5D61A

Moa-z-vad-fmk complex, direct orientation
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
292
structure length
292
Chain Sequence
b'SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Agglutinin
publication title An Unusual Member of the Papain Superfamily: Mapping the Catalytic Cleft of the Marasmius oreades agglutinin (MOA) with a Caspase Inhibitor.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Hydrolase
total genus 92
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5d61A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5d61A02
3NBNA 4GP3A 3O4OA 1XHBA 4G6JA 2D20A 3CRIA 6I1BA 4J2XA 5D62A 3N7MA 2NTDA 3BRDA 3UD9A 4GOVA 4LO0A 3WMUA 1JT5A 3A23A 2FFVA 1GGPB 3B9UA 3BAUA 3PG0A 1ISVA 1AXMA 3FJFA 4GOYA 3Q7YA 2BFHA 1FGAA 4OWKA 3AKFA 3D7WB 1AVAC 4J2YA 4ZA3B 3WO2A 4OWLA 3OBRA 3Q7WA 3QYDA 2D44A 3WA1A 2FDBM 5F8YA 3JRRA 2AAIB 1TTUA 3CA4A 5I1BA 3AKGA 2LIQA 4I4RA 3PMEA 1ONKB 3OJVA 3VT2A 4G1RA 3A07A 1QXMA 1ISYA 2VSAA 5HPZA 4ZBVB 4F83A 3AH1A 3O5WB 1HWPB 3UD8A 2Q9XA 2VXRA 3OGGA 1SR4C 3H6QA 1IOBA 1JLXA 2K4AB 1RMLA 3BADA 3CRGA 4JAWA 4QKSA 2P39A 4L4HA 4I4OA 4FGFA 3RTJB 2F8XC 1VCLA 1JQZA 3BAVA 1YBIA 3FJAA 3VSFA 3ILAA 4P0KA 1RY7A 5BOWA 3TC2A 1ISXA 3F1RA 3F62B 3ZXDA 4KC3A 3IM6A 4ZOTA 4I8MA 1S0LA 1R8OA 4J2SA 2E4MC 4I4PA 4OUJA 2FFUA 1R8NA 1K5VA 2Y9FA 2YUGA 3RMXA 4ZFWB 1K5UA 4G6MA 5BP5A 2UUSA 5EHAA 1V6WA 2WRYA 1G9AA 4TLPA 2RSTA 3WINA 1S0BA 4OWJA 2VSEA 1SR4A 4I37A 4Q9GA 2VUAA 4PC4A 2MIBA 1IILA 5F8SA 3FJIA 4XFSA 4I1BA 3R4SA 1G9BA 2KH2A 3NJ5A 1HWMB 3BA4A 1M2TB 4EEEB 4IY8A 2QN4A 2RQ9A 5BXSA 3O49A 4CJMA 1XYFA 3WMVA 4IQPA 3BAOA 1FMZA 4KEIA 4IZXA 4D0TA 1BLDA 3P6JA 5DVHA 1BFGA 2NM1A 1DJSB 3BA5A 1IT0A 3EF2A 3WO3A 4JP0A 4DEPA 4EFRA 4D0ZA 3VUOA 3AKIA 3FJJA 1FV2A 4JKQA 3FUQA 3AZWA 1HKNA 1HWOB 1QQKA 4X38A 4OEFA 5FZUA 1AVWB 3LLPA 4IZEA 4OEGA 2K43A 1BA7A 1CE7B 1RZOB 2Z48A 1YXWA 5FZZA 1WD3A 3OBTA 1DIWA 2X2TA 1V6UA 1AVXB 3UJ4A 4Z8SB 3SNVA 3K1XA 2D24A 3S8KA 3AJ6A 4JPZA 4OEEA 4X37A 3FGMA 5EG6C 2DREA 4R6UB 5DSSB 1AF9A 4XKIA 2IWTB 1S0EA 2LIEA 2NYYA 1ILR1 2AFGA 3BA7A 1EVTA 1RG8A 2KI6B 3FJ8A 2ESUA 3HBWA 5G00A 3CRHA 4FVVA 1JLYA 1Q1UA 1FMMS 3CQAA 3P6IA 4ZGRB 3VT0A 1JTCA 1G82A 4JQ0A 2ET2A 3UD7A 3BB2A 4P0JA 2Z49A 5BP5C 2HZ9A 1EPWA 4GAIA 4Q9PA 5B2HA 3WINC 3RMYA 2GZBA 1ABRB 3VT1A 4WBCA 4IY9A 4GAFA 3O4CA 1S0CA 3N7JA 1AVUA 3CU1B 5FNXA 3UDAA 1OQLB 1EYLA 3O3QA 4I3NA 4XFUA 4LO3C 2DRYA 3IIRA 4KBBA 3AZVA 2DS0A 2MLLB 3OJMA 1MD6A 5E24E 3ZC8A 1UPSA 1A8DA 2P23A 2F2FC 4LO7B 3BAQA 5JMCA 1L2HA 4J2KA 1DFQA 1CVSA 1WBAA 3O44A 4LO8B 5EC5A 1J0SA 3VWCA 1PC8B 1JT7A 5DZUA 1Q04A 1DQGA 3BRGC 3LTQA 2FO1A 5FNWA 3N7KA 2BEAA 4G9MA 2X2SA 1T4QA 5BQUA 1SZ6B 1ISWA 2D23A 2BEBA 3CA6A 1WBCA 4ENDA 1W3AA 2RG9B 1I1BA 2AQZA 1IHKA 4I4VA 1BASA 1W3FA 4DENA 2GO2A 5D61A 4IHZA 4LO3A 3PUBA 3WO4A 2M49A 4EFQA 1BFFA 4I4SA 1EV2A 2F2FA 2HWMA 2I1BA 5BXTA 1S0FA 1TFMB 2HW9A 3KMVA 4OW4A 1IRAX 2D43A 1II4A 3V0AB 1G9DA 2DRZA 2K8RA 3FJDA 4ZLBB 3BAHA 3VSZA 5D63A 4ZKTB 1XG6A 3IM5A 4USOA 1JT3A 1PWAA 2VLCA 3OJ2A 3NBCA 3NBDA 1HWNB 1FV3A 5GAQA 5F90A 4IONA 1HCEA 1AFCA 2KLLA 4QC4A 4LO7C 3POKA 4USPA 4I7IA 1DQOA 2D7IA 4EFPA 1HCDA 4EB2B 1HIBA 3HN1A 3MALA 4Z9WB 4LO2A 1JY0A 5JLVA 4QALA 3C9ZA 2KKIA 3NBEA 3HALA 1ISZA 1MC9A 1I1EA 4Q91A 4KEJA 3FJ9A 1TWMA 3BAGA 1BFBA 4GP0A 3A21A 4EKXB 1JT4A 1S0DA 21BIA 3FJBA 1Z4SA 1D0HA 3FUOA 1N4KA 3HMYA 5BXRA 1BFCA 1IJTA 1Z2VA 3IM7A 2ZQOA 3BTAA 3H6SE 3VEQA 3FJCA 2KI4A 3RTIB 5BVPI 4IYBA 5F8WA 3O4BA 2NVHA 1PUUB 3I2XA 3FJKA 1DFCA 4I4XA 1V6XA 3HSMA 4I4YA 5BQUC 4A7ZA 1BLAA 1IRPA 1P63A 2D22A 3AH2A 3O4DA 3BRFA 4A7KA 2NP0A 1ITBA 4XFTA 3I29B 4ISQA 4H04A 5DUYA 2Y9WC 2VU9A 3V0BA 2Y9XE 3MPPG 1FN0A 4I2SA 1YYNA 2HWAA 2L5XA 1BARA 1YF8B 3AKHA 4P0LA 2Y9GA 5BXPA 3N0KA 1QQLA 1F31A 4I6IA 3AH4A 4H9WA 1FQ9A 2J3PA 1V6VA 4I4UA 4QBCA 3I2AA 3T8SA 1WD4A 2VXTI 2Q3NB 4HA2A 3V0BB 2AXMA 4D8HA 1G9CA 31BIA 3S8JA 3R4UA 4G9NA 4QD2B 2QYIB 3V79C 1W3GA 3E8LC 2D7RA 3FFZA 2D1ZA 3ZXGA 4HR6C 3ZC9A 3ZX7A 4F34A 3N7LA 2R9KB 1KNMA 1TP0A 3CA1A 1DLLA 2XOAA 1TOOA 3W9TA 3CAHA 1Z0HA 4L4IA 4LO2C 1M16A 3OGFA 1PZZA 2WBCA 3QR5A 2ZQNA 3UJ0A 4ZFYB 1E0OA 4JRAA 3BX1C 3O4AA 4LO1C 5FZYA 3FJHA 3CA0A 3V0AA 1XZZA 4I4QA 4AN7B 9ILBA 1Q03A 4JKXB 3RSJA 8I1BA 1FWVA 4A7YA 3PHZA 4P6AA 1DZCA 3AJ5A 4LO0C 4X39A 4I96A 1TWEA 4ZFUB 4QKRA 4KEKA 4II0A 3P53A 4DCKC 3IAGC 4QBVA 2ZR1B 1DZDA 1NZKA 1T9FA 2ERMA 1S0GA 3Q7XA 3CA3A 2FGFA 3H6RA 3HOMA 4ISRA 4YOLA 3JUTA 4HJJA 1PUMB 2IHOA 4J23B 3FJEA 7I1BA 1NUNA 3A22A 2MC2A 41BIA 2E4MA 4AN6A 3CA5A 2NZ9A 1TIEA 4I0YA 1YTOA 4I1EA 4QD2C 1FWUA 4X3AA 3H6RB 4LO1A 4QO3A
chains in the Genus database with same CATH superfamily
1ZQUA 1XHBA 4EEBA 4Z6DA 2D20A 4X4OA 5D62A 3BRDA 4GOVA 4LO0A 4LT6A 4RQ4A 3BAUA 1ISVA 5DB8A 4LZGA 1FGAA 1NOMA 4I2BA 4TURA 4XUSA 4WBZA 3AKFA 4J2YA 3QYDA 2BCQA 4PHAA 5IIMA 1TTUA 5I1BA 3VT2A 4OAHA 2NRKA 4QZBA 3O5WB 1TFYA 3UD8A 5HRGA 2VXRA 2PFQA 2IHMA 3FJAA 4UBCA 5CA7A 3ILAA 5BPCA 3F62B 4FO1A 4I0UA 4I8MA 4IQUA 4NXWA 1R8OA 2DR9A 2FFUA 2PBEA 3RMXA 1K5UA 1JQRA 4NM1A 9ICQA 4TUQA 1G9AA 3GDXA 3WINA 4GXIA 4Q9GA 2VUAA 4WC7A 5DB9A 4M0AA 5F8SA 4WQLA 1UETA 5CHEA 1M2TB 4IY8A 3HJ1A 3O49A 4WC4A 1ZQYA 4JLZA 5IIOA 4KEIA 4IZXA 4D0TA 3MGHA 3C2KA 4X4SA 3NYBA 3UQ0A 4UAYA 3FJJA 1Q79A 4X38A 4KM5A 4KLLA 4KLSA 3LLPA 4IZEA 4OEGA 4K4IA 4I2HA 4NLZA 2Z48A 5CFUA 4LVSA 9ICKA 5FZZA 1JN3A 1DIWA 2X2TA 3K1XA 2BBHA 4WQKA 3S8KA 4X37A 3FGMA 4XKIA 3AU6A 1ILR1 2Q66A 4P4OA 3FJ8A 2ESUA 5G00A 3CRHA 3VT0A 2DRBA 1JTCA 5EOZA 2ET2A 1TFWA 2PFNA 8ICKA 4NXVA 3WINC 4S3NA 3UPQA 4IQTA 2DVIA 3CU1B 3UDAA 1EYLA 4O5CA 4I3NA 4LO3C 2MLLB 3C5FA 4LO7B 5JMCA 4K4GA 4UB1A 1CVSA 1WBAA 5EC5A 4O69A 4EV6A 4RQ6A 2ZH1A 1JT7A 2ZH2A 4H75A 4EBKA 1Q04A 1DQGA 4I29A 3N7KA 2BEAA 1T4QA 3CA6A 1I1BA 1R8BA 1IHKA 1ZQBA 3C5GA 4IHZA 3PUBA 4K8VA 3OVBA 4XQ7A 4I4SA 1EV2A 3WFPA 2HWMA 5BXTA 1TFMB 4OW4A 4GXJA 1IRAX 3AUOA 3K7DA 9ICFA 4LEWA 4ZLBB 3VSZA 3RJJA 3AQMA 1JT3A 5GAQA 1AFCA 2KLLA 4LO7C 5CB1A 5J2KA 4I7IA 3WFSC 4X4PA 4DOBA 2D7IA 4EFPA 5TZVA 1MQ2A 1UEVA 3C9ZA 2KKIA 4R66A 7ICMA 4QZDA 1XSNA 3FJ9A 1TWMA 4EKXB 5J2HA 21BIA 1ZQNA 8ICJA 1N4KA 1ZQPA 3WFQE 1Z2VA 2ZQOA 1YLQA 1KEJA 4WC0A 1JMSA 3HSMA 2B4VA 2ZH6A 3BRFA 4A7KA 1ITBA 2HN1A 3LQCB 4XA5A 2BPGA 4H04A 2Y9WC 2Y9XE 4I2SA 1YYNA 2HWAA 3WFRE 3K75D 3L9DA 3N0KA 3RJIA 4H9WA 2J3PA 3T8SA 3JPTA 4D8HA 4YMOA 3H39A 1W3GA 7ICRA 2VANA 2D7RA 3LK9A 4P4MA 3ZXGA 3C18A 2FMSA 4QZIA 3ZX7A 4F34A 3N7LA 1KNMA 1TP0A 3CA1A 1DLLA 3C66A 4I27A 2WBCA 2ZQNA 4JRAA 3O4AA 3CA0A 1XZZA 4I4QA 3RSJA 3B0YA 3AJ5A 3C2LA 4I2AA 4II0A 4IG8A 2ZR1B 4JLXA 1T9FA 3ISDA 2FMQA 2DRAA 3ER9B 4PGQA 3CA3A 5J0UA 4ISRA 4YOLA 4HJJA 1NUNA 5F2VO 3A22A 1ZQXA 2MC2A 2P66A 5DBCA 4I0YA 5J2EA 4KLOA 4FH3A 5HRKA 9ICEA 3OVAA 1BPDA 3CRIA 1ZQSA 4KLTA 2NTDA 3UD9A 3B9UA 9ICNA 3PG0A 1AXMA 3FJFA 4GOYA 2BFHA 1AVAC 5D49A 8ICVA 4ZA3B 4OWLA 3OBRA 3JRRA 2AAIB 1BPZA 1NO5A 5CP2A 4WC2A 1ONKB 7ICQA 3A07A 1ISYA 2VSAA 4ZBVB 4F83A 3OGGA 5HRDA 4XJEA 1SR4C 5J2CA 1RMLA 3BADA 2P39A 3RTJB 1VCLA 4UB3A 4RT3A 3OVSA 1RY7A 5BOWA 3F1RA 4MZGB 4ZOTA 4NXZA 5HHIA 2ZH8A 4X4TA 4QZGA 4NLKA 4I4PA 1K5VA 4ZFWB 3RH4A 5BP5A 3RJGA 3V7JA 5HREA 2UUSA 5EHAA 4TLPA 9ICBA 2DR7A 2VSEA 4O68A 4I37A 1BPEA 4MF8A 4I1BA 3R4SA 4I2CA 3NJ5A 1HWMB 4EEEB 3V7KA 5D46A 2RQ9A 3NWIA 5DDMA 1XYFA 1RPLA 2I9GA 4IQPA 1FMZA 3PMNA 2NM1A 1DJSB 3ISBA 3BA5A 1IT0A 3EF2A 4EFRA 4D0ZA 3AKIA 1FV2A 3FUQA 4M47A 3AZWA 1HKNA 2ZH4A 1CE7B 1RZOB 1YXWA 1WD3A 4O67A 2RFFA 3HW8A 4O5KA 2D24A 3AJ6A 4JPZA 5EG6C 2DREA 1KNYA 4R6UB 4YD2A 1S0EA 7ICNA 2ZHBA 1ZQQA 4YMNA 9ICGA 4JWMA 8ICCA 1JLYA 7ICTA 3CQAA 3P6IA 4ZGRB 5J2AA 4TUSA 4X0AA 2Z49A 5BP5C 4NXUA 5HRFA 4UB4A 2EWRA 1MIWA 4Q9PA 4X4RA 3RMYA 4MFAA 1MIYA 3UPSA 1ABRB 3VT1A 4IY9A 8ICZA 1S0CA 1ZQKA 5FNXA 5HR9A 4RPZA 1MD6A 1UPSA 7ICLA 4I2GA 3BAQA 1L2HA 1DFQA 1ZJMA 3O44A 4LO8B 8ICAA 4UD5A 4WH5A 4RQ3A 5BQUA 1SZ6B 2GWSA 4RQ7A 1R8CA 1Q78A 8ICNA 4IQWA 1BASA 1W3FA 5J0WA 2GO2A 1BPYA 4XRHA 4LO3A 3WO4A 4F5PA 2BCUA 2M49A 4O9MA 3JCFA 1ZQEA 2I1BA 1S0FA 3KMVA 4E7XA 1ZQFA 4RWPA 8ICWA 3V0AB 1G9DA 2DRZA 3UXOA 8ICOA 3BAHA 3AU2A 4ZKTB 3IM5A 4USOA 1PWAA 4RQ5A 3NBCA 4LEZA 1HWNB 5CR0A 5F90A 1HCEA 1ZQZA 1HIBA 3MALA 4RPYA 1JY0A 5JLVA 1F5AA 2GA9D 3BAGA 1BFBA 9ICVA 7ICJA 3FUOA 4WC3A 5BXRA 4TUPA 5IIKA 9ICUA 2KI4A 5BVPI 4IYBA 4P2HA 2NVHA 4I4XA 1DFCA 5BQUC 5BOMA 4KLDA 3O4DA 4Z6EA 4XFTA 3I29B 5DEDA 4JWNA 3MDCA 3RJFA 2ZHAA 2BCVA 1FN0A 3HIYA 4AT8A 1YF8B 2W9MA 4M9NA 1F31A 3MBYA 4I6IA 3H38A 1FQ9A 4I4UA 4UY4A 4LEVA 2VXTI 4HA2A 3JPNA 31BIA 3AQLA 4F5QA 3JPSA 4G9NA 4O5EA 2QYIB 3V79C 4AT8B 4UB5A 4P4PA 4R65A 3E8LC 4RQ1A 3FFZA 3RJEA 3CK6A 5J2GA 2R9KB 4KLFA 1TOOA 4OAFA 4L4IA 1M16A 3OGFA 1PZZA 3QR5A 3UJ0A 8ICLA 3FJHA 4Z6CA 2ISOA 5JTGA 1ZQOA 5DECA 1FWVA 4A7YA 1ZQLA 3PHZA 1DZCA 4X39A 3RJHA 4I96A 2ISPA 8ICBA 4KEKA 5HHHA 5CJ7A 4DCKC 9ICLA 3HOMA 8ICHA 2IHOA 4FHVA 7I1BA 4I2DA 4FHPA 41BIA 2E4MA 4AN6A 1ZJNA 3CA5A 4KB6A 1YTOA 4X3AA 4K99A 4QO3A 3JPQA 7ICEA 6I1BA 4J2XA 4WOYA 3UQ2A 3N7MA 4MZFB 3WMUA 3NVOA 1JT5A 1GGPB 1OU5A 4OAIZ 3B0XA 3WO2A 1ZQJA 3WA1A 2FDBM 5F8YA 1BPXA 5BOLA 5IILA 3CA4A 2LIQA 4I4RA 4DO9A 4FH5A 3OJVA 4G1RA 1QXMA 5HPZA 4EP7A 4K9AA 4DOAA 3AH1A 7ICOA 4I2IA 9ICJA 3H6QA 2K4AB 3CRGA 4JAWA 5IIIA 5CWRA 4I4OA 4FGFA 1JQZA 1YBIA 4M9LA 7ICSA 3VSFA 4MZHA 4KLGA 3UXNA 4P0KA 3TC2A 2HN2A 3IM6A 4IQVA 1S0LA 4J2SA 2E4MC 9ICSA 4OUJA 5CFTA 1KDHA 2Y9FA 2O1PA 2PXIA 5HRIA 9ICCA 2RSTA 8ICEA 1S0BA 4OWJA 1SR4A 2MIBA 4RPXA 1IILA 7ICFA 4XFSA 2KH2A 4GXKA 3OUYA 3BA4A 3RH5A 2QN4A 4UAZA 4CJMA 3WMVA 3BAOA 3TFRA 5DVHA 2B56A 5DBBA 4QZCA 3OUYB 4FHYA 1HWOB 4XQ8A 4UB2A 5CFSA 5IINA 2K43A 1ZQHA 2ZH7A 4KLQA 1BA7A 4PHPA 3OBTA 1V6UA 1AVXB 3UJ4A 1RZTA 3SNVA 4OEEA 4O6AA 7ICKA 5DSSB 1AF9A 4YN4A 1EVTA 5CHGA 1RG8A 2KI6B 1Q1UA 1G82A 4NLNA 3UD7A 3BB2A 4P0JA 9ICHA 1EPWA 4GAIA 4MF2A 5B2HA 1ZQWA 4R63A 2GZBA 3O4CA 4M04A 1R89A 1UEUA 4E8FA 1OQLB 3O3QA 4F5NA 5HRHA 2F2FC 1HUZA 3PNCA 4QZ8A 3VWCA 4RWNA 1ZQVA 4I28A 3BRGC 2BCRA 4K98A 2FO1A 5IIJA 4G9MA 4AT9B 5J29A 3HX0A 4QZHA 3PMLA 4M9GA 1ISWA 2D23A 1WBCA 4ENDA 1W3AA 2AQZA 4I4VA 2ZH3A 5J0QA 8ICYA 4EFQA 4ATBA 2HW9A 2D43A 4YD1A 5J0XA 3FJDA 3C2MA 9ICOA 1XG6A 3OJ2A 2VLCA 4ATBB 5HRLA 1FV3A 4IONA 4PHEA 4USPA 1DQOA 1HCDA 4EB2B 3HN1A 4LO2A 4QALA 4F5RA 7ICUA 3NBEA 3HALA 1ISZA 1MC9A 5DDYA 3AQKA 1I1EA 5J0YA 1JT4A 4R64A 3OWGA 1Z4SA 1D0HA 3HMYA 4NM2A 1BFCA 1IJTA 4EEDA 4FHWA 3BTAA 8ICGA 3FJCA 3I2XA 3FJKA 4I4YA 4A7ZA 1IRPA 2O5AA 1P63A 2D22A 2IUBA 5DUYA 3AQNA 2PFOA 3MPPG 3V72A 3TFSA 4KLJA 2L5XA 1BARA 3AKHA 4P0LA 5BXPA 1QQLA 4FO6A 3AH4A 4RQ2A 4QBCA 1V6VA 2Q3NB 2AXMA 3RH6A 3R4UA 4M2YA 2PFPA 4WBYA 4M9HA 3ZC9A 1BPBA 4QZFA 2XOAA 3W9TA 2BBJA 4OAGA 3CAHA 1Z0HA 4LO2C 4QZEA 5J0SA 5D4BA 1E0OA 7ICHA 3BX1C 4LO1C 3V0AA 9ICIA 4PPXA 4LO0C 1TWEA 4ZFUB 4QKRA 1V4AA 4M9JA 3IAGC 1ZQRA 2ERMA 1S0GA 3Q7XA 1ZQGA 5J0PA 2BPCA 3ISCA 1PUMB 2M2WA 3FJEA 4NY8A 2NZ9A 8ICIA 9ICXA 1TIEA 4I1EA 1FWUA 1FA0A 3NBNA 4GP3A 3O4OA 4Z6FA 4G6JA 5J0TA 4X4VA 4KLEA 1ZQCA 1MQ3A 4X4UA 8ICSA 1ZQTA 3A23A 2FFVA 5HRBA 3Q7YA 4OWKA 3WFOA 1XSPA 3D7WB 3Q7WA 2D44A 3AKGA 5J2BA 3ER8C 2FCLA 3PMEA 4K9BA 2BCSA 8ICFA 1HWPB 2Q9XA 5DB7A 2FMPA 1IOBA 1JLXA 2M2VA 4QKSA 4L4HA 2F8XC 4RWOA 3BAVA 1MIVA 4DOCA 1ISXA 5J0OA 3ZXDA 4KC3A 3JPPA 5J2FA 4X4NA 3MCRA 4I2JA 1R8NA 2YUGA 4G6MA 4RQ0A 1V6WA 4KLUA 2WRYA 3H3AA 4PHDA 1VFGA 4UAWA 1ZQMA 5B3QA 4FHXA 4EBJA 4PC4A 4M5DA 4YMMA 3FJIA 4RQ8A 1G9BA 8ICQA 4MKPA 1GPJA 5BXSA 1TV9A 1BLDA 9ICPA 5J2DA 3P6JA 1BFGA 4DEPA 3WO3A 4JP0A 4HX0A 3VUOA 4JKQA 9ICRA 1QQKA 4OEFA 5FZUA 9ICTA 5J2JA 1AVWB 1HUOA 1TVAA 7ICIA 4Z8SB 5B3PA 7ICVA 1R8AA 3JPRA 1VJ7A 2IWTB 2LIEA 2NYYA 2AFGA 4AT7A 3BA7A 3HBWA 4FVVA 1FMMS 5J2IA 3V7LA 3H37A 4JQ0A 1ZQDA 4YCXA 4PGYA 4N7RA 7ICGA 2HZ9A 4AT7B 4NXXA 3JYYA 4UD4A 4WBCA 4GAFA 3N7JA 1AVUA 3MDAA 4NXTA 4XFUA 4WC6A 2DRYA 3IIRA 4KBBA 4X4QA 3AZVA 2DS0A 3OJMA 5E24E 3ZC8A 1A8DA 4K97A 2P23A 4J2KA 9ICWA 1ZQIA 1J0SA 1PC8B 5DZUA 2GAFD 3LTQA 5FNWA 2X2SA 4NKTA 4KLMA 2BEBA 8ICRA 3ERCC 2RG9B 4I2FA 4EGWA 4DENA 4WC1A 4QZ9A 5D61A 2M2TA 3RJKA 5DKWA 3UXPA 1BFFA 2F2FA 5J0RA 1II4A 8ICXA 1WOTA 2K8RA 4WC5A 5D63A 3NBDA 9ICAA 4QC4A 3POKA 3JPOA 3OGUA 4Z9WB 4K4HA 4Q91A 4KEJA 4GP0A 1ZQAA 4X0BA 3A21A 4PGXA 2ZH5A 1S0DA 3FJBA 4E80A 3IM7A 3JZ0A 3H6SE 3VEQA 2HHPA 3RTIB 1PX5A 8ICPA 1XSLA 5F8WA 3O4BA 1PUUB 1V6XA 1BLAA 4KLIA 8ICMA 5DB6A 3AH2A 2NP0A 4UBBA 2NS2A 4ISQA 2DR5A 4MFCA 2VU9A 3V0BA 4I2EA 4F5OA 4K96A 2BE3A 3HJ4A 4QZAA 8ICUA 2Y9GA 4AT9A 3I2AA 3NKUA 1WD4A 3V0BB 1G9CA 3S8JA 4RT2A 2DR8A 4QD2B 2D1ZA 4HR6C 2M2UA 4NKUA 4PH5A 4RWQA 4ZFYB 2ID1A 5HC9A 4MFFA 5FZYA 4AN7B 9ILBA 8ICTA 5DBAA 1JAJA 1Q03A 4JKXB 3HWTA 8I1BA 4P6AA 3OV7A 3P53A 4QBVA 1DZDA 1NZKA 4X5VA 4LEYA 9ICMA 2FGFA 3H6RA 4LZDA 3JUTA 3MGIA 7ICPA 4J23B 2BPFA 2ZH9A 4KLHA 2B51A 4QD2C 3H6RB 4WCWA 4LO1A
chains in the Genus database with same CATH topology
3NBNA 4GP3A 3O4OA 1XHBA 4G6JA 2D20A 3CRIA 6I1BA 4J2XA 4WOYA 5D62A 3N7MA 2NTDA 4MZFB 3BRDA 3UD9A 4GOVA 4LO0A 3WMUA 1JT5A 3A23A 2FFVA 1GGPB 3B9UA 3BAUA 3PG0A 1ISVA 1AXMA 3FJFA 4GOYA 3Q7YA 2BFHA 1FGAA 4OWKA 4OAIZ 3AKFA 3D7WB 1AVAC 4J2YA 4ZA3B 3WO2A 4OWLA 3OBRA 3Q7WA 3QYDA 2D44A 3WA1A 2FDBM 5F8YA 3JRRA 2AAIB 1TTUA 3CA4A 5I1BA 3AKGA 2LIQA 4I4RA 2FCLA 3ER8C 3PMEA 1ONKB 4K9BA 3OJVA 3VT2A 4OAHA 4G1RA 3A07A 1QXMA 1ISYA 2VSAA 5HPZA 4ZBVB 4F83A 4K9AA 3AH1A 3O5WB 1HWPB 3UD8A 2Q9XA 2VXRA 3OGGA 4XJEA 1SR4C 3H6QA 1IOBA 1JLXA 2K4AB 1RMLA 3BADA 3CRGA 4JAWA 4QKSA 2P39A 4L4HA 4I4OA 4FGFA 3RTJB 2F8XC 1VCLA 1JQZA 3BAVA 1YBIA 3FJAA 3VSFA 4MZHA 3ILAA 4P0KA 1RY7A 5BOWA 3TC2A 1ISXA 3F1RA 4MZGB 3F62B 3ZXDA 4KC3A 3IM6A 4FO1A 4ZOTA 4I8MA 1S0LA 4NXWA 1R8OA 4J2SA 2E4MC 4I4PA 3MCRA 4OUJA 2FFUA 1R8NA 5CFTA 1K5VA 2Y9FA 2YUGA 3RMXA 4ZFWB 1K5UA 4G6MA 5BP5A 2UUSA 5EHAA 1V6WA 2WRYA 1G9AA 4TLPA 2RSTA 3WINA 1S0BA 4OWJA 2VSEA 4O68A 5B3QA 1SR4A 4I37A 4Q9GA 2VUAA 4PC4A 2MIBA 1IILA 5F8SA 4WQLA 3FJIA 4XFSA 4I1BA 3R4SA 1G9BA 2KH2A 3NJ5A 1HWMB 5CHEA 3BA4A 4MKPA 1M2TB 4EEEB 1GPJA 4IY8A 2QN4A 2RQ9A 5BXSA 3O49A 4CJMA 4JLZA 1XYFA 3WMVA 4IQPA 3BAOA 1FMZA 4KEIA 4IZXA 4D0TA 1BLDA 3P6JA 5DVHA 2B56A 1BFGA 2NM1A 1DJSB 3BA5A 1IT0A 3EF2A 3WO3A 4JP0A 4DEPA 4EFRA 4HX0A 4D0ZA 3VUOA 3AKIA 3FJJA 1FV2A 4JKQA 3FUQA 3AZWA 1HKNA 1HWOB 1QQKA 4X38A 4OEFA 5FZUA 4KM5A 1AVWB 3LLPA 5CFSA 4IZEA 4OEGA 2K43A 1BA7A 1CE7B 1RZOB 2Z48A 1YXWA 5CFUA 5FZZA 1WD3A 3OBTA 4O67A 1DIWA 2X2TA 1V6UA 1AVXB 3UJ4A 4Z8SB 3SNVA 3K1XA 5B3PA 4WQKA 2D24A 3S8KA 3AJ6A 4JPZA 4OEEA 4X37A 4O6AA 3FGMA 5EG6C 2DREA 4R6UB 5DSSB 1AF9A 4XKIA 2IWTB 1S0EA 2LIEA 2NYYA 1ILR1 2AFGA 3BA7A 1EVTA 1RG8A 2KI6B 3FJ8A 2ESUA 3HBWA 5G00A 3CRHA 4FVVA 1JLYA 1Q1UA 1FMMS 3CQAA 3P6IA 4ZGRB 3VT0A 1JTCA 1G82A 4JQ0A 2ET2A 3UD7A 3BB2A 4P0JA 2Z49A 5BP5C 4NXUA 4N7RA 2HZ9A 1EPWA 4GAIA 2EWRA 4NXVA 4Q9PA 4NXXA 5B2HA 3WINC 3RMYA 2GZBA 1ABRB 3VT1A 4WBCA 4IY9A 4GAFA 3O4CA 1S0CA 3N7JA 1AVUA 3CU1B 4NXTA 5FNXA 3UDAA 1OQLB 1EYLA 3O3QA 4I3NA 4XFUA 4LO3C 2DRYA 3IIRA 4KBBA 3AZVA 2DS0A 2MLLB 3OJMA 1MD6A 5E24E 3ZC8A 1UPSA 1A8DA 4K97A 2P23A 2F2FC 4LO7B 3BAQA 5JMCA 1L2HA 4J2KA 1DFQA 1CVSA 1WBAA 3O44A 4LO8B 5EC5A 4O69A 1J0SA 3VWCA 1PC8B 1JT7A 4H75A 5DZUA 2GAFD 1Q04A 1DQGA 3BRGC 4WH5A 4K98A 3LTQA 2FO1A 5FNWA 3N7KA 2BEAA 4G9MA 2X2SA 1T4QA 5BQUA 1SZ6B 1ISWA 2D23A 2BEBA 3CA6A 3ERCC 1WBCA 4ENDA 1W3AA 2RG9B 1I1BA 2AQZA 1IHKA 4I4VA 1BASA 1W3FA 4DENA 2GO2A 5D61A 4IHZA 4LO3A 3PUBA 3WO4A 4K8VA 2M49A 4EFQA 1BFFA 4I4SA 1EV2A 2F2FA 2HWMA 2I1BA 5BXTA 1S0FA 1TFMB 2HW9A 3KMVA 4OW4A 1IRAX 2D43A 1II4A 3K7DA 3V0AB 1G9DA 2DRZA 2K8RA 3FJDA 4LEWA 4ZLBB 3BAHA 3VSZA 5D63A 4ZKTB 1XG6A 3IM5A 4USOA 1JT3A 1PWAA 2VLCA 3OJ2A 3NBCA 4LEZA 3NBDA 1HWNB 1FV3A 5GAQA 5F90A 4IONA 1HCEA 1AFCA 2KLLA 4QC4A 4LO7C 3POKA 4USPA 4I7IA 1DQOA 2D7IA 4EFPA 1HCDA 4EB2B 1HIBA 3HN1A 3MALA 4Z9WB 4LO2A 1JY0A 5JLVA 4QALA 3C9ZA 2KKIA 3NBEA 3HALA 1ISZA 2GA9D 1MC9A 1I1EA 4Q91A 4KEJA 3FJ9A 1TWMA 3BAGA 1BFBA 4GP0A 3A21A 4EKXB 1JT4A 1S0DA 3OWGA 21BIA 3FJBA 1Z4SA 1D0HA 3FUOA 1N4KA 3HMYA 5BXRA 1BFCA 1IJTA 1Z2VA 3IM7A 2ZQOA 3BTAA 3H6SE 3VEQA 3FJCA 2KI4A 3RTIB 5BVPI 4IYBA 5F8WA 3O4BA 2NVHA 1PUUB 3I2XA 3FJKA 1DFCA 4I4XA 1V6XA 3HSMA 4I4YA 5BQUC 4A7ZA 1BLAA 1IRPA 2B4VA 1P63A 2D22A 3AH2A 3O4DA 3BRFA 4A7KA 2NP0A 1ITBA 4XFTA 2NS2A 3I29B 4ISQA 4H04A 5DUYA 2Y9WC 2VU9A 3V0BA 2Y9XE 3MPPG 1FN0A 4I2SA 1YYNA 2HWAA 4K96A 2L5XA 1BARA 1YF8B 3AKHA 4P0LA 2Y9GA 5BXPA 3N0KA 1QQLA 1F31A 4I6IA 3AH4A 4H9WA 1FQ9A 2J3PA 1V6VA 4I4UA 4QBCA 3I2AA 4UY4A 3NKUA 3T8SA 4LEVA 1WD4A 2VXTI 2Q3NB 4HA2A 3V0BB 2AXMA 4D8HA 1G9CA 31BIA 3S8JA 3R4UA 4G9NA 4QD2B 2QYIB 3V79C 1W3GA 3E8LC 2D7RA 3FFZA 2D1ZA 3ZXGA 4HR6C 3ZC9A 3ZX7A 4F34A 3N7LA 2R9KB 1KNMA 1TP0A 3CA1A 1DLLA 2XOAA 1TOOA 3W9TA 4OAGA 4OAFA 3CAHA 1Z0HA 4L4IA 4LO2C 1M16A 3OGFA 1PZZA 2WBCA 3QR5A 2ZQNA 3UJ0A 4ZFYB 1E0OA 4JRAA 3BX1C 3O4AA 4LO1C 5FZYA 3FJHA 3CA0A 3V0AA 1XZZA 4I4QA 4AN7B 9ILBA 1Q03A 4JKXB 3RSJA 8I1BA 1FWVA 4A7YA 3PHZA 4P6AA 1DZCA 3AJ5A 4LO0C 4X39A 4I96A 1TWEA 4ZFUB 4QKRA 4KEKA 4II0A 3P53A 4DCKC 3IAGC 4QBVA 2ZR1B 1DZDA 1NZKA 4JLXA 1T9FA 2ERMA 4LEYA 1S0GA 3Q7XA 3ER9B 3CA3A 2FGFA 3H6RA 3HOMA 4ISRA 4YOLA 3JUTA 4HJJA 1PUMB 2IHOA 4J23B 3FJEA 7I1BA 1NUNA 3A22A 2MC2A 41BIA 2E4MA 4AN6A 3CA5A 2NZ9A 4KB6A 1TIEA 4I0YA 2B51A 1YTOA 4I1EA 4QD2C 1FWUA 4X3AA 4K99A 3H6RB 4LO1A 4QO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBN A;  4GP3 A;  3O4O A;  1XHB A;  4G6J A;  2D20 A;  3CRI A;  6I1B A;  4J2X A;  5D62 A;  3N7M A;  2NTD A;  3BRD A;  3UD9 A;  4GOV A;  4LO0 A;  3WMU A;  1JT5 A;  3A23 A;  2FFV A;  1GGP B;  3B9U A;  3BAU A;  3PG0 A;  1ISV A;  1AXM A;  3FJF A;  4GOY A;  3Q7Y A;  2BFH A;  1FGA A;  4OWK A;  3AKF A;  3D7W B;  1AVA C;  4J2Y A;  4ZA3 B;  3WO2 A;  4OWL A;  3OBR A;  3Q7W A;  3QYD A;  2D44 A;  3WA1 A;  2FDB M;  5F8Y A;  3JRR A;  2AAI B;  1TTU A;  3CA4 A;  5I1B A;  3AKG A;  2LIQ A;  4I4R A;  3PME A;  1ONK B;  3OJV A;  3VT2 A;  4G1R A;  3A07 A;  1QXM A;  1ISY A;  2VSA A;  5HPZ A;  4ZBV B;  4F83 A;  3AH1 A;  3O5W B;  1HWP B;  3UD8 A;  2Q9X A;  2VXR A;  3OGG A;  1SR4 C;  3H6Q A;  1IOB A;  1JLX A;  2K4A B;  1RML A;  3BAD A;  3CRG A;  4JAW A;  4QKS A;  2P39 A;  4L4H A;  4I4O A;  4FGF A;  3RTJ B;  2F8X C;  1VCL A;  1JQZ A;  3BAV A;  1YBI A;  3FJA A;  3VSF A;  3ILA A;  4P0K A;  1RY7 A;  5BOW A;  3TC2 A;  1ISX A;  3F1R A;  3F62 B;  3ZXD A;  4KC3 A;  3IM6 A;  4ZOT A;  4I8M A;  1S0L A;  1R8O A;  4J2S A;  2E4M C;  4I4P A;  4OUJ A;  2FFU A;  1R8N A;  1K5V A;  2Y9F A;  2YUG A;  3RMX A;  4ZFW B;  1K5U A;  4G6M A;  5BP5 A;  2UUS A;  5EHA A;  1V6W A;  2WRY A;  1G9A A;  4TLP A;  2RST A;  3WIN A;  1S0B A;  4OWJ A;  2VSE A;  1SR4 A;  4I37 A;  4Q9G A;  2VUA A;  4PC4 A;  2MIB A;  1IIL A;  5F8S A;  3FJI A;  4XFS A;  4I1B A;  3R4S A;  1G9B A;  2KH2 A;  3NJ5 A;  1HWM B;  3BA4 A;  1M2T B;  4EEE B;  4IY8 A;  2QN4 A;  2RQ9 A;  5BXS A;  3O49 A;  4CJM A;  1XYF A;  3WMV A;  4IQP A;  3BAO A;  1FMZ A;  4KEI A;  4IZX A;  4D0T A;  1BLD A;  3P6J A;  5DVH A;  1BFG A;  2NM1 A;  1DJS B;  3BA5 A;  1IT0 A;  3EF2 A;  3WO3 A;  4JP0 A;  4DEP A;  4EFR A;  4D0Z A;  3VUO A;  3AKI A;  3FJJ A;  1FV2 A;  4JKQ A;  3FUQ A;  3AZW A;  1HKN A;  1HWO B;  1QQK A;  4X38 A;  4OEF A;  5FZU A;  1AVW B;  3LLP A;  4IZE A;  4OEG A;  2K43 A;  1BA7 A;  1CE7 B;  1RZO B;  2Z48 A;  1YXW A;  5FZZ A;  1WD3 A;  3OBT A;  1DIW A;  2X2T A;  1V6U A;  1AVX B;  3UJ4 A;  4Z8S B;  3SNV A;  3K1X A;  2D24 A;  3S8K A;  3AJ6 A;  4JPZ A;  4OEE A;  4X37 A;  3FGM A;  5EG6 C;  2DRE A;  4R6U B;  5DSS B;  1AF9 A;  4XKI A;  2IWT B;  1S0E A;  2LIE A;  2NYY A;  1ILR 1;  2AFG A;  3BA7 A;  1EVT A;  1RG8 A;  2KI6 B;  3FJ8 A;  2ESU A;  3HBW A;  5G00 A;  3CRH A;  4FVV A;  1JLY A;  1Q1U A;  1FMM S;  3CQA A;  3P6I A;  4ZGR B;  3VT0 A;  1JTC A;  1G82 A;  4JQ0 A;  2ET2 A;  3UD7 A;  3BB2 A;  4P0J A;  2Z49 A;  5BP5 C;  2HZ9 A;  1EPW A;  4GAI A;  4Q9P A;  5B2H A;  3WIN C;  3RMY A;  2GZB A;  1ABR B;  3VT1 A;  4WBC A;  4IY9 A;  4GAF A;  3O4C A;  1S0C A;  3N7J A;  1AVU A;  3CU1 B;  5FNX A;  3UDA A;  1OQL B;  1EYL A;  3O3Q A;  4I3N A;  4XFU A;  4LO3 C;  2DRY A;  3IIR A;  4KBB A;  3AZV A;  2DS0 A;  2MLL B;  3OJM A;  1MD6 A;  5E24 E;  3ZC8 A;  1UPS A;  1A8D A;  2P23 A;  2F2F C;  4LO7 B;  3BAQ A;  5JMC A;  1L2H A;  4J2K A;  1DFQ A;  1CVS A;  1WBA A;  3O44 A;  4LO8 B;  5EC5 A;  1J0S A;  3VWC A;  1PC8 B;  1JT7 A;  5DZU A;  1Q04 A;  1DQG A;  3BRG C;  3LTQ A;  2FO1 A;  5FNW A;  3N7K A;  2BEA A;  4G9M A;  2X2S A;  1T4Q A;  5BQU A;  1SZ6 B;  1ISW A;  2D23 A;  2BEB A;  3CA6 A;  1WBC A;  4END A;  1W3A A;  2RG9 B;  1I1B A;  2AQZ A;  1IHK A;  4I4V A;  1BAS A;  1W3F A;  4DEN A;  2GO2 A;  5D61 A;  4IHZ A;  4LO3 A;  3PUB A;  3WO4 A;  2M49 A;  4EFQ A;  1BFF A;  4I4S A;  1EV2 A;  2F2F A;  2HWM A;  2I1B A;  5BXT A;  1S0F A;  1TFM B;  2HW9 A;  3KMV A;  4OW4 A;  1IRA X;  2D43 A;  1II4 A;  3V0A B;  1G9D A;  2DRZ A;  2K8R A;  3FJD A;  4ZLB B;  3BAH A;  3VSZ A;  5D63 A;  4ZKT B;  1XG6 A;  3IM5 A;  4USO A;  1JT3 A;  1PWA A;  2VLC A;  3OJ2 A;  3NBC A;  3NBD A;  1HWN B;  1FV3 A;  5GAQ A;  5F90 A;  4ION A;  1HCE A;  1AFC A;  2KLL A;  4QC4 A;  4LO7 C;  3POK A;  4USP A;  4I7I A;  1DQO A;  2D7I A;  4EFP A;  1HCD A;  4EB2 B;  1HIB A;  3HN1 A;  3MAL A;  4Z9W B;  4LO2 A;  1JY0 A;  5JLV A;  4QAL A;  3C9Z A;  2KKI A;  3NBE A;  3HAL A;  1ISZ A;  1MC9 A;  1I1E A;  4Q91 A;  4KEJ A;  3FJ9 A;  1TWM A;  3BAG A;  1BFB A;  4GP0 A;  3A21 A;  4EKX B;  1JT4 A;  1S0D A;  21BI A;  3FJB A;  1Z4S A;  1D0H A;  3FUO A;  1N4K A;  3HMY A;  5BXR A;  1BFC A;  1IJT A;  1Z2V A;  3IM7 A;  2ZQO A;  3BTA A;  3H6S E;  3VEQ A;  3FJC A;  2KI4 A;  3RTI B;  5BVP I;  4IYB A;  5F8W A;  3O4B A;  2NVH A;  1PUU B;  3I2X A;  3FJK A;  1DFC A;  4I4X A;  1V6X A;  3HSM A;  4I4Y A;  5BQU C;  4A7Z A;  1BLA A;  1IRP A;  1P63 A;  2D22 A;  3AH2 A;  3O4D A;  3BRF A;  4A7K A;  2NP0 A;  1ITB A;  4XFT A;  3I29 B;  4ISQ A;  4H04 A;  5DUY A;  2Y9W C;  2VU9 A;  3V0B A;  2Y9X E;  3MPP G;  1FN0 A;  4I2S A;  1YYN A;  2HWA A;  2L5X A;  1BAR A;  1YF8 B;  3AKH A;  4P0L A;  2Y9G A;  5BXP A;  3N0K A;  1QQL A;  1F31 A;  4I6I A;  3AH4 A;  4H9W A;  1FQ9 A;  2J3P A;  1V6V A;  4I4U A;  4QBC A;  3I2A A;  3T8S A;  1WD4 A;  2VXT I;  2Q3N B;  4HA2 A;  3V0B B;  2AXM A;  4D8H A;  1G9C A;  31BI A;  3S8J A;  3R4U A;  4G9N A;  4QD2 B;  2QYI B;  3V79 C;  1W3G A;  3E8L C;  2D7R A;  3FFZ A;  2D1Z A;  3ZXG A;  4HR6 C;  3ZC9 A;  3ZX7 A;  4F34 A;  3N7L A;  2R9K B;  1KNM A;  1TP0 A;  3CA1 A;  1DLL A;  2XOA A;  1TOO A;  3W9T A;  3CAH A;  1Z0H A;  4L4I A;  4LO2 C;  1M16 A;  3OGF A;  1PZZ A;  2WBC A;  3QR5 A;  2ZQN A;  3UJ0 A;  4ZFY B;  1E0O A;  4JRA A;  3BX1 C;  3O4A A;  4LO1 C;  5FZY A;  3FJH A;  3CA0 A;  3V0A A;  1XZZ A;  4I4Q A;  4AN7 B;  9ILB A;  1Q03 A;  4JKX B;  3RSJ A;  8I1B A;  1FWV A;  4A7Y A;  3PHZ A;  4P6A A;  1DZC A;  3AJ5 A;  4LO0 C;  4X39 A;  4I96 A;  1TWE A;  4ZFU B;  4QKR A;  4KEK A;  4II0 A;  3P53 A;  4DCK C;  3IAG C;  4QBV A;  2ZR1 B;  1DZD A;  1NZK A;  1T9F A;  2ERM A;  1S0G A;  3Q7X A;  3CA3 A;  2FGF A;  3H6R A;  3HOM A;  4ISR A;  4YOL A;  3JUT A;  4HJJ A;  1PUM B;  2IHO A;  4J23 B;  3FJE A;  7I1B A;  1NUN A;  3A22 A;  2MC2 A;  41BI A;  2E4M A;  4AN6 A;  3CA5 A;  2NZ9 A;  1TIE A;  4I0Y A;  1YTO A;  4I1E A;  4QD2 C;  1FWU A;  4X3A A;  3H6R B;  4LO1 A;  4QO3 A; 
#chains in the Genus database with same CATH topology
 1ZQU A;  1XHB A;  4EEB A;  4Z6D A;  2D20 A;  4X4O A;  5D62 A;  3BRD A;  4GOV A;  4LO0 A;  4LT6 A;  4RQ4 A;  3BAU A;  1ISV A;  5DB8 A;  4LZG A;  1FGA A;  1NOM A;  4I2B A;  4TUR A;  4XUS A;  4WBZ A;  3AKF A;  4J2Y A;  3QYD A;  2BCQ A;  4PHA A;  5IIM A;  1TTU A;  5I1B A;  3VT2 A;  4OAH A;  2NRK A;  4QZB A;  3O5W B;  1TFY A;  3UD8 A;  5HRG A;  2VXR A;  2PFQ A;  2IHM A;  3FJA A;  4UBC A;  5CA7 A;  3ILA A;  5BPC A;  3F62 B;  4FO1 A;  4I0U A;  4I8M A;  4IQU A;  4NXW A;  1R8O A;  2DR9 A;  2FFU A;  2PBE A;  3RMX A;  1K5U A;  1JQR A;  4NM1 A;  9ICQ A;  4TUQ A;  1G9A A;  3GDX A;  3WIN A;  4GXI A;  4Q9G A;  2VUA A;  4WC7 A;  5DB9 A;  4M0A A;  5F8S A;  4WQL A;  1UET A;  5CHE A;  1M2T B;  4IY8 A;  3HJ1 A;  3O49 A;  4WC4 A;  1ZQY A;  4JLZ A;  5IIO A;  4KEI A;  4IZX A;  4D0T A;  3MGH A;  3C2K A;  4X4S A;  3NYB A;  3UQ0 A;  4UAY A;  3FJJ A;  1Q79 A;  4X38 A;  4KM5 A;  4KLL A;  4KLS A;  3LLP A;  4IZE A;  4OEG A;  4K4I A;  4I2H A;  4NLZ A;  2Z48 A;  5CFU A;  4LVS A;  9ICK A;  5FZZ A;  1JN3 A;  1DIW A;  2X2T A;  3K1X A;  2BBH A;  4WQK A;  3S8K A;  4X37 A;  3FGM A;  4XKI A;  3AU6 A;  1ILR 1;  2Q66 A;  4P4O A;  3FJ8 A;  2ESU A;  5G00 A;  3CRH A;  3VT0 A;  2DRB A;  1JTC A;  5EOZ A;  2ET2 A;  1TFW A;  2PFN A;  8ICK A;  4NXV A;  3WIN C;  4S3N A;  3UPQ A;  4IQT A;  2DVI A;  3CU1 B;  3UDA A;  1EYL A;  4O5C A;  4I3N A;  4LO3 C;  2MLL B;  3C5F A;  4LO7 B;  5JMC A;  4K4G A;  4UB1 A;  1CVS A;  1WBA A;  5EC5 A;  4O69 A;  4EV6 A;  4RQ6 A;  2ZH1 A;  1JT7 A;  2ZH2 A;  4H75 A;  4EBK A;  1Q04 A;  1DQG A;  4I29 A;  3N7K A;  2BEA A;  1T4Q A;  3CA6 A;  1I1B A;  1R8B A;  1IHK A;  1ZQB A;  3C5G A;  4IHZ A;  3PUB A;  4K8V A;  3OVB A;  4XQ7 A;  4I4S A;  1EV2 A;  3WFP A;  2HWM A;  5BXT A;  1TFM B;  4OW4 A;  4GXJ A;  1IRA X;  3AUO A;  3K7D A;  9ICF A;  4LEW A;  4ZLB B;  3VSZ A;  3RJJ A;  3AQM A;  1JT3 A;  5GAQ A;  1AFC A;  2KLL A;  4LO7 C;  5CB1 A;  5J2K A;  4I7I A;  3WFS C;  4X4P A;  4DOB A;  2D7I A;  4EFP A;  5TZV A;  1MQ2 A;  1UEV A;  3C9Z A;  2KKI A;  4R66 A;  7ICM A;  4QZD A;  1XSN A;  3FJ9 A;  1TWM A;  4EKX B;  5J2H A;  21BI A;  1ZQN A;  8ICJ A;  1N4K A;  1ZQP A;  3WFQ E;  1Z2V A;  2ZQO A;  1YLQ A;  1KEJ A;  4WC0 A;  1JMS A;  3HSM A;  2B4V A;  2ZH6 A;  3BRF A;  4A7K A;  1ITB A;  2HN1 A;  3LQC B;  4XA5 A;  2BPG A;  4H04 A;  2Y9W C;  2Y9X E;  4I2S A;  1YYN A;  2HWA A;  3WFR E;  3K75 D;  3L9D A;  3N0K A;  3RJI A;  4H9W A;  2J3P A;  3T8S A;  3JPT A;  4D8H A;  4YMO A;  3H39 A;  1W3G A;  7ICR A;  2VAN A;  2D7R A;  3LK9 A;  4P4M A;  3ZXG A;  3C18 A;  2FMS A;  4QZI A;  3ZX7 A;  4F34 A;  3N7L A;  1KNM A;  1TP0 A;  3CA1 A;  1DLL A;  3C66 A;  4I27 A;  2WBC A;  2ZQN A;  4JRA A;  3O4A A;  3CA0 A;  1XZZ A;  4I4Q A;  3RSJ A;  3B0Y A;  3AJ5 A;  3C2L A;  4I2A A;  4II0 A;  4IG8 A;  2ZR1 B;  4JLX A;  1T9F A;  3ISD A;  2FMQ A;  2DRA A;  3ER9 B;  4PGQ A;  3CA3 A;  5J0U A;  4ISR A;  4YOL A;  4HJJ A;  1NUN A;  5F2V O;  3A22 A;  1ZQX A;  2MC2 A;  2P66 A;  5DBC A;  4I0Y A;  5J2E A;  4KLO A;  4FH3 A;  5HRK A;  9ICE A;  3OVA A;  1BPD A;  3CRI A;  1ZQS A;  4KLT A;  2NTD A;  3UD9 A;  3B9U A;  9ICN A;  3PG0 A;  1AXM A;  3FJF A;  4GOY A;  2BFH A;  1AVA C;  5D49 A;  8ICV A;  4ZA3 B;  4OWL A;  3OBR A;  3JRR A;  2AAI B;  1BPZ A;  1NO5 A;  5CP2 A;  4WC2 A;  1ONK B;  7ICQ A;  3A07 A;  1ISY A;  2VSA A;  4ZBV B;  4F83 A;  3OGG A;  5HRD A;  4XJE A;  1SR4 C;  5J2C A;  1RML A;  3BAD A;  2P39 A;  3RTJ B;  1VCL A;  4UB3 A;  4RT3 A;  3OVS A;  1RY7 A;  5BOW A;  3F1R A;  4MZG B;  4ZOT A;  4NXZ A;  5HHI A;  2ZH8 A;  4X4T A;  4QZG A;  4NLK A;  4I4P A;  1K5V A;  4ZFW B;  3RH4 A;  5BP5 A;  3RJG A;  3V7J A;  5HRE A;  2UUS A;  5EHA A;  4TLP A;  9ICB A;  2DR7 A;  2VSE A;  4O68 A;  4I37 A;  1BPE A;  4MF8 A;  4I1B A;  3R4S A;  4I2C A;  3NJ5 A;  1HWM B;  4EEE B;  3V7K A;  5D46 A;  2RQ9 A;  3NWI A;  5DDM A;  1XYF A;  1RPL A;  2I9G A;  4IQP A;  1FMZ A;  3PMN A;  2NM1 A;  1DJS B;  3ISB A;  3BA5 A;  1IT0 A;  3EF2 A;  4EFR A;  4D0Z A;  3AKI A;  1FV2 A;  3FUQ A;  4M47 A;  3AZW A;  1HKN A;  2ZH4 A;  1CE7 B;  1RZO B;  1YXW A;  1WD3 A;  4O67 A;  2RFF A;  3HW8 A;  4O5K A;  2D24 A;  3AJ6 A;  4JPZ A;  5EG6 C;  2DRE A;  1KNY A;  4R6U B;  4YD2 A;  1S0E A;  7ICN A;  2ZHB A;  1ZQQ A;  4YMN A;  9ICG A;  4JWM A;  8ICC A;  1JLY A;  7ICT A;  3CQA A;  3P6I A;  4ZGR B;  5J2A A;  4TUS A;  4X0A A;  2Z49 A;  5BP5 C;  4NXU A;  5HRF A;  4UB4 A;  2EWR A;  1MIW A;  4Q9P A;  4X4R A;  3RMY A;  4MFA A;  1MIY A;  3UPS A;  1ABR B;  3VT1 A;  4IY9 A;  8ICZ A;  1S0C A;  1ZQK A;  5FNX A;  5HR9 A;  4RPZ A;  1MD6 A;  1UPS A;  7ICL A;  4I2G A;  3BAQ A;  1L2H A;  1DFQ A;  1ZJM A;  3O44 A;  4LO8 B;  8ICA A;  4UD5 A;  4WH5 A;  4RQ3 A;  5BQU A;  1SZ6 B;  2GWS A;  4RQ7 A;  1R8C A;  1Q78 A;  8ICN A;  4IQW A;  1BAS A;  1W3F A;  5J0W A;  2GO2 A;  1BPY A;  4XRH A;  4LO3 A;  3WO4 A;  4F5P A;  2BCU A;  2M49 A;  4O9M A;  3JCF A;  1ZQE A;  2I1B A;  1S0F A;  3KMV A;  4E7X A;  1ZQF A;  4RWP A;  8ICW A;  3V0A B;  1G9D A;  2DRZ A;  3UXO A;  8ICO A;  3BAH A;  3AU2 A;  4ZKT B;  3IM5 A;  4USO A;  1PWA A;  4RQ5 A;  3NBC A;  4LEZ A;  1HWN B;  5CR0 A;  5F90 A;  1HCE A;  1ZQZ A;  1HIB A;  3MAL A;  4RPY A;  1JY0 A;  5JLV A;  1F5A A;  2GA9 D;  3BAG A;  1BFB A;  9ICV A;  7ICJ A;  3FUO A;  4WC3 A;  5BXR A;  4TUP A;  5IIK A;  9ICU A;  2KI4 A;  5BVP I;  4IYB A;  4P2H A;  2NVH A;  4I4X A;  1DFC A;  5BQU C;  5BOM A;  4KLD A;  3O4D A;  4Z6E A;  4XFT A;  3I29 B;  5DED A;  4JWN A;  3MDC A;  3RJF A;  2ZHA A;  2BCV A;  1FN0 A;  3HIY A;  4AT8 A;  1YF8 B;  2W9M A;  4M9N A;  1F31 A;  3MBY A;  4I6I A;  3H38 A;  1FQ9 A;  4I4U A;  4UY4 A;  4LEV A;  2VXT I;  4HA2 A;  3JPN A;  31BI A;  3AQL A;  4F5Q A;  3JPS A;  4G9N A;  4O5E A;  2QYI B;  3V79 C;  4AT8 B;  4UB5 A;  4P4P A;  4R65 A;  3E8L C;  4RQ1 A;  3FFZ A;  3RJE A;  3CK6 A;  5J2G A;  2R9K B;  4KLF A;  1TOO A;  4OAF A;  4L4I A;  1M16 A;  3OGF A;  1PZZ A;  3QR5 A;  3UJ0 A;  8ICL A;  3FJH A;  4Z6C A;  2ISO A;  5JTG A;  1ZQO A;  5DEC A;  1FWV A;  4A7Y A;  1ZQL A;  3PHZ A;  1DZC A;  4X39 A;  3RJH A;  4I96 A;  2ISP A;  8ICB A;  4KEK A;  5HHH A;  5CJ7 A;  4DCK C;  9ICL A;  3HOM A;  8ICH A;  2IHO A;  4FHV A;  7I1B A;  4I2D A;  4FHP A;  41BI A;  2E4M A;  4AN6 A;  1ZJN A;  3CA5 A;  4KB6 A;  1YTO A;  4X3A A;  4K99 A;  4QO3 A;  3JPQ A;  7ICE A;  6I1B A;  4J2X A;  4WOY A;  3UQ2 A;  3N7M A;  4MZF B;  3WMU A;  3NVO A;  1JT5 A;  1GGP B;  1OU5 A;  4OAI Z;  3B0X A;  3WO2 A;  1ZQJ A;  3WA1 A;  2FDB M;  5F8Y A;  1BPX A;  5BOL A;  5IIL A;  3CA4 A;  2LIQ A;  4I4R A;  4DO9 A;  4FH5 A;  3OJV A;  4G1R A;  1QXM A;  5HPZ A;  4EP7 A;  4K9A A;  4DOA A;  3AH1 A;  7ICO A;  4I2I A;  9ICJ A;  3H6Q A;  2K4A B;  3CRG A;  4JAW A;  5III A;  5CWR A;  4I4O A;  4FGF A;  1JQZ A;  1YBI A;  4M9L A;  7ICS A;  3VSF A;  4MZH A;  4KLG A;  3UXN A;  4P0K A;  3TC2 A;  2HN2 A;  3IM6 A;  4IQV A;  1S0L A;  4J2S A;  2E4M C;  9ICS A;  4OUJ A;  5CFT A;  1KDH A;  2Y9F A;  2O1P A;  2PXI A;  5HRI A;  9ICC A;  2RST A;  8ICE A;  1S0B A;  4OWJ A;  1SR4 A;  2MIB A;  4RPX A;  1IIL A;  7ICF A;  4XFS A;  2KH2 A;  4GXK A;  3OUY A;  3BA4 A;  3RH5 A;  2QN4 A;  4UAZ A;  4CJM A;  3WMV A;  3BAO A;  3TFR A;  5DVH A;  2B56 A;  5DBB A;  4QZC A;  3OUY B;  4FHY A;  1HWO B;  4XQ8 A;  4UB2 A;  5CFS A;  5IIN A;  2K43 A;  1ZQH A;  2ZH7 A;  4KLQ A;  1BA7 A;  4PHP A;  3OBT A;  1V6U A;  1AVX B;  3UJ4 A;  1RZT A;  3SNV A;  4OEE A;  4O6A A;  7ICK A;  5DSS B;  1AF9 A;  4YN4 A;  1EVT A;  5CHG A;  1RG8 A;  2KI6 B;  1Q1U A;  1G82 A;  4NLN A;  3UD7 A;  3BB2 A;  4P0J A;  9ICH A;  1EPW A;  4GAI A;  4MF2 A;  5B2H A;  1ZQW A;  4R63 A;  2GZB A;  3O4C A;  4M04 A;  1R89 A;  1UEU A;  4E8F A;  1OQL B;  3O3Q A;  4F5N A;  5HRH A;  2F2F C;  1HUZ A;  3PNC A;  4QZ8 A;  3VWC A;  4RWN A;  1ZQV A;  4I28 A;  3BRG C;  2BCR A;  4K98 A;  2FO1 A;  5IIJ A;  4G9M A;  4AT9 B;  5J29 A;  3HX0 A;  4QZH A;  3PML A;  4M9G A;  1ISW A;  2D23 A;  1WBC A;  4END A;  1W3A A;  2AQZ A;  4I4V A;  2ZH3 A;  5J0Q A;  8ICY A;  4EFQ A;  4ATB A;  2HW9 A;  2D43 A;  4YD1 A;  5J0X A;  3FJD A;  3C2M A;  9ICO A;  1XG6 A;  3OJ2 A;  2VLC A;  4ATB B;  5HRL A;  1FV3 A;  4ION A;  4PHE A;  4USP A;  1DQO A;  1HCD A;  4EB2 B;  3HN1 A;  4LO2 A;  4QAL A;  4F5R A;  7ICU A;  3NBE A;  3HAL A;  1ISZ A;  1MC9 A;  5DDY A;  3AQK A;  1I1E A;  5J0Y A;  1JT4 A;  4R64 A;  3OWG A;  1Z4S A;  1D0H A;  3HMY A;  4NM2 A;  1BFC A;  1IJT A;  4EED A;  4FHW A;  3BTA A;  8ICG A;  3FJC A;  3I2X A;  3FJK A;  4I4Y A;  4A7Z A;  1IRP A;  2O5A A;  1P63 A;  2D22 A;  2IUB A;  5DUY A;  3AQN A;  2PFO A;  3MPP G;  3V72 A;  3TFS A;  4KLJ A;  2L5X A;  1BAR A;  3AKH A;  4P0L A;  5BXP A;  1QQL A;  4FO6 A;  3AH4 A;  4RQ2 A;  4QBC A;  1V6V A;  2Q3N B;  2AXM A;  3RH6 A;  3R4U A;  4M2Y A;  2PFP A;  4WBY A;  4M9H A;  3ZC9 A;  1BPB A;  4QZF A;  2XOA A;  3W9T A;  2BBJ A;  4OAG A;  3CAH A;  1Z0H A;  4LO2 C;  4QZE A;  5J0S A;  5D4B A;  1E0O A;  7ICH A;  3BX1 C;  4LO1 C;  3V0A A;  9ICI A;  4PPX A;  4LO0 C;  1TWE A;  4ZFU B;  4QKR A;  1V4A A;  4M9J A;  3IAG C;  1ZQR A;  2ERM A;  1S0G A;  3Q7X A;  1ZQG A;  5J0P A;  2BPC A;  3ISC A;  1PUM B;  2M2W A;  3FJE A;  4NY8 A;  2NZ9 A;  8ICI A;  9ICX A;  1TIE A;  4I1E A;  1FWU A;  1FA0 A;  3NBN A;  4GP3 A;  3O4O A;  4Z6F A;  4G6J A;  5J0T A;  4X4V A;  4KLE A;  1ZQC A;  1MQ3 A;  4X4U A;  8ICS A;  1ZQT A;  3A23 A;  2FFV A;  5HRB A;  3Q7Y A;  4OWK A;  3WFO A;  1XSP A;  3D7W B;  3Q7W A;  2D44 A;  3AKG A;  5J2B A;  3ER8 C;  2FCL A;  3PME A;  4K9B A;  2BCS A;  8ICF A;  1HWP B;  2Q9X A;  5DB7 A;  2FMP A;  1IOB A;  1JLX A;  2M2V A;  4QKS A;  4L4H A;  2F8X C;  4RWO A;  3BAV A;  1MIV A;  4DOC A;  1ISX A;  5J0O A;  3ZXD A;  4KC3 A;  3JPP A;  5J2F A;  4X4N A;  3MCR A;  4I2J A;  1R8N A;  2YUG A;  4G6M A;  4RQ0 A;  1V6W A;  4KLU A;  2WRY A;  3H3A A;  4PHD A;  1VFG A;  4UAW A;  1ZQM A;  5B3Q A;  4FHX A;  4EBJ A;  4PC4 A;  4M5D A;  4YMM A;  3FJI A;  4RQ8 A;  1G9B A;  8ICQ A;  4MKP A;  1GPJ A;  5BXS A;  1TV9 A;  1BLD A;  9ICP A;  5J2D A;  3P6J A;  1BFG A;  4DEP A;  3WO3 A;  4JP0 A;  4HX0 A;  3VUO A;  4JKQ A;  9ICR A;  1QQK A;  4OEF A;  5FZU A;  9ICT A;  5J2J A;  1AVW B;  1HUO A;  1TVA A;  7ICI A;  4Z8S B;  5B3P A;  7ICV A;  1R8A A;  3JPR A;  1VJ7 A;  2IWT B;  2LIE A;  2NYY A;  2AFG A;  4AT7 A;  3BA7 A;  3HBW A;  4FVV A;  1FMM S;  5J2I A;  3V7L A;  3H37 A;  4JQ0 A;  1ZQD A;  4YCX A;  4PGY A;  4N7R A;  7ICG A;  2HZ9 A;  4AT7 B;  4NXX A;  3JYY A;  4UD4 A;  4WBC A;  4GAF A;  3N7J A;  1AVU A;  3MDA A;  4NXT A;  4XFU A;  4WC6 A;  2DRY A;  3IIR A;  4KBB A;  4X4Q A;  3AZV A;  2DS0 A;  3OJM A;  5E24 E;  3ZC8 A;  1A8D A;  4K97 A;  2P23 A;  4J2K A;  9ICW A;  1ZQI A;  1J0S A;  1PC8 B;  5DZU A;  2GAF D;  3LTQ A;  5FNW A;  2X2S A;  4NKT A;  4KLM A;  2BEB A;  8ICR A;  3ERC C;  2RG9 B;  4I2F A;  4EGW A;  4DEN A;  4WC1 A;  4QZ9 A;  5D61 A;  2M2T A;  3RJK A;  5DKW A;  3UXP A;  1BFF A;  2F2F A;  5J0R A;  1II4 A;  8ICX A;  1WOT A;  2K8R A;  4WC5 A;  5D63 A;  3NBD A;  9ICA A;  4QC4 A;  3POK A;  3JPO A;  3OGU A;  4Z9W B;  4K4H A;  4Q91 A;  4KEJ A;  4GP0 A;  1ZQA A;  4X0B A;  3A21 A;  4PGX A;  2ZH5 A;  1S0D A;  3FJB A;  4E80 A;  3IM7 A;  3JZ0 A;  3H6S E;  3VEQ A;  2HHP A;  3RTI B;  1PX5 A;  8ICP A;  1XSL A;  5F8W A;  3O4B A;  1PUU B;  1V6X A;  1BLA A;  4KLI A;  8ICM A;  5DB6 A;  3AH2 A;  2NP0 A;  4UBB A;  2NS2 A;  4ISQ A;  2DR5 A;  4MFC A;  2VU9 A;  3V0B A;  4I2E A;  4F5O A;  4K96 A;  2BE3 A;  3HJ4 A;  4QZA A;  8ICU A;  2Y9G A;  4AT9 A;  3I2A A;  3NKU A;  1WD4 A;  3V0B B;  1G9C A;  3S8J A;  4RT2 A;  2DR8 A;  4QD2 B;  2D1Z A;  4HR6 C;  2M2U A;  4NKU A;  4PH5 A;  4RWQ A;  4ZFY B;  2ID1 A;  5HC9 A;  4MFF A;  5FZY A;  4AN7 B;  9ILB A;  8ICT A;  5DBA A;  1JAJ A;  1Q03 A;  4JKX B;  3HWT A;  8I1B A;  4P6A A;  3OV7 A;  3P53 A;  4QBV A;  1DZD A;  1NZK A;  4X5V A;  4LEY A;  9ICM A;  2FGF A;  3H6R A;  4LZD A;  3JUT A;  3MGI A;  7ICP A;  4J23 B;  2BPF A;  2ZH9 A;  4KLH A;  2B51 A;  4QD2 C;  3H6R B;  4WCW A;  4LO1 A; 
#chains in the Genus database with same CATH homology
 3NBN A;  4GP3 A;  3O4O A;  1XHB A;  4G6J A;  2D20 A;  3CRI A;  6I1B A;  4J2X A;  4WOY A;  5D62 A;  3N7M A;  2NTD A;  4MZF B;  3BRD A;  3UD9 A;  4GOV A;  4LO0 A;  3WMU A;  1JT5 A;  3A23 A;  2FFV A;  1GGP B;  3B9U A;  3BAU A;  3PG0 A;  1ISV A;  1AXM A;  3FJF A;  4GOY A;  3Q7Y A;  2BFH A;  1FGA A;  4OWK A;  4OAI Z;  3AKF A;  3D7W B;  1AVA C;  4J2Y A;  4ZA3 B;  3WO2 A;  4OWL A;  3OBR A;  3Q7W A;  3QYD A;  2D44 A;  3WA1 A;  2FDB M;  5F8Y A;  3JRR A;  2AAI B;  1TTU A;  3CA4 A;  5I1B A;  3AKG A;  2LIQ A;  4I4R A;  2FCL A;  3ER8 C;  3PME A;  1ONK B;  4K9B A;  3OJV A;  3VT2 A;  4OAH A;  4G1R A;  3A07 A;  1QXM A;  1ISY A;  2VSA A;  5HPZ A;  4ZBV B;  4F83 A;  4K9A A;  3AH1 A;  3O5W B;  1HWP B;  3UD8 A;  2Q9X A;  2VXR A;  3OGG A;  4XJE A;  1SR4 C;  3H6Q A;  1IOB A;  1JLX A;  2K4A B;  1RML A;  3BAD A;  3CRG A;  4JAW A;  4QKS A;  2P39 A;  4L4H A;  4I4O A;  4FGF A;  3RTJ B;  2F8X C;  1VCL A;  1JQZ A;  3BAV A;  1YBI A;  3FJA A;  3VSF A;  4MZH A;  3ILA A;  4P0K A;  1RY7 A;  5BOW A;  3TC2 A;  1ISX A;  3F1R A;  4MZG B;  3F62 B;  3ZXD A;  4KC3 A;  3IM6 A;  4FO1 A;  4ZOT A;  4I8M A;  1S0L A;  4NXW A;  1R8O A;  4J2S A;  2E4M C;  4I4P A;  3MCR A;  4OUJ A;  2FFU A;  1R8N A;  5CFT A;  1K5V A;  2Y9F A;  2YUG A;  3RMX A;  4ZFW B;  1K5U A;  4G6M A;  5BP5 A;  2UUS A;  5EHA A;  1V6W A;  2WRY A;  1G9A A;  4TLP A;  2RST A;  3WIN A;  1S0B A;  4OWJ A;  2VSE A;  4O68 A;  5B3Q A;  1SR4 A;  4I37 A;  4Q9G A;  2VUA A;  4PC4 A;  2MIB A;  1IIL A;  5F8S A;  4WQL A;  3FJI A;  4XFS A;  4I1B A;  3R4S A;  1G9B A;  2KH2 A;  3NJ5 A;  1HWM B;  5CHE A;  3BA4 A;  4MKP A;  1M2T B;  4EEE B;  1GPJ A;  4IY8 A;  2QN4 A;  2RQ9 A;  5BXS A;  3O49 A;  4CJM A;  4JLZ A;  1XYF A;  3WMV A;  4IQP A;  3BAO A;  1FMZ A;  4KEI A;  4IZX A;  4D0T A;  1BLD A;  3P6J A;  5DVH A;  2B56 A;  1BFG A;  2NM1 A;  1DJS B;  3BA5 A;  1IT0 A;  3EF2 A;  3WO3 A;  4JP0 A;  4DEP A;  4EFR A;  4HX0 A;  4D0Z A;  3VUO A;  3AKI A;  3FJJ A;  1FV2 A;  4JKQ A;  3FUQ A;  3AZW A;  1HKN A;  1HWO B;  1QQK A;  4X38 A;  4OEF A;  5FZU A;  4KM5 A;  1AVW B;  3LLP A;  5CFS A;  4IZE A;  4OEG A;  2K43 A;  1BA7 A;  1CE7 B;  1RZO B;  2Z48 A;  1YXW A;  5CFU A;  5FZZ A;  1WD3 A;  3OBT A;  4O67 A;  1DIW A;  2X2T A;  1V6U A;  1AVX B;  3UJ4 A;  4Z8S B;  3SNV A;  3K1X A;  5B3P A;  4WQK A;  2D24 A;  3S8K A;  3AJ6 A;  4JPZ A;  4OEE A;  4X37 A;  4O6A A;  3FGM A;  5EG6 C;  2DRE A;  4R6U B;  5DSS B;  1AF9 A;  4XKI A;  2IWT B;  1S0E A;  2LIE A;  2NYY A;  1ILR 1;  2AFG A;  3BA7 A;  1EVT A;  1RG8 A;  2KI6 B;  3FJ8 A;  2ESU A;  3HBW A;  5G00 A;  3CRH A;  4FVV A;  1JLY A;  1Q1U A;  1FMM S;  3CQA A;  3P6I A;  4ZGR B;  3VT0 A;  1JTC A;  1G82 A;  4JQ0 A;  2ET2 A;  3UD7 A;  3BB2 A;  4P0J A;  2Z49 A;  5BP5 C;  4NXU A;  4N7R A;  2HZ9 A;  1EPW A;  4GAI A;  2EWR A;  4NXV A;  4Q9P A;  4NXX A;  5B2H A;  3WIN C;  3RMY A;  2GZB A;  1ABR B;  3VT1 A;  4WBC A;  4IY9 A;  4GAF A;  3O4C A;  1S0C A;  3N7J A;  1AVU A;  3CU1 B;  4NXT A;  5FNX A;  3UDA A;  1OQL B;  1EYL A;  3O3Q A;  4I3N A;  4XFU A;  4LO3 C;  2DRY A;  3IIR A;  4KBB A;  3AZV A;  2DS0 A;  2MLL B;  3OJM A;  1MD6 A;  5E24 E;  3ZC8 A;  1UPS A;  1A8D A;  4K97 A;  2P23 A;  2F2F C;  4LO7 B;  3BAQ A;  5JMC A;  1L2H A;  4J2K A;  1DFQ A;  1CVS A;  1WBA A;  3O44 A;  4LO8 B;  5EC5 A;  4O69 A;  1J0S A;  3VWC A;  1PC8 B;  1JT7 A;  4H75 A;  5DZU A;  2GAF D;  1Q04 A;  1DQG A;  3BRG C;  4WH5 A;  4K98 A;  3LTQ A;  2FO1 A;  5FNW A;  3N7K A;  2BEA A;  4G9M A;  2X2S A;  1T4Q A;  5BQU A;  1SZ6 B;  1ISW A;  2D23 A;  2BEB A;  3CA6 A;  3ERC C;  1WBC A;  4END A;  1W3A A;  2RG9 B;  1I1B A;  2AQZ A;  1IHK A;  4I4V A;  1BAS A;  1W3F A;  4DEN A;  2GO2 A;  5D61 A;  4IHZ A;  4LO3 A;  3PUB A;  3WO4 A;  4K8V A;  2M49 A;  4EFQ A;  1BFF A;  4I4S A;  1EV2 A;  2F2F A;  2HWM A;  2I1B A;  5BXT A;  1S0F A;  1TFM B;  2HW9 A;  3KMV A;  4OW4 A;  1IRA X;  2D43 A;  1II4 A;  3K7D A;  3V0A B;  1G9D A;  2DRZ A;  2K8R A;  3FJD A;  4LEW A;  4ZLB B;  3BAH A;  3VSZ A;  5D63 A;  4ZKT B;  1XG6 A;  3IM5 A;  4USO A;  1JT3 A;  1PWA A;  2VLC A;  3OJ2 A;  3NBC A;  4LEZ A;  3NBD A;  1HWN B;  1FV3 A;  5GAQ A;  5F90 A;  4ION A;  1HCE A;  1AFC A;  2KLL A;  4QC4 A;  4LO7 C;  3POK A;  4USP A;  4I7I A;  1DQO A;  2D7I A;  4EFP A;  1HCD A;  4EB2 B;  1HIB A;  3HN1 A;  3MAL A;  4Z9W B;  4LO2 A;  1JY0 A;  5JLV A;  4QAL A;  3C9Z A;  2KKI A;  3NBE A;  3HAL A;  1ISZ A;  2GA9 D;  1MC9 A;  1I1E A;  4Q91 A;  4KEJ A;  3FJ9 A;  1TWM A;  3BAG A;  1BFB A;  4GP0 A;  3A21 A;  4EKX B;  1JT4 A;  1S0D A;  3OWG A;  21BI A;  3FJB A;  1Z4S A;  1D0H A;  3FUO A;  1N4K A;  3HMY A;  5BXR A;  1BFC A;  1IJT A;  1Z2V A;  3IM7 A;  2ZQO A;  3BTA A;  3H6S E;  3VEQ A;  3FJC A;  2KI4 A;  3RTI B;  5BVP I;  4IYB A;  5F8W A;  3O4B A;  2NVH A;  1PUU B;  3I2X A;  3FJK A;  1DFC A;  4I4X A;  1V6X A;  3HSM A;  4I4Y A;  5BQU C;  4A7Z A;  1BLA A;  1IRP A;  2B4V A;  1P63 A;  2D22 A;  3AH2 A;  3O4D A;  3BRF A;  4A7K A;  2NP0 A;  1ITB A;  4XFT A;  2NS2 A;  3I29 B;  4ISQ A;  4H04 A;  5DUY A;  2Y9W C;  2VU9 A;  3V0B A;  2Y9X E;  3MPP G;  1FN0 A;  4I2S A;  1YYN A;  2HWA A;  4K96 A;  2L5X A;  1BAR A;  1YF8 B;  3AKH A;  4P0L A;  2Y9G A;  5BXP A;  3N0K A;  1QQL A;  1F31 A;  4I6I A;  3AH4 A;  4H9W A;  1FQ9 A;  2J3P A;  1V6V A;  4I4U A;  4QBC A;  3I2A A;  4UY4 A;  3NKU A;  3T8S A;  4LEV A;  1WD4 A;  2VXT I;  2Q3N B;  4HA2 A;  3V0B B;  2AXM A;  4D8H A;  1G9C A;  31BI A;  3S8J A;  3R4U A;  4G9N A;  4QD2 B;  2QYI B;  3V79 C;  1W3G A;  3E8L C;  2D7R A;  3FFZ A;  2D1Z A;  3ZXG A;  4HR6 C;  3ZC9 A;  3ZX7 A;  4F34 A;  3N7L A;  2R9K B;  1KNM A;  1TP0 A;  3CA1 A;  1DLL A;  2XOA A;  1TOO A;  3W9T A;  4OAG A;  4OAF A;  3CAH A;  1Z0H A;  4L4I A;  4LO2 C;  1M16 A;  3OGF A;  1PZZ A;  2WBC A;  3QR5 A;  2ZQN A;  3UJ0 A;  4ZFY B;  1E0O A;  4JRA A;  3BX1 C;  3O4A A;  4LO1 C;  5FZY A;  3FJH A;  3CA0 A;  3V0A A;  1XZZ A;  4I4Q A;  4AN7 B;  9ILB A;  1Q03 A;  4JKX B;  3RSJ A;  8I1B A;  1FWV A;  4A7Y A;  3PHZ A;  4P6A A;  1DZC A;  3AJ5 A;  4LO0 C;  4X39 A;  4I96 A;  1TWE A;  4ZFU B;  4QKR A;  4KEK A;  4II0 A;  3P53 A;  4DCK C;  3IAG C;  4QBV A;  2ZR1 B;  1DZD A;  1NZK A;  4JLX A;  1T9F A;  2ERM A;  4LEY A;  1S0G A;  3Q7X A;  3ER9 B;  3CA3 A;  2FGF A;  3H6R A;  3HOM A;  4ISR A;  4YOL A;  3JUT A;  4HJJ A;  1PUM B;  2IHO A;  4J23 B;  3FJE A;  7I1B A;  1NUN A;  3A22 A;  2MC2 A;  41BI A;  2E4M A;  4AN6 A;  3CA5 A;  2NZ9 A;  4KB6 A;  1TIE A;  4I0Y A;  2B51 A;  1YTO A;  4I1E A;  4QD2 C;  1FWU A;  4X3A A;  4K99 A;  3H6R B;  4LO1 A;  4QO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...