5D61A

Moa-z-vad-fmk complex, direct orientation
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
292
structure length
292
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Unusual Member of the Papain Superfamily: Mapping the Catalytic Cleft of the Marasmius oreades agglutinin (MOA) with a Caspase Inhibitor.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Hydrolase
molecule keywords Agglutinin
total genus 92
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5d61A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5d61A02
1AVUA 2M49A 4I96A 1DZDA 3D7WB 3T8SA 2DREA 4LO7C 3HOMA 3WINA 4KC3A 3H6SE 3SNVA 5BQUC 4I4VA 2VSEA 4FVVA 3A07A 5F8SA 2WBCA 1TWMA 3QYDA 1EYLA 5DZUA 1QQKA 31BIA 3WINC 3UJ0A 3V0AB 3BAQA 2P23A 1MD6A 4H04A 1IRPA 1BLDA 1Z0HA 2D23A 4USPA 1S0EA 1PC8B 5JMCA 1Q04A 4PC4A 1M2TB 3NJ5A 2FDBM 3KMVA 3UD8A 4A7ZA 2HW9A 4AN7B 5F90A 1S0FA 4QO3A 2ZQOA 4IQPA 4JKXB 4QBVA 1G9CA 2QN4A 1ITBA 4QALA 3C9ZA 4X3AA 3RMYA 5BXSA 3CAHA 2Y9FA 3AKGA 5BQUA 2AAIB 4USOA 1DIWA 1FQ9A 2GO2A 3HALA 4LO1A 1SR4C 3I2AA 3BADA 4OWKA 3FJHA 1HKNA 1S0LA 1JY0A 3W9TA 3IM5A 1CE7B 2VXRA 3MALA 3E8LC 2DRYA 3VSZA 4JKQA 2BFHA 2K4AB 2D7RA 1L2HA 3UJ4A 3ZC8A 3JRRA 5EC5A 2BEBA 4DEPA 2BEAA 1NZKA 4X38A 2DRZA 3P53A 3CA0A 6I1BA 5GAQA 4TLPA 1FMMS 3AKIA 3AJ6A 4R6UB 1V6UA 1WBCA 3TC2A 1II4A 1TFMB 3LLPA 1EVTA 2D44A 5D62A 41BIA 2Y9WC 1JQZA 2L5XA 3VSFA 2RG9B 3N7LA 1V6VA 4I3NA 3AKHA 1FGAA 1YBIA 1Z2VA 2NM1A 3QR5A 4EEEB 4LO3C 5EG6C 4EFRA 4X39A 2RQ9A 4XFUA 5I1BA 4F83A 2NZ9A 5BP5C 3ZXDA 1CVSA 1S0DA 1T9FA 3A23A 3N7KA 5D61A 2MIBA 1J0SA 1W3FA 1G9AA 4EB2B 3PMEA 1AFCA 5FZYA 1QQLA 2D24A 1IT0A 1XZZA 2J3PA 3NBEA 3RMXA 3S8KA 3CA1A 3WA1A 3N7JA 1DZCA 3VUOA 3FJJA 3OBTA 4HJJA 4KEIA 3WMVA 3B9UA 4LO2A 1RY7A 3EF2A 4YOLA 4ENDA 1DFQA 3FJEA 4I6IA 1Q1UA 2KI6B 2F2FC 3WO3A 4IZXA 4G6MA 5DSSB 3O3QA 4IY8A 3O4CA 5EHAA 1IJTA 2VU9A 4ZOTA 1AXMA 5FZUA 5BVPI 1TWEA 1YF8B 1ISYA 1IOBA 1AVWB 1T4QA 1BLAA 2D1ZA 2WRYA 3CRIA 2RSTA 4J2YA 2Q9XA 2K43A 4ZFYB 1FN0A 3WO4A 4I4YA 4LO0C 3IM7A 1IHKA 2X2SA 4DENA 3O5WB 3CA6A 3AZVA 3AKFA 3PG0A 4LO0A 4Q91A 3JUTA 1MC9A 3BAUA 3OJMA 4GOVA 1TTUA 1PUUB 1HWMB 3F1RA 3CRGA 3I29B 2X2TA 1ISXA 4ZBVB 3HMYA 2GZBA 2Y9XE 5E24E 3S8JA 3BRGC 1FV3A 4P0JA 4XKIA 4H9WA 1JT7A 1R8OA 1BFBA 4L4IA 1M16A 1R8NA 3RTIB 1TOOA 1G9BA 3OJ2A 3OJVA 4G6JA 2D22A 2AFGA 4JQ0A 4JAWA 3V79C 4GOYA 2VLCA 3BA5A 3PHZA 1GGPB 1HWOB 4LO3A 4OUJA 1V6WA 1TIEA 2NP0A 4IYBA 1E0OA 2KLLA 2MLLB 2AQZA 3Q7YA 4ZA3B 2D43A 1Z4SA 4DCKC 4I4PA 2ERMA 2K8RA 4GP0A 3N7MA 4ZLBB 3VEQA 3FUQA 4IY9A 5BOWA 1BFFA 1ISWA 4XFSA 1HWNB 1YYNA 4KEJA 1JT3A 1WBAA 1PWAA 4QKSA 1W3GA 1ONKB 3WMUA 3CRHA 2F8XC 4II0A 3N0KA 1QXMA 1HWPB 3WO2A 1XG6A 1IRAX 3AZWA 3O44A 3CQAA 4GAIA 2NYYA 2E4MC 2KH2A 3HBWA 4AN6A 2UUSA 5BP5A 1ABRB 1XYFA 3ZX7A 4ZFUB 3A21A 3O4BA 4FGFA 1HCEA 5JLVA 1FWUA 4EFPA 3POKA 1Q03A 4Q9GA 2YUGA 2NTDA 1JLXA 4HA2A 1UPSA 3FGMA 1ILR1 3CA5A 1ISVA 1G9DA 4OEEA 4XFTA 3BTAA 2R9KB 4A7KA 3BAHA 4IONA 4QBCA 4J2KA 4EKXB 3I2XA 3O4DA 2P39A 2Z48A 3FJAA 2Y9GA 2FFVA 4I37A 1WD4A 5B2HA 1DQOA 4G9NA 1ISZA 1FMZA 2VXTI 3NBDA 1PZZA 2ET2A 3FJKA 1SR4A 2AXMA 4D0ZA 4JP0A 4LO1C 1DJSB 2D20A 4J23B 1FV2A 1BFGA 1JT4A 3HN1A 2HWAA 3ZC9A 2DS0A 4F34A 5FZZA 4QC4A 4JRAA 4LO8B 4GP3A 3IAGC 1I1BA 1NUNA 1TP0A 1HIBA 2F2FA 1HCDA 4IHZA 1K5VA 1YXWA 3V0AA 2HWMA 2LIEA 4ISQA 3CA3A 1KNMA 3NBCA 3LTQA 3AH4A 2VSAA 1EV2A 3P6IA 1P63A 4I4XA 4EFQA 3AH1A 3K1XA 4ZGRB 3RSJA 2FFUA 5DVHA 3IM6A 5FNWA 3RTJB 3VT1A 3NBNA 2MC2A 3V0BA 3AJ5A 3ILAA 4I2SA 4OWLA 1N4KA 4I4SA 3CA4A 3BX1C 2Q3NB 4QD2C 4I8MA 4L4HA 2NVHA 3AH2A 3BRDA 2ZQNA 3BA4A 4JPZA 3FJIA 4KEKA 3Q7WA 3FJCA 4G9MA 4OEGA 4J2XA 3O4OA 3R4SA 1AVXB 4OEFA 1DFCA 8I1BA 3BRFA 3OGGA 4I4UA 4CJMA 4G1RA 2HZ9A 3FJBA 3FJFA 4GAFA 4D0TA 1IILA 1SZ6B 4X37A 1G82A 4P0LA 1JTCA 1K5UA 4LO7B 4I1EA 3OGFA 2I1BA 4Q9PA 1WD3A 2FGFA 1XHBA 1A8DA 3O49A 4I4QA 1YTOA 3BB2A 3BAOA 3FJ9A 3FJDA 1AVAC 4Z9WB 3H6RA 1W3AA 1OQLB 5DUYA 1I1EA 3IIRA 4QD2B 3UD7A 5F8YA 4P0KA 2FO1A 2KI4A 3O4AA 1RG8A 1AF9A 2LIQA 3OBRA 3P6JA 3UDAA 2VUAA 4J2SA 3V0BB 4HR6C 2IHOA 1S0BA 3BAVA 2E4MA 1BA7A 3FJ8A 1VCLA 3VT0A 4QKRA 1F31A 4P6AA 5D63A 2KKIA 1BARA 2ESUA 2D7IA 1JLYA 4WBCA 5HPZA 1S0GA 3H6RB 3FUOA 1D0HA 1FWVA 3ZXGA 4I4OA 1RZOB 3BAGA 7I1BA 4OWJA 5F8WA 4KBBA 3A22A 3R4UA 3CU1B 2XOAA 4OW4A 3FFZA 5BXTA 4I7IA 21BIA 5G00A 1DLLA 1BASA 4I1BA 5BXPA 3VT2A 3UD9A 1EPWA 1BFCA 2QYIB 3VWCA 4I4RA 4ISRA 9ILBA 4LO2C 1V6XA 3BA7A 4A7YA 3PUBA 4D8HA 1JT5A 4IZEA 4Z8SB 3HSMA 1DQGA 4ZKTB 3Q7XA 5BXRA 1S0CA 2Z49A 4ZFWB 1PUMB 1RMLA 3MPPG 4I0YA 2IWTB 3F62B 3H6QA 2ZR1B 5FNXA
chains in the Genus database with same CATH superfamily
4FO6A 4K4IA 1AVUA 2M49A 4I96A 1DZDA 4QZAA 1ZQOA 3D7WB 2GAFD 3T8SA 1JN3A 7ICMA 2DREA 4LO7C 4X4TA 3HOMA 4UAYA 3WINA 8ICGA 2DR8A 4RQ3A 4WOYA 4K96A 4KC3A 3H6SE 4UB4A 2BPGA 3SNVA 4AT9A 1ZQQA 5BQUC 4M9HA 4I4VA 1ZQEA 2BBJA 4UAWA 4RPXA 4NM1A 5HRDA 2VSEA 4FVVA 3A07A 4JWNA 4WQLA 5F8SA 4LZGA 4M2YA 2WBCA 1FA0A 8ICLA 1ZQCA 1TWMA 3JCFA 3QYDA 4RQ1A 1EYLA 5DZUA 1ZQSA 1QQKA 9ICRA 3OUYA 4FO1A 31BIA 2PFPA 8ICVA 3WINC 3H38A 3UJ0A 3V7KA 3V0AB 2RFFA 4R65A 3BAQA 2P23A 1MD6A 3V7LA 4I2GA 4H04A 1KEJA 8ICWA 3AQKA 4QZGA 1IRPA 3AQMA 4YD2A 4TURA 2DVIA 4WBYA 4KLTA 1BLDA 1Z0HA 5EOZA 2D23A 4USPA 1S0EA 1PC8B 5JMCA 1R89A 4KLOA 1Q04A 4LEYA 1Q79A 1ZQZA 4PC4A 1M2TB 8ICOA 7ICPA 5CHGA 4Z6FA 2FCLA 3NJ5A 1HUZA 1JQRA 4KLUA 2FDBM 3KMVA 3UD8A 4A7ZA 1OU5A 4FHWA 2HW9A 4AN7B 5F90A 1TVAA 4RT2A 4O68A 1S0FA 4QO3A 4IG8A 4Z6CA 2ZQOA 4IQPA 4JKXB 4QBVA 1G9CA 4R66A 3JYYA 1YLQA 2QN4A 4QZFA 5CFSA 2DR9A 4MF8A 1ITBA 4I2BA 4QALA 4QZ8A 4GXJA 3C9ZA 4X3AA 4X0BA 1BPXA 3RMYA 5DEDA 5BPCA 9ICTA 4GXKA 5BXSA 4JLXA 2P66A 8ICIA 3CAHA 9ICMA 2Y9FA 1ZJNA 4K97A 3AKGA 5BQUA 2AAIB 4USOA 4MFCA 1DIWA 1FQ9A 2GO2A 3HALA 4LO1A 3L9DA 3WFSC 1SR4C 3UXPA 3I2AA 3BADA 4OWKA 3FJHA 1HKNA 4EP7A 1S0LA 1JY0A 3W9TA 1UETA 4FHPA 5D49A 1MIWA 3RH6A 3RJJA 3RH5A 3IM5A 1CE7B 2VXRA 3MALA 3UQ0A 3E8LC 8ICXA 7ICKA 2DRYA 3VSZA 4JKQA 5HRBA 2BFHA 2K4AB 2D7RA 9ICUA 4PGQA 1L2HA 3UJ4A 3ZC8A 5CP2A 3AUOA 3JRRA 1HUOA 5EC5A 4NXZA 2IUBA 3MDCA 2BEBA 4DEPA 2BEAA 5HRFA 5J0QA 4X0AA 1NZKA 4X38A 2DRZA 2PXIA 8ICZA 3P53A 3CA0A 3OV7A 5IILA 6I1BA 5GAQA 4TLPA 4PHAA 5BOMA 3RJKA 4NXXA 1FMMS 3AKIA 3AJ6A 4R6UB 5CR0A 5DDMA 1V6UA 1WBCA 5J2FA 3TC2A 4QZBA 1II4A 4WC6A 1TFMB 3LLPA 4FH3A 3MGHA 1EVTA 2D44A 3ER9B 1ZQDA 5D62A 41BIA 4DOAA 2Y9WC 1JQZA 2L5XA 4LVSA 4KLMA 3VSFA 4O67A 2RG9B 3N7LA 1V6VA 1ZQMA 4I3NA 3AKHA 4FHXA 1FGAA 5J2HA 4M9GA 4FH5A 1YBIA 1Z2VA 7ICLA 2NM1A 1ZQRA 3QR5A 4NKUA 4EEEB 4LO3C 5EG6C 4EFRA 4X39A 2RQ9A 4WC1A 4AT8A 2NRKA 4XFUA 5I1BA 4UBCA 4F83A 4IQWA 4I2CA 4JLZA 2NZ9A 5BP5C 3ZXDA 4OAIZ 8ICYA 1CVSA 2O1PA 8ICJA 1S0DA 1T9FA 3A23A 3AQLA 3RJHA 3N7KA 5D61A 2MIBA 1JMSA 1J0SA 1W3FA 4RWPA 1G9AA 4X5VA 4KLLA 4EB2B 5CFUA 4WBZA 4E7XA 4X4QA 4M04A 2ZH2A 5CFTA 4RT3A 3WFRE 3PMEA 1AFCA 5FZYA 4K9BA 4NXVA 1QQLA 4GXIA 2D24A 3V72A 1IT0A 1XZZA 1ZQAA 7ICGA 2J3PA 3NBEA 3RMXA 3NVOA 3S8KA 2B51A 2ZH9A 4I2FA 3CA1A 3WA1A 4WQKA 5HRIA 4YD1A 3N7JA 9ICKA 4AT7A 4RQ2A 4FHYA 9ICSA 4RWNA 2IHMA 5J2JA 1DZCA 3VUOA 3FJJA 3OBTA 4HJJA 3MDAA 4KEIA 4YMMA 5DBAA 4X4NA 3WMVA 4P4OA 3MBYA 4P2HA 1XSNA 3B9UA 4LO2A 1RY7A 3EF2A 4YOLA 7ICIA 5HRLA 4K9AA 4ENDA 4F5OA 1DFQA 3GDXA 4EBJA 1R8CA 3FJEA 4I6IA 1Q1UA 1TFWA 1ZQNA 2KI6B 1JAJA 2F2FC 4K4HA 3WO3A 4IZXA 4G6MA 5DSSB 3O3QA 1BPYA 4IY8A 1GPJA 2ZHAA 3O4CA 5DB9A 5J2KA 5J2IA 5EHAA 1IJTA 2VU9A 4ZOTA 1AXMA 3C5GA 7ICHA 3HJ1A 4IQVA 2BBHA 4KLIA 5FZUA 4X4UA 4AT8B 4JWMA 5BVPI 9ICHA 1TWEA 1YF8B 1ISYA 1IOBA 1AVWB 1T4QA 3H3AA 1BLAA 2D1ZA 3AQNA 2BCVA 2WRYA 1NOMA 4F5NA 1BPZA 7ICFA 5J0RA 3CRIA 1BPBA 2RSTA 4J2YA 4DOBA 3UXNA 2Q9XA 2K43A 7ICQA 9ICNA 4ZFYB 1KDHA 1FN0A 3OVSA 3WO4A 1ZQLA 4I4YA 4LO0C 4O9MA 3IM7A 4Z6EA 1IHKA 2X2SA 4DENA 3O5WB 4S3NA 3CA6A 3AZVA 3AKFA 3PG0A 4LO0A 4RQ7A 4X4OA 2ZHBA 4Q91A 3JUTA 5CB1A 1MC9A 2B56A 4O5CA 1ZJMA 4UBBA 1ZQIA 4PGYA 3ISBA 3BAUA 3OJMA 4GOVA 1TTUA 1PUUB 8ICCA 8ICMA 1HWMB 3F1RA 3CRGA 1ZQVA 2HHPA 3I29B 2X2TA 1ISXA 4ZBVB 4WC4A 3HMYA 3HX0A 2DR7A 2GZBA 4NLZA 3C2LA 2Y9XE 5E24E 4RPYA 3S8JA 4YCXA 3BRGC 2PFQA 1FV3A 4P0JA 7ICTA 4XKIA 4KLGA 4H9WA 5J0SA 1JT7A 1R8OA 3HJ4A 5DBBA 5J2AA 4I2DA 1BFBA 1ZQXA 4L4IA 1M16A 1R8NA 3RTIB 8ICBA 1TOOA 1G9BA 3OJ2A 3OJVA 4G6JA 2D22A 4M9LA 2AFGA 4JQ0A 5HHIA 4JAWA 3V79C 4GOYA 4OAGA 4EEDA 3C2MA 9ICXA 2VLCA 3BA5A 4IQTA 5DDYA 1ZQUA 4AT7B 3PHZA 4P4MA 3PNCA 4PH5A 1GGPB 4IQUA 1HWOB 2M2WA 2ZH4A 4LO3A 4OUJA 1WOTA 1V6WA 5J2EA 1TIEA 2NP0A 4N7RA 4IYBA 1E0OA 2KLLA 2MLLB 2AQZA 3Q7YA 4ZA3B 2D43A 4EV6A 8ICHA 1Z4SA 4DCKC 9ICIA 4I4PA 2ERMA 2K8RA 4GP0A 3N7MA 4QZHA 4PPXA 4ZLBB 9ICWA 3VEQA 3FUQA 4IY9A 4UY4A 3RH4A 5IIJA 4P4PA 2M2VA 5BOWA 3UPSA 1BFFA 1ISWA 4XFSA 1HWNB 1YYNA 4KEJA 1JT3A 1WBAA 1PWAA 4QKSA 1W3GA 1ONKB 3WMUA 3UQ2A 3CRHA 2F8XC 4II0A 9ICQA 3N0KA 1QXMA 4O6AA 5HRKA 1HWPB 3WO2A 4LEVA 3ERCC 3OGUA 1XG6A 2I9GA 1IRAX 4TUPA 2O5AA 5J29A 3PMLA 3C2KA 3AZWA 3O44A 2EWRA 4UD4A 2BCRA 2GWSA 2BE3A 3CQAA 5B3PA 5J0WA 4KLJA 4GAIA 2NYYA 3B0YA 2BPFA 2BCSA 2E4MC 2KH2A 3OUYB 1KNYA 4KM5A 4WCWA 3HBWA 4AN6A 2PFNA 2UUSA 5BP5A 1ABRB 1XYFA 3ZX7A 4ZFUB 4M9NA 5DECA 3A21A 3O4BA 4KLDA 8ICRA 4XUSA 4FGFA 5J2GA 5J0YA 5J2DA 1HCEA 5JLVA 3JZ0A 4F5QA 4I2EA 1FWUA 4EFPA 3POKA 1Q03A 4Q9GA 4DO9A 2YUGA 2NTDA 4QZIA 1JLXA 3JPOA 4HA2A 1UPSA 4X4SA 3FGMA 4XQ7A 1ILR1 2ZH6A 4X4PA 3CA5A 1ISVA 5CA7A 9ICCA 4XRHA 1G9DA 4OEEA 3OWGA 4FHVA 5J0XA 4XFTA 3BTAA 4M9JA 2R9KB 4A7KA 9ICOA 1R8BA 2BPCA 3BAHA 4IONA 4QBCA 4J2KA 3K75D 4EKXB 1MIYA 3I2XA 5DKWA 4RQ0A 7ICEA 3O4DA 2P39A 2Z48A 3FJAA 8ICSA 5J0OA 2Y9GA 1XSLA 2DR5A 2FFVA 4WC0A 4I37A 2DRBA 1WD4A 5B2HA 4UB5A 3JPSA 1DQOA 2B4VA 1XSPA 7ICSA 4G9NA 4OAFA 5B3QA 5J2CA 2FMQA 3RJIA 4UB1A 5HR9A 1ISZA 5IIIA 4KLHA 1FMZA 2VXTI 4RWQA 3NBDA 1PZZA 2ET2A 3FJKA 1SR4A 2AXMA 5CJ7A 4D0ZA 2HN1A 4JP0A 4LO1C 1DJSB 2VANA 4O69A 5IIMA 4NY8A 2D20A 4J23B 1ZQKA 3V7JA 3WFOA 4I0UA 1FV2A 4RQ4A 1BFGA 4R63A 5J2BA 1JT4A 3HN1A 2HWAA 5HC9A 3ZC9A 4WC5A 2BCQA 2DS0A 4F34A 3H39A 5FZZA 5JTGA 4RPZA 4TUSA 1UEVA 3WFQE 4QC4A 4JRAA 4KB6A 4LO8B 7ICOA 4GP3A 7ICNA 3IAGC 1I1BA 1NUNA 1TP0A 1HIBA 4H75A 2F2FA 1HCDA 5DB7A 1MQ3A 8ICNA 4IHZA 1K5VA 1YXWA 5CHEA 5J0UA 3V0AA 8ICAA 2HWMA 5TZVA 2LIEA 4ISQA 4MZHA 3CA3A 1KNMA 4NXWA 3NBCA 5IIOA 3LTQA 3AH4A 2VSAA 1EV2A 3P6IA 4NXUA 2W9MA 3MCRA 4QZDA 1P63A 4I4XA 4EFQA 3JPNA 4I29A 1PX5A 1VFGA 3AH1A 4K99A 2M2TA 4QZ9A 3K1XA 4ZGRB 4EEBA 3RSJA 2FFUA 9ICGA 5DVHA 4AT9B 4RWOA 3IM6A 5FNWA 1V4AA 4UB3A 4UB2A 3RTJB 3HW8A 3VT1A 3NBNA 2MC2A 5HREA 5IINA 4E80A 3V0BA 1ZQFA 3OVAA 1ZQTA 3AJ5A 3RJGA 4I2HA 4EGWA 3ILAA 4I2SA 1R8AA 4OWLA 5F2VO 1N4KA 3RJFA 4I4SA 8ICTA 3CA4A 4WC3A 3BX1C 2Q3NB 4QD2C 3NYBA 3JPPA 4I8MA 4L4HA 9ICPA 2NVHA 3AH2A 3JPRA 3BRDA 4I2AA 2ZQNA 2FMSA 3BA4A 4JPZA 1ZQJA 1ZQYA 3OVBA 3FJIA 4KEKA 4I2JA 3Q7WA 1ZQHA 3FJCA 4G9MA 1UEUA 4OEGA 1NO5A 4J2XA 5DBCA 4I28A 9ICFA 4HX0A 3O4OA 3R4SA 1AVXB 4OEFA 4Z6DA 5HHHA 1DFCA 4O5KA 2NS2A 3K7DA 8I1BA 3BRFA 4TUQA 4R64A 3RJEA 4M47A 9ICAA 4RQ5A 4K8VA 3OGGA 4I4UA 3PMNA 4CJMA 2PBEA 4G1RA 2HZ9A 3FJBA 3FJFA 4GAFA 3H37A 2ZH8A 4D0TA 4MFFA 1IILA 1SZ6B 5HRHA 5IIKA 4LEWA 4MF2A 4YMOA 2GA9D 4QZCA 4XA5A 4X37A 1G82A 4P0LA 2FMPA 1JTCA 1K5UA 3AU2A 2ZH1A 4WC7A 4LO7B 3ISDA 4I1EA 3OGFA 2I1BA 9ICLA 4Q9PA 5HRGA 4ATBB 1WD3A 1MIVA 8ICKA 4X4VA 2FGFA 1XHBA 1A8DA 3O49A 4I4QA 4YMNA 1YTOA 3BB2A 3BAOA 3FJ9A 3C18A 3TFSA 4M0AA 3FJDA 4LEZA 1AVAC 9ICJA 4Z9WB 4KLEA 3H6RA 1BPEA 1ZQWA 3C66A 1W3AA 1OQLB 5DUYA 1I1EA 4K4GA 3IIRA 3HIYA 7ICUA 4QD2B 3UD7A 4UAZA 4X4RA 9ICEA 5F8YA 1F5AA 4P0KA 2FO1A 8ICPA 2KI4A 3WFPA 3ISCA 2Q66A 3O4AA 1RG8A 4PHPA 1AF9A 2LIQA 3OBRA 3P6JA 3UDAA 4QZEA 4PHDA 4MFAA 2VUAA 4J2SA 3V0BB 4HR6C 1BPDA 4WH5A 5DB6A 2IHOA 4RQ6A 1S0BA 2BCUA 9ICVA 3JPQA 3BAVA 3UPQA 3CK6A 5D4BA 2E4MA 1BA7A 3FJ8A 1VCLA 1ZQGA 4MZFB 3HWTA 4MZGB 4PHEA 3VT0A 4QKRA 2M2UA 1F31A 4P6AA 5D46A 5D63A 5DB8A 1RZTA 2KKIA 2DRAA 4I2IA 3C5FA 1BARA 2ESUA 3LK9A 1TV9A 2ZH3A 2D7IA 1JLYA 4WBCA 5HPZA 3B0XA 4LT6A 1S0GA 4MKPA 2PFOA 4KLSA 3H6RB 3FUOA 1D0HA 1FWVA 3ZXGA 2ID1A 4WC2A 1MQ2A 4EBKA 1TFYA 4I4OA 1RZOB 3BAGA 7I1BA 4OWJA 1VJ7A 4RQ8A 5F8WA 4KBBA 3A22A 3R4UA 4F5RA 7ICRA 4DOCA 3LQCB 3CU1B 2XOAA 4OW4A 4ATBA 3FFZA 5BXTA 4LZDA 4NKTA 2ZH5A 4I7IA 21BIA 2ZH7A 4UD5A 5G00A 1DLLA 1BASA 4NXTA 4K98A 4I27A 4I1BA 7ICJA 8ICUA 2ISPA 5BXPA 3VT2A 4M5DA 3UD9A 5J0PA 4NLNA 1EPWA 1BFCA 4NM2A 4PGXA 2QYIB 3VWCA 3JPTA 4I4RA 4ISRA 9ILBA 4YN4A 3MGIA 4XJEA 4LO2C 8ICEA 1V6XA 3BA7A 4A7YA 4NLKA 8ICQA 2ISOA 3PUBA 1Q78A 4D8HA 1JT5A 7ICVA 4IZEA 4Z8SB 4F5PA 3HSMA 1ZQPA 4XQ8A 1DQGA 1RPLA 4KLQA 4ZKTB 3ER8C 4OAHA 9ICBA 3Q7XA 5BXRA 5BOLA 1S0CA 2Z49A 4ZFWB 3UXOA 1PUMB 5CWRA 1RMLA 3NKUA 2HN2A 4E8FA 3TFRA 3MPPG 3NWIA 4I0YA 5J0TA 2IWTB 3AU6A 4KLFA 3F62B 1ZQBA 3H6QA 8ICFA 2ZR1B 4O5EA 5FNXA
chains in the Genus database with same CATH topology
1AVUA 2M49A 4I96A 1DZDA 3D7WB 2GAFD 3T8SA 2DREA 4LO7C 3HOMA 3WINA 4WOYA 4K96A 4KC3A 3H6SE 3SNVA 5BQUC 4I4VA 2VSEA 4FVVA 3A07A 4WQLA 5F8SA 2WBCA 1TWMA 3QYDA 1EYLA 5DZUA 1QQKA 4FO1A 31BIA 3WINC 3UJ0A 3V0AB 3BAQA 2P23A 1MD6A 4H04A 1IRPA 1BLDA 1Z0HA 2D23A 4USPA 1S0EA 1PC8B 5JMCA 1Q04A 4LEYA 4PC4A 1M2TB 2FCLA 3NJ5A 2FDBM 3KMVA 3UD8A 4A7ZA 2HW9A 4AN7B 5F90A 4O68A 1S0FA 4QO3A 2ZQOA 4IQPA 4JKXB 4QBVA 1G9CA 2QN4A 5CFSA 1ITBA 4QALA 3C9ZA 4X3AA 3RMYA 5BXSA 4JLXA 3CAHA 2Y9FA 4K97A 3AKGA 5BQUA 2AAIB 4USOA 1DIWA 1FQ9A 2GO2A 3HALA 4LO1A 1SR4C 3I2AA 3BADA 4OWKA 3FJHA 1HKNA 1S0LA 1JY0A 3W9TA 3IM5A 1CE7B 2VXRA 3MALA 3E8LC 2DRYA 3VSZA 4JKQA 2BFHA 2K4AB 2D7RA 1L2HA 3UJ4A 3ZC8A 3JRRA 5EC5A 2BEBA 4DEPA 2BEAA 1NZKA 4X38A 2DRZA 3P53A 3CA0A 6I1BA 5GAQA 4TLPA 4NXXA 1FMMS 3AKIA 3AJ6A 4R6UB 1V6UA 1WBCA 3TC2A 1II4A 1TFMB 3LLPA 3ER9B 1EVTA 2D44A 5D62A 41BIA 2Y9WC 1JQZA 2L5XA 3VSFA 4O67A 2RG9B 3N7LA 1V6VA 4I3NA 3AKHA 1FGAA 1YBIA 1Z2VA 2NM1A 3QR5A 4EEEB 4LO3C 5EG6C 4EFRA 4X39A 2RQ9A 4XFUA 5I1BA 4F83A 4JLZA 2NZ9A 5BP5C 3ZXDA 4OAIZ 1CVSA 1S0DA 1T9FA 3A23A 3N7KA 5D61A 2MIBA 1J0SA 1W3FA 1G9AA 4EB2B 5CFUA 5CFTA 3PMEA 1AFCA 5FZYA 4K9BA 4NXVA 1QQLA 2D24A 1IT0A 1XZZA 2J3PA 3NBEA 3RMXA 3S8KA 2B51A 3CA1A 3WA1A 4WQKA 3N7JA 1DZCA 3VUOA 3FJJA 3OBTA 4HJJA 4KEIA 3WMVA 3B9UA 4LO2A 1RY7A 3EF2A 4YOLA 4K9AA 4ENDA 1DFQA 3FJEA 4I6IA 1Q1UA 2KI6B 2F2FC 3WO3A 4IZXA 4G6MA 5DSSB 3O3QA 4IY8A 1GPJA 3O4CA 5EHAA 1IJTA 2VU9A 4ZOTA 1AXMA 5FZUA 5BVPI 1TWEA 1YF8B 1ISYA 1IOBA 1AVWB 1T4QA 1BLAA 2D1ZA 2WRYA 3CRIA 2RSTA 4J2YA 2Q9XA 2K43A 4ZFYB 1FN0A 3WO4A 4I4YA 4LO0C 3IM7A 1IHKA 2X2SA 4DENA 3O5WB 3CA6A 3AZVA 3AKFA 3PG0A 4LO0A 4Q91A 3JUTA 1MC9A 2B56A 3BAUA 3OJMA 4GOVA 1TTUA 1PUUB 1HWMB 3F1RA 3CRGA 4LEZA 3I29B 2X2TA 1ISXA 4ZBVB 3HMYA 2GZBA 2Y9XE 5E24E 3S8JA 3BRGC 1FV3A 4P0JA 4XKIA 4H9WA 1JT7A 1R8OA 1BFBA 4L4IA 1M16A 1R8NA 3RTIB 1TOOA 1G9BA 3OJ2A 3OJVA 4G6JA 2D22A 2AFGA 4JQ0A 4JAWA 3V79C 4GOYA 4OAGA 2VLCA 3BA5A 3PHZA 1GGPB 1HWOB 4LO3A 4OUJA 1V6WA 1TIEA 2NP0A 4N7RA 4IYBA 1E0OA 2KLLA 2MLLB 2AQZA 3Q7YA 4ZA3B 2D43A 1Z4SA 4DCKC 4I4PA 2ERMA 2K8RA 4GP0A 3N7MA 4ZLBB 3VEQA 3FUQA 4IY9A 4UY4A 5BOWA 1BFFA 1ISWA 4XFSA 1HWNB 1YYNA 4KEJA 1JT3A 1WBAA 1PWAA 4QKSA 1W3GA 1ONKB 3WMUA 3CRHA 2F8XC 4II0A 3N0KA 1QXMA 4O6AA 3ERCC 1HWPB 3WO2A 4LEVA 1XG6A 1IRAX 3AZWA 3O44A 2EWRA 5B3PA 3CQAA 4GAIA 2NYYA 2E4MC 2KH2A 4KM5A 3HBWA 4AN6A 2UUSA 5BP5A 1ABRB 1XYFA 3ZX7A 4ZFUB 3A21A 3O4BA 4FGFA 1HCEA 5JLVA 1FWUA 4EFPA 3POKA 1Q03A 4Q9GA 2YUGA 2NTDA 1JLXA 4HA2A 1UPSA 3FGMA 1ILR1 3CA5A 1ISVA 1G9DA 4OEEA 3OWGA 4XFTA 3BTAA 2R9KB 4A7KA 3BAHA 4IONA 4QBCA 4J2KA 4EKXB 3I2XA 3O4DA 2P39A 2Z48A 3FJAA 2Y9GA 2FFVA 4I37A 1WD4A 5B2HA 1DQOA 2B4VA 4G9NA 4OAFA 5B3QA 1ISZA 1FMZA 2VXTI 3NBDA 1PZZA 2ET2A 3FJKA 1SR4A 2AXMA 4D0ZA 4JP0A 4LO1C 1DJSB 4O69A 2D20A 4J23B 1FV2A 1BFGA 1JT4A 3HN1A 2HWAA 3ZC9A 2DS0A 4F34A 5FZZA 4QC4A 4JRAA 4KB6A 4LO8B 4GP3A 3IAGC 1I1BA 1NUNA 1TP0A 1HIBA 4H75A 2F2FA 1HCDA 4IHZA 1K5VA 1YXWA 5CHEA 3V0AA 2HWMA 2LIEA 4ISQA 4MZHA 3CA3A 1KNMA 4NXWA 3NBCA 3LTQA 3AH4A 2VSAA 1EV2A 3P6IA 4NXUA 3MCRA 1P63A 4I4XA 4EFQA 3AH1A 4K99A 3K1XA 4ZGRB 3RSJA 2FFUA 5DVHA 3IM6A 5FNWA 3RTJB 3VT1A 3NBNA 2MC2A 3V0BA 3AJ5A 3ILAA 4I2SA 4OWLA 1N4KA 4I4SA 3CA4A 3BX1C 2Q3NB 4QD2C 4I8MA 4L4HA 2NVHA 3AH2A 3BRDA 2ZQNA 3BA4A 4JPZA 3FJIA 4KEKA 3Q7WA 3FJCA 4G9MA 4OEGA 4J2XA 4HX0A 3O4OA 3R4SA 1AVXB 4OEFA 1DFCA 2NS2A 3K7DA 8I1BA 3BRFA 4K8VA 3OGGA 4I4UA 4CJMA 4G1RA 2HZ9A 3FJBA 3FJFA 4GAFA 4D0TA 1IILA 1SZ6B 4LEWA 2GA9D 4X37A 1G82A 4P0LA 1JTCA 1K5UA 4LO7B 4I1EA 3OGFA 2I1BA 4Q9PA 1WD3A 2FGFA 1XHBA 1A8DA 3O49A 4I4QA 1YTOA 3BB2A 3BAOA 3FJ9A 3FJDA 1AVAC 4Z9WB 3H6RA 1W3AA 1OQLB 5DUYA 1I1EA 3IIRA 4QD2B 3UD7A 5F8YA 4P0KA 2FO1A 2KI4A 3O4AA 1RG8A 1AF9A 2LIQA 3OBRA 3P6JA 3UDAA 2VUAA 4J2SA 3V0BB 4HR6C 4WH5A 2IHOA 1S0BA 3BAVA 2E4MA 1BA7A 3FJ8A 1VCLA 4MZFB 4MZGB 3VT0A 4QKRA 1F31A 4P6AA 5D63A 2KKIA 1BARA 2ESUA 2D7IA 1JLYA 4WBCA 5HPZA 4MKPA 1S0GA 3H6RB 3FUOA 1D0HA 1FWVA 3ZXGA 4I4OA 1RZOB 3BAGA 7I1BA 4OWJA 5F8WA 4KBBA 3A22A 3R4UA 3CU1B 2XOAA 4OW4A 3FFZA 5BXTA 4I7IA 21BIA 5G00A 1DLLA 1BASA 4NXTA 4K98A 4I1BA 5BXPA 3VT2A 3UD9A 1EPWA 1BFCA 2QYIB 3VWCA 4I4RA 4ISRA 9ILBA 4XJEA 4LO2C 1V6XA 3BA7A 4A7YA 3PUBA 4D8HA 1JT5A 4IZEA 4Z8SB 3HSMA 1DQGA 4ZKTB 3ER8C 4OAHA 3Q7XA 5BXRA 1S0CA 2Z49A 4ZFWB 1PUMB 1RMLA 3NKUA 3MPPG 4I0YA 2IWTB 3F62B 3H6QA 2ZR1B 5FNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVU A;  2M49 A;  4I96 A;  1DZD A;  3D7W B;  3T8S A;  2DRE A;  4LO7 C;  3HOM A;  3WIN A;  4KC3 A;  3H6S E;  3SNV A;  5BQU C;  4I4V A;  2VSE A;  4FVV A;  3A07 A;  5F8S A;  2WBC A;  1TWM A;  3QYD A;  1EYL A;  5DZU A;  1QQK A;  31BI A;  3WIN C;  3UJ0 A;  3V0A B;  3BAQ A;  2P23 A;  1MD6 A;  4H04 A;  1IRP A;  1BLD A;  1Z0H A;  2D23 A;  4USP A;  1S0E A;  1PC8 B;  5JMC A;  1Q04 A;  4PC4 A;  1M2T B;  3NJ5 A;  2FDB M;  3KMV A;  3UD8 A;  4A7Z A;  2HW9 A;  4AN7 B;  5F90 A;  1S0F A;  4QO3 A;  2ZQO A;  4IQP A;  4JKX B;  4QBV A;  1G9C A;  2QN4 A;  1ITB A;  4QAL A;  3C9Z A;  4X3A A;  3RMY A;  5BXS A;  3CAH A;  2Y9F A;  3AKG A;  5BQU A;  2AAI B;  4USO A;  1DIW A;  1FQ9 A;  2GO2 A;  3HAL A;  4LO1 A;  1SR4 C;  3I2A A;  3BAD A;  4OWK A;  3FJH A;  1HKN A;  1S0L A;  1JY0 A;  3W9T A;  3IM5 A;  1CE7 B;  2VXR A;  3MAL A;  3E8L C;  2DRY A;  3VSZ A;  4JKQ A;  2BFH A;  2K4A B;  2D7R A;  1L2H A;  3UJ4 A;  3ZC8 A;  3JRR A;  5EC5 A;  2BEB A;  4DEP A;  2BEA A;  1NZK A;  4X38 A;  2DRZ A;  3P53 A;  3CA0 A;  6I1B A;  5GAQ A;  4TLP A;  1FMM S;  3AKI A;  3AJ6 A;  4R6U B;  1V6U A;  1WBC A;  3TC2 A;  1II4 A;  1TFM B;  3LLP A;  1EVT A;  2D44 A;  5D62 A;  41BI A;  2Y9W C;  1JQZ A;  2L5X A;  3VSF A;  2RG9 B;  3N7L A;  1V6V A;  4I3N A;  3AKH A;  1FGA A;  1YBI A;  1Z2V A;  2NM1 A;  3QR5 A;  4EEE B;  4LO3 C;  5EG6 C;  4EFR A;  4X39 A;  2RQ9 A;  4XFU A;  5I1B A;  4F83 A;  2NZ9 A;  5BP5 C;  3ZXD A;  1CVS A;  1S0D A;  1T9F A;  3A23 A;  3N7K A;  5D61 A;  2MIB A;  1J0S A;  1W3F A;  1G9A A;  4EB2 B;  3PME A;  1AFC A;  5FZY A;  1QQL A;  2D24 A;  1IT0 A;  1XZZ A;  2J3P A;  3NBE A;  3RMX A;  3S8K A;  3CA1 A;  3WA1 A;  3N7J A;  1DZC A;  3VUO A;  3FJJ A;  3OBT A;  4HJJ A;  4KEI A;  3WMV A;  3B9U A;  4LO2 A;  1RY7 A;  3EF2 A;  4YOL A;  4END A;  1DFQ A;  3FJE A;  4I6I A;  1Q1U A;  2KI6 B;  2F2F C;  3WO3 A;  4IZX A;  4G6M A;  5DSS B;  3O3Q A;  4IY8 A;  3O4C A;  5EHA A;  1IJT A;  2VU9 A;  4ZOT A;  1AXM A;  5FZU A;  5BVP I;  1TWE A;  1YF8 B;  1ISY A;  1IOB A;  1AVW B;  1T4Q A;  1BLA A;  2D1Z A;  2WRY A;  3CRI A;  2RST A;  4J2Y A;  2Q9X A;  2K43 A;  4ZFY B;  1FN0 A;  3WO4 A;  4I4Y A;  4LO0 C;  3IM7 A;  1IHK A;  2X2S A;  4DEN A;  3O5W B;  3CA6 A;  3AZV A;  3AKF A;  3PG0 A;  4LO0 A;  4Q91 A;  3JUT A;  1MC9 A;  3BAU A;  3OJM A;  4GOV A;  1TTU A;  1PUU B;  1HWM B;  3F1R A;  3CRG A;  3I29 B;  2X2T A;  1ISX A;  4ZBV B;  3HMY A;  2GZB A;  2Y9X E;  5E24 E;  3S8J A;  3BRG C;  1FV3 A;  4P0J A;  4XKI A;  4H9W A;  1JT7 A;  1R8O A;  1BFB A;  4L4I A;  1M16 A;  1R8N A;  3RTI B;  1TOO A;  1G9B A;  3OJ2 A;  3OJV A;  4G6J A;  2D22 A;  2AFG A;  4JQ0 A;  4JAW A;  3V79 C;  4GOY A;  2VLC A;  3BA5 A;  3PHZ A;  1GGP B;  1HWO B;  4LO3 A;  4OUJ A;  1V6W A;  1TIE A;  2NP0 A;  4IYB A;  1E0O A;  2KLL A;  2MLL B;  2AQZ A;  3Q7Y A;  4ZA3 B;  2D43 A;  1Z4S A;  4DCK C;  4I4P A;  2ERM A;  2K8R A;  4GP0 A;  3N7M A;  4ZLB B;  3VEQ A;  3FUQ A;  4IY9 A;  5BOW A;  1BFF A;  1ISW A;  4XFS A;  1HWN B;  1YYN A;  4KEJ A;  1JT3 A;  1WBA A;  1PWA A;  4QKS A;  1W3G A;  1ONK B;  3WMU A;  3CRH A;  2F8X C;  4II0 A;  3N0K A;  1QXM A;  1HWP B;  3WO2 A;  1XG6 A;  1IRA X;  3AZW A;  3O44 A;  3CQA A;  4GAI A;  2NYY A;  2E4M C;  2KH2 A;  3HBW A;  4AN6 A;  2UUS A;  5BP5 A;  1ABR B;  1XYF A;  3ZX7 A;  4ZFU B;  3A21 A;  3O4B A;  4FGF A;  1HCE A;  5JLV A;  1FWU A;  4EFP A;  3POK A;  1Q03 A;  4Q9G A;  2YUG A;  2NTD A;  1JLX A;  4HA2 A;  1UPS A;  3FGM A;  1ILR 1;  3CA5 A;  1ISV A;  1G9D A;  4OEE A;  4XFT A;  3BTA A;  2R9K B;  4A7K A;  3BAH A;  4ION A;  4QBC A;  4J2K A;  4EKX B;  3I2X A;  3O4D A;  2P39 A;  2Z48 A;  3FJA A;  2Y9G A;  2FFV A;  4I37 A;  1WD4 A;  5B2H A;  1DQO A;  4G9N A;  1ISZ A;  1FMZ A;  2VXT I;  3NBD A;  1PZZ A;  2ET2 A;  3FJK A;  1SR4 A;  2AXM A;  4D0Z A;  4JP0 A;  4LO1 C;  1DJS B;  2D20 A;  4J23 B;  1FV2 A;  1BFG A;  1JT4 A;  3HN1 A;  2HWA A;  3ZC9 A;  2DS0 A;  4F34 A;  5FZZ A;  4QC4 A;  4JRA A;  4LO8 B;  4GP3 A;  3IAG C;  1I1B A;  1NUN A;  1TP0 A;  1HIB A;  2F2F A;  1HCD A;  4IHZ A;  1K5V A;  1YXW A;  3V0A A;  2HWM A;  2LIE A;  4ISQ A;  3CA3 A;  1KNM A;  3NBC A;  3LTQ A;  3AH4 A;  2VSA A;  1EV2 A;  3P6I A;  1P63 A;  4I4X A;  4EFQ A;  3AH1 A;  3K1X A;  4ZGR B;  3RSJ A;  2FFU A;  5DVH A;  3IM6 A;  5FNW A;  3RTJ B;  3VT1 A;  3NBN A;  2MC2 A;  3V0B A;  3AJ5 A;  3ILA A;  4I2S A;  4OWL A;  1N4K A;  4I4S A;  3CA4 A;  3BX1 C;  2Q3N B;  4QD2 C;  4I8M A;  4L4H A;  2NVH A;  3AH2 A;  3BRD A;  2ZQN A;  3BA4 A;  4JPZ A;  3FJI A;  4KEK A;  3Q7W A;  3FJC A;  4G9M A;  4OEG A;  4J2X A;  3O4O A;  3R4S A;  1AVX B;  4OEF A;  1DFC A;  8I1B A;  3BRF A;  3OGG A;  4I4U A;  4CJM A;  4G1R A;  2HZ9 A;  3FJB A;  3FJF A;  4GAF A;  4D0T A;  1IIL A;  1SZ6 B;  4X37 A;  1G82 A;  4P0L A;  1JTC A;  1K5U A;  4LO7 B;  4I1E A;  3OGF A;  2I1B A;  4Q9P A;  1WD3 A;  2FGF A;  1XHB A;  1A8D A;  3O49 A;  4I4Q A;  1YTO A;  3BB2 A;  3BAO A;  3FJ9 A;  3FJD A;  1AVA C;  4Z9W B;  3H6R A;  1W3A A;  1OQL B;  5DUY A;  1I1E A;  3IIR A;  4QD2 B;  3UD7 A;  5F8Y A;  4P0K A;  2FO1 A;  2KI4 A;  3O4A A;  1RG8 A;  1AF9 A;  2LIQ A;  3OBR A;  3P6J A;  3UDA A;  2VUA A;  4J2S A;  3V0B B;  4HR6 C;  2IHO A;  1S0B A;  3BAV A;  2E4M A;  1BA7 A;  3FJ8 A;  1VCL A;  3VT0 A;  4QKR A;  1F31 A;  4P6A A;  5D63 A;  2KKI A;  1BAR A;  2ESU A;  2D7I A;  1JLY A;  4WBC A;  5HPZ A;  1S0G A;  3H6R B;  3FUO A;  1D0H A;  1FWV A;  3ZXG A;  4I4O A;  1RZO B;  3BAG A;  7I1B A;  4OWJ A;  5F8W A;  4KBB A;  3A22 A;  3R4U A;  3CU1 B;  2XOA A;  4OW4 A;  3FFZ A;  5BXT A;  4I7I A;  21BI A;  5G00 A;  1DLL A;  1BAS A;  4I1B A;  5BXP A;  3VT2 A;  3UD9 A;  1EPW A;  1BFC A;  2QYI B;  3VWC A;  4I4R A;  4ISR A;  9ILB A;  4LO2 C;  1V6X A;  3BA7 A;  4A7Y A;  3PUB A;  4D8H A;  1JT5 A;  4IZE A;  4Z8S B;  3HSM A;  1DQG A;  4ZKT B;  3Q7X A;  5BXR A;  1S0C A;  2Z49 A;  4ZFW B;  1PUM B;  1RML A;  3MPP G;  4I0Y A;  2IWT B;  3F62 B;  3H6Q A;  2ZR1 B;  5FNX A; 
#chains in the Genus database with same CATH topology
 4FO6 A;  4K4I A;  1AVU A;  2M49 A;  4I96 A;  1DZD A;  4QZA A;  1ZQO A;  3D7W B;  2GAF D;  3T8S A;  1JN3 A;  7ICM A;  2DRE A;  4LO7 C;  4X4T A;  3HOM A;  4UAY A;  3WIN A;  8ICG A;  2DR8 A;  4RQ3 A;  4WOY A;  4K96 A;  4KC3 A;  3H6S E;  4UB4 A;  2BPG A;  3SNV A;  4AT9 A;  1ZQQ A;  5BQU C;  4M9H A;  4I4V A;  1ZQE A;  2BBJ A;  4UAW A;  4RPX A;  4NM1 A;  5HRD A;  2VSE A;  4FVV A;  3A07 A;  4JWN A;  4WQL A;  5F8S A;  4LZG A;  4M2Y A;  2WBC A;  1FA0 A;  8ICL A;  1ZQC A;  1TWM A;  3JCF A;  3QYD A;  4RQ1 A;  1EYL A;  5DZU A;  1ZQS A;  1QQK A;  9ICR A;  3OUY A;  4FO1 A;  31BI A;  2PFP A;  8ICV A;  3WIN C;  3H38 A;  3UJ0 A;  3V7K A;  3V0A B;  2RFF A;  4R65 A;  3BAQ A;  2P23 A;  1MD6 A;  3V7L A;  4I2G A;  4H04 A;  1KEJ A;  8ICW A;  3AQK A;  4QZG A;  1IRP A;  3AQM A;  4YD2 A;  4TUR A;  2DVI A;  4WBY A;  4KLT A;  1BLD A;  1Z0H A;  5EOZ A;  2D23 A;  4USP A;  1S0E A;  1PC8 B;  5JMC A;  1R89 A;  4KLO A;  1Q04 A;  4LEY A;  1Q79 A;  1ZQZ A;  4PC4 A;  1M2T B;  8ICO A;  7ICP A;  5CHG A;  4Z6F A;  2FCL A;  3NJ5 A;  1HUZ A;  1JQR A;  4KLU A;  2FDB M;  3KMV A;  3UD8 A;  4A7Z A;  1OU5 A;  4FHW A;  2HW9 A;  4AN7 B;  5F90 A;  1TVA A;  4RT2 A;  4O68 A;  1S0F A;  4QO3 A;  4IG8 A;  4Z6C A;  2ZQO A;  4IQP A;  4JKX B;  4QBV A;  1G9C A;  4R66 A;  3JYY A;  1YLQ A;  2QN4 A;  4QZF A;  5CFS A;  2DR9 A;  4MF8 A;  1ITB A;  4I2B A;  4QAL A;  4QZ8 A;  4GXJ A;  3C9Z A;  4X3A A;  4X0B A;  1BPX A;  3RMY A;  5DED A;  5BPC A;  9ICT A;  4GXK A;  5BXS A;  4JLX A;  2P66 A;  8ICI A;  3CAH A;  9ICM A;  2Y9F A;  1ZJN A;  4K97 A;  3AKG A;  5BQU A;  2AAI B;  4USO A;  4MFC A;  1DIW A;  1FQ9 A;  2GO2 A;  3HAL A;  4LO1 A;  3L9D A;  3WFS C;  1SR4 C;  3UXP A;  3I2A A;  3BAD A;  4OWK A;  3FJH A;  1HKN A;  4EP7 A;  1S0L A;  1JY0 A;  3W9T A;  1UET A;  4FHP A;  5D49 A;  1MIW A;  3RH6 A;  3RJJ A;  3RH5 A;  3IM5 A;  1CE7 B;  2VXR A;  3MAL A;  3UQ0 A;  3E8L C;  8ICX A;  7ICK A;  2DRY A;  3VSZ A;  4JKQ A;  5HRB A;  2BFH A;  2K4A B;  2D7R A;  9ICU A;  4PGQ A;  1L2H A;  3UJ4 A;  3ZC8 A;  5CP2 A;  3AUO A;  3JRR A;  1HUO A;  5EC5 A;  4NXZ A;  2IUB A;  3MDC A;  2BEB A;  4DEP A;  2BEA A;  5HRF A;  5J0Q A;  4X0A A;  1NZK A;  4X38 A;  2DRZ A;  2PXI A;  8ICZ A;  3P53 A;  3CA0 A;  3OV7 A;  5IIL A;  6I1B A;  5GAQ A;  4TLP A;  4PHA A;  5BOM A;  3RJK A;  4NXX A;  1FMM S;  3AKI A;  3AJ6 A;  4R6U B;  5CR0 A;  5DDM A;  1V6U A;  1WBC A;  5J2F A;  3TC2 A;  4QZB A;  1II4 A;  4WC6 A;  1TFM B;  3LLP A;  4FH3 A;  3MGH A;  1EVT A;  2D44 A;  3ER9 B;  1ZQD A;  5D62 A;  41BI A;  4DOA A;  2Y9W C;  1JQZ A;  2L5X A;  4LVS A;  4KLM A;  3VSF A;  4O67 A;  2RG9 B;  3N7L A;  1V6V A;  1ZQM A;  4I3N A;  3AKH A;  4FHX A;  1FGA A;  5J2H A;  4M9G A;  4FH5 A;  1YBI A;  1Z2V A;  7ICL A;  2NM1 A;  1ZQR A;  3QR5 A;  4NKU A;  4EEE B;  4LO3 C;  5EG6 C;  4EFR A;  4X39 A;  2RQ9 A;  4WC1 A;  4AT8 A;  2NRK A;  4XFU A;  5I1B A;  4UBC A;  4F83 A;  4IQW A;  4I2C A;  4JLZ A;  2NZ9 A;  5BP5 C;  3ZXD A;  4OAI Z;  8ICY A;  1CVS A;  2O1P A;  8ICJ A;  1S0D A;  1T9F A;  3A23 A;  3AQL A;  3RJH A;  3N7K A;  5D61 A;  2MIB A;  1JMS A;  1J0S A;  1W3F A;  4RWP A;  1G9A A;  4X5V A;  4KLL A;  4EB2 B;  5CFU A;  4WBZ A;  4E7X A;  4X4Q A;  4M04 A;  2ZH2 A;  5CFT A;  4RT3 A;  3WFR E;  3PME A;  1AFC A;  5FZY A;  4K9B A;  4NXV A;  1QQL A;  4GXI A;  2D24 A;  3V72 A;  1IT0 A;  1XZZ A;  1ZQA A;  7ICG A;  2J3P A;  3NBE A;  3RMX A;  3NVO A;  3S8K A;  2B51 A;  2ZH9 A;  4I2F A;  3CA1 A;  3WA1 A;  4WQK A;  5HRI A;  4YD1 A;  3N7J A;  9ICK A;  4AT7 A;  4RQ2 A;  4FHY A;  9ICS A;  4RWN A;  2IHM A;  5J2J A;  1DZC A;  3VUO A;  3FJJ A;  3OBT A;  4HJJ A;  3MDA A;  4KEI A;  4YMM A;  5DBA A;  4X4N A;  3WMV A;  4P4O A;  3MBY A;  4P2H A;  1XSN A;  3B9U A;  4LO2 A;  1RY7 A;  3EF2 A;  4YOL A;  7ICI A;  5HRL A;  4K9A A;  4END A;  4F5O A;  1DFQ A;  3GDX A;  4EBJ A;  1R8C A;  3FJE A;  4I6I A;  1Q1U A;  1TFW A;  1ZQN A;  2KI6 B;  1JAJ A;  2F2F C;  4K4H A;  3WO3 A;  4IZX A;  4G6M A;  5DSS B;  3O3Q A;  1BPY A;  4IY8 A;  1GPJ A;  2ZHA A;  3O4C A;  5DB9 A;  5J2K A;  5J2I A;  5EHA A;  1IJT A;  2VU9 A;  4ZOT A;  1AXM A;  3C5G A;  7ICH A;  3HJ1 A;  4IQV A;  2BBH A;  4KLI A;  5FZU A;  4X4U A;  4AT8 B;  4JWM A;  5BVP I;  9ICH A;  1TWE A;  1YF8 B;  1ISY A;  1IOB A;  1AVW B;  1T4Q A;  3H3A A;  1BLA A;  2D1Z A;  3AQN A;  2BCV A;  2WRY A;  1NOM A;  4F5N A;  1BPZ A;  7ICF A;  5J0R A;  3CRI A;  1BPB A;  2RST A;  4J2Y A;  4DOB A;  3UXN A;  2Q9X A;  2K43 A;  7ICQ A;  9ICN A;  4ZFY B;  1KDH A;  1FN0 A;  3OVS A;  3WO4 A;  1ZQL A;  4I4Y A;  4LO0 C;  4O9M A;  3IM7 A;  4Z6E A;  1IHK A;  2X2S A;  4DEN A;  3O5W B;  4S3N A;  3CA6 A;  3AZV A;  3AKF A;  3PG0 A;  4LO0 A;  4RQ7 A;  4X4O A;  2ZHB A;  4Q91 A;  3JUT A;  5CB1 A;  1MC9 A;  2B56 A;  4O5C A;  1ZJM A;  4UBB A;  1ZQI A;  4PGY A;  3ISB A;  3BAU A;  3OJM A;  4GOV A;  1TTU A;  1PUU B;  8ICC A;  8ICM A;  1HWM B;  3F1R A;  3CRG A;  1ZQV A;  2HHP A;  3I29 B;  2X2T A;  1ISX A;  4ZBV B;  4WC4 A;  3HMY A;  3HX0 A;  2DR7 A;  2GZB A;  4NLZ A;  3C2L A;  2Y9X E;  5E24 E;  4RPY A;  3S8J A;  4YCX A;  3BRG C;  2PFQ A;  1FV3 A;  4P0J A;  7ICT A;  4XKI A;  4KLG A;  4H9W A;  5J0S A;  1JT7 A;  1R8O A;  3HJ4 A;  5DBB A;  5J2A A;  4I2D A;  1BFB A;  1ZQX A;  4L4I A;  1M16 A;  1R8N A;  3RTI B;  8ICB A;  1TOO A;  1G9B A;  3OJ2 A;  3OJV A;  4G6J A;  2D22 A;  4M9L A;  2AFG A;  4JQ0 A;  5HHI A;  4JAW A;  3V79 C;  4GOY A;  4OAG A;  4EED A;  3C2M A;  9ICX A;  2VLC A;  3BA5 A;  4IQT A;  5DDY A;  1ZQU A;  4AT7 B;  3PHZ A;  4P4M A;  3PNC A;  4PH5 A;  1GGP B;  4IQU A;  1HWO B;  2M2W A;  2ZH4 A;  4LO3 A;  4OUJ A;  1WOT A;  1V6W A;  5J2E A;  1TIE A;  2NP0 A;  4N7R A;  4IYB A;  1E0O A;  2KLL A;  2MLL B;  2AQZ A;  3Q7Y A;  4ZA3 B;  2D43 A;  4EV6 A;  8ICH A;  1Z4S A;  4DCK C;  9ICI A;  4I4P A;  2ERM A;  2K8R A;  4GP0 A;  3N7M A;  4QZH A;  4PPX A;  4ZLB B;  9ICW A;  3VEQ A;  3FUQ A;  4IY9 A;  4UY4 A;  3RH4 A;  5IIJ A;  4P4P A;  2M2V A;  5BOW A;  3UPS A;  1BFF A;  1ISW A;  4XFS A;  1HWN B;  1YYN A;  4KEJ A;  1JT3 A;  1WBA A;  1PWA A;  4QKS A;  1W3G A;  1ONK B;  3WMU A;  3UQ2 A;  3CRH A;  2F8X C;  4II0 A;  9ICQ A;  3N0K A;  1QXM A;  4O6A A;  5HRK A;  1HWP B;  3WO2 A;  4LEV A;  3ERC C;  3OGU A;  1XG6 A;  2I9G A;  1IRA X;  4TUP A;  2O5A A;  5J29 A;  3PML A;  3C2K A;  3AZW A;  3O44 A;  2EWR A;  4UD4 A;  2BCR A;  2GWS A;  2BE3 A;  3CQA A;  5B3P A;  5J0W A;  4KLJ A;  4GAI A;  2NYY A;  3B0Y A;  2BPF A;  2BCS A;  2E4M C;  2KH2 A;  3OUY B;  1KNY A;  4KM5 A;  4WCW A;  3HBW A;  4AN6 A;  2PFN A;  2UUS A;  5BP5 A;  1ABR B;  1XYF A;  3ZX7 A;  4ZFU B;  4M9N A;  5DEC A;  3A21 A;  3O4B A;  4KLD A;  8ICR A;  4XUS A;  4FGF A;  5J2G A;  5J0Y A;  5J2D A;  1HCE A;  5JLV A;  3JZ0 A;  4F5Q A;  4I2E A;  1FWU A;  4EFP A;  3POK A;  1Q03 A;  4Q9G A;  4DO9 A;  2YUG A;  2NTD A;  4QZI A;  1JLX A;  3JPO A;  4HA2 A;  1UPS A;  4X4S A;  3FGM A;  4XQ7 A;  1ILR 1;  2ZH6 A;  4X4P A;  3CA5 A;  1ISV A;  5CA7 A;  9ICC A;  4XRH A;  1G9D A;  4OEE A;  3OWG A;  4FHV A;  5J0X A;  4XFT A;  3BTA A;  4M9J A;  2R9K B;  4A7K A;  9ICO A;  1R8B A;  2BPC A;  3BAH A;  4ION A;  4QBC A;  4J2K A;  3K75 D;  4EKX B;  1MIY A;  3I2X A;  5DKW A;  4RQ0 A;  7ICE A;  3O4D A;  2P39 A;  2Z48 A;  3FJA A;  8ICS A;  5J0O A;  2Y9G A;  1XSL A;  2DR5 A;  2FFV A;  4WC0 A;  4I37 A;  2DRB A;  1WD4 A;  5B2H A;  4UB5 A;  3JPS A;  1DQO A;  2B4V A;  1XSP A;  7ICS A;  4G9N A;  4OAF A;  5B3Q A;  5J2C A;  2FMQ A;  3RJI A;  4UB1 A;  5HR9 A;  1ISZ A;  5III A;  4KLH A;  1FMZ A;  2VXT I;  4RWQ A;  3NBD A;  1PZZ A;  2ET2 A;  3FJK A;  1SR4 A;  2AXM A;  5CJ7 A;  4D0Z A;  2HN1 A;  4JP0 A;  4LO1 C;  1DJS B;  2VAN A;  4O69 A;  5IIM A;  4NY8 A;  2D20 A;  4J23 B;  1ZQK A;  3V7J A;  3WFO A;  4I0U A;  1FV2 A;  4RQ4 A;  1BFG A;  4R63 A;  5J2B A;  1JT4 A;  3HN1 A;  2HWA A;  5HC9 A;  3ZC9 A;  4WC5 A;  2BCQ A;  2DS0 A;  4F34 A;  3H39 A;  5FZZ A;  5JTG A;  4RPZ A;  4TUS A;  1UEV A;  3WFQ E;  4QC4 A;  4JRA A;  4KB6 A;  4LO8 B;  7ICO A;  4GP3 A;  7ICN A;  3IAG C;  1I1B A;  1NUN A;  1TP0 A;  1HIB A;  4H75 A;  2F2F A;  1HCD A;  5DB7 A;  1MQ3 A;  8ICN A;  4IHZ A;  1K5V A;  1YXW A;  5CHE A;  5J0U A;  3V0A A;  8ICA A;  2HWM A;  5TZV A;  2LIE A;  4ISQ A;  4MZH A;  3CA3 A;  1KNM A;  4NXW A;  3NBC A;  5IIO A;  3LTQ A;  3AH4 A;  2VSA A;  1EV2 A;  3P6I A;  4NXU A;  2W9M A;  3MCR A;  4QZD A;  1P63 A;  4I4X A;  4EFQ A;  3JPN A;  4I29 A;  1PX5 A;  1VFG A;  3AH1 A;  4K99 A;  2M2T A;  4QZ9 A;  3K1X A;  4ZGR B;  4EEB A;  3RSJ A;  2FFU A;  9ICG A;  5DVH A;  4AT9 B;  4RWO A;  3IM6 A;  5FNW A;  1V4A A;  4UB3 A;  4UB2 A;  3RTJ B;  3HW8 A;  3VT1 A;  3NBN A;  2MC2 A;  5HRE A;  5IIN A;  4E80 A;  3V0B A;  1ZQF A;  3OVA A;  1ZQT A;  3AJ5 A;  3RJG A;  4I2H A;  4EGW A;  3ILA A;  4I2S A;  1R8A A;  4OWL A;  5F2V O;  1N4K A;  3RJF A;  4I4S A;  8ICT A;  3CA4 A;  4WC3 A;  3BX1 C;  2Q3N B;  4QD2 C;  3NYB A;  3JPP A;  4I8M A;  4L4H A;  9ICP A;  2NVH A;  3AH2 A;  3JPR A;  3BRD A;  4I2A A;  2ZQN A;  2FMS A;  3BA4 A;  4JPZ A;  1ZQJ A;  1ZQY A;  3OVB A;  3FJI A;  4KEK A;  4I2J A;  3Q7W A;  1ZQH A;  3FJC A;  4G9M A;  1UEU A;  4OEG A;  1NO5 A;  4J2X A;  5DBC A;  4I28 A;  9ICF A;  4HX0 A;  3O4O A;  3R4S A;  1AVX B;  4OEF A;  4Z6D A;  5HHH A;  1DFC A;  4O5K A;  2NS2 A;  3K7D A;  8I1B A;  3BRF A;  4TUQ A;  4R64 A;  3RJE A;  4M47 A;  9ICA A;  4RQ5 A;  4K8V A;  3OGG A;  4I4U A;  3PMN A;  4CJM A;  2PBE A;  4G1R A;  2HZ9 A;  3FJB A;  3FJF A;  4GAF A;  3H37 A;  2ZH8 A;  4D0T A;  4MFF A;  1IIL A;  1SZ6 B;  5HRH A;  5IIK A;  4LEW A;  4MF2 A;  4YMO A;  2GA9 D;  4QZC A;  4XA5 A;  4X37 A;  1G82 A;  4P0L A;  2FMP A;  1JTC A;  1K5U A;  3AU2 A;  2ZH1 A;  4WC7 A;  4LO7 B;  3ISD A;  4I1E A;  3OGF A;  2I1B A;  9ICL A;  4Q9P A;  5HRG A;  4ATB B;  1WD3 A;  1MIV A;  8ICK A;  4X4V A;  2FGF A;  1XHB A;  1A8D A;  3O49 A;  4I4Q A;  4YMN A;  1YTO A;  3BB2 A;  3BAO A;  3FJ9 A;  3C18 A;  3TFS A;  4M0A A;  3FJD A;  4LEZ A;  1AVA C;  9ICJ A;  4Z9W B;  4KLE A;  3H6R A;  1BPE A;  1ZQW A;  3C66 A;  1W3A A;  1OQL B;  5DUY A;  1I1E A;  4K4G A;  3IIR A;  3HIY A;  7ICU A;  4QD2 B;  3UD7 A;  4UAZ A;  4X4R A;  9ICE A;  5F8Y A;  1F5A A;  4P0K A;  2FO1 A;  8ICP A;  2KI4 A;  3WFP A;  3ISC A;  2Q66 A;  3O4A A;  1RG8 A;  4PHP A;  1AF9 A;  2LIQ A;  3OBR A;  3P6J A;  3UDA A;  4QZE A;  4PHD A;  4MFA A;  2VUA A;  4J2S A;  3V0B B;  4HR6 C;  1BPD A;  4WH5 A;  5DB6 A;  2IHO A;  4RQ6 A;  1S0B A;  2BCU A;  9ICV A;  3JPQ A;  3BAV A;  3UPQ A;  3CK6 A;  5D4B A;  2E4M A;  1BA7 A;  3FJ8 A;  1VCL A;  1ZQG A;  4MZF B;  3HWT A;  4MZG B;  4PHE A;  3VT0 A;  4QKR A;  2M2U A;  1F31 A;  4P6A A;  5D46 A;  5D63 A;  5DB8 A;  1RZT A;  2KKI A;  2DRA A;  4I2I A;  3C5F A;  1BAR A;  2ESU A;  3LK9 A;  1TV9 A;  2ZH3 A;  2D7I A;  1JLY A;  4WBC A;  5HPZ A;  3B0X A;  4LT6 A;  1S0G A;  4MKP A;  2PFO A;  4KLS A;  3H6R B;  3FUO A;  1D0H A;  1FWV A;  3ZXG A;  2ID1 A;  4WC2 A;  1MQ2 A;  4EBK A;  1TFY A;  4I4O A;  1RZO B;  3BAG A;  7I1B A;  4OWJ A;  1VJ7 A;  4RQ8 A;  5F8W A;  4KBB A;  3A22 A;  3R4U A;  4F5R A;  7ICR A;  4DOC A;  3LQC B;  3CU1 B;  2XOA A;  4OW4 A;  4ATB A;  3FFZ A;  5BXT A;  4LZD A;  4NKT A;  2ZH5 A;  4I7I A;  21BI A;  2ZH7 A;  4UD5 A;  5G00 A;  1DLL A;  1BAS A;  4NXT A;  4K98 A;  4I27 A;  4I1B A;  7ICJ A;  8ICU A;  2ISP A;  5BXP A;  3VT2 A;  4M5D A;  3UD9 A;  5J0P A;  4NLN A;  1EPW A;  1BFC A;  4NM2 A;  4PGX A;  2QYI B;  3VWC A;  3JPT A;  4I4R A;  4ISR A;  9ILB A;  4YN4 A;  3MGI A;  4XJE A;  4LO2 C;  8ICE A;  1V6X A;  3BA7 A;  4A7Y A;  4NLK A;  8ICQ A;  2ISO A;  3PUB A;  1Q78 A;  4D8H A;  1JT5 A;  7ICV A;  4IZE A;  4Z8S B;  4F5P A;  3HSM A;  1ZQP A;  4XQ8 A;  1DQG A;  1RPL A;  4KLQ A;  4ZKT B;  3ER8 C;  4OAH A;  9ICB A;  3Q7X A;  5BXR A;  5BOL A;  1S0C A;  2Z49 A;  4ZFW B;  3UXO A;  1PUM B;  5CWR A;  1RML A;  3NKU A;  2HN2 A;  4E8F A;  3TFR A;  3MPP G;  3NWI A;  4I0Y A;  5J0T A;  2IWT B;  3AU6 A;  4KLF A;  3F62 B;  1ZQB A;  3H6Q A;  8ICF A;  2ZR1 B;  4O5E A;  5FNX A; 
#chains in the Genus database with same CATH homology
 1AVU A;  2M49 A;  4I96 A;  1DZD A;  3D7W B;  2GAF D;  3T8S A;  2DRE A;  4LO7 C;  3HOM A;  3WIN A;  4WOY A;  4K96 A;  4KC3 A;  3H6S E;  3SNV A;  5BQU C;  4I4V A;  2VSE A;  4FVV A;  3A07 A;  4WQL A;  5F8S A;  2WBC A;  1TWM A;  3QYD A;  1EYL A;  5DZU A;  1QQK A;  4FO1 A;  31BI A;  3WIN C;  3UJ0 A;  3V0A B;  3BAQ A;  2P23 A;  1MD6 A;  4H04 A;  1IRP A;  1BLD A;  1Z0H A;  2D23 A;  4USP A;  1S0E A;  1PC8 B;  5JMC A;  1Q04 A;  4LEY A;  4PC4 A;  1M2T B;  2FCL A;  3NJ5 A;  2FDB M;  3KMV A;  3UD8 A;  4A7Z A;  2HW9 A;  4AN7 B;  5F90 A;  4O68 A;  1S0F A;  4QO3 A;  2ZQO A;  4IQP A;  4JKX B;  4QBV A;  1G9C A;  2QN4 A;  5CFS A;  1ITB A;  4QAL A;  3C9Z A;  4X3A A;  3RMY A;  5BXS A;  4JLX A;  3CAH A;  2Y9F A;  4K97 A;  3AKG A;  5BQU A;  2AAI B;  4USO A;  1DIW A;  1FQ9 A;  2GO2 A;  3HAL A;  4LO1 A;  1SR4 C;  3I2A A;  3BAD A;  4OWK A;  3FJH A;  1HKN A;  1S0L A;  1JY0 A;  3W9T A;  3IM5 A;  1CE7 B;  2VXR A;  3MAL A;  3E8L C;  2DRY A;  3VSZ A;  4JKQ A;  2BFH A;  2K4A B;  2D7R A;  1L2H A;  3UJ4 A;  3ZC8 A;  3JRR A;  5EC5 A;  2BEB A;  4DEP A;  2BEA A;  1NZK A;  4X38 A;  2DRZ A;  3P53 A;  3CA0 A;  6I1B A;  5GAQ A;  4TLP A;  4NXX A;  1FMM S;  3AKI A;  3AJ6 A;  4R6U B;  1V6U A;  1WBC A;  3TC2 A;  1II4 A;  1TFM B;  3LLP A;  3ER9 B;  1EVT A;  2D44 A;  5D62 A;  41BI A;  2Y9W C;  1JQZ A;  2L5X A;  3VSF A;  4O67 A;  2RG9 B;  3N7L A;  1V6V A;  4I3N A;  3AKH A;  1FGA A;  1YBI A;  1Z2V A;  2NM1 A;  3QR5 A;  4EEE B;  4LO3 C;  5EG6 C;  4EFR A;  4X39 A;  2RQ9 A;  4XFU A;  5I1B A;  4F83 A;  4JLZ A;  2NZ9 A;  5BP5 C;  3ZXD A;  4OAI Z;  1CVS A;  1S0D A;  1T9F A;  3A23 A;  3N7K A;  5D61 A;  2MIB A;  1J0S A;  1W3F A;  1G9A A;  4EB2 B;  5CFU A;  5CFT A;  3PME A;  1AFC A;  5FZY A;  4K9B A;  4NXV A;  1QQL A;  2D24 A;  1IT0 A;  1XZZ A;  2J3P A;  3NBE A;  3RMX A;  3S8K A;  2B51 A;  3CA1 A;  3WA1 A;  4WQK A;  3N7J A;  1DZC A;  3VUO A;  3FJJ A;  3OBT A;  4HJJ A;  4KEI A;  3WMV A;  3B9U A;  4LO2 A;  1RY7 A;  3EF2 A;  4YOL A;  4K9A A;  4END A;  1DFQ A;  3FJE A;  4I6I A;  1Q1U A;  2KI6 B;  2F2F C;  3WO3 A;  4IZX A;  4G6M A;  5DSS B;  3O3Q A;  4IY8 A;  1GPJ A;  3O4C A;  5EHA A;  1IJT A;  2VU9 A;  4ZOT A;  1AXM A;  5FZU A;  5BVP I;  1TWE A;  1YF8 B;  1ISY A;  1IOB A;  1AVW B;  1T4Q A;  1BLA A;  2D1Z A;  2WRY A;  3CRI A;  2RST A;  4J2Y A;  2Q9X A;  2K43 A;  4ZFY B;  1FN0 A;  3WO4 A;  4I4Y A;  4LO0 C;  3IM7 A;  1IHK A;  2X2S A;  4DEN A;  3O5W B;  3CA6 A;  3AZV A;  3AKF A;  3PG0 A;  4LO0 A;  4Q91 A;  3JUT A;  1MC9 A;  2B56 A;  3BAU A;  3OJM A;  4GOV A;  1TTU A;  1PUU B;  1HWM B;  3F1R A;  3CRG A;  4LEZ A;  3I29 B;  2X2T A;  1ISX A;  4ZBV B;  3HMY A;  2GZB A;  2Y9X E;  5E24 E;  3S8J A;  3BRG C;  1FV3 A;  4P0J A;  4XKI A;  4H9W A;  1JT7 A;  1R8O A;  1BFB A;  4L4I A;  1M16 A;  1R8N A;  3RTI B;  1TOO A;  1G9B A;  3OJ2 A;  3OJV A;  4G6J A;  2D22 A;  2AFG A;  4JQ0 A;  4JAW A;  3V79 C;  4GOY A;  4OAG A;  2VLC A;  3BA5 A;  3PHZ A;  1GGP B;  1HWO B;  4LO3 A;  4OUJ A;  1V6W A;  1TIE A;  2NP0 A;  4N7R A;  4IYB A;  1E0O A;  2KLL A;  2MLL B;  2AQZ A;  3Q7Y A;  4ZA3 B;  2D43 A;  1Z4S A;  4DCK C;  4I4P A;  2ERM A;  2K8R A;  4GP0 A;  3N7M A;  4ZLB B;  3VEQ A;  3FUQ A;  4IY9 A;  4UY4 A;  5BOW A;  1BFF A;  1ISW A;  4XFS A;  1HWN B;  1YYN A;  4KEJ A;  1JT3 A;  1WBA A;  1PWA A;  4QKS A;  1W3G A;  1ONK B;  3WMU A;  3CRH A;  2F8X C;  4II0 A;  3N0K A;  1QXM A;  4O6A A;  3ERC C;  1HWP B;  3WO2 A;  4LEV A;  1XG6 A;  1IRA X;  3AZW A;  3O44 A;  2EWR A;  5B3P A;  3CQA A;  4GAI A;  2NYY A;  2E4M C;  2KH2 A;  4KM5 A;  3HBW A;  4AN6 A;  2UUS A;  5BP5 A;  1ABR B;  1XYF A;  3ZX7 A;  4ZFU B;  3A21 A;  3O4B A;  4FGF A;  1HCE A;  5JLV A;  1FWU A;  4EFP A;  3POK A;  1Q03 A;  4Q9G A;  2YUG A;  2NTD A;  1JLX A;  4HA2 A;  1UPS A;  3FGM A;  1ILR 1;  3CA5 A;  1ISV A;  1G9D A;  4OEE A;  3OWG A;  4XFT A;  3BTA A;  2R9K B;  4A7K A;  3BAH A;  4ION A;  4QBC A;  4J2K A;  4EKX B;  3I2X A;  3O4D A;  2P39 A;  2Z48 A;  3FJA A;  2Y9G A;  2FFV A;  4I37 A;  1WD4 A;  5B2H A;  1DQO A;  2B4V A;  4G9N A;  4OAF A;  5B3Q A;  1ISZ A;  1FMZ A;  2VXT I;  3NBD A;  1PZZ A;  2ET2 A;  3FJK A;  1SR4 A;  2AXM A;  4D0Z A;  4JP0 A;  4LO1 C;  1DJS B;  4O69 A;  2D20 A;  4J23 B;  1FV2 A;  1BFG A;  1JT4 A;  3HN1 A;  2HWA A;  3ZC9 A;  2DS0 A;  4F34 A;  5FZZ A;  4QC4 A;  4JRA A;  4KB6 A;  4LO8 B;  4GP3 A;  3IAG C;  1I1B A;  1NUN A;  1TP0 A;  1HIB A;  4H75 A;  2F2F A;  1HCD A;  4IHZ A;  1K5V A;  1YXW A;  5CHE A;  3V0A A;  2HWM A;  2LIE A;  4ISQ A;  4MZH A;  3CA3 A;  1KNM A;  4NXW A;  3NBC A;  3LTQ A;  3AH4 A;  2VSA A;  1EV2 A;  3P6I A;  4NXU A;  3MCR A;  1P63 A;  4I4X A;  4EFQ A;  3AH1 A;  4K99 A;  3K1X A;  4ZGR B;  3RSJ A;  2FFU A;  5DVH A;  3IM6 A;  5FNW A;  3RTJ B;  3VT1 A;  3NBN A;  2MC2 A;  3V0B A;  3AJ5 A;  3ILA A;  4I2S A;  4OWL A;  1N4K A;  4I4S A;  3CA4 A;  3BX1 C;  2Q3N B;  4QD2 C;  4I8M A;  4L4H A;  2NVH A;  3AH2 A;  3BRD A;  2ZQN A;  3BA4 A;  4JPZ A;  3FJI A;  4KEK A;  3Q7W A;  3FJC A;  4G9M A;  4OEG A;  4J2X A;  4HX0 A;  3O4O A;  3R4S A;  1AVX B;  4OEF A;  1DFC A;  2NS2 A;  3K7D A;  8I1B A;  3BRF A;  4K8V A;  3OGG A;  4I4U A;  4CJM A;  4G1R A;  2HZ9 A;  3FJB A;  3FJF A;  4GAF A;  4D0T A;  1IIL A;  1SZ6 B;  4LEW A;  2GA9 D;  4X37 A;  1G82 A;  4P0L A;  1JTC A;  1K5U A;  4LO7 B;  4I1E A;  3OGF A;  2I1B A;  4Q9P A;  1WD3 A;  2FGF A;  1XHB A;  1A8D A;  3O49 A;  4I4Q A;  1YTO A;  3BB2 A;  3BAO A;  3FJ9 A;  3FJD A;  1AVA C;  4Z9W B;  3H6R A;  1W3A A;  1OQL B;  5DUY A;  1I1E A;  3IIR A;  4QD2 B;  3UD7 A;  5F8Y A;  4P0K A;  2FO1 A;  2KI4 A;  3O4A A;  1RG8 A;  1AF9 A;  2LIQ A;  3OBR A;  3P6J A;  3UDA A;  2VUA A;  4J2S A;  3V0B B;  4HR6 C;  4WH5 A;  2IHO A;  1S0B A;  3BAV A;  2E4M A;  1BA7 A;  3FJ8 A;  1VCL A;  4MZF B;  4MZG B;  3VT0 A;  4QKR A;  1F31 A;  4P6A A;  5D63 A;  2KKI A;  1BAR A;  2ESU A;  2D7I A;  1JLY A;  4WBC A;  5HPZ A;  4MKP A;  1S0G A;  3H6R B;  3FUO A;  1D0H A;  1FWV A;  3ZXG A;  4I4O A;  1RZO B;  3BAG A;  7I1B A;  4OWJ A;  5F8W A;  4KBB A;  3A22 A;  3R4U A;  3CU1 B;  2XOA A;  4OW4 A;  3FFZ A;  5BXT A;  4I7I A;  21BI A;  5G00 A;  1DLL A;  1BAS A;  4NXT A;  4K98 A;  4I1B A;  5BXP A;  3VT2 A;  3UD9 A;  1EPW A;  1BFC A;  2QYI B;  3VWC A;  4I4R A;  4ISR A;  9ILB A;  4XJE A;  4LO2 C;  1V6X A;  3BA7 A;  4A7Y A;  3PUB A;  4D8H A;  1JT5 A;  4IZE A;  4Z8S B;  3HSM A;  1DQG A;  4ZKT B;  3ER8 C;  4OAH A;  3Q7X A;  5BXR A;  1S0C A;  2Z49 A;  4ZFW B;  1PUM B;  1RML A;  3NKU A;  3MPP G;  4I0Y A;  2IWT B;  3F62 B;  3H6Q A;  2ZR1 B;  5FNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...