3HSFA 4CO8A 3ZMVA 2XAHA 1LDJA 1PDNC 3QP5A 2O6GE 3E6DA 5F6FA 2IRFG 2CW0F 1KGSA 2E7WA 1TTYA 1W7PD 4N9IA 2ZXJA 4I98B 2V6CA 3PQKA 2LKPA 2HKXA 4KN7X 5D8LB 2K27A 5CVUA 1KA8A 3J7AO 2XKPA 1XSDA 4EJTA 4ZYHA 4XSXF 2P5KA 1LEAA 2WTEA 1G3YA 3ZMUA 1SFUA 2MD5A 4RAYA 3HRUA 4CICA 2RVCA 4HF2A 2GQQA 1KQ0A 4FX0A 3WTVC 2O8XA 2YR2A 2PJPA 2FA5A 3F6VA 3J81Z 1YIOA 1XMAA 4NB5A 5ILUA 1O3SA 3WODF 5DUIA 5D6FA 1DDNA 5CVIA 3WTYC 1B9MA 4I01A 3KZYA 1R1VA 5FFXA 2ETHA 3TO9A 3HSRA 4O6JA 4ESJA 1XGMA 4PGGA 3WGGA 2HEOA 5DD4A 4CZZA 3FMSA 2H6CA 3JSOA 1S8NA 2MLGA 4L9VA 1FSEA 4G7OF 4R1HA 2F2EA 2J5PA 3P9CA 2XGXA 5KVRA 2ESHA 4ENNA 3FHZA 4MQVA 1G3TA 4PGHA 3V8KA 2TDXA 1IXCA 5EEHA 1FYKA 3E3VA 3GYHX 3K69A 3MQ0A 2DQRA 2ESNA 3FXQA 3HUGA 3I59A 2OQRA 2EJRA 3TKYA 4OIPF 3F8BA 2X0LA 4M6YA 1S7OA 3CLOA 3L09A 1J59A 1T6SA 5HDKA 2A61A 2V1XA 3ABUA 1FX7A 4EM2A 2FNPA 5LLQA 2PMHA 3LFKA 2O61A 5TRDA 2DLLA 1FP2A 1W7PB 1UHWA 3F23A 2WV0A 3WTXC 3QOPA 1ZH5A 3Q9SA 3CTAA 1Q1HA 4IPAA 1K79A 2LF8A 1L3LA 3OOPA 3ROUA 2VE8A 4EV0A 2OZ6A 3HRSA 4OMYA 4G6QA 3RIRA 3V8JA 4PCQA 3HRMA 1YQAA 4RB2C 2A07F 3K9TA 3LA3A 4HF1A 3ZN0A 2VONA 4I2OA 3I71A 2HOEA 4EJOA 2NNYA 1QZZA 3ECHA 5LBQA 5LHGA 3HHHA 4RS8A 2JT1A 4BH9A 1ODDA 2EFQA 1MGTA 3HSEA 2QYOA 1P4XA 4PDKA 1FZPB 1XSXA 2PQ8A 4N0BA 2LF7A 2ZBKA 2CG4A 1B4AA 3LWFA 4U0VA 4LK1F 4OMZA 3VODA 2HYFA 2K02A 4IVNA 1XMKA 2Q2EA 3G3ZA 4L9TA 1FP1D 4UHTA 3QAHA 2VN2A 3F21A 1STZA 1Y0UA 2NRAC 1KYZA 5CVVA 2L54A 4WXDA 1XCVA 1BI1A 4ZYEA 4YIIA 5D8KB 5IT9Z 1GVJA 5DDGA 1PP7U 3HYIA 3ECOA 4WK8F 1J75A 3R60A 3R6SA 2QQ9A 2RGVA 1BC7C 3GVAA 4HAMA 2K7LA 2STTA 4KICA 2CYYA 3M7GA 2DK8A 2R7FA 1QBJA 3FXRA 4M73A 4Q47A 2VT3A 5D5XB 2NAZA 5LGTA 2PLYA 1OYYA 1XDSA 5BOXA 1K78B 2ZMEB 3JSPA 4XSZF 5LGUA 3P7NA 2RKHA 2EA2A 3U2RA 1QGPA 1IAWA 4Y15A 3LA2A 2R7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRC A;  1K7A A;  1TW2 A;  1BIB A;  3I5U A;  1XCB A;  3E5X A;  3E6B A;  4DQ2 A;  5HDN A;  5A2Q Z;  1P4W A;  2MLK A;  3W6K B;  1BC8 C;  2XAS A;  3O3K A;  5HLI A;  1A04 A;  4LLL A;  2FOK A;  3TOB A;  3DP7 A;  1Z6R A;  2DTR A;  2HYG D;  4L5J A;  1WQ2 A;  4KMF A;  3F3X A;  4G6D A;  3BWG A;  5K5R A;  4BQA A;  1GHC A;  1KQ8 A;  2VBX A;  5CVR A;  4EM1 A;  1FBQ A;  4R79 A;  1LDK B;  1MJ9 A;  2GWR A;  4ZZD A;  5FB2 A;  1YW9 A;  2VOD A;  2MC3 A;  3ERE D;  2P5V A;  4BYY A;  2G7H A;  4RB1 A;  1HXD A;  2JZY A;  2W25 A;  1OPC A;  1XGS A;  4ON0 A;  3GFL A;  2K4B A;  3MWM A;  1SD5 A;  4HZF A;  4UXN A;  1IN4 A;  1Z6T A;  4AWX B;  1MD0 A;  3F8N A;  3S2W A;  1F9N A;  3BJ6 A;  1SFX A;  3JTH A;  4LMY A;  4TV7 A;  3K0L A;  2GA2 A;  2EB7 A;  1R00 A;  3TDZ C;  1EH8 A;  4BHB A;  5HLH A;  1R36 A;  3T5X A;  5JFR A;  2FE3 A;  1NHA A;  1RZ4 A;  3RPU A;  1D8J A;  2M30 A;  3WTT C;  4IRG A;  2V79 A;  1HSJ A;  3R61 A;  2AXL A;  1UCR A;  5LHH A;  2XHK A;  2BV6 A;  4BHP A;  3G73 A;  2HQR A;  3H92 A;  3FM3 A;  5DD8 A;  3BP8 A;  5FLX K;  4P96 A;  5JHU A;  4A5M A;  2JPB A;  4ESF A;  1W7P A;  1KU7 A;  2WC2 A;  2P5L C;  4JQF A;  1G3W A;  5L3C A;  4LD5 A;  3OV8 A;  1H9G A;  1SAX A;  5DUK A;  1U3E M;  3WE3 A;  3WU0 A;  1I1G A;  4Q5S F;  2HGC A;  1RNL A;  3R0J A;  5HDG A;  2HTJ A;  4E70 A;  3E6M A;  4GYG A;  2QEN A;  5D6E A;  1KU3 A;  4OOI A;  5E17 F;  2K4J A;  2VOP A;  3WU1 B;  4MTE A;  2Z5U A;  2QBY B;  4P55 A;  1D3Y A;  3KP2 A;  3IC7 A;  1HW1 A;  1RUO A;  3ZMZ A;  1DUX C;  5DV5 A;  3IRR A;  2OD5 A;  1D8K A;  1FBS A;  3L2C A;  3QRF F;  2XAF A;  1J7K A;  1YS7 A;  1HKT A;  3I58 A;  4Q48 A;  1Z05 A;  3R0A A;  4HF0 A;  2CSO A;  2XAQ A;  1XDU A;  2V1U A;  3F8M A;  5LHI A;  3LQQ A;  4JBA A;  1H9T A;  1ZN2 A;  1T0F A;  5DCF A;  3RDI A;  5TJJ A;  4KT5 C;  5HS7 A;  2VC0 A;  2EWN A;  2DW4 A;  3CDH A;  1IN8 A;  4GCV A;  2PMU A;  3QU6 A;  1YW7 A;  2IW5 A;  1QPM A;  4LLG F;  2A6H F;  1ZYR F;  2DBB A;  2FU4 A;  1LNW A;  4ENK A;  3ZQ7 A;  2ISZ A;  1IUY A;  3V7R A;  1B6A A;  1X3U A;  4UVB A;  3JAM K;  4GO1 A;  3AAF A;  1MJA A;  3TO7 A;  2W57 A;  3EDP A;  4HW0 A;  2A69 F;  2ZNZ A;  2ZKZ A;  4M6X A;  5IT3 A;  3ZP5 A;  3DFG A;  2ZME A;  1QQI A;  2HQN A;  2XUB A;  2Z9O A;  4OIR F;  3P9K A;  5L3F A;  2CO5 A;  1U2W A;  1Z7U A;  3QP6 A;  2IP2 A;  5JVT A;  5E18 F;  1JXS A;  4WXC A;  1YLF A;  4P9U A;  1USS A;  4EGY A;  2BYV E;  4U88 A;  4LGW A;  1HW2 A;  3L9F A;  1KQ9 A;  1JE8 A;  3BRO A;  2H27 A;  4EGZ A;  2GXB A;  3DPT A;  4KNY A;  5K1Y A;  1I27 A;  2DU9 A;  3F8C A;  3VB2 A;  3BOQ A;  4CHU A;  3T1B A;  1FBU A;  1HKS A;  5J6X A;  3DKW A;  3FM5 A;  2DFI A;  1G3S A;  1FPQ A;  1TQP A;  3IKT A;  5AIP A;  4U7D A;  1P2F A;  3FMR A;  1R1T A;  1IW7 F;  2EFN A;  2HR3 A;  2CWE A;  1F1Z A;  3T8T A;  1IN7 A;  2IA0 A;  1YG2 A;  1ZRE A;  1AWC A;  1F4K A;  3V7S A;  2QM3 A;  2RQP A;  4L5I A;  4KMU X;  2UXX A;  5AON A;  1CGP A;  3E6C C;  4ZH4 F;  1TNT A;  3KEO A;  3R4K A;  2EFP A;  3BJA A;  4G9Y A;  4YFN F;  1YO5 C;  2V9V A;  1E2X A;  4ENJ A;  3V7C A;  3HTS B;  1UB9 A;  1MZB A;  3DF8 A;  3ML6 A;  2XRO A;  5FFZ A;  1IF1 A;  4BHC A;  1Z1D A;  3LQR A;  1RIO H;  3PQJ A;  1BI0 A;  2HWV A;  1WI9 A;  1U5T C;  1ZG3 A;  4PZJ A;  1R5H A;  1O3T A;  1WKM A;  1TQM A;  1G4D A;  3GX4 X;  1BBY A;  4MNU A;  2FBI A;  2ZFW A;  1O57 A;  3N97 A;  3O6B B;  2ELH A;  5FD5 A;  2UWM A;  2XV4 S;  4D0P A;  4LG0 B;  3GFM A;  3KP7 A;  3MFK A;  2RV8 A;  1KYW A;  1QO0 D;  2STW A;  4RAZ A;  2ZNY A;  2PEX A;  4Y17 A;  2UXN A;  2OBP A;  5DCM B;  3RJP A;  3WTW C;  4DNC A;  3WG9 A;  4YG2 F;  4MEX F;  3LAP A;  4OIO F;  3GO5 A;  2F5D A;  1XB4 A;  3I4P A;  3DQV C;  3P9I A;  3J81 K;  2Q8K A;  1J9I A;  1HKQ A;  5H6R A;  4EJU A;  1FLI A;  3RTR A;  4KIF A;  1O7F A;  5CVJ A;  3Q5F A;  3E5U A;  2A6E F;  2R3S A;  2VBZ A;  3MCZ A;  1HQC A;  5E1W A;  4A12 A;  2PI0 A;  4CDG A;  3ABT A;  4AIH A;  1B59 A;  3SZT A;  3CUO A;  1JHF A;  1ZG5 A;  4ZZL A;  4MGR A;  1IRF A;  4UVA A;  4WCG A;  2FRH A;  3VEP A;  4EVI A;  4G94 A;  3H3U A;  3KET A;  3DPL C;  4LLN A;  5LEJ A;  3K2Z A;  3LAJ A;  2EA4 A;  1UHM A;  1V3F A;  3RYR A;  4LK0 F;  1S3J A;  2K86 A;  4HDU A;  1K6O A;  1MDM B;  2P6T A;  1SFE A;  3K1N A;  3H3Z A;  3K1M A;  1E17 A;  3SQN A;  3VFZ A;  5CYV A;  2XAJ A;  1LQ1 A;  4WX9 A;  1WWX A;  2QBY A;  3NEU A;  2KJC A;  3SXY A;  3T8R A;  2M5W A;  2GZW A;  3I64 A;  4UVC A;  1DPR A;  3EQL F;  2WWY A;  1O3R A;  2UZK A;  5FO5 A;  1TQI A;  4ENM A;  1YTY A;  3QPT A;  4GXO A;  2VE9 A;  2Y48 A;  3COA C;  2EV6 A;  3C1D A;  4UNO A;  4LFU A;  4WF2 A;  2DPD A;  4BXU A;  2QZ8 A;  4OU0 A;  1IN5 A;  4I09 A;  5BPI A;  2FBK A;  1O7L A;  2EV0 A;  5L3E A;  4ASN A;  1W5T A;  3BPX A;  3TGN A;  3RKW A;  1FY7 A;  4GYI A;  1T39 A;  5LGN A;  4IRI A;  3RYP A;  2P4W A;  1QNT A;  2KJB A;  1CF7 A;  1ZLJ A;  2X4H A;  2IVM A;  4IJA A;  4BNC A;  1U5T B;  3IKV A;  4A0X A;  1HBX G;  1YYV A;  4KIB A;  1H0M A;  2HS5 A;  2L4M A;  2AS5 F;  1R22 A;  4MTD A;  5JR3 A;  3KLN A;  5LRR A;  5K5O A;  2EK5 A;  1TLH B;  2DT5 A;  1P6R A;  1I1S A;  3FMQ A;  1W4M A;  4KDP A;  4RGR A;  4CYD A;  3MZY A;  4G7H F;  2RC4 A;  1U6G A;  3NQO A;  4EM0 B;  2QLZ A;  5ILV A;  5F64 A;  2YU3 A;  4QLC U;  1ZLK A;  4BAY A;  3NRV A;  5D4S A;  2FSW A;  2Z99 A;  4K2E A;  2F5C A;  5E8I A;  5H6Q A;  1FYM A;  2LDU A;  5ERI A;  2ACJ A;  2P8T A;  3F8F A;  2ZCW A;  2PFB A;  2M45 A;  1G6N A;  1BI3 A;  3I53 A;  2RN7 A;  1Z91 A;  1I5Z A;  1R5G A;  1W5S A;  2ZO4 A;  3F6O A;  1BN5 A;  1R7J A;  2XRN A;  1LEB A;  3HHG A;  3ELK A;  3C3W A;  4S05 A;  1TNS A;  3SZP A;  4WWC A;  3CUQ C;  1J0R A;  4M9S A;  3WGH A;  3KLO A;  2JSC A;  1DPU A;  3V8L A;  3L00 A;  5E8G A;  5FD6 A;  5FGM A;  3IL2 A;  4UUV A;  1J5Y A;  4I0B A;  1XD7 A;  2NNN A;  1OR7 A;  3KP6 A;  1VTN C;  4MEY F;  2B0L A;  3SFZ A;  2L01 A;  2P7V B;  1C0W A;  2Y75 A;  1S29 A;  5ILS A;  3MEX A;  4OIQ F;  2F5E A;  2G7U A;  2W84 A;  2QWW A;  3WE2 A;  1U5T A;  3IWZ A;  5IT9 K;  4O5V A;  3WGI A;  2JRT A;  2M8E A;  2NS0 A;  2A3S A;  1SMT A;  2ISY A;  3GFJ A;  5K5Q A;  3EET A;  3N4M A;  3KP3 A;  5D5V B;  4L9J A;  1O3Q A;  2EFW A;  3Q9V A;  2D45 A;  4RB3 C;  1U8R A;  3E97 A;  5DEQ A;  1ONV A;  2LNB A;  1WSU A;  4RGU A;  2RDP A;  5HS9 A;  2ZJ2 A;  5D4R A;  4ESB A;  3LA7 A;  3TDU C;  3RKY A;  1P4A A;  2OQG A;  4WXH A;  2VBY A;  4KFC A;  3CJN A;  2D1V A;  2LSO A;  1IXS B;  1LVA A;  4UV8 A;  3JTG A;  4YIF A;  1ZAR A;  1IN6 A;  1FC3 A;  3GZ6 A;  4FT8 A;  4YFX F;  5JI6 A;  2MH2 A;  3GEZ A;  5J8F A;  1DP7 P;  3U9G A;  2A68 F;  2IA1 A;  1JGS A;  3GXO A;  2COM A;  4XLN F;  2H09 A;  4A0Y A;  1FOK A;  5ED4 A;  4U7B A;  2XIG A;  3HRT A;  1FWZ A;  3KZZ A;  4F7Z A;  2HZT A;  4UV9 A;  2OAZ A;  3BZ6 A;  1ZGA A;  2KIU A;  1OMI A;  4HLX A;  2FML A;  4Z2Y A;  1XGO A;  1R23 A;  4AIJ A;  4YFK F;  3TQN A;  3GW2 A;  5EEG A;  4KYW A;  3E5Q A;  1FT9 A;  4LB5 A;  2YPR A;  5D5U B;  4M72 A;  1FNN A;  4LJZ F;  4IHS A;  1SD4 A;  3F22 A;  1ULY A;  2W24 A;  2IA2 A;  2L02 A;  3C7J A;  1HW5 A;  2PN6 A;  2FMY A;  5CJ9 A;  3GZ5 A;  1IZ1 A;  5ICE A;  4HQE A;  4S04 A;  2L4A A;  2YSR A;  5AIQ A;  5D5W B;  1UFM A;  1T2K A;  4FHT A;  2NYX A;  1BI2 A;  1PUE E;  4EMS A;  4AIK A;  4B09 A;  1XSV A;  4IRH A;  1PP8 F;  5HS8 A;  4JK1 X;  5E1X A;  2XKO A;  4NHJ A;  2P6S A;  4CXF A;  4L18 B;  3V4G A;  4L0Y B;  3CUQ A;  3WTU C;  4HDV A;  3ZPL A;  3FXU A;  4XLP F;  1WRJ A;  3D5L A;  3FF5 A;  4B8X A;  3C18 A;  2EFO A;  2J5O A;  3J80 K;  1ON2 A;  1ZRD A;  1U78 A;  2VT2 A;  3O2P E;  2HFH A;  2BEO A;  4P9F A;  2GIV A;  5H20 A;  2HDC A;  4LG0 A;  4KN4 X;  4CGZ A;  2H94 A;  2Q0O A;  1IXR C;  4HX8 A;  1LB2 A;  1YW8 A;  1ZRF A;  3QU3 A;  5L3B A;  2VXZ A;  2MA3 A;  5E1Z B;  2M87 A;  1OKR A;  4U0W A;  2E1C A;  2D2W A;  4ZYD A;  1SMY F;  3B73 A;  3BPV A;  2CFX A;  4M74 A;  3EYY A;  5CLS A;  4Y13 A;  2DAO A;  3I59 B;  4A6D A;  1OYW A;  5J8C A;  1K78 A;  3ISP A;  1ZHF A;  2CGP A;  4XBF A;  1R1U A;  4M71 A;  4ETS A;  1S6L A;  3TOA A;  4EJV A;  2FBH A;  4HQM A;  2KKO A;  3B02 A;  4MHG A;  4HX4 A;  1YFH A;  4ZYG A;  3I0T A;  4G8X A;  5A2Q K;  4AVP A;  4H0E A;  3DEU A;  3CO6 C;  2VC1 A;  3GFI A;  4HX7 A;  1D5V A;  3JAM Z;  3KP5 A;  2O3F A;  2OA4 A;  5L3G A;  5ICC A;  5DCM A;  3GF2 A;  5HVQ C;  1XN7 A;  2MBF A;  2E7X A;  2RNJ A;  3DXJ F;  3ZN1 A;  3RKX A;  4AD9 A;  1HST A;  3RI4 A;  1KU2 A;  1L0O C;  1B1B A;  2IT0 A;  1MDM A;  2Y0M A;  2FEZ A;  1ZAO A;  1BIA A;  1LDD A;  2QVO A;  2CQK A;  4Q4Z F;  4A5N A;  3CO7 C;  1XGN A;  2F5F A;  3BY6 A;  1RI7 A;  4HYE A;  4HBL A;  4RB0 A;  5BPD A;  5BQT A;  3RPQ A;  3U1D A;  2ADU A;  2JTV A;  2VOO A;  5ICG A;  2BBY A;  2DK5 A;  2L3D A;  3BDD A;  2JPC A;  4OIN F;  1ON1 A;  2GAU A;  2G9W A;  4U0Y A;  3HOS A;  2EV5 A;  4M9Z A;  2KIF A;  4A6E A;  4N9H A;  4KA4 A;  3ULQ B;  2OZU A;  2QUF A;  2QQB A;  1EH7 A;  4O3M A;  1V4R A;  2IJL A;  2KIM A;  4RGX A;  1BM9 A;  2W85 A;  2XAG A;  4HOB A;  3GLX A;  2FXA A;  5LEK A;  3HOT A;  2OU2 A;  4KUM A;  3KP4 A;  2DO7 A;  4G7Z F;  3GUD A;  4I7H A;  2IPQ X;  3TO6 A;  2PG4 A;  1OYI A;  2A5Y B;  4IHT A;  3ZMD A;  3W6J B;  3IHU A;  1T38 A;  2FNA A;  3KCC A;  1S7A A;  2M1B A;  2C6Y A;  4HV5 A;  3M9A A;  4KIG A;  4P5O A;  1R58 A;  2KRF A;  3HTU A;  4IF4 A;  1EV7 A;  4EJW A;  4EQQ A;  4HLY A;  3IRQ A;  3I54 A;  1QZY A;  4HV6 A;  4HA8 A;  3SHF A;  2P7C B;  1YS6 A;  4FX4 A;  2DPU A;  5HLG A;  1ZGJ A;  3D0S A;  4A2U A;  2GA1 A;  3REO A;  3IWF A;  1F5T A;  3JW4 A;  2YX7 A;  1GXQ A;  1B9N A;  3GWZ A;  3KFW X;  3EUH A;  3KEQ A;  1RUN A;  2V1D A;  4M9X A;  1MJB A;  3J80 Z;  2XVC A;  3EYI A;  3FX3 A;  5L3D A;  3BJO A;  1Z9C A;  2DI3 A;  1ZG1 A;  1JHH A;  3FWE A;  5FLX Z;  3F72 A;  3LST A;  1BOA A;  3M1E A;  2VBW A;  4GGG A;  2GXG A;  4L9N A;  3WTS C;  4I0A A;  1LJ9 A;  2BE5 F;  5E20 A;  2E1N A;  5LRS A;  3M8F A;  3DV8 A;  1SD7 A;  2MH9 A;  2D1H A;  1P92 A;  3ZMT A;  5DYM A;  2FF4 A;  1REP C;  4I02 A;  3MZH A;  5BMZ A;  3M8E A;  3L7W A;  2HKO A;  4LB6 B;  1I6X A;  6PAX A;  1IRG A;  1FYL A;  1MKM A;  3MAJ A;  3CUQ B;  3T0Y A;  1SD6 A;  4A0Z A;  5ICF A;  3KE2 A;  1TW3 A;  2QQA A;  4NQW A;  4MQ9 F;  3HIF A;  4QWQ A;  2O03 A;  1UST A;  4XRF A;  3WTZ A;  1T98 A;  1FSH A;  2Z3Y A;  1KU9 A;  1EH6 A;  1CF7 B;  2HTS A;  5HOO A;  1J2X A;  1BJA A;  4IXA A;  1AOY A;  1TBX A;  3K1P A;  4L0Z B;  2YX4 A;  2PBI A;  5KK1 A;  4R8H A;  5F1R A;  3ZMS A;  4RGS A;  5BS6 A;  1GXP A;  3VOE A;  3FZV A;  2H6B A;  2FQ3 A;  2Z33 A;  3PFI A;  2DQL A;  2BGC A;  2O0Y A;  3QPH A;  3HSF A;  4CO8 A;  3ZMV A;  2XAH A;  1LDJ A;  1PDN C;  3QP5 A;  2O6G E;  3E6D A;  5F6F A;  2IRF G;  2CW0 F;  1KGS A;  2E7W A;  1TTY A;  1W7P D;  4N9I A;  2ZXJ A;  4I98 B;  2V6C A;  3PQK A;  2LKP A;  2HKX A;  4KN7 X;  5D8L B;  2K27 A;  5CVU A;  1KA8 A;  3J7A O;  2XKP A;  1XSD A;  4EJT A;  4ZYH A;  4XSX F;  2P5K A;  1LEA A;  2WTE A;  1G3Y A;  3ZMU A;  1SFU A;  2MD5 A;  4RAY A;  3HRU A;  4CIC A;  2RVC A;  4HF2 A;  2GQQ A;  1KQ0 A;  4FX0 A;  3WTV C;  2O8X A;  2YR2 A;  2PJP A;  2FA5 A;  3F6V A;  3J81 Z;  1YIO A;  1XMA A;  4NB5 A;  5ILU A;  1O3S A;  3WOD F;  5DUI A;  5D6F A;  1DDN A;  5CVI A;  3WTY C;  1B9M A;  4I01 A;  3KZY A;  1R1V A;  5FFX A;  2ETH A;  3TO9 A;  3HSR A;  4O6J A;  4ESJ A;  1XGM A;  4PGG A;  3WGG A;  2HEO A;  5DD4 A;  4CZZ A;  3FMS A;  2H6C A;  3JSO A;  1S8N A;  2MLG A;  4L9V A;  1FSE A;  4G7O F;  4R1H A;  2F2E A;  2J5P A;  3P9C A;  2XGX A;  5KVR A;  2ESH A;  4ENN A;  3FHZ A;  4MQV A;  1G3T A;  4PGH A;  3V8K A;  2TDX A;  1IXC A;  5EEH A;  1FYK A;  3E3V A;  3GYH X;  3K69 A;  3MQ0 A;  2DQR A;  2ESN A;  3FXQ A;  3HUG A;  3I59 A;  2OQR A;  2EJR A;  3TKY A;  4OIP F;  3F8B A;  2X0L A;  4M6Y A;  1S7O A;  3CLO A;  3L09 A;  1J59 A;  1T6S A;  5HDK A;  2A61 A;  2V1X A;  3ABU A;  1FX7 A;  4EM2 A;  2FNP A;  5LLQ A;  2PMH A;  3LFK A;  2O61 A;  5TRD A;  2DLL A;  1FP2 A;  1W7P B;  1UHW A;  3F23 A;  2WV0 A;  3WTX C;  3QOP A;  1ZH5 A;  3Q9S A;  3CTA A;  1Q1H A;  4IPA A;  1K79 A;  2LF8 A;  1L3L A;  3OOP A;  3ROU A;  2VE8 A;  4EV0 A;  2OZ6 A;  3HRS A;  4OMY A;  4G6Q A;  3RIR A;  3V8J A;  4PCQ A;  3HRM A;  1YQA A;  4RB2 C;  2A07 F;  3K9T A;  3LA3 A;  4HF1 A;  3ZN0 A;  2VON A;  4I2O A;  3I71 A;  2HOE A;  4EJO A;  2NNY A;  1QZZ A;  3ECH A;  5LBQ A;  5LHG A;  3HHH A;  4RS8 A;  2JT1 A;  4BH9 A;  1ODD A;  2EFQ A;  1MGT A;  3HSE A;  2QYO A;  1P4X A;  4PDK A;  1FZP B;  1XSX A;  2PQ8 A;  4N0B A;  2LF7 A;  2ZBK A;  2CG4 A;  1B4A A;  3LWF A;  4U0V A;  4LK1 F;  4OMZ A;  3VOD A;  2HYF A;  2K02 A;  4IVN A;  1XMK A;  2Q2E A;  3G3Z A;  4L9T A;  1FP1 D;  4UHT A;  3QAH A;  2VN2 A;  3F21 A;  1STZ A;  1Y0U A;  2NRA C;  1KYZ A;  5CVV A;  2L54 A;  4WXD A;  1XCV A;  1BI1 A;  4ZYE A;  4YII A;  5D8K B;  5IT9 Z;  1GVJ A;  5DDG A;  1PP7 U;  3HYI A;  3ECO A;  4WK8 F;  1J75 A;  3R60 A;  3R6S A;  2QQ9 A;  2RGV A;  1BC7 C;  3GVA A;  4HAM A;  2K7L A;  2STT A;  4KIC A;  2CYY A;  3M7G A;  2DK8 A;  2R7F A;  1QBJ A;  3FXR A;  4M73 A;  4Q47 A;  2VT3 A;  5D5X B;  2NAZ A;  5LGT A;  2PLY A;  1OYY A;  1XDS A;  5BOX A;  1K78 B;  2ZME B;  3JSP A;  4XSZ F;  5LGU A;  3P7N A;  2RKH A;  2EA2 A;  3U2R A;  1QGP A;  1IAW A;  4Y15 A;  3LA2 A;  2R7D A; 
#chains in the Genus database with same CATH topology
 1ZRC A;  1K7A A;  2C6Y A;  4F93 B;  1TW2 A;  1TWH J;  1BIB A;  4A3K J;  1OIS A;  1XCB A;  3I5U A;  2V7F A;  2Y31 A;  3E5X A;  3E6B A;  1N78 A;  1OJL A;  4RLQ A;  4DQ2 A;  1FOW A;  2K9S A;  4M3D A;  2HDD A;  5HDN A;  3KZI C;  5A2Q Z;  3FKJ A;  3PNV A;  2R7W A;  4II2 A;  1P4W A;  2MLK A;  2DA7 A;  3W6K B;  3HL2 A;  1BC8 C;  2JA5 J;  2XAS A;  3DLL F;  2M4G A;  1TWA J;  3O3K A;  1YX5 A;  1T95 A;  2OF7 A;  3BTI A;  1Y1W J;  1AKH A;  5HLI A;  1A04 A;  4LLL A;  2FOK A;  3TOB A;  3DP7 A;  1K6Y A;  1Z6R A;  2DTR A;  3CF5 F;  2B9S A;  3Q0V A;  1HDD C;  2R7O A;  1MMG A;  1WJF A;  2HYG D;  3LSI A;  4L5J A;  1WQ2 A;  3G71 I;  4KMF A;  3F3X A;  3O8H A;  4G6D A;  3BWG A;  1PJR A;  2QCO A;  5GAG J;  5K5R A;  2LKX A;  4BQA A;  2K9M A;  1GHC A;  1KQ8 A;  3CMA I;  3SDG A;  2VBX A;  1WJC A;  2BW3 B;  5CVR A;  4EM1 A;  2NXN B;  2E2I J;  1FBQ A;  2HU9 A;  4R79 A;  1LDK B;  4BL0 B;  1MJ9 A;  2GWR A;  4ZZD A;  1JI8 A;  5E3O A;  5FB2 A;  1YW9 A;  2VOD A;  2MC3 A;  1LFP A;  3AL0 B;  3PL8 A;  2LBF A;  2P5V A;  4BYY A;  2G7H A;  3ERE D;  3U21 A;  4RB1 A;  3FIS A;  1HXD A;  1EF4 A;  2JZY A;  2W25 A;  2CQ7 A;  1OPC A;  1XGS A;  4ON0 A;  2Q2E B;  3GFL A;  2K4B A;  3MWM A;  5FKN A;  4G6T B;  1SD5 A;  1Y39 A;  1YRN B;  1ETK A;  4HZF A;  2ZME C;  2ZSH B;  2M7A A;  4G12 A;  4UXN A;  1IN4 A;  2L5Q A;  1Z6T A;  2RNG A;  3DBL B;  3FDY A;  2VJ4 A;  2DOF A;  4AWX B;  1MD0 A;  3F8N A;  3S2W A;  3PJR A;  1S72 I;  1F9N A;  3BJ6 A;  1SFX A;  3JTH A;  5B5E C;  4LMY A;  2CQQ A;  1IGN A;  2VAS A;  4N4N B;  4TV7 A;  3K0L A;  4FE4 A;  2GA2 A;  2EB7 A;  3ZQI A;  2OJE D;  3ASO H;  1H88 C;  2EIK H;  3G1L A;  2QF7 A;  3CP2 A;  1R00 A;  3TDZ C;  1EH8 A;  4BHB A;  4DYR A;  4BJ5 C;  5HLH A;  5FKK A;  1R36 A;  3K4J A;  3T5X A;  5JFR A;  2R7Z J;  2FE3 A;  1DQU A;  1NHA A;  1RZ4 A;  4DGW B;  2LD5 A;  3RPU A;  1LE8 B;  2M30 A;  2VPL A;  3WTT C;  1D8J A;  4IRG A;  1JJ6 C;  2V79 A;  4HPQ A;  1E3P A;  4PFO A;  3BG7 A;  1QZE A;  4IKF A;  4CZC A;  1HSJ A;  4BDZ A;  3R61 A;  2AXL A;  1UCR A;  5LHH A;  4X6A J;  2XHK A;  2BV6 A;  1DGW Y;  2IEK A;  3HJE A;  1ERD A;  4BHP A;  3G73 A;  1H89 C;  2HQR A;  3H92 A;  1IV6 A;  3FM3 A;  1IV8 A;  3BP8 A;  5DD8 A;  4P96 A;  5FLX K;  5JHU A;  3HPH A;  3L2V A;  4A5M A;  2JPB A;  4ESF A;  1W7P A;  4XKW A;  2P0W A;  2WC2 A;  1KU7 A;  2P5L C;  3OIO A;  2XB5 A;  4JQF A;  4XKC A;  3UR3 C;  1G3W A;  2NVT J;  5L3C A;  5IP9 J;  4LD5 A;  3OV8 A;  1H9G A;  2XDV A;  1MSE C;  1SAX A;  1A35 A;  5DUK A;  1U3E M;  5E79 C;  3WE3 A;  3I4M J;  3WU0 A;  1I1G A;  4Q5S F;  2HGC A;  1RNL A;  3R0J A;  5HDG A;  3BR3 A;  2HTJ A;  2ZXW H;  3K4L A;  3HM5 A;  4E70 A;  2GOX B;  1YJW I;  2DMU A;  1MBJ A;  1Y8Q B;  2VKH A;  3E6M A;  2A5W A;  4GYG A;  4LG3 A;  1R71 A;  2R92 J;  2QEN A;  5D6E A;  3HGG A;  1XG1 A;  4A3F J;  5CPR B;  1KU3 A;  5LFA A;  3HXL A;  4PJ0 C;  4OOI A;  5E17 F;  4CCO A;  2M9H A;  2K4J A;  4XR6 A;  2Q1Z B;  4UUS B;  4C2M J;  2VOP A;  1I39 A;  3WU1 B;  3S8P A;  2R5Z A;  1LPQ A;  2VLA A;  4MTE A;  2AQF A;  4QSH A;  1ZK8 A;  4LIT A;  3CCE I;  4FIS A;  2Z5U A;  2QBY B;  4P55 A;  1D3Y A;  3KP2 A;  2KRH A;  3IC7 A;  2EZI A;  1HW1 A;  1RUO A;  3ZMZ A;  1DUX C;  5DV5 A;  3IRR A;  2OD5 A;  1D8K A;  1FBS A;  2Z1D A;  4HNU A;  3L2C A;  3QRF F;  3FXK A;  2HQ5 A;  2XAF A;  3CJT B;  1J7K A;  1YS7 A;  3A01 A;  1HKT A;  1VF9 A;  3I58 A;  1XS9 A;  4Q48 A;  1SVL A;  4XK4 A;  3Q0W A;  2DA1 A;  2KFD A;  1Z05 A;  2UUZ A;  4YIR X;  3R0A A;  1YRN A;  4HF0 A;  2H1L A;  3H3V K;  2MSY A;  2CSO A;  2XAQ A;  1XDU A;  2V1U A;  3F8M A;  3CMY A;  1BOB A;  5LHI A;  3LQQ A;  3G2B A;  4JBA A;  1UJ8 A;  4EEF G;  1H9T A;  2DOA A;  1LKX A;  1ZN2 A;  1R4N B;  2JVG A;  5FKM A;  2EPF A;  1T0F A;  1VQ8 I;  3GTK J;  1M1E B;  5DCF A;  3RDI A;  1VZ0 A;  5TJJ A;  1VQP I;  4MIM A;  3GTO J;  4KT5 C;  4HNV A;  2KL4 A;  5HS7 A;  2VC0 A;  2EWN A;  4XLF A;  1BA5 A;  2M34 A;  2DW4 A;  4YEJ A;  4RM2 A;  3H5R A;  3CDH A;  3GTJ J;  1IN8 A;  4GCV A;  4BGD A;  2PMU A;  3QU6 A;  1YW7 A;  1KON A;  2IW5 A;  2QSF X;  4V19 K;  2CUZ A;  1QPM A;  1S7E A;  2OTJ I;  2DMN A;  4LLG F;  4UB8 C;  2A6H F;  1RC9 A;  1ZYR F;  2HVR A;  3H5N A;  2DFF A;  3IAM 2;  1ZEL A;  3CME I;  3N05 A;  2DBB A;  2FU4 A;  1LNW A;  2KHM A;  4IHV A;  3CES A;  4ENK A;  3ZQ7 A;  4DJA A;  3DEW A;  1WCM J;  1Y1V J;  1HDP A;  3OYF A;  2ISZ A;  3DKX A;  3V7R A;  1IUY A;  1B6A A;  2XRL A;  5M3M J;  3OR1 C;  1X3U A;  4UVB A;  3JAM K;  4GO1 A;  3AAF A;  1MJA A;  5E3M A;  2OUM A;  1VQ6 I;  3TO7 A;  2M8G X;  3EDP A;  1FOY A;  2W57 A;  3ERM A;  1MMD A;  3JRC A;  5F08 A;  1QPI A;  4XRS A;  4HW0 A;  2DJI A;  5IYC J;  2A69 F;  2IXS A;  2ZNZ A;  2ZKZ A;  2FX0 A;  2JWT A;  2EZL A;  4DBR A;  4Y7N J;  4M6X A;  5IT3 A;  4BY7 J;  2KDO A;  3ZP5 A;  3DFG A;  2ZME A;  1QQI A;  2HQN A;  3RCO A;  5C4J J;  1TWG J;  4E7S A;  1R49 A;  2XUB A;  2Z9O A;  2WB1 A;  3ASN H;  4OIR F;  2AXT C;  3P9K A;  5L3F A;  2CO5 A;  1U2W A;  1Z7U A;  3QP6 A;  2IP2 A;  5JVT A;  2W1O A;  1VQN I;  5E18 F;  3KYL A;  2Y9Z A;  1HF0 A;  2KIQ A;  2HDW A;  1A5J A;  3H5A A;  5K7F A;  1JXS A;  4WXC A;  2OTL I;  1YLF A;  4P9U A;  1USS A;  5JLX A;  2BYV E;  4EGY A;  1ZR4 A;  4U88 A;  4LGW A;  1HW2 A;  3L9F A;  1KQ9 A;  1JE8 A;  4XQF A;  3BRO A;  2H27 A;  1Q1V A;  1JTX A;  2E1M B;  4EGZ A;  3BQY A;  2GXB A;  5K7Z A;  3DPT A;  4XLE A;  3MVP A;  2XF6 A;  1ETY A;  2X6O A;  3FK6 A;  4KNY A;  5K1Y A;  1I27 A;  2VQG A;  3BG5 A;  4AID A;  1SC7 A;  2DU9 A;  3ZOB A;  3F8C A;  3VB2 A;  3BOQ A;  4CHU A;  3M4O J;  1FEX A;  3T1B A;  3BG3 A;  1A31 A;  1FBU A;  2K85 A;  1HKS A;  2HNH A;  2HI3 A;  5J6X A;  3PO3 J;  3DKW A;  1JKQ C;  3FM5 A;  2OC6 A;  3H9J A;  2DFI A;  1H8A C;  3VYU B;  1G3S A;  2JA6 J;  1FPQ A;  1TQP A;  1W36 D;  1HC8 A;  2ZB9 A;  5AIP A;  3NAR A;  3IKT A;  4MFE A;  3RKQ A;  2DCE A;  3FHN A;  5E3N A;  4U7D A;  1P2F A;  3FMR A;  3OIQ A;  1R1T A;  1IW7 F;  3C2G A;  1PUF A;  3CF2 A;  2EFN A;  3AG2 H;  5GTI C;  2HR3 A;  2EIM H;  3DKY A;  2CWE A;  3VYR B;  5M3F J;  1F1Z A;  4PK4 A;  3CC7 I;  4XOR A;  3T8T A;  3S32 A;  3DEE A;  1IN7 A;  2IA0 A;  1YG2 A;  1R9T J;  1ZRE A;  1AWC A;  3M07 A;  2CJJ A;  1U9O A;  4XNF A;  3V7S A;  1K4T A;  1F4K A;  2O8K A;  2QM3 A;  2RQP A;  4L5I A;  3EUA A;  4KMU X;  2UXX A;  2E2H J;  5AON A;  1CGP A;  4JX6 A;  3E6C C;  4YRV A;  2QGU A;  4ZH4 F;  1TNT A;  3KEO A;  4BBS J;  3R4K A;  1XMX A;  2EFP A;  3BJA A;  3A4C A;  4DOZ A;  3E1S A;  1Y56 A;  4G9Y A;  4YFN F;  1YO5 C;  2V9V A;  4DZJ A;  4E7H A;  1E2X A;  2R0Q C;  4ENJ A;  3V7C A;  3HTS B;  1MMS A;  1UB9 A;  1MZB A;  5J1R A;  3DF8 A;  3ML6 A;  2XRO A;  2MGQ A;  2MFZ A;  5FFZ A;  2DN0 A;  2XF7 A;  3PIP F;  5J3L A;  1OCZ H;  1IF1 A;  2XGC A;  2QQ8 A;  4BHC A;  1Z1D A;  3LQR A;  1RIO H;  5LD2 C;  3PQJ A;  3CCU I;  1BI0 A;  2HWV A;  1WI9 A;  4OAY A;  1U5T C;  1T33 A;  1ZG3 A;  4BXX J;  4PZJ A;  1R5H A;  5IOZ A;  4BE0 A;  2X6X A;  4F91 B;  3HOW J;  2COB A;  1O3T A;  1WKM A;  1TQM A;  2UV1 A;  1G4D A;  3GX4 X;  3J7Z I;  2LR8 A;  1VFC A;  4XOP A;  1BBY A;  3CCL I;  2IS4 A;  3ABL H;  4MNU A;  2FBI A;  1WH5 A;  3FXM A;  1MIJ A;  1OR7 C;  2ZFW A;  3ONQ A;  3G1M A;  3CP8 A;  1D0Y A;  1O57 A;  2WBM A;  4NC8 A;  3N97 A;  4XLC A;  4IL6 C;  3O6B B;  2ELH A;  5FD5 A;  2UWM A;  2XV4 S;  2XSJ C;  4D0P A;  4RBO A;  2E1O A;  3WU2 C;  4LG0 B;  2KDZ A;  3GFM A;  1DGR M;  2B7E A;  1YOV B;  3KP7 A;  2BHZ A;  4IEJ A;  4ZDP A;  4BQN A;  3MFK A;  2RV8 A;  1KYW A;  1QO0 D;  4FAS D;  2STW A;  4RAZ A;  2ZNY A;  2PEX A;  3ZQQ A;  2IGM A;  2ZXI A;  4Y17 A;  2UXN A;  2V4J C;  5TIS C;  2OBP A;  3AL0 C;  5DCM B;  3RJP A;  3WTW C;  1MH4 A;  4DNC A;  5M5Y J;  1I50 J;  3WG9 A;  3OYN A;  4YG2 F;  3S93 A;  4MEX F;  5TGT A;  3LAP A;  4OIO F;  3GO5 A;  2F5D A;  1XB4 A;  3I4P A;  4DYQ A;  2WB1 N;  3DQV C;  5K7H A;  2BVM A;  3P9I A;  3J81 K;  2Q8K A;  1J9I A;  5IOY A;  1HKQ A;  4V2F A;  5H6R A;  4EJU A;  1FLI A;  3RTR A;  4W97 A;  4KIF A;  1O7F A;  5CVJ A;  4XRS G;  1D1B A;  2XGD A;  3E5U A;  1X4P A;  2GOM A;  3Q5F A;  1UHS A;  2A6E F;  2R3S A;  2VBZ A;  1OCO H;  1TP4 A;  3F0C A;  3MCZ A;  1HQC A;  5E1W A;  4A12 A;  2PI0 A;  4CDG A;  3D5R C;  3ABT A;  4AIH A;  3L2W A;  3GTG J;  1B59 A;  3SZT A;  3CUO A;  5IP7 J;  3BC8 A;  3OS2 A;  2IGO A;  1UEL B;  1JHF A;  3IUO A;  5F04 A;  3BTJ A;  1ZG5 A;  4ZZL A;  1E0E A;  2H8W A;  4N4O B;  2V26 A;  4MGR A;  2V1N A;  1IRF A;  4UVA A;  4H4K C;  4WCG A;  3I4N J;  2FRH A;  3M8J A;  3FIW A;  3VEP A;  3QOD A;  4EVI A;  4G94 A;  1IO2 A;  3H3U A;  4AC0 A;  3G6E I;  2ELK A;  3KET A;  3DPL C;  5LEJ A;  2ELJ A;  4LLN A;  3K2Z A;  1X4O A;  3LAJ A;  1LVK A;  2EA4 A;  1UHM A;  4QPO A;  3TMO A;  1V3F A;  3IH2 A;  3RYR A;  1QA6 A;  4LK0 F;  1S3J A;  4NC7 A;  3JR9 A;  2GXA A;  2K86 A;  4HDU A;  1K6O A;  1WJA A;  2X48 A;  1MDM B;  2ID6 A;  2P6T A;  3MN2 A;  1SFE A;  3K1N A;  3H3Z A;  1APL C;  3K1M A;  2CMP A;  3DLA A;  1E17 A;  3DTK A;  2ID3 A;  2L7K A;  3DPU A;  3SQN A;  3BR5 A;  3SEZ A;  3VFZ A;  5CYV A;  2XAJ A;  5DS9 A;  1LQ1 A;  1D5Y A;  5JHF A;  4WX9 A;  1WWX A;  3SFI A;  1GV5 A;  2QBY A;  3NEU A;  1BW6 A;  2KJC A;  3SXY A;  1V5G A;  3T8R A;  2M5W A;  2GZW A;  3I64 A;  3PSI A;  4MO7 A;  4FE7 A;  4UVC A;  1DPR A;  3EQL F;  2WWY A;  3S3N A;  1O3R A;  1QU3 A;  2UZK A;  5HOD A;  3Q0U A;  1T0F C;  1YIJ I;  1X58 A;  3HEF A;  5FO5 A;  1TQI A;  2BW3 A;  3FBN B;  1WJB A;  4ENM A;  4IQ4 A;  1YTY A;  2F48 A;  3TED A;  3QPT A;  2K9Q A;  4GXO A;  2VE9 A;  2Y48 A;  3COA C;  2EV6 A;  3BT9 A;  3C1D A;  3AG4 H;  2BY0 A;  2K40 A;  3GME A;  3KX2 A;  4UNO A;  4LFU A;  4WF2 A;  2DPD A;  3K70 D;  5FRO A;  1UG2 A;  2QZ8 A;  3EPZ A;  4OU0 A;  4BXU A;  4CCJ A;  2QA4 I;  1IN5 A;  3HDD A;  1OQY A;  4I09 A;  3SZG A;  2LFB A;  5BPI A;  2FBK A;  1O7L A;  2EV0 A;  5L3E A;  2KZG A;  4ASN A;  1W5T A;  3BPX A;  2E71 A;  3BCA A;  3TGN A;  4I6Z A;  3RKW A;  3ABK H;  1FY7 A;  1IRX A;  1UG0 A;  4GYI A;  1T39 A;  5LGN A;  4IRI A;  3RPU D;  4XID A;  3RYP A;  4IHX A;  3A0H C;  3S3M A;  5B66 C;  2P4W A;  1QNT A;  2KJB A;  1CF7 A;  1ZLJ A;  2X4H A;  5DM6 F;  2IVM A;  4IJA A;  4BNC A;  2JA2 A;  2R5Y B;  4X0G A;  1U5T B;  3IKV A;  4E7L A;  4A0X A;  2DA4 A;  2GBY A;  5F1J A;  1HBX G;  3SEQ A;  3LSG A;  1X1C A;  3SDB A;  1J09 A;  3GTP J;  1FIP A;  4B43 A;  3OR2 C;  3S2H J;  3MD2 A;  4IQJ A;  4J19 A;  3HOZ J;  4XL9 A;  4IHY A;  3CDI A;  1HOM A;  1YYV A;  4KIB A;  1H0M A;  2HS5 A;  2L4M A;  2AS5 F;  1R22 A;  4AYB A;  4Y3O A;  3K10 A;  3NAU A;  1P9Q C;  5JR3 A;  4MTD A;  3MKL A;  1MBH A;  2DJN A;  5IY5 H;  3KLN A;  2LP0 A;  5LRR A;  4DYC A;  5K5O A;  2EK5 A;  4NDL A;  4RLF A;  1TLH B;  2DT5 A;  1YJN I;  1P6R A;  1I1S A;  3QPL A;  3FMQ A;  1W4M A;  4KDP A;  3JRA A;  4RGR A;  4CYD A;  2M7B A;  1TWF J;  3MZY A;  4G7H F;  1X3W B;  2O5R A;  2KMU A;  2RC4 A;  1U6G A;  1RKT A;  2A6T A;  3NQO A;  4CH7 A;  4EM0 B;  2QLZ A;  5ILV A;  5F64 A;  5IPA A;  3CMM A;  2YU3 A;  4C3J J;  4QLC U;  1ZLK A;  4DBQ A;  1VQ5 I;  3TP3 A;  4BAY A;  3NRV A;  5D4S A;  2FSW A;  2DA6 A;  2Z99 A;  4K2E A;  2F5C A;  3S1N J;  5E8I A;  5H6Q A;  1FYM A;  2LDU A;  3Q3S A;  5ERI A;  2HOA A;  5CQG A;  2ACJ A;  3CQZ J;  1W5C C;  3K4C A;  1VQ7 I;  2P8T A;  3F8F A;  2ZCW A;  3DCF A;  1PVE A;  1Z3X A;  2PFB A;  2PMZ N;  3MKY B;  1JT0 A;  4XOT A;  1TC3 C;  2M45 A;  3LMM A;  4XIC A;  4PJL A;  2R7U A;  2M0M A;  1G6N A;  4BXF A;  1BI3 A;  3I53 A;  1GVD A;  2RN7 A;  1Z91 A;  5HNF A;  1I5Z A;  1R5G A;  4PJJ A;  1W5S A;  2I10 A;  4XON A;  4CCK A;  2ZO4 A;  2E2J J;  3F6O A;  2V6E A;  2LH9 A;  3LOC A;  1BN5 A;  1R7J A;  2WAF A;  3BZK A;  5F0C A;  4C9Y A;  2XRN A;  1LEB A;  3TP0 A;  3HHG A;  3A03 A;  3ELK A;  3C3W A;  3ZQC A;  4S05 A;  2E1M C;  1TNS A;  3SZP A;  4XN3 A;  4WWC A;  3OY9 A;  3CUQ C;  4C3I J;  2FOW A;  3ZGK A;  3RZD J;  4C30 A;  3A01 B;  1TWC J;  5KCM A;  1J0R A;  2XB0 X;  2BOL A;  2TRT A;  4M9S A;  1XTA A;  4BDY A;  2EIL H;  3WGH A;  3KLO A;  2JSC A;  5KHD A;  2Y0S N;  1WHU A;  1X19 A;  1DPU A;  3V8L A;  3IH3 A;  3LSR A;  3L00 A;  3HOY J;  5E8G A;  5FD6 A;  5FGM A;  4E7K A;  1Y8R B;  5EF6 A;  1GT0 C;  3IL2 A;  4UUV A;  1J5Y A;  3MMY B;  4I0B A;  1XD7 A;  3QWL A;  2NNN A;  1OR7 A;  5HNH A;  3KP6 A;  1VTN C;  3LL7 A;  4MEY F;  1MBF A;  2B0L A;  1BJZ A;  2VQL A;  4Y33 A;  2DDB A;  3SFZ A;  3I9V 2;  1XX5 A;  2L01 A;  2P7V B;  1C0W A;  2Y75 A;  4XKV A;  4A3I J;  1MH3 A;  1S29 A;  5ILS A;  4FQG A;  3MEX A;  3S1R J;  4OIQ F;  1PYV A;  2F5E A;  2G7U A;  4RAF A;  2DFH A;  4CSW A;  3OOU A;  4B4C A;  2W84 A;  2WY8 Q;  2QWW A;  3WE2 A;  1U5T A;  3IWZ A;  2LRE A;  3L2Q A;  1Z67 A;  5IT9 K;  5BNG A;  2M4K A;  3I56 I;  4O5V A;  3WGI A;  2JRT A;  2K3P A;  2M8E A;  2NS0 A;  2YU9 J;  2A3S A;  1SMT A;  2DYS H;  2ISY A;  3GFJ A;  5K5Q A;  1IC8 A;  3EET A;  1FMW A;  2LC2 A;  3KP3 A;  5D5V B;  3N4M A;  5GTH C;  3H35 A;  3S14 J;  4L9J A;  1O3Q A;  1TL8 A;  2EFW A;  1X1P A;  3Q9V A;  2D45 A;  3K4M A;  2X9D A;  3FK7 A;  4RB3 C;  3VSK A;  1U8R A;  3E97 A;  5DEQ A;  3TBI A;  1ONV A;  2LNB A;  1WSU A;  5FRN A;  4RGU A;  2RDP A;  5HS9 A;  2X1D A;  3S1Q J;  2ZJ2 A;  3OYI A;  2W7N A;  5D4R A;  1ETW A;  4ESB A;  3HOU J;  3LA7 A;  2HVQ A;  3TDU C;  2VB6 A;  3VSL A;  4IHW A;  1QVT A;  3RKY A;  1P4A A;  2OQG A;  4WXH A;  2VBY A;  4KFC A;  3HB9 A;  3RSN A;  3WHB A;  1RKW A;  3CJN A;  4A3C J;  2E35 A;  4ANJ A;  2D1V A;  2LSO A;  1IXS B;  3J7A Y;  1LVA A;  4UV8 A;  3JTG A;  4YIF A;  1ZAR A;  1FJL A;  4C2U A;  4A93 J;  1RES A;  3JRB A;  1IN6 A;  3L1P A;  1FC3 A;  4A3D J;  3GZ6 A;  4FT8 A;  1JUM A;  4YFX F;  5JI6 A;  2MH2 A;  3GEZ A;  5J8F A;  1DP7 P;  3BCB A;  3U9G A;  1WJD A;  2A68 F;  2IA1 A;  2M2E A;  1JGS A;  3GXO A;  2COM A;  2VJI A;  4XLN F;  5J4Y A;  2HXI A;  2H09 A;  5GAD J;  5IYB J;  4A0Y A;  3PIO F;  1FOK A;  4GFB A;  2A05 A;  2JUG A;  4HEA 2;  5ED4 A;  4U7B A;  2XIG A;  1G2H A;  3HRT A;  2WAQ N;  1FWZ A;  3KZZ A;  1VQ4 I;  4F7Z A;  2HZT A;  4BJ6 C;  4UV9 A;  2GM4 A;  4XLH A;  2OAZ A;  3BZ6 A;  3H36 A;  1ZGA A;  2KIU A;  5B1B H;  1OMI A;  4HLX A;  3DU5 A;  2FML A;  3BQZ A;  4Z2Y A;  1XGO A;  2MG4 A;  5EGO A;  1R23 A;  3W2V A;  3H0D A;  4AIJ A;  4YFK F;  3ZRG A;  3TQN A;  3GW2 A;  3I3L A;  5EEG A;  4KYW A;  2F6C A;  4ZYA A;  1A6Q A;  3ZQG A;  3E5Q A;  5EEA A;  3JRG A;  1FT9 A;  1VQO I;  4LB5 A;  2ICW G;  3OWT A;  3RZO J;  2YPR A;  3PM1 A;  5D5U B;  4BEH A;  2KQR A;  3CDL A;  3D1N I;  4M72 A;  4AU7 A;  1FNN A;  2X85 A;  4LJZ F;  3VWB A;  4IHS A;  1SD4 A;  3F22 A;  1RR7 A;  1ULY A;  5E3L A;  1OFC X;  2W24 A;  2DYR H;  2IA2 A;  2L02 A;  1K61 A;  3C7J A;  1HW5 A;  3VPR A;  4DIQ A;  1V54 H;  2KZV A;  2PN6 A;  5C3E J;  2FMY A;  4BS9 A;  5CJ9 A;  4PSX A;  3GZ5 A;  3VYS B;  1WH7 A;  3BZC A;  3ZXS A;  1IZ1 A;  5ICE A;  4HQE A;  4S04 A;  3IP4 B;  2L4A A;  2YSR A;  5AIQ A;  4PJM A;  5D5W B;  1UFM A;  3S16 J;  3MZ8 A;  3OYE A;  2F4M B;  1T2K A;  2VJ5 A;  4ABZ A;  4A3G J;  3RQ4 A;  4FHT A;  2VKV A;  1ETO A;  2NYX A;  1G8X A;  1BI2 A;  1PUE E;  4EMS A;  2XC7 A;  2HOS A;  2HYJ A;  2L9N A;  3LNQ A;  4AIK A;  5FRM A;  4V2G A;  1YI2 I;  1EKE A;  4B09 A;  1XSV A;  4IRH A;  1PP8 F;  1ENH A;  5HS8 A;  4CYC B;  1MW7 A;  3OYM A;  4JK1 X;  1B8I B;  5E1X A;  1SAN A;  3W6V A;  1DP3 A;  3W2W A;  2EZK A;  3LSM A;  2XKO A;  1XPX A;  2HZD A;  4NHJ A;  2P6S A;  4CXF A;  3FXJ A;  4L18 B;  4DW6 A;  3V4G A;  4L0Y B;  3CUQ A;  3WTU C;  2H8R A;  4HDV A;  3ZPL A;  2PX9 A;  3FXU A;  4XLP F;  1WGX A;  1WRJ A;  2IBD A;  3D5L A;  3FF5 A;  4ZC3 A;  4B8X A;  4KIS A;  3O8G A;  4CUG A;  2WA0 A;  3CLQ A;  1FTT A;  3C18 A;  2EFO A;  2YUS A;  2J5O A;  3J80 K;  1ON2 A;  5B1A H;  2HOT A;  1ZRD A;  4E4H A;  3V42 A;  4HNT A;  4PUS A;  3BTL A;  1K4S A;  5GAH J;  1U78 A;  2YS9 A;  2VT2 A;  2NOG A;  3O2P E;  2HFH A;  1YE9 A;  5FLM J;  1WFX A;  2BEO A;  4P9F A;  2GIV A;  3A02 A;  3IV5 A;  3NWS A;  2R4G A;  5H20 A;  2HDC A;  4LG0 A;  4KN4 X;  4A3M J;  2DTZ A;  4CGZ A;  2H94 A;  2Q0O A;  3SJM A;  2VIX A;  1IXR C;  4HX8 A;  2L9S A;  1YW8 A;  1LB2 A;  1ZRF A;  3QU3 A;  3BG9 A;  1V5F A;  5L3B A;  2K9N A;  3W2A A;  2VXZ A;  3CC2 I;  2MA3 A;  4PFP A;  2Y30 A;  3W3C A;  2KPM A;  2W4S A;  5E1Z B;  3LSJ A;  2CW7 A;  2M87 A;  2PMZ A;  2IS1 A;  3QYE A;  2R7R A;  1NK2 P;  1OKR A;  4ZDO A;  4U0W A;  2E1C A;  2D2W A;  2H1K A;  3GZN B;  3HC7 A;  4ZYD A;  5F0H A;  2E34 A;  1SMY F;  3B73 A;  1OCT C;  3BPV A;  2CFX A;  2LY9 A;  5EGO B;  4M74 A;  3EYY A;  5CLS A;  4Y13 A;  2DAO A;  3I59 B;  2OCE A;  4A6D A;  1OYW A;  5J8C A;  1K78 A;  1ZQ3 P;  3ISP A;  4ZDL A;  3DTE A;  2XSD C;  1JT6 A;  1ZHF A;  2CGP A;  4XBF A;  1R1U A;  4M71 A;  1W36 C;  2VQH A;  4ETS A;  1S6L A;  4GRI A;  3TOA A;  2ZC2 A;  4EJV A;  2FBH A;  4HQM A;  2KKO A;  4II3 A;  3B02 A;  4MHG A;  4HX4 A;  1YFH A;  3CCQ I;  1N77 A;  2BVL A;  2PJR A;  5B3S H;  2CQN A;  3HUG B;  3I0T A;  4G8X A;  4ZYG A;  4PSW A;  5A2Q K;  4AVP A;  5EG0 A;  3BG6 A;  3DEU A;  1YX3 A;  4H0E A;  3CO6 C;  1U8B A;  1R6R A;  2VC1 A;  4BE1 A;  3GFI A;  4HX7 A;  1D5V A;  3AG1 H;  3JAM Z;  3KP5 A;  2L7Z A;  2O3F A;  2OA4 A;  3AFH A;  5L3G A;  5ICC A;  2EQR A;  2EIJ H;  5DCM A;  3GF2 A;  5HVQ C;  1JJ8 C;  1XN7 A;  2MBF A;  2E7X A;  2RNJ A;  3OYC A;  3DXJ F;  3ZN1 A;  2R7T A;  3RKX A;  4AD9 A;  1HST A;  1D0Z A;  3RI4 A;  1KU2 A;  1DU0 A;  3PNY A;  4RMN A;  2LY1 A;  2HQA A;  2LOO A;  1L0O C;  1OCP A;  1BR2 A;  4CA0 A;  1B1B A;  2IT0 A;  4BY1 J;  3L2R A;  1MDM A;  2Y0M A;  3B6C A;  3CJR B;  2JQ7 A;  2F4I A;  1ZAO A;  2FEZ A;  1BIA A;  1LDD A;  3AG3 H;  2NOJ B;  2QVO A;  2CQK A;  2LK2 A;  4Q4Z F;  4A5N A;  3GTM J;  2NVU B;  2NVY J;  2LBF B;  3CO7 C;  4BBR J;  1XGN A;  4D1Q A;  1SFO J;  2F5F A;  1BR1 A;  3BY6 A;  4XKB A;  3CCR I;  1RI7 A;  3CC4 I;  1NG7 A;  4HYE A;  1WPK A;  4HBL A;  4RB0 A;  5BPD A;  2CS3 A;  2KP6 A;  5BQT A;  2L2O A;  4C2T A;  4Y52 J;  3RPQ A;  3U1D A;  2ADU A;  2JTV A;  2VOO A;  5ICG A;  3S3O A;  2BBY A;  4ZTJ A;  2DK5 A;  2L3D A;  2HVS A;  3BDD A;  2ZFU A;  4E7I A;  2JPC A;  2LKS A;  4OIN F;  1ON1 A;  2GAU A;  3KYD B;  3DBH B;  1VQK I;  1VQ9 I;  4KT6 A;  4D7N A;  2G9W A;  4U0Y A;  3HOS A;  3DU6 A;  1UMQ A;  2MC4 A;  3WG7 H;  2EV5 A;  4M9Z A;  3QPS A;  4UY8 I;  2KIF A;  4A6E A;  4N9H A;  4KA4 A;  4HSR A;  2EZH A;  3ULQ B;  2OZU A;  2QUF A;  2QQB A;  4RAG A;  1EH7 A;  4O3M A;  1FIA A;  1V4R A;  3OYB A;  3X2Q H;  2IJL A;  1BL0 A;  2KIM A;  3CJQ B;  4RGX A;  1Z3Y A;  4F3Q A;  2R7V A;  1BM9 A;  2W85 A;  2XAG A;  3BR2 A;  3NWT A;  4HOB A;  3GLX A;  2FXA A;  5LEK A;  3HOT A;  2OU2 A;  4KUM A;  1IUF A;  3KP4 A;  1R4M B;  2DO7 A;  3PUF A;  5KAF C;  4G7Z F;  2CUJ A;  3GUD A;  2K9L A;  4D9J A;  2F5V A;  3TL4 X;  4I7H A;  2IPQ X;  1HCR A;  3LSP A;  3TO6 A;  2PG4 A;  1Z0X A;  4E6K G;  1OYI A;  2A5Y B;  4IHT A;  3ZMD A;  3W6J B;  3IHU A;  1T38 A;  1YIT I;  2FNA A;  2GIZ A;  3KCC A;  1S7A A;  5C44 J;  4B3X A;  2M1B A;  4ZJZ A;  2BZT A;  4IO9 F;  1I3Q J;  1VI0 A;  1I3A A;  1JUS A;  5J40 A;  4HV5 A;  3M9A A;  4KIG A;  4D5C A;  4P5O A;  1R58 A;  5M5W J;  2KRF A;  3HTU A;  4IF4 A;  1EV7 A;  5J1U A;  4EJW A;  4EQQ A;  4HLY A;  5J4V A;  4M3E A;  3I54 A;  3IRQ A;  1QZY A;  4HV6 A;  4HA8 A;  4F92 B;  2MW8 A;  3SHF A;  2L7F P;  2P7C B;  1YS6 A;  2N8G A;  3KIO A;  4FX4 A;  2JN6 A;  4BAC A;  2B63 J;  4AUX A;  2DPU A;  1G59 A;  2MAB A;  2I8D A;  1X1B A;  1B72 B;  5HLG A;  1ZGJ A;  3FXO A;  3OYD A;  3D0S A;  4A2U A;  5J1Y A;  2JRM A;  3OS1 A;  3MKZ A;  1A36 A;  2QEX I;  1BW5 A;  4BEH B;  4AM3 A;  1XC5 A;  2GA1 A;  1R5I D;  5EJC A;  4EAT A;  2DT7 B;  4A3J J;  3REO A;  5FJ8 J;  5IP6 A;  3IWF A;  1F5T A;  3HPG A;  2WAE A;  2WY7 Q;  2X1E A;  3JW4 A;  2VQC A;  2YX7 A;  2IGK A;  1GXQ A;  1B9N A;  3GWZ A;  1LFB A;  3KFW X;  3K6G A;  3EUH A;  3KEQ A;  1DU6 A;  3BLY A;  4J01 A;  1RUN A;  2V1D A;  4M9X A;  1MJB A;  2HPI A;  1V55 H;  1Y6I A;  3J80 Z;  3JCU C;  2CH0 A;  2XVC A;  4UB6 C;  2CV0 A;  3EYI A;  3FX3 A;  1RET A;  5KNL A;  3OMY A;  3HOX J;  5L3D A;  1POG A;  3BJO A;  3H1C A;  1Z9C A;  2DI3 A;  2EIN H;  2ZJR F;  3JRD A;  3KEY A;  2R7Q A;  1ZG1 A;  4QTR A;  1JHH A;  3FWE A;  5FLV A;  5FLX Z;  3F72 A;  3GLL A;  1WI3 A;  3DTI A;  2DXI A;  2CUF A;  2ZJP F;  3LST A;  1BOA A;  3A2K A;  3QYF A;  3M1E A;  3GTQ J;  4D7M A;  2F4O B;  4X1E A;  4CCL A;  2VBW A;  3S1M J;  1MBG A;  1WZ2 A;  2AHQ A;  4GGG A;  2GXG A;  4GDF A;  1MSF C;  4L9N A;  1ETV A;  1YHQ I;  3WTS C;  1K83 J;  1ZKG A;  4JX4 A;  3OYA A;  4I0A A;  3AKZ A;  2Y0S A;  1LJ9 A;  2BE5 F;  5E20 A;  4E7Z A;  2E1N A;  2QKM B;  5LRS A;  3OYH A;  1OCR H;  2AO9 A;  4AVZ A;  4C3H J;  1Z21 A;  3M8F A;  2MD0 A;  2DMT A;  2E36 A;  2RAE A;  3DV8 A;  4NNJ A;  2JA7 J;  1SD7 A;  2MH9 A;  2D1H A;  2EH3 A;  3M3Y J;  2G0E A;  1P92 A;  3ZMT A;  5DYM A;  2K5C A;  2XF5 A;  2FF4 A;  1NH3 A;  3QYB A;  1REP C;  5EDN A;  3OYG A;  4I02 A;  2V9P A;  3A1Y A;  3MZH A;  5BMZ A;  3M8E A;  3IAS 2;  1HLV A;  3L7W A;  2W48 A;  4FCY A;  4XRM A;  2QSH X;  2HKO A;  2Y9Y A;  4LB6 B;  3HKZ A;  1IRZ A;  1I6X A;  4FTH A;  6PAX A;  1IRG A;  1FYL A;  2E5Z A;  4LOC A;  2RQQ A;  1MKM A;  3G1O A;  3MAJ A;  3CUQ B;  3QOE A;  1IDZ A;  3T0Y A;  1SD6 A;  2AQE A;  1GV2 A;  4A0Z A;  2Z16 A;  1S5L C;  3ZQL A;  5ICF A;  3KE2 A;  1TW3 A;  2QQA A;  4HG2 A;  4NQW A;  4I99 C;  4MQ9 F;  4M3G A;  3HIF A;  5C4X J;  4QWQ A;  1EA3 A;  2O03 A;  4U87 A;  1RRJ A;  1MBK A;  1B72 A;  1UST A;  1QHH D;  4XRF A;  3WTZ A;  1T98 A;  1FSH A;  2KRC A;  4B3A A;  2Z3Y A;  5DM7 F;  1SFK A;  1KU9 A;  3GTL J;  1EH6 A;  1CF7 B;  2HTS A;  3PNT A;  2Z2S B;  1X2N A;  5HOO A;  3CZ6 A;  4LIV A;  1Z7L A;  2R5Y A;  1J2X A;  2O9L A;  1BJA A;  2M3A A;  4IXA A;  3CD6 I;  1AOY A;  5HLT A;  3E7L A;  2K3F A;  5JVG F;  3PSF A;  1TBX A;  3K1P A;  4L0Z B;  2OCC H;  2YX4 A;  2JMW A;  2PBI A;  1SEU A;  1X2M A;  2CW8 A;  3C2B A;  4Y4R A;  5KK1 A;  4R8H A;  5F1R A;  3EUK L;  3ZMS A;  3HG9 A;  2DOD A;  1GLN A;  4RGS A;  3BR0 A;  5BS6 A;  1GXP A;  3VOE A;  1X3Z B;  3FZV A;  2H6B A;  1UZC A;  2FQ3 A;  4M6V A;  1MND A;  5GP9 A;  4QPQ A;  1A6I A;  2Z33 A;  3PFI A;  2DQL A;  2XAU A;  2BGC A;  2O0Y A;  3QPH A;  3HSF A;  4NBQ A;  4CO8 A;  1QHG A;  1D0X A;  2VPR A;  1LUJ B;  3ZMV A;  1ZR2 A;  3B6A A;  2XAH A;  1LDJ A;  1T56 A;  1PDN C;  2WAD A;  2Y2Z A;  1ITY A;  3LFU A;  5CKT A;  3QP5 A;  2O6G E;  3E6D A;  5F6F A;  2IRF G;  2I5U A;  2BXY A;  2PJR B;  2CW0 F;  1KGS A;  2E7W A;  2DT6 A;  1IJW C;  1TTY A;  1SAU A;  1AKH B;  1W7P D;  4IX7 A;  2JVH A;  2ME0 A;  4JYK A;  4N9I A;  3OL3 A;  2ZXJ A;  3FXL A;  4JOM A;  4I98 B;  1CQT A;  2V6C A;  3PQK A;  2LKP A;  2NS7 A;  3TW7 A;  2VKE A;  2OPT A;  2M0C A;  2HKX A;  1U0J A;  1MNM C;  5IYD J;  4KN7 X;  3JRH A;  2CV1 A;  2ECC A;  2DOE A;  5D8L B;  2K27 A;  2HXO A;  2QKL B;  5CVU A;  1KA8 A;  1BR4 A;  1TZL A;  2HPM A;  4UUS A;  3J7A O;  2XKP A;  1XSD A;  4IOA F;  4EJT A;  2XGE A;  4ZYH A;  4XSX F;  2P5K A;  1LEA A;  1N25 A;  1SVM A;  3IH4 A;  2WTE A;  1G3Y A;  3ZMU A;  3BR1 A;  1SFU A;  1KZH A;  2MD5 A;  4F55 A;  1QRY A;  4RAY A;  1B8I A;  3HRU A;  2BHY A;  1O4X A;  3OSG A;  4CIC A;  2RVC A;  1AA7 A;  3C2H A;  4HF2 A;  3G4S I;  2GQQ A;  1KQ0 A;  2ZXH A;  3SYT A;  4FX0 A;  5GPC A;  3WTV C;  2O8X A;  3CCY A;  2YR2 A;  2PJP A;  2FA5 A;  3F6V A;  3J81 Z;  1YIO A;  1T08 B;  1XMA A;  4NB5 A;  2BY2 A;  2LLK A;  3HZJ A;  5ILU A;  1E3H A;  1O3S A;  1UAA A;  3WOD F;  1JKO C;  3D5S C;  5DUI A;  4CYC A;  4B47 A;  5D6F A;  4M3F A;  1T8I A;  4JX5 A;  1DDN A;  5CVI A;  2VKD A;  3WTY C;  1B9M A;  2Y69 H;  4I01 A;  3KZY A;  1NK3 P;  1MMN A;  1R1V A;  2WV1 A;  5FFX A;  1W0U A;  2ETH A;  2LTP A;  2RRE A;  3TO9 A;  1D1A A;  3HSR A;  3QQA A;  4O6J A;  4OAZ A;  2NVX J;  1VQM I;  1JKR C;  2GLO A;  1E3O C;  1N75 A;  2FUG 2;  4ESJ A;  2FD5 A;  2LVS A;  1XGM A;  2ME6 A;  4J00 A;  4BKX A;  3S17 J;  4PGG A;  3JRE A;  2V9K A;  5EZH A;  4XMY A;  3WGG A;  2HEO A;  3PO2 J;  5DD4 A;  4MFD A;  4CZZ A;  3FMS A;  2KT0 A;  4NUB A;  3UKG A;  3KYC B;  2H6C A;  2ZJQ F;  3JSO A;  1S8N A;  2R7X A;  2MLG A;  4L9V A;  4FET A;  2DA2 A;  2LG4 A;  4B1R A;  3UNG C;  1FSE A;  4G7O F;  2CUE A;  2VXD A;  3K4K A;  1WJE A;  2F2E A;  3LSK A;  4R1H A;  2X51 A;  2NVQ J;  1D1C A;  2J5P A;  3P9C A;  2R93 J;  2CQX A;  2XGX A;  5KVR A;  1LFU P;  2ESH A;  4ENN A;  1FOX A;  4MLO A;  3S2D J;  2FJ1 A;  3ZCO A;  2JA8 J;  3OYK A;  1YJ9 I;  3H9Q A;  4P1W A;  1LE8 A;  3FHZ A;  1MBE A;  4MQV A;  4IZZ A;  1G3T A;  4PGH A;  3V8K A;  1Z77 A;  2FQ4 A;  2TDX A;  4B48 A;  2X6Y A;  2VUM J;  1JUP A;  4M3B A;  1IXC A;  3ESW B;  1Y0N A;  3OS0 A;  5EEH A;  1F43 A;  1FYK A;  2BXZ A;  2DA5 A;  3E3V A;  3K2A A;  5J47 A;  3GYH X;  3K69 A;  3EUH C;  3MKW B;  2DQR A;  2ESN A;  3HUG A;  3FXQ A;  3I59 A;  3MQ0 A;  3VYT B;  1RR8 C;  4A69 C;  1MMA A;  2OQR A;  2EJR A;  4ITV A;  3TKY A;  3OIP A;  2L0K A;  4OIP F;  3ZR8 X;  3ABM H;  3F8B A;  1GDT A;  2IAI A;  1EJ9 A;  3OL4 A;  2X0L A;  4M6Y A;  1S7O A;  3CLO A;  2LY2 A;  3L09 A;  1J59 A;  4Z6Y A;  5FKL A;  2WAQ A;  1T6S A;  2L9V A;  2DMP A;  3HKZ N;  1P7I A;  2W82 A;  3JRF A;  5HDK A;  4XLA A;  2A61 A;  2V1X A;  4HRI A;  1AHD P;  3ABU A;  1FX7 A;  5F27 A;  2FNP A;  3BR6 A;  4EM2 A;  5LLQ A;  2PMH A;  3LFK A;  4CCN A;  3K4B A;  2O61 A;  1SVO A;  4AYB N;  5TRD A;  3KPH A;  2ZSI B;  2DLL A;  1FP2 A;  3L2U A;  3GCM A;  1S9H A;  3GBG A;  5EYR A;  1W7P B;  1UHW A;  3OYL A;  3F23 A;  2D5V A;  1ZTR A;  4JP0 A;  2WV0 A;  3WTX C;  3QOP A;  1JTY A;  1ZH5 A;  1IG7 A;  1I6H J;  2DMQ A;  3Q9S A;  3CTA A;  1Q1H A;  1NG6 A;  5F0F A;  4IPA A;  2LRD A;  1K79 A;  2JK3 A;  2LF8 A;  3RQI A;  3M1C A;  2P81 A;  2LMD A;  1L3L A;  3CCS I;  3K7A J;  4W1U A;  3OOP A;  2BY3 A;  2NS8 A;  5EG0 B;  3ROU A;  4F52 A;  2VE8 A;  5H2F C;  4EV0 A;  2OZ6 A;  2TCT A;  3HRS A;  3CCV I;  3WHC A;  4OMY A;  4G6Q A;  3RIR A;  4D5F A;  3V8J A;  4PCQ A;  4BE2 A;  1PUF B;  1NTC A;  4RA2 A;  3HOV J;  3HRM A;  1YQA A;  2CFO A;  2XPV A;  2KLO A;  4RB2 C;  1X1A A;  4RDU A;  2A07 F;  2L7M P;  3K9T A;  3LA3 A;  4HF1 A;  3ZN0 A;  4L5E A;  3FKI J;  3HGY A;  4S0H B;  2VON A;  2X1C A;  3HBL A;  2R5Z B;  3I55 I;  1JGG A;  1VQL I;  2IGN A;  4I2O A;  2W00 A;  4NQW B;  3I71 A;  1ZGW A;  2HOE A;  4BUP A;  4EJO A;  4A3E J;  3U1K A;  2NNY A;  3H9G A;  1MNE A;  1QZZ A;  3ECH A;  1WJ5 A;  5LBQ A;  3CCJ I;  4OWR B;  5LHG A;  4B44 A;  1ETX A;  3HHH A;  4RS8 A;  5GAE J;  2EBI A;  2JT1 A;  1HA8 A;  3H0G J;  9ANT A;  1WVR A;  2VL8 A;  4BH9 A;  4IOC F;  1ODD A;  3BTC A;  3ZQF A;  2EFQ A;  3PUB A;  4KIT B;  3OYJ A;  5DTD A;  1MGT A;  3HSE A;  2QYO A;  2JUC A;  1ETQ A;  1P4X A;  2LYC A;  4PDK A;  4ZTF A;  1FZP B;  1XSX A;  4DZP A;  3JRI A;  2PQ8 A;  4N0B A;  2VJJ A;  2DA3 A;  2DDA A;  2LF7 A;  1FMV A;  2ZBK A;  2CG4 A;  1B4A A;  1W1W E;  4A3L J;  2O7O A;  2XPU A;  3DBR B;  3LWF A;  2OV7 A;  4YEL A;  1F36 A;  2E5N A;  4U0V A;  5CQE A;  4LK1 F;  2CRG A;  4OMZ A;  1ORK A;  2JJ7 A;  3VOD A;  4E7J A;  2HYF A;  3OSF A;  1TT5 B;  2K02 A;  4IVN A;  2E60 A;  5FKO A;  1XMK A;  2Q2E A;  2CU7 A;  2IS6 A;  3G3Z A;  4BJT A;  4L9T A;  1FP1 D;  4I76 A;  1GUU A;  3LSH A;  4UHT A;  4HST A;  3PFY A;  3QAH A;  3K70 C;  2VN2 A;  2XPW A;  1STZ A;  3F21 A;  4BQO A;  1Y0U A;  1IDY A;  2NRA C;  1KYZ A;  5CVV A;  2L54 A;  4WXD A;  5EZG A;  2QSG X;  4KJZ A;  4XM3 A;  1V5E A;  1XCV A;  1BI1 A;  4ZYE A;  4CCM A;  2X6W A;  4NC6 A;  1QVU A;  1X1D A;  4YII A;  1RPW A;  5D8K B;  4QIW N;  2CV2 A;  5IT9 Z;  3A0B C;  5M5X J;  1P7J A;  3S15 J;  3E0J B;  1GVJ A;  5DDG A;  1PP7 U;  1OCC H;  3HYI A;  3P5J A;  3ECO A;  4WK8 F;  3VDX A;  1J75 A;  3R60 A;  3K4N A;  2L9R A;  1TT0 A;  3R6S A;  2QQ9 A;  2RGV A;  2DFE A;  3FBI B;  1BC7 C;  4A3B J;  3GVA A;  2IS2 A;  1JKP C;  4HAM A;  2K7L A;  1AU7 A;  2STT A;  4KIC A;  1OLT A;  2BY1 A;  2CYY A;  3M7G A;  5KAI C;  4BU2 A;  2DK8 A;  2R7F A;  2ECB A;  1QBJ A;  3FXR A;  2R7S A;  4M73 A;  5JLW A;  1FTZ A;  4Q47 A;  3ZQH A;  2VT3 A;  2MYS A;  3TW6 A;  2VI6 A;  2NAZ A;  5D5X B;  1VND A;  5LGT A;  2PLY A;  4RM3 A;  4UUT A;  1W0T A;  3DWL E;  1OYY A;  1XDS A;  4PJN A;  5BOX A;  4LIU A;  2JSP A;  4XN0 A;  2KIS A;  3CCM I;  1ACI A;  3F9K A;  5GPA A;  1U9N A;  1K78 B;  2ZME B;  3JSP A;  4XSZ F;  5LGU A;  3P7N A;  3J7Y J;  4BQQ A;  2RKH A;  2EA2 A;  3U2R A;  1QGP A;  1IAW A;  4Y15 A;  2E19 A;  3LA2 A;  2R7D A; 
#chains in the Genus database with same CATH homology
 1ZRC A;  1K7A A;  1TW2 A;  1BIB A;  3I5U A;  1XCB A;  3E5X A;  3E6B A;  4DQ2 A;  5HDN A;  5A2Q Z;  1P4W A;  2MLK A;  3W6K B;  1BC8 C;  2XAS A;  3O3K A;  5HLI A;  1A04 A;  4LLL A;  2FOK A;  3TOB A;  3DP7 A;  1Z6R A;  2DTR A;  2HYG D;  4L5J A;  1WQ2 A;  4KMF A;  3F3X A;  4G6D A;  3BWG A;  5K5R A;  4BQA A;  1GHC A;  1KQ8 A;  2VBX A;  5CVR A;  4EM1 A;  1FBQ A;  4R79 A;  1LDK B;  1MJ9 A;  2GWR A;  4ZZD A;  5FB2 A;  1YW9 A;  2VOD A;  2MC3 A;  3ERE D;  2P5V A;  4BYY A;  2G7H A;  4RB1 A;  1HXD A;  2JZY A;  2W25 A;  1OPC A;  1XGS A;  4ON0 A;  3GFL A;  2K4B A;  3MWM A;  1SD5 A;  4HZF A;  4UXN A;  1IN4 A;  1Z6T A;  4AWX B;  1MD0 A;  3F8N A;  3S2W A;  1F9N A;  3BJ6 A;  1SFX A;  3JTH A;  4LMY A;  4TV7 A;  3K0L A;  2GA2 A;  2EB7 A;  1R00 A;  3TDZ C;  1EH8 A;  4BHB A;  5HLH A;  1R36 A;  3T5X A;  5JFR A;  2FE3 A;  1NHA A;  1RZ4 A;  3RPU A;  1D8J A;  2M30 A;  3WTT C;  4IRG A;  2V79 A;  1HSJ A;  3R61 A;  2AXL A;  1UCR A;  5LHH A;  2XHK A;  2BV6 A;  4BHP A;  3G73 A;  2HQR A;  3H92 A;  3FM3 A;  5DD8 A;  3BP8 A;  5FLX K;  4P96 A;  5JHU A;  4A5M A;  2JPB A;  4ESF A;  1W7P A;  1KU7 A;  2WC2 A;  2P5L C;  4JQF A;  1G3W A;  5L3C A;  4LD5 A;  3OV8 A;  1H9G A;  1SAX A;  5DUK A;  1U3E M;  3WE3 A;  3WU0 A;  1I1G A;  4Q5S F;  2HGC A;  1RNL A;  3R0J A;  5HDG A;  2HTJ A;  4E70 A;  3E6M A;  4GYG A;  2QEN A;  5D6E A;  1KU3 A;  4OOI A;  5E17 F;  2K4J A;  2VOP A;  3WU1 B;  4MTE A;  2Z5U A;  2QBY B;  4P55 A;  1D3Y A;  3KP2 A;  3IC7 A;  1HW1 A;  1RUO A;  3ZMZ A;  1DUX C;  5DV5 A;  3IRR A;  2OD5 A;  1D8K A;  1FBS A;  3L2C A;  3QRF F;  2XAF A;  1J7K A;  1YS7 A;  1HKT A;  3I58 A;  4Q48 A;  1Z05 A;  3R0A A;  4HF0 A;  2CSO A;  2XAQ A;  1XDU A;  2V1U A;  3F8M A;  5LHI A;  3LQQ A;  4JBA A;  1H9T A;  1ZN2 A;  1T0F A;  5DCF A;  3RDI A;  5TJJ A;  4KT5 C;  5HS7 A;  2VC0 A;  2EWN A;  2DW4 A;  3CDH A;  1IN8 A;  4GCV A;  2PMU A;  3QU6 A;  1YW7 A;  2IW5 A;  1QPM A;  4LLG F;  2A6H F;  1ZYR F;  2DBB A;  2FU4 A;  1LNW A;  4ENK A;  3ZQ7 A;  2ISZ A;  1IUY A;  3V7R A;  1B6A A;  1X3U A;  4UVB A;  3JAM K;  4GO1 A;  3AAF A;  1MJA A;  3TO7 A;  2W57 A;  3EDP A;  4HW0 A;  2A69 F;  2ZNZ A;  2ZKZ A;  4M6X A;  5IT3 A;  3ZP5 A;  3DFG A;  2ZME A;  1QQI A;  2HQN A;  2XUB A;  2Z9O A;  4OIR F;  3P9K A;  5L3F A;  2CO5 A;  1U2W A;  1Z7U A;  3QP6 A;  2IP2 A;  5JVT A;  5E18 F;  1JXS A;  4WXC A;  1YLF A;  4P9U A;  1USS A;  4EGY A;  2BYV E;  4U88 A;  4LGW A;  1HW2 A;  3L9F A;  1KQ9 A;  1JE8 A;  3BRO A;  2H27 A;  4EGZ A;  2GXB A;  3DPT A;  4KNY A;  5K1Y A;  1I27 A;  2DU9 A;  3F8C A;  3VB2 A;  3BOQ A;  4CHU A;  3T1B A;  1FBU A;  1HKS A;  5J6X A;  3DKW A;  3FM5 A;  2DFI A;  1G3S A;  1FPQ A;  1TQP A;  3IKT A;  5AIP A;  4U7D A;  1P2F A;  3FMR A;  1R1T A;  1IW7 F;  2EFN A;  2HR3 A;  2CWE A;  1F1Z A;  3T8T A;  1IN7 A;  2IA0 A;  1YG2 A;  1ZRE A;  1AWC A;  1F4K A;  3V7S A;  2QM3 A;  2RQP A;  4L5I A;  4KMU X;  2UXX A;  5AON A;  1CGP A;  3E6C C;  4ZH4 F;  1TNT A;  3KEO A;  3R4K A;  2EFP A;  3BJA A;  4G9Y A;  4YFN F;  1YO5 C;  2V9V A;  1E2X A;  4ENJ A;  3V7C A;  3HTS B;  1UB9 A;  1MZB A;  3DF8 A;  3ML6 A;  2XRO A;  5FFZ A;  1IF1 A;  4BHC A;  1Z1D A;  3LQR A;  1RIO H;  3PQJ A;  1BI0 A;  2HWV A;  1WI9 A;  1U5T C;  1ZG3 A;  4PZJ A;  1R5H A;  1O3T A;  1WKM A;  1TQM A;  1G4D A;  3GX4 X;  1BBY A;  4MNU A;  2FBI A;  2ZFW A;  1O57 A;  3N97 A;  3O6B B;  2ELH A;  5FD5 A;  2UWM A;  2XV4 S;  4D0P A;  4LG0 B;  3GFM A;  3KP7 A;  3MFK A;  2RV8 A;  1KYW A;  1QO0 D;  2STW A;  4RAZ A;  2ZNY A;  2PEX A;  4Y17 A;  2UXN A;  2OBP A;  5DCM B;  3RJP A;  3WTW C;  4DNC A;  3WG9 A;  4YG2 F;  4MEX F;  3LAP A;  4OIO F;  3GO5 A;  2F5D A;  1XB4 A;  3I4P A;  3DQV C;  3P9I A;  3J81 K;  2Q8K A;  1J9I A;  1HKQ A;  5H6R A;  4EJU A;  1FLI A;  3RTR A;  4KIF A;  1O7F A;  5CVJ A;  3Q5F A;  3E5U A;  2A6E F;  2R3S A;  2VBZ A;  3MCZ A;  1HQC A;  5E1W A;  4A12 A;  2PI0 A;  4CDG A;  3ABT A;  4AIH A;  1B59 A;  3SZT A;  3CUO A;  1JHF A;  1ZG5 A;  4ZZL A;  4MGR A;  1IRF A;  4UVA A;  4WCG A;  2FRH A;  3VEP A;  4EVI A;  4G94 A;  3H3U A;  3KET A;  3DPL C;  4LLN A;  5LEJ A;  3K2Z A;  3LAJ A;  2EA4 A;  1UHM A;  1V3F A;  3RYR A;  4LK0 F;  1S3J A;  2K86 A;  4HDU A;  1K6O A;  1MDM B;  2P6T A;  1SFE A;  3K1N A;  3H3Z A;  3K1M A;  1E17 A;  3SQN A;  3VFZ A;  5CYV A;  2XAJ A;  1LQ1 A;  4WX9 A;  1WWX A;  2QBY A;  3NEU A;  2KJC A;  3SXY A;  3T8R A;  2M5W A;  2GZW A;  3I64 A;  4UVC A;  1DPR A;  3EQL F;  2WWY A;  1O3R A;  2UZK A;  5FO5 A;  1TQI A;  4ENM A;  1YTY A;  3QPT A;  4GXO A;  2VE9 A;  2Y48 A;  3COA C;  2EV6 A;  3C1D A;  4UNO A;  4LFU A;  4WF2 A;  2DPD A;  4BXU A;  2QZ8 A;  4OU0 A;  1IN5 A;  4I09 A;  5BPI A;  2FBK A;  1O7L A;  2EV0 A;  5L3E A;  4ASN A;  1W5T A;  3BPX A;  3TGN A;  3RKW A;  1FY7 A;  4GYI A;  1T39 A;  5LGN A;  4IRI A;  3RYP A;  2P4W A;  1QNT A;  2KJB A;  1CF7 A;  1ZLJ A;  2X4H A;  2IVM A;  4IJA A;  4BNC A;  1U5T B;  3IKV A;  4A0X A;  1HBX G;  1YYV A;  4KIB A;  1H0M A;  2HS5 A;  2L4M A;  2AS5 F;  1R22 A;  4MTD A;  5JR3 A;  3KLN A;  5LRR A;  5K5O A;  2EK5 A;  1TLH B;  2DT5 A;  1P6R A;  1I1S A;  3FMQ A;  1W4M A;  4KDP A;  4RGR A;  4CYD A;  3MZY A;  4G7H F;  2RC4 A;  1U6G A;  3NQO A;  4EM0 B;  2QLZ A;  5ILV A;  5F64 A;  2YU3 A;  4QLC U;  1ZLK A;  4BAY A;  3NRV A;  5D4S A;  2FSW A;  2Z99 A;  4K2E A;  2F5C A;  5E8I A;  5H6Q A;  1FYM A;  2LDU A;  5ERI A;  2ACJ A;  2P8T A;  3F8F A;  2ZCW A;  2PFB A;  2M45 A;  1G6N A;  1BI3 A;  3I53 A;  2RN7 A;  1Z91 A;  1I5Z A;  1R5G A;  1W5S A;  2ZO4 A;  3F6O A;  1BN5 A;  1R7J A;  2XRN A;  1LEB A;  3HHG A;  3ELK A;  3C3W A;  4S05 A;  1TNS A;  3SZP A;  4WWC A;  3CUQ C;  1J0R A;  4M9S A;  3WGH A;  3KLO A;  2JSC A;  1DPU A;  3V8L A;  3L00 A;  5E8G A;  5FD6 A;  5FGM A;  3IL2 A;  4UUV A;  1J5Y A;  4I0B A;  1XD7 A;  2NNN A;  1OR7 A;  3KP6 A;  1VTN C;  4MEY F;  2B0L A;  3SFZ A;  2L01 A;  2P7V B;  1C0W A;  2Y75 A;  1S29 A;  5ILS A;  3MEX A;  4OIQ F;  2F5E A;  2G7U A;  2W84 A;  2QWW A;  3WE2 A;  1U5T A;  3IWZ A;  5IT9 K;  4O5V A;  3WGI A;  2JRT A;  2M8E A;  2NS0 A;  2A3S A;  1SMT A;  2ISY A;  3GFJ A;  5K5Q A;  3EET A;  3N4M A;  3KP3 A;  5D5V B;  4L9J A;  1O3Q A;  2EFW A;  3Q9V A;  2D45 A;  4RB3 C;  1U8R A;  3E97 A;  5DEQ A;  1ONV A;  2LNB A;  1WSU A;  4RGU A;  2RDP A;  5HS9 A;  2ZJ2 A;  5D4R A;  4ESB A;  3LA7 A;  3TDU C;  3RKY A;  1P4A A;  2OQG A;  4WXH A;  2VBY A;  4KFC A;  3CJN A;  2D1V A;  2LSO A;  1IXS B;  1LVA A;  4UV8 A;  3JTG A;  4YIF A;  1ZAR A;  1IN6 A;  1FC3 A;  3GZ6 A;  4FT8 A;  4YFX F;  5JI6 A;  2MH2 A;  3GEZ A;  5J8F A;  1DP7 P;  3U9G A;  2A68 F;  2IA1 A;  1JGS A;  3GXO A;  2COM A;  4XLN F;  2H09 A;  4A0Y A;  1FOK A;  5ED4 A;  4U7B A;  2XIG A;  3HRT A;  1FWZ A;  3KZZ A;  4F7Z A;  2HZT A;  4UV9 A;  2OAZ A;  3BZ6 A;  1ZGA A;  2KIU A;  1OMI A;  4HLX A;  2FML A;  4Z2Y A;  1XGO A;  1R23 A;  4AIJ A;  4YFK F;  3TQN A;  3GW2 A;  5EEG A;  4KYW A;  3E5Q A;  1FT9 A;  4LB5 A;  2YPR A;  5D5U B;  4M72 A;  1FNN A;  4LJZ F;  4IHS A;  1SD4 A;  3F22 A;  1ULY A;  2W24 A;  2IA2 A;  2L02 A;  3C7J A;  1HW5 A;  2PN6 A;  2FMY A;  5CJ9 A;  3GZ5 A;  1IZ1 A;  5ICE A;  4HQE A;  4S04 A;  2L4A A;  2YSR A;  5AIQ A;  5D5W B;  1UFM A;  1T2K A;  4FHT A;  2NYX A;  1BI2 A;  1PUE E;  4EMS A;  4AIK A;  4B09 A;  1XSV A;  4IRH A;  1PP8 F;  5HS8 A;  4JK1 X;  5E1X A;  2XKO A;  4NHJ A;  2P6S A;  4CXF A;  4L18 B;  3V4G A;  4L0Y B;  3CUQ A;  3WTU C;  4HDV A;  3ZPL A;  3FXU A;  4XLP F;  1WRJ A;  3D5L A;  3FF5 A;  4B8X A;  3C18 A;  2EFO A;  2J5O A;  3J80 K;  1ON2 A;  1ZRD A;  1U78 A;  2VT2 A;  3O2P E;  2HFH A;  2BEO A;  4P9F A;  2GIV A;  5H20 A;  2HDC A;  4LG0 A;  4KN4 X;  4CGZ A;  2H94 A;  2Q0O A;  1IXR C;  4HX8 A;  1LB2 A;  1YW8 A;  1ZRF A;  3QU3 A;  5L3B A;  2VXZ A;  2MA3 A;  5E1Z B;  2M87 A;  1OKR A;  4U0W A;  2E1C A;  2D2W A;  4ZYD A;  1SMY F;  3B73 A;  3BPV A;  2CFX A;  4M74 A;  3EYY A;  5CLS A;  4Y13 A;  2DAO A;  3I59 B;  4A6D A;  1OYW A;  5J8C A;  1K78 A;  3ISP A;  1ZHF A;  2CGP A;  4XBF A;  1R1U A;  4M71 A;  4ETS A;  1S6L A;  3TOA A;  4EJV A;  2FBH A;  4HQM A;  2KKO A;  3B02 A;  4MHG A;  4HX4 A;  1YFH A;  4ZYG A;  3I0T A;  4G8X A;  5A2Q K;  4AVP A;  4H0E A;  3DEU A;  3CO6 C;  2VC1 A;  3GFI A;  4HX7 A;  1D5V A;  3JAM Z;  3KP5 A;  2O3F A;  2OA4 A;  5L3G A;  5ICC A;  5DCM A;  3GF2 A;  5HVQ C;  1XN7 A;  2MBF A;  2E7X A;  2RNJ A;  3DXJ F;  3ZN1 A;  3RKX A;  4AD9 A;  1HST A;  3RI4 A;  1KU2 A;  1L0O C;  1B1B A;  2IT0 A;  1MDM A;  2Y0M A;  2FEZ A;  1ZAO A;  1BIA A;  1LDD A;  2QVO A;  2CQK A;  4Q4Z F;  4A5N A;  3CO7 C;  1XGN A;  2F5F A;  3BY6 A;  1RI7 A;  4HYE A;  4HBL A;  4RB0 A;  5BPD A;  5BQT A;  3RPQ A;  3U1D A;  2ADU A;  2JTV A;  2VOO A;  5ICG A;  2BBY A;  2DK5 A;  2L3D A;  3BDD A;  2JPC A;  4OIN F;  1ON1 A;  2GAU A;  2G9W A;  4U0Y A;  3HOS A;  2EV5 A;  4M9Z A;  2KIF A;  4A6E A;  4N9H A;  4KA4 A;  3ULQ B;  2OZU A;  2QUF A;  2QQB A;  1EH7 A;  4O3M A;  1V4R A;  2IJL A;  2KIM A;  4RGX A;  1BM9 A;  2W85 A;  2XAG A;  4HOB A;  3GLX A;  2FXA A;  5LEK A;  3HOT A;  2OU2 A;  4KUM A;  3KP4 A;  2DO7 A;  4G7Z F;  3GUD A;  4I7H A;  2IPQ X;  3TO6 A;  2PG4 A;  1OYI A;  2A5Y B;  4IHT A;  3ZMD A;  3W6J B;  3IHU A;  1T38 A;  2FNA A;  3KCC A;  1S7A A;  2M1B A;  2C6Y A;  4HV5 A;  3M9A A;  4KIG A;  4P5O A;  1R58 A;  2KRF A;  3HTU A;  4IF4 A;  1EV7 A;  4EJW A;  4EQQ A;  4HLY A;  3IRQ A;  3I54 A;  1QZY A;  4HV6 A;  4HA8 A;  3SHF A;  2P7C B;  1YS6 A;  4FX4 A;  2DPU A;  5HLG A;  1ZGJ A;  3D0S A;  4A2U A;  2GA1 A;  3REO A;  3IWF A;  1F5T A;  3JW4 A;  2YX7 A;  1GXQ A;  1B9N A;  3GWZ A;  3KFW X;  3EUH A;  3KEQ A;  1RUN A;  2V1D A;  4M9X A;  1MJB A;  3J80 Z;  2XVC A;  3EYI A;  3FX3 A;  5L3D A;  3BJO A;  1Z9C A;  2DI3 A;  1ZG1 A;  1JHH A;  3FWE A;  5FLX Z;  3F72 A;  3LST A;  1BOA A;  3M1E A;  2VBW A;  4GGG A;  2GXG A;  4L9N A;  3WTS C;  4I0A A;  1LJ9 A;  2BE5 F;  5E20 A;  2E1N A;  5LRS A;  3M8F A;  3DV8 A;  1SD7 A;  2MH9 A;  2D1H A;  1P92 A;  3ZMT A;  5DYM A;  2FF4 A;  1REP C;  4I02 A;  3MZH A;  5BMZ A;  3M8E A;  3L7W A;  2HKO A;  4LB6 B;  1I6X A;  6PAX A;  1IRG A;  1FYL A;  1MKM A;  3MAJ A;  3CUQ B;  3T0Y A;  1SD6 A;  4A0Z A;  5ICF A;  3KE2 A;  1TW3 A;  2QQA A;  4NQW A;  4MQ9 F;  3HIF A;  4QWQ A;  2O03 A;  1UST A;  4XRF A;  3WTZ A;  1T98 A;  1FSH A;  2Z3Y A;  1KU9 A;  1EH6 A;  1CF7 B;  2HTS A;  5HOO A;  1J2X A;  1BJA A;  4IXA A;  1AOY A;  1TBX A;  3K1P A;  4L0Z B;  2YX4 A;  2PBI A;  5KK1 A;  4R8H A;  5F1R A;  3ZMS A;  4RGS A;  5BS6 A;  1GXP A;  3VOE A;  3FZV A;  2H6B A;  2FQ3 A;  2Z33 A;  3PFI A;  2DQL A;  2BGC A;  2O0Y A;  3QPH A;  3HSF A;  4CO8 A;  3ZMV A;  2XAH A;  1LDJ A;  1PDN C;  3QP5 A;  2O6G E;  3E6D A;  5F6F A;  2IRF G;  2CW0 F;  1KGS A;  2E7W A;  1TTY A;  1W7P D;  4N9I A;  2ZXJ A;  4I98 B;  2V6C A;  3PQK A;  2LKP A;  2HKX A;  4KN7 X;  5D8L B;  2K27 A;  5CVU A;  1KA8 A;  3J7A O;  2XKP A;  1XSD A;  4EJT A;  4ZYH A;  4XSX F;  2P5K A;  1LEA A;  2WTE A;  1G3Y A;  3ZMU A;  1SFU A;  2MD5 A;  4RAY A;  3HRU A;  4CIC A;  2RVC A;  4HF2 A;  2GQQ A;  1KQ0 A;  4FX0 A;  3WTV C;  2O8X A;  2YR2 A;  2PJP A;  2FA5 A;  3F6V A;  3J81 Z;  1YIO A;  1XMA A;  4NB5 A;  5ILU A;  1O3S A;  3WOD F;  5DUI A;  5D6F A;  1DDN A;  5CVI A;  3WTY C;  1B9M A;  4I01 A;  3KZY A;  1R1V A;  5FFX A;  2ETH A;  3TO9 A;  3HSR A;  4O6J A;  4ESJ A;  1XGM A;  4PGG A;  3WGG A;  2HEO A;  5DD4 A;  4CZZ A;  3FMS A;  2H6C A;  3JSO A;  1S8N A;  2MLG A;  4L9V A;  1FSE A;  4G7O F;  4R1H A;  2F2E A;  2J5P A;  3P9C A;  2XGX A;  5KVR A;  2ESH A;  4ENN A;  3FHZ A;  4MQV A;  1G3T A;  4PGH A;  3V8K A;  2TDX A;  1IXC A;  5EEH A;  1FYK A;  3E3V A;  3GYH X;  3K69 A;  3MQ0 A;  2DQR A;  2ESN A;  3FXQ A;  3HUG A;  3I59 A;  2OQR A;  2EJR A;  3TKY A;  4OIP F;  3F8B A;  2X0L A;  4M6Y A;  1S7O A;  3CLO A;  3L09 A;  1J59 A;  1T6S A;  5HDK A;  2A61 A;  2V1X A;  3ABU A;  1FX7 A;  4EM2 A;  2FNP A;  5LLQ A;  2PMH A;  3LFK A;  2O61 A;  5TRD A;  2DLL A;  1FP2 A;  1W7P B;  1UHW A;  3F23 A;  2WV0 A;  3WTX C;  3QOP A;  1ZH5 A;  3Q9S A;  3CTA A;  1Q1H A;  4IPA A;  1K79 A;  2LF8 A;  1L3L A;  3OOP A;  3ROU A;  2VE8 A;  4EV0 A;  2OZ6 A;  3HRS A;  4OMY A;  4G6Q A;  3RIR A;  3V8J A;  4PCQ A;  3HRM A;  1YQA A;  4RB2 C;  2A07 F;  3K9T A;  3LA3 A;  4HF1 A;  3ZN0 A;  2VON A;  4I2O A;  3I71 A;  2HOE A;  4EJO A;  2NNY A;  1QZZ A;  3ECH A;  5LBQ A;  5LHG A;  3HHH A;  4RS8 A;  2JT1 A;  4BH9 A;  1ODD A;  2EFQ A;  1MGT A;  3HSE A;  2QYO A;  1P4X A;  4PDK A;  1FZP B;  1XSX A;  2PQ8 A;  4N0B A;  2LF7 A;  2ZBK A;  2CG4 A;  1B4A A;  3LWF A;  4U0V A;  4LK1 F;  4OMZ A;  3VOD A;  2HYF A;  2K02 A;  4IVN A;  1XMK A;  2Q2E A;  3G3Z A;  4L9T A;  1FP1 D;  4UHT A;  3QAH A;  2VN2 A;  3F21 A;  1STZ A;  1Y0U A;  2NRA C;  1KYZ A;  5CVV A;  2L54 A;  4WXD A;  1XCV A;  1BI1 A;  4ZYE A;  4YII A;  5D8K B;  5IT9 Z;  1GVJ A;  5DDG A;  1PP7 U;  3HYI A;  3ECO A;  4WK8 F;  1J75 A;  3R60 A;  3R6S A;  2QQ9 A;  2RGV A;  1BC7 C;  3GVA A;  4HAM A;  2K7L A;  2STT A;  4KIC A;  2CYY A;  3M7G A;  2DK8 A;  2R7F A;  1QBJ A;  3FXR A;  4M73 A;  4Q47 A;  2VT3 A;  5D5X B;  2NAZ A;  5LGT A;  2PLY A;  1OYY A;  1XDS A;  5BOX A;  1K78 B;  2ZME B;  3JSP A;  4XSZ F;  5LGU A;  3P7N A;  2RKH A;  2EA2 A;  3U2R A;  1QGP A;  1IAW A;  4Y15 A;  3LA2 A;  2R7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...