5D61A

Moa-z-vad-fmk complex, direct orientation
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
292
structure length
292
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Agglutinin
publication title An Unusual Member of the Papain Superfamily: Mapping the Catalytic Cleft of the Marasmius oreades agglutinin (MOA) with a Caspase Inhibitor.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Hydrolase
total genus 92
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5d61A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5d61A02
3HOMA 2QYIB 3LTQA 3POKA 1KNMA 3CA1A 1JTCA 3IM7A 3V0AA 3OJVA 4GP0A 2D44A 2AQZA 1P63A 1RY7A 3ZXDA 3ZC9A 4JQ0A 1HKNA 2E4MC 3C9ZA 1F31A 4I4SA 4R6UB 3AZVA 1S0CA 2WBCA 4JRAA 2KLLA 1ISVA 1DQGA 4CJMA 7I1BA 4FGFA 1CVSA 4G6MA 3MPPG 3WMUA 1AF9A 3BTAA 3OJMA 4LO3C 2F2FA 3F1RA 3IIRA 3OBTA 3CA6A 1T4QA 2Q3NB 2FFVA 3A21A 1ILR1 3R4UA 3AH2A 1HIBA 1ONKB 1W3GA 4A7ZA 3VSFA 5D61A 2X2SA 1R8NA 2D20A 1M2TB 3P6JA 4II0A 4I4QA 2Q9XA 5FZYA 1AVXB 1RZOB 3I29B 4GAFA 4OEGA 4ZFUB 1TFMB 5EHAA 1D0HA 1JT4A 1N4KA 2DREA 3H6SE 3HMYA 5BQUC 21BIA 4X38A 3BAGA 3PMEA 3RMXA 3ZXGA 4QD2B 5GAQA 5FNXA 1K5VA 3WINA 3NBNA 1BA7A 1JQZA 1FV2A 4JPZA 1CE7B 1EYLA 2AXMA 1J0SA 1AVUA 3S8JA 2Y9GA 2LIEA 3AH1A 4DEPA 3O4DA 1DFCA 8I1BA 2IWTB 4QD2C 2GO2A 4G6JA 1V6XA 3CA4A 3O3QA 3RTJB 2WRYA 3MALA 1TIEA 3N0KA 3V0BB 3OBRA 4LO1C 1G82A 3FJHA 1IRAX 1E0OA 3AH4A 1FN0A 4KBBA 3KMVA 3QR5A 3NBCA 3ZC8A 1W3FA 4A7YA 4JAWA 4P0KA 2D23A 1FWUA 3BAQA 4ZFWB 2UUSA 4I1EA 4ZFYB 5BP5C 3FJIA 1MC9A 4I4VA 1TTUA 4USPA 1M16A 3CA3A 4LO2C 4EFQA 4LO7C 4PC4A 1Q1UA 4I1BA 3D7WB 4G9MA 1HCEA 1YF8B 4IZXA 2D1ZA 3LLPA 1FWVA 2NYYA 1FMZA 2ESUA 3Q7WA 3VT1A 1JT3A 1AVWB 1OQLB 2GZBA 3FJCA 4X3AA 4D0TA 1WBAA 4I4RA 1BFCA 2MC2A 3FJAA 3UD7A 1XZZA 3VSZA 3VT2A 3O44A 3ZX7A 3PUBA 5I1BA 1DZDA 1WD4A 3K1XA 3O4OA 1DQOA 3RTIB 4EFRA 3HSMA 4LO0C 1PWAA 2FDBM 2RSTA 4I7IA 3PG0A 2D24A 2Z49A 1Q03A 2VXRA 4J2SA 1YTOA 1HWPB 4HJJA 3PHZA 2AFGA 2RG9B 4IY8A 4KEJA 4ISRA 3TC2A 1VCLA 2FO1A 3FUOA 3AJ5A 1TP0A 3NJ5A 3CA5A 4I4OA 1SR4C 1FGAA 1XHBA 4J23B 4QKRA 1IT0A 4F83A 1PZZA 4KC3A 1RG8A 1XYFA 4P6AA 4Z8SB 2VSAA 3FGMA 4P0JA 2RQ9A 1BFGA 1W3AA 1IRPA 1R8OA 1I1BA 2AAIB 3BRDA 3NBDA 3FJ9A 3BA7A 2NM1A 1QXMA 3BRFA 5JLVA 4ZKTB 3FJ8A 3CRHA 2F2FC 1TWEA 2J3PA 4I4XA 3FJBA 2HW9A 2D7RA 4KEKA 4OW4A 3BA4A 1AVAC 1Q04A 4X39A 5F8SA 3BAHA 2VU9A 3JRRA 9ILBA 4Z9WB 4JP0A 1DLLA 4LO3A 4QKSA 4WBCA 3BADA 2DRZA 2D22A 4FVVA 4GOVA 3UJ0A 2MLLB 1G9AA 2Y9FA 1G9CA 3WO4A 2ZQOA 2ZQNA 2K8RA 3WA1A 1ISZA 3WMVA 1QQLA 1G9DA 4JKXB 5F8WA 3FJFA 1FV3A 1ABRB 1YBIA 3N7KA 4HA2A 4EFPA 4I4PA 3BB2A 4ISQA 4OUJA 4EEEB 2BFHA 2HWAA 3CRIA 4ZA3B 1V6VA 2ET2A 4H9WA 1RMLA 2K4AB 3FUQA 3O4CA 1NUNA 31BIA 2P39A 2X2TA 1YYNA 4I4UA 4Q9PA 3Q7YA 4I3NA 4ZGRB 1WD3A 1DJSB 3H6RA 3OGFA 2QN4A 1JY0A 3BRGC 1HCDA 5DSSB 3AKHA 5FNWA 4I2SA 1II4A 3EF2A 1GGPB 3FJJA 4XKIA 1JLYA 3WO3A 1Z2VA 1AFCA 2FFUA 2NVHA 3N7MA 3N7LA 2D7IA 3N7JA 5BP5A 5DVHA 1ISWA 4A7KA 1DIWA 3V79C 5FZZA 5DUYA 4IQPA 2IHOA 5FZUA 2M49A 3R4SA 3OGGA 2BEBA 5BXPA 3O49A 1YXWA 1BASA 5F8YA 3O4BA 1IHKA 2HWMA 4I4YA 4JKQA 3UDAA 4TLPA 1ISYA 4QALA 2R9KB 3P53A 3FFZA 1ISXA 4OWLA 3CAHA 2I1BA 2KKIA 3CA0A 4GOYA 3T8SA 41BIA 3BAVA 3SNVA 3JUTA 5BXTA 2XOAA 3H6QA 2BEAA 4LO8B 2MIBA 1G9BA 3AKFA 1BLDA 1AXMA 2ZR1B 1HWMB 1JT5A 3O5WB 1PC8B 2E4MA 3I2AA 4I6IA 1FMMS 1WBCA 5E24E 3CRGA 4OWJA 4XFUA 2Y9WC 3OJ2A 3RMYA 1TOOA 1SR4A 3FJKA 4ZBVB 1S0FA 3F62B 4L4HA 5BXSA 2VSEA 4P0LA 6I1BA 4EB2B 3BAOA 1TWMA 3Q7XA 4ZOTA 3I2XA 3HBWA 4OWKA 3P6IA 4YOLA 1BFFA 4Q9GA 1Z4SA 3A07A 3UJ4A 1S0BA 2LIQA 1ITBA 1HWNB 1IOBA 2FGFA 4G9NA 5DZUA 1QQKA 1BARA 2HZ9A 3ILAA 3BA5A 1A8DA 1V6UA 3FJDA 1EVTA 3WINC 5BOWA 2NTDA 5BQUA 1EV2A 4AN7B 5HPZA 1BLAA 5D63A 3VUOA 4J2XA 2KI4A 1JLXA 1PUMB 5EG6C 2D43A 3AZWA 4XFSA 3H6RB 3IM6A 3O4AA 1T9FA 3E8LC 5BVPI 2NZ9A 5EC5A 1IJTA 4AN6A 4USOA 2ERMA 1JT7A 4ZLBB 4IHZA 1SZ6B 2VUAA 4ENDA 2KH2A 3VT0A 1I1EA 1IILA 3UD9A 3HN1A 4GAIA 4OEFA 2YUGA 1PUUB 2Y9XE 4H04A 4QO3A 4I37A 4KEIA 3IM5A 4DCKC 1DZCA 3AKGA 3HALA 4D0ZA 2K43A 5BXRA 2DS0A 4G1RA 4J2KA 3A23A 3FJEA 1NZKA 3IAGC 1UPSA 3VEQA 2P23A 4LO7B 4HR6C 5G00A 4QC4A 4LO1A 4I0YA 4X37A 5F90A 1DFQA 4F34A 3BAUA 2NP0A 4IY9A 1S0EA 1S0GA 4GP3A 3VWCA 3CQAA 3W9TA 2F8XC 1V6WA 4IYBA 1MD6A 4I96A 4EKXB 4D8HA 4QBVA 1FQ9A 5B2HA 4L4IA 1K5UA 1Z0HA 3S8KA 3UD8A 1EPWA 4LO2A 4Q91A 3CU1B 3A22A 4DENA 1S0DA 4I8MA 3V0BA 2VXTI 1HWOB 2VLCA 3QYDA 4QBCA 3B9UA 2KI6B 4OEEA 4IZEA 3V0AB 3NBEA 2Z48A 1S0LA 3BX1C 4XFTA 4J2YA 3RSJA 5D62A 2DRYA 2L5XA 4LO0A 3WO2A 1XG6A 3AJ6A 4IONA 5JMCA 1L2HA 3AKIA 1BFBA
chains in the Genus database with same CATH superfamily
3HOMA 2QYIB 3POKA 3ISCA 1ZQFA 4GP0A 3RH4A 2M2VA 4O9MA 1HKNA 3C5GA 3RH5A 4Z6EA 5DDYA 3C18A 2KLLA 4UD4A 1ISVA 1DQGA 7I1BA 4KLDA 1CVSA 3JPTA 3BTAA 4PGQA 4EEBA 3IIRA 3CA6A 1T4QA 3R4UA 1HIBA 1ONKB 7ICJA 1R8NA 3RJIA 7ICUA 4I4QA 2Q9XA 3UQ2A 3I29B 4NY8A 4ZFUB 5EHAA 1JT4A 2DREA 3BAGA 3RMXA 4M2YA 4QD2B 3RH6A 2Q66A 3OWGA 5HRKA 1EYLA 2LIEA 4KM5A 3WFRE 4I2IA 3AH1A 3O4DA 4I29A 5J0RA 3WFSC 2DRAA 2IWTB 3GDXA 3RTJB 2ZH7A 4KBBA 3NBCA 4RQ2A 4I1EA 4ZFYB 4NKUA 1HCEA 5HR9A 2NRKA 8ICJA 2NYYA 3VT1A 2B56A 4D0TA 4RPXA 1WD4A 3K1XA 3OUYA 2RSTA 2D24A 5J2IA 3CK6A 2VXRA 1YTOA 3TC2A 3FUOA 9ICBA 4NKTA 5DDMA 3TFRA 1XHBA 4QKRA 5J0OA 4F83A 1PZZA 8ICHA 1ZJNA 1XYFA 4P6AA 4R64A 2VSAA 4P0JA 4FHYA 2RQ9A 5D4BA 1IRPA 1TFWA 1I1BA 2AAIB 5DBAA 3FJ9A 9ICCA 1QXMA 1JAJA 9ICAA 2F2FC 1TWEA 4I4XA 4FH3A 4XQ8A 8ICFA 4KEKA 3WFPA 1Q04A 5DB7A 5B3PA 3JRRA 1DLLA 2DRZA 4RT2A 3MGHA 4GOVA 3RJEA 2MLLB 4WC3A 1G9CA 3WA1A 2DRBA 1G9DA 4JKXB 5BOLA 4EEDA 1ABRB 4WH5A 9ICWA 5DKWA 1YBIA 3V7JA 4HA2A 3UPSA 2ISPA 2FMPA 2K4AB 3FUQA 2BBHA 31BIA 4I4UA 4Q9PA 4FO6A 4X5VA 1UEVA 3WO3A 3OVSA 2FFUA 1AFCA 2NVHA 3N7MA 5IILA 5BP5A 4RQ1A 4PHDA 1ISWA 1ZQKA 3C66A 5CFTA 5FZZA 4AT7B 2M49A 4I2JA 7ICEA 3K75D 2HWMA 8ICYA 9ICVA 1ZQSA 4QALA 1ISXA 3SNVA 2BEAA 3AKFA 4RQ7A 1BLDA 8ICMA 2ZR1B 1HWMB 1JT5A 4MZHA 4X4OA 1PC8B 1FMMS 1WBCA 8ICQA 4OWJA 4QZIA 4XA5A 1TOOA 1S0FA 4E7XA 6I1BA 2ZH1A 5J29A 4ZOTA 5HRGA 3I2XA 2O1PA 4RQ6A 4OWKA 4YOLA 4M0AA 8ICUA 4XUSA 3MGIA 5DEDA 7ICFA 5J2BA 1ITBA 1HWNB 4IQWA 7ICMA 4P2HA 2M2WA 1QQKA 1XSPA 2BCSA 3BA5A 2BE3A 2NTDA 1EV2A 5D63A 3VUOA 4J2XA 9ICOA 2KI4A 1JLXA 4M04A 1RZTA 3AZWA 1ZQTA 3IM6A 3LQCB 5EC5A 1JT7A 1TV9A 1IILA 4H04A 3ER9B 4PGYA 3K7DA 4G1RA 4Z6DA 1NZKA 2DR7A 8ICOA 2ZHAA 4LO7B 4HR6C 4K97A 4LO1A 5F90A 1DFQA 5CR0A 4GXJA 4R63A 2F8XC 1ZQGA 4WC0A 1MD6A 4I96A 4EKXB 3S8KA 1Z0HA 3NWIA 4LO2A 1UETA 1R89A 2B4VA 2VXTI 1HWOB 4NXWA 3QYDA 3H38A 4WC4A 1PX5A 1S0LA 4XFTA 2PBEA 3RSJA 4RQ3A 4LO0A 3WO2A 1ZQWA 3AQMA 4N7RA 4OAIZ 3AKIA 3ZXDA 1KNMA 1GPJA 3V0AA 2AQZA 1P63A 5J2AA 3ZC9A 4JQ0A 3C9ZA 2E4MC 5HRFA 2ZH6A 1JQRA 4AT9B 5J0UA 2BPCA 5HRLA 4EV6A 4LO3C 1ZQQA 3F1RA 4I2DA 4F5NA 2FFVA 4HX0A 3A21A 1KNYA 1W3GA 4A7ZA 5D61A 4II0A 2ZH3A 1HUZA 1RZOB 4KLTA 1D0HA 1N4KA 5BQUC 3PMEA 3C2LA 4I28A 4FH5A 5FNXA 4NM2A 4YMMA 3NBNA 3WINA 1BA7A 1ZQXA 1ZQLA 2B51A 4JPZA 1CE7B 2AXMA 1AVUA 4I2AA 4LEVA 1ZQNA 4RQ0A 2ZH4A 4K9AA 3CA4A 3O3QA 5J0TA 1TIEA 3OBRA 4LZDA 1IRAX 1E0OA 3ISBA 9ICQA 4JAWA 3FJIA 1MC9A 4MKPA 2FMQA 4LO7C 4JLZA 4WQLA 4I1BA 1YF8B 1ZQAA 4IZXA 2D1ZA 5HRHA 1FMZA 2EWRA 4X4SA 4X3AA 4X4TA 1WBAA 1BFCA 2MC2A 8ICXA 3JZ0A 1MQ3A 1DQOA 3RTIB 3HSMA 3AUOA 1PWAA 2FDBM 3PMNA 4I7IA 2Z49A 1Q03A 3L9DA 1HWPB 4KEJA 3PHZA 2GWSA 2RG9B 4ISRA 1VCLA 4DOCA 4X4QA 4LT6A 4J23B 7ICKA 4PHAA 4WC1A 4KC3A 4ATBA 1VFGA 4UD5A 2FCLA 2M2UA 1W3AA 4Z6FA 4M9GA 3BRFA 5JLVA 4ZKTB 3RJKA 7ICRA 3MDAA 1AVAC 4X39A 5F8SA 3BAHA 3ERCC 8ICGA 1ZQPA 4OAFA 4PPXA 1G9AA 2PFPA 4S3NA 4RPZA 2PFNA 2K8RA 8ICIA 3C2KA 5EOZA 2ZHBA 3FJFA 2DR9A 5JTGA 4DO9A 3BB2A 4OUJA 2BFHA 1RMLA 5J2DA 1NUNA 2P39A 5J0QA 4I3NA 2IUBA 3V7LA 4ZGRB 3RJJA 3H6RA 3OGUA 2QN4A 5J2CA 4RWNA 3BRGC 1HCDA 1NOMA 4Z6CA 3AKHA 4RPYA 5J2KA 3EF2A 1GGPB 1BPDA 2PFOA 2ID1A 3ER8C 5DVHA 4WBYA 4KLHA 1DIWA 3V79C 5DUYA 4IQPA 5FZUA 2IHMA 5CP2A 5BXPA 3O49A 1BASA 5F8YA 4F5PA 3NKUA 3P53A 5IIIA 9ICRA 2I1BA 2DR8A 3CA0A 4AT8A 4MZGB 3BAVA 3JPSA 3I2AA 4I6IA 5E24E 4EBJA 3RMYA 4L4HA 2VSEA 7ICHA 4QZ9A 4E80A 3Q7XA 4YD1A 1BPBA 3P6IA 5HRBA 4Q9GA 3UJ4A 2HN2A 1S0BA 2LIQA 3WFQE 5HRIA 4IQUA 2ZH8A 5DZUA 5HHHA 1BARA 2HZ9A 3ILAA 1A8DA 5HPZA 4I27A 4XFSA 3JPOA 1T9FA 5BVPI 2NZ9A 4XRHA 4AN6A 4LEYA 5IIMA 3HJ1A 5J2EA 9ICPA 4ZLBB 2VUAA 3VT0A 3UD9A 4GAIA 4K99A 1PUUB 4QO3A 4OAGA 4KEIA 4M9NA 4DCKC 2K43A 1YLQA 1ZQIA 4J2KA 3FJEA 4QZFA 2P23A 4KLQA 3TFSA 4I0YA 5J2JA 1ZQEA 3CQAA 3W9TA 1V6WA 1MIVA 4D8HA 4QBVA 1FQ9A 1K5UA 4NXTA 1EPWA 3AU6A 4DENA 8ICBA 4I8MA 2M2TA 2KI6B 1ZQDA 1ZQYA 3V0AB 3NBEA 2Z48A 5DB6A 5TZVA 3AJ6A 3NYBA 4IONA 5JMCA 3CA1A 1JTCA 4KLFA 2D44A 5D46A 1RY7A 1OU5A 5HRDA 4WC2A 4H75A 4NLZA 1S0CA 1MQ2A 4JRAA 1ZJMA 1R8CA 4FGFA 3MPPG 1AF9A 1NO5A 1RPLA 4NM1A 1ILR1 8ICWA 3AH2A 4GXKA 3VSFA 3P6JA 1M2TB 3C2MA 4OEGA 3H3AA 4GXIA 3H6SE 3HMYA 2I9GA 5GAQA 3JPQA 4O68A 4OAHA 4EBKA 3RJFA 1K5VA 5B3QA 1JQZA 2P66A 7ICVA 3HWTA 3RJGA 4UBCA 1FV2A 1J0SA 3S8JA 8ICLA 4DEPA 1DFCA 4UB2A 8ICCA 3AQKA 1TFYA 4WC5A 2GO2A 4G6JA 2WRYA 3V0BB 4LO1C 4I2BA 5DECA 1FN0A 5J2HA 4UAZA 3KMVA 4X4RA 3QR5A 3HIYA 1W3FA 3C5FA 4P0KA 2D23A 1FWUA 4ZFWB 4FO1A 2UUSA 4I4VA 1TTUA 8ICTA 3AU2A 1M16A 4EFQA 4LO2C 5CA7A 4PC4A 1Q1UA 3D7WB 9ICSA 1R8BA 3LLPA 8ICNA 2ESUA 4YN4A 1AVWB 1OQLB 2GZBA 4FHWA 4I4RA 3FJAA 3ZX7A 3B0XA 5I1BA 1DZDA 3O4OA 4EFRA 4LO0C 3PG0A 7ICSA 4J2SA 4HJJA 4IY8A 2FO1A 4QZCA 4M5DA 4RWQA 3CA5A 4QZAA 4AT7A 1SR4C 4YD2A 7ICPA 1ZQMA 1RG8A 3PMLA 4Z8SB 4I2HA 3V7KA 4K98A 7ICLA 1R8OA 2NM1A 4QZHA 1TVAA 5IIKA 8ICRA 5HHIA 2VU9A 9ILBA 2DR5A 4Z9WB 3JPRA 4JP0A 4RQ4A 4WBCA 4LO3A 3BADA 2D22A 2HHPA 3NVOA 4FVVA 2Y9FA 5BOMA 2ZQOA 2ZQNA 1JN3A 1ISZA 9ICKA 4EFPA 1ZQOA 4ISQA 2HWAA 1BPZA 3CRIA 5J2FA 1V6VA 1UEUA 1BPXA 1BPEA 1YYNA 4LZGA 4PGXA 1BPYA 4I2CA 1WD3A 2PXIA 3OGFA 3OUYB 1JY0A 5DSSB 2ZH2A 4I2SA 9ICLA 3FJJA 4KLIA 1JLYA 1Z2VA 3N7LA 4NXZA 4FHVA 4XJEA 4X4NA 8ICSA 3RJHA 4P4MA 4I2GA 4NXUA 3R4SA 3OGGA 2BEBA 1YXWA 2BBJA 8ICKA 3O4BA 4K8VA 4I4YA 4K9BA 3UDAA 2R9KB 4F5RA 3CAHA 3JUTA 3H6QA 3OV7A 1G9BA 1AXMA 4KB6A 1VJ7A 4RQ8A 3AQNA 4IQVA 3CRGA 3OJ2A 1JMSA 4JWNA 4ZBVB 3F62B 5BXSA 3UXPA 4P0LA 3HBWA 3HJ4A 9ICHA 1BFFA 4UB1A 4YCXA 2ISOA 1Z4SA 3A07A 4PHEA 3AQLA 4WC6A 1IOBA 2FGFA 4AT9A 7ICTA 4G9NA 3UXOA 4MF8A 2RFFA 4I0UA 4E8FA 1EVTA 4AN7B 4UAWA 2BCQA 4UB3A 4KLLA 1PUMB 5EG6C 2D43A 4EGWA 3O4AA 5CB1A 4RQ5A 1IJTA 9ICIA 2ERMA 3MCRA 1SZ6B 4ENDA 8ICEA 4OEFA 2YUGA 4YMNA 2Y9XE 4I37A 3HALA 5BXRA 4WQKA 2DS0A 1KEJA 4KLOA 4M9LA 3IAGC 3VEQA 1ZQBA 4O67A 4QC4A 4RWOA 4O5EA 4LEWA 2NP0A 4IY9A 4KLJA 2BPFA 1R8AA 4K4GA 1S0GA 4GP3A 3VWCA 4IQTA 4IYBA 3LK9A 2DVIA 4JWMA 2BCUA 3CU1B 2VLCA 3B9UA 4MFFA 7ICOA 4NLKA 2GA9D 4IZEA 2GAFD 4X0AA 4J2YA 1F5AA 5D62A 1ZQJA 2L5XA 1ZQRA 2PFQA 9ICEA 1L2HA 5D49A 5CWRA 4XFUA 1BFBA 3LTQA 4LEZA 2NS2A 3IM7A 3OJVA 4FHPA 8ICZA 3UXNA 4KLUA 4WC7A 4TUPA 1F31A 4YMOA 4I4SA 4R6UB 3AZVA 2ZH5A 4TURA 2WBCA 2HN1A 4QZEA 1MIWA 4CJMA 4O5KA 7ICNA 7ICQA 4G6MA 3WMUA 3OJMA 2F2FA 3OBTA 2Q3NB 4IG8A 4QZBA 4P4OA 2X2SA 2D20A 2W9MA 5FZYA 1AVXB 4GAFA 2FMSA 1TFMB 5J0XA 21BIA 4X38A 3ZXGA 4QZDA 4QZGA 2Y9GA 4R65A 8I1BA 4X0BA 4RT3A 9ICTA 9ICXA 4QD2C 4MF2A 1HUOA 1V6XA 4M9JA 1V4AA 3MALA 2VANA 3N0KA 1G82A 3FJHA 4KLSA 4WOYA 2BPGA 3AH4A 1XSLA 3ZC8A 4A7YA 4EP7A 3BAQA 5BP5C 4USPA 3CA3A 4NXXA 3JYYA 4G9MA 5CFSA 5CJ7A 1FWVA 7ICGA 3Q7WA 1JT3A 7ICIA 1MIYA 4X4UA 3FJCA 4UAYA 3UD7A 1XZZA 3VSZA 3VT2A 3O44A 3PUBA 9ICMA 3UPQA 4P4PA 8ICPA 9ICNA 2AFGA 1FA0A 2O5AA 3AJ5A 1TP0A 3NJ5A 4K96A 5J0WA 4I4OA 3HW8A 1FGAA 4FHXA 9ICFA 1IT0A 5IIJA 5IINA 1ZQZA 4RWPA 4WCWA 3FGMA 3PNCA 4KLEA 3OVAA 1BFGA 3BRDA 3JPPA 3NBDA 3BA7A 5CHGA 3FJ8A 3CRHA 2J3PA 3FJBA 2HW9A 2D7RA 4OW4A 3BA4A 1ZQVA 4TUSA 4QKSA 3MBYA 4UY4A 1ZQUA 3UJ0A 3H37A 3WO4A 3H39A 3WMVA 4NXVA 1QQLA 5F8WA 1ZQCA 1FV3A 3B0YA 4NLNA 4KLMA 4PH5A 8ICVA 3N7KA 4I4PA 5IIOA 4EEEB 3MDCA 4O5CA 4ZA3B 4O6AA 2ET2A 4KLGA 4H9WA 5DBBA 3O4CA 4R66A 2X2TA 1Q79A 3Q7YA 4F5QA 4QZ8A 1DJSB 4M9HA 5F2VO 5FNWA 1II4A 4XKIA 3OVBA 2D7IA 3N7JA 2ZH9A 4A7KA 4MFCA 4X4VA 3WFOA 2IHOA 5J0SA 4I2EA 4ATBB 1IHKA 5HC9A 4JKQA 4TLPA 1KDHA 1ISYA 3FFZA 4OWLA 4XQ7A 2KKIA 4GOYA 3T8SA 41BIA 1WOTA 5BXTA 2XOAA 4LO8B 2MIBA 3O5WB 2E4MA 2BCRA 4I2FA 5J2GA 2Y9WC 1SR4A 3FJKA 4UBBA 4EB2B 3BAOA 4MFAA 1TWMA 4MZFB 4DOBA 8ICAA 4X4PA 3V72A 5CFUA 5DB8A 5HREA 9ICGA 9ICUA 4UB5A 1V6UA 3FJDA 3WINC 4WBZA 5BOWA 5BQUA 5BPCA 1BLAA 5J0YA 5J0PA 3H6RB 3E8LC 4F5OA 5CHEA 4USOA 4IHZA 3ISDA 4K4HA 2KH2A 1I1EA 3HN1A 3IM5A 1DZCA 3AKGA 4D0ZA 9ICJA 3A23A 4O69A 3HX0A 3UQ0A 4LVSA 1UPSA 5G00A 4M47A 4X37A 4F34A 3BAUA 1S0EA 3JCFA 1Q78A 5B2HA 4L4IA 4DOAA 3UD8A 4Q91A 3JPNA 4K4IA 4AT8B 1ZQHA 3A22A 1S0DA 5DBCA 2BCVA 3V0BA 4QBCA 4OEEA 4JLXA 3BX1C 4PHPA 5DB9A 2DRYA 4TUQA 1XG6A 1XSNA 4UB4A
chains in the Genus database with same CATH topology
3HOMA 2QYIB 3LTQA 2NS2A 1KNMA 3POKA 3CA1A 4LEZA 1GPJA 1JTCA 3IM7A 3V0AA 3OJVA 4GP0A 2D44A 2AQZA 1P63A 1RY7A 3ZXDA 3ZC9A 4JQ0A 1HKNA 2E4MC 3C9ZA 1F31A 4I4SA 4R6UB 3AZVA 4H75A 1S0CA 2WBCA 4JRAA 2KLLA 1ISVA 1DQGA 4CJMA 7I1BA 4FGFA 1CVSA 4G6MA 3MPPG 3WMUA 1AF9A 3BTAA 3OJMA 4LO3C 2F2FA 3F1RA 3IIRA 3OBTA 3CA6A 1T4QA 2Q3NB 2FFVA 4HX0A 3A21A 1ILR1 3R4UA 3AH2A 1HIBA 1ONKB 1W3GA 4A7ZA 3VSFA 5D61A 2X2SA 1R8NA 2D20A 1M2TB 3P6JA 4II0A 4I4QA 2Q9XA 5FZYA 1AVXB 1RZOB 3I29B 4GAFA 4OEGA 4ZFUB 1TFMB 5EHAA 1D0HA 1JT4A 1N4KA 2DREA 3H6SE 3HMYA 5BQUC 21BIA 4X38A 3BAGA 3PMEA 3RMXA 3ZXGA 4QD2B 5GAQA 5FNXA 4O68A 4OAHA 1K5VA 3WINA 3NBNA 1BA7A 5B3QA 1JQZA 3OWGA 1FV2A 2B51A 4JPZA 1CE7B 1EYLA 2AXMA 1J0SA 1AVUA 3S8JA 2Y9GA 2LIEA 4KM5A 3AH1A 4LEVA 4DEPA 3O4DA 1DFCA 8I1BA 2IWTB 4QD2C 2GO2A 4G6JA 1V6XA 4K9AA 3CA4A 3O3QA 3RTJB 2WRYA 3MALA 1TIEA 3N0KA 3V0BB 3OBRA 4LO1C 1G82A 3FJHA 1IRAX 4WOYA 1E0OA 3AH4A 1FN0A 4KBBA 3KMVA 3QR5A 3NBCA 3ZC8A 1W3FA 4A7YA 4JAWA 4P0KA 2D23A 1FWUA 3BAQA 4ZFWB 4FO1A 2UUSA 4I1EA 4ZFYB 5BP5C 3FJIA 1MC9A 4I4VA 1TTUA 4MKPA 4USPA 1M16A 3CA3A 4LO2C 4EFQA 4NXXA 4LO7C 4PC4A 4JLZA 4WQLA 1Q1UA 4I1BA 3D7WB 4G9MA 1HCEA 5CFSA 1YF8B 4IZXA 2D1ZA 3LLPA 1FWVA 2NYYA 1FMZA 2ESUA 3Q7WA 3VT1A 2B56A 1JT3A 2EWRA 1AVWB 1OQLB 2GZBA 3FJCA 4X3AA 4D0TA 1WBAA 4I4RA 1BFCA 2MC2A 3FJAA 3UD7A 1XZZA 3VSZA 3VT2A 3O44A 3ZX7A 3PUBA 5I1BA 1DZDA 1WD4A 3K1XA 3O4OA 1DQOA 3RTIB 4EFRA 3HSMA 4LO0C 1PWAA 2FDBM 2RSTA 4I7IA 3PG0A 2D24A 2Z49A 1Q03A 2VXRA 4J2SA 1YTOA 1HWPB 4HJJA 3PHZA 2AFGA 2RG9B 4IY8A 4KEJA 4ISRA 3TC2A 1VCLA 2FO1A 3FUOA 3AJ5A 1TP0A 3NJ5A 4K96A 3CA5A 4I4OA 1SR4C 1FGAA 1XHBA 4J23B 4QKRA 1IT0A 4F83A 1PZZA 4KC3A 1RG8A 1XYFA 4P6AA 4Z8SB 2VSAA 3FGMA 4P0JA 2RQ9A 4K98A 2FCLA 1BFGA 1W3AA 1IRPA 1R8OA 1I1BA 2AAIB 3BRDA 3NBDA 3FJ9A 3BA7A 2NM1A 1QXMA 3BRFA 5JLVA 4ZKTB 3FJ8A 3CRHA 2F2FC 1TWEA 2J3PA 4I4XA 3FJBA 2HW9A 2D7RA 4KEKA 4OW4A 3BA4A 1AVAC 1Q04A 4X39A 5F8SA 3BAHA 2VU9A 5B3PA 3JRRA 9ILBA 3ERCC 4Z9WB 4JP0A 1DLLA 4LO3A 4QKSA 4WBCA 3BADA 4UY4A 2DRZA 2D22A 4OAFA 4FVVA 4GOVA 3UJ0A 2MLLB 1G9AA 2Y9FA 1G9CA 3WO4A 2ZQOA 2ZQNA 2K8RA 3WA1A 1ISZA 3WMVA 4NXVA 1QQLA 1G9DA 4JKXB 5F8WA 3FJFA 1FV3A 1ABRB 4WH5A 1YBIA 3N7KA 4HA2A 4EFPA 4I4PA 3BB2A 4ISQA 4OUJA 4EEEB 2BFHA 2HWAA 3CRIA 4ZA3B 4O6AA 1V6VA 2ET2A 4H9WA 1RMLA 2K4AB 3FUQA 3O4CA 1NUNA 31BIA 2P39A 2X2TA 1YYNA 4I4UA 4Q9PA 3Q7YA 4I3NA 4ZGRB 1WD3A 1DJSB 3H6RA 3OGFA 2QN4A 1JY0A 3BRGC 1HCDA 5DSSB 3AKHA 5FNWA 4I2SA 1II4A 3EF2A 1GGPB 3FJJA 4XKIA 1JLYA 3WO3A 1Z2VA 1AFCA 2FFUA 2NVHA 3N7MA 3N7LA 2D7IA 3ER8C 3N7JA 4XJEA 5BP5A 5DVHA 1ISWA 4A7KA 1DIWA 3V79C 5CFTA 5FZZA 4NXUA 5DUYA 4IQPA 2IHOA 5FZUA 2M49A 3R4SA 3OGGA 2BEBA 5BXPA 3O49A 1YXWA 1BASA 5F8YA 3O4BA 1IHKA 4K8VA 2HWMA 4I4YA 4JKQA 4K9BA 3UDAA 4TLPA 3NKUA 1ISYA 4QALA 2R9KB 3P53A 3FFZA 1ISXA 4OWLA 3CAHA 2I1BA 2KKIA 3CA0A 4GOYA 4MZGB 3T8SA 41BIA 3BAVA 3SNVA 3JUTA 5BXTA 2XOAA 3H6QA 2BEAA 4LO8B 2MIBA 1G9BA 3AKFA 1BLDA 1AXMA 2ZR1B 4KB6A 1HWMB 1JT5A 3O5WB 4MZHA 1PC8B 2E4MA 3I2AA 4I6IA 1FMMS 1WBCA 5E24E 3CRGA 4OWJA 4XFUA 2Y9WC 3OJ2A 3RMYA 1TOOA 1SR4A 3FJKA 4ZBVB 1S0FA 3F62B 4L4HA 5BXSA 2VSEA 4P0LA 6I1BA 4EB2B 3BAOA 1TWMA 3Q7XA 4ZOTA 3I2XA 4MZFB 3HBWA 4OWKA 3P6IA 4YOLA 1BFFA 4Q9GA 5CFUA 1Z4SA 3A07A 3UJ4A 1S0BA 2LIQA 1ITBA 1HWNB 1IOBA 2FGFA 4G9NA 5DZUA 1QQKA 1BARA 2HZ9A 3ILAA 3BA5A 1A8DA 1V6UA 3FJDA 1EVTA 3WINC 5BOWA 2NTDA 5BQUA 1EV2A 4AN7B 5HPZA 1BLAA 5D63A 3VUOA 4J2XA 2KI4A 1JLXA 1PUMB 5EG6C 2D43A 3AZWA 4XFSA 3H6RB 3IM6A 3O4AA 1T9FA 3E8LC 5BVPI 2NZ9A 5CHEA 5EC5A 1IJTA 4AN6A 4LEYA 4USOA 2ERMA 1JT7A 3MCRA 4ZLBB 4IHZA 1SZ6B 2VUAA 4ENDA 2KH2A 3VT0A 1I1EA 1IILA 3UD9A 3HN1A 4GAIA 4OEFA 2YUGA 1PUUB 4K99A 2Y9XE 4H04A 3ER9B 4QO3A 4OAGA 4I37A 4KEIA 3IM5A 4DCKC 3K7DA 1DZCA 3AKGA 3HALA 4D0ZA 2K43A 5BXRA 4WQKA 2DS0A 4G1RA 4J2KA 3A23A 3FJEA 4O69A 1NZKA 3IAGC 1UPSA 3VEQA 2P23A 4LO7B 4HR6C 4K97A 5G00A 4QC4A 4LO1A 4O67A 4I0YA 4X37A 5F90A 1DFQA 4F34A 3BAUA 2NP0A 4IY9A 4LEWA 1S0EA 1S0GA 4GP3A 3VWCA 3CQAA 3W9TA 2F8XC 1V6WA 4IYBA 1MD6A 4I96A 4EKXB 4D8HA 4QBVA 1FQ9A 5B2HA 4L4IA 1K5UA 1Z0HA 3S8KA 4NXTA 3UD8A 1EPWA 4LO2A 4Q91A 3CU1B 3A22A 4DENA 1S0DA 4I8MA 2B4VA 3V0BA 2VXTI 1HWOB 2VLCA 4NXWA 3QYDA 4QBCA 3B9UA 2KI6B 2GA9D 4OEEA 4JLXA 4IZEA 3V0AB 3NBEA 2Z48A 2GAFD 1S0LA 3BX1C 4XFTA 4J2YA 3RSJA 5D62A 2DRYA 2L5XA 4LO0A 3WO2A 1XG6A 3AJ6A 4N7RA 4IONA 5JMCA 1L2HA 4OAIZ 3AKIA 1BFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOM A;  2QYI B;  3LTQ A;  3POK A;  1KNM A;  3CA1 A;  1JTC A;  3IM7 A;  3V0A A;  3OJV A;  4GP0 A;  2D44 A;  2AQZ A;  1P63 A;  1RY7 A;  3ZXD A;  3ZC9 A;  4JQ0 A;  1HKN A;  2E4M C;  3C9Z A;  1F31 A;  4I4S A;  4R6U B;  3AZV A;  1S0C A;  2WBC A;  4JRA A;  2KLL A;  1ISV A;  1DQG A;  4CJM A;  7I1B A;  4FGF A;  1CVS A;  4G6M A;  3MPP G;  3WMU A;  1AF9 A;  3BTA A;  3OJM A;  4LO3 C;  2F2F A;  3F1R A;  3IIR A;  3OBT A;  3CA6 A;  1T4Q A;  2Q3N B;  2FFV A;  3A21 A;  1ILR 1;  3R4U A;  3AH2 A;  1HIB A;  1ONK B;  1W3G A;  4A7Z A;  3VSF A;  5D61 A;  2X2S A;  1R8N A;  2D20 A;  1M2T B;  3P6J A;  4II0 A;  4I4Q A;  2Q9X A;  5FZY A;  1AVX B;  1RZO B;  3I29 B;  4GAF A;  4OEG A;  4ZFU B;  1TFM B;  5EHA A;  1D0H A;  1JT4 A;  1N4K A;  2DRE A;  3H6S E;  3HMY A;  5BQU C;  21BI A;  4X38 A;  3BAG A;  3PME A;  3RMX A;  3ZXG A;  4QD2 B;  5GAQ A;  5FNX A;  1K5V A;  3WIN A;  3NBN A;  1BA7 A;  1JQZ A;  1FV2 A;  4JPZ A;  1CE7 B;  1EYL A;  2AXM A;  1J0S A;  1AVU A;  3S8J A;  2Y9G A;  2LIE A;  3AH1 A;  4DEP A;  3O4D A;  1DFC A;  8I1B A;  2IWT B;  4QD2 C;  2GO2 A;  4G6J A;  1V6X A;  3CA4 A;  3O3Q A;  3RTJ B;  2WRY A;  3MAL A;  1TIE A;  3N0K A;  3V0B B;  3OBR A;  4LO1 C;  1G82 A;  3FJH A;  1IRA X;  1E0O A;  3AH4 A;  1FN0 A;  4KBB A;  3KMV A;  3QR5 A;  3NBC A;  3ZC8 A;  1W3F A;  4A7Y A;  4JAW A;  4P0K A;  2D23 A;  1FWU A;  3BAQ A;  4ZFW B;  2UUS A;  4I1E A;  4ZFY B;  5BP5 C;  3FJI A;  1MC9 A;  4I4V A;  1TTU A;  4USP A;  1M16 A;  3CA3 A;  4LO2 C;  4EFQ A;  4LO7 C;  4PC4 A;  1Q1U A;  4I1B A;  3D7W B;  4G9M A;  1HCE A;  1YF8 B;  4IZX A;  2D1Z A;  3LLP A;  1FWV A;  2NYY A;  1FMZ A;  2ESU A;  3Q7W A;  3VT1 A;  1JT3 A;  1AVW B;  1OQL B;  2GZB A;  3FJC A;  4X3A A;  4D0T A;  1WBA A;  4I4R A;  1BFC A;  2MC2 A;  3FJA A;  3UD7 A;  1XZZ A;  3VSZ A;  3VT2 A;  3O44 A;  3ZX7 A;  3PUB A;  5I1B A;  1DZD A;  1WD4 A;  3K1X A;  3O4O A;  1DQO A;  3RTI B;  4EFR A;  3HSM A;  4LO0 C;  1PWA A;  2FDB M;  2RST A;  4I7I A;  3PG0 A;  2D24 A;  2Z49 A;  1Q03 A;  2VXR A;  4J2S A;  1YTO A;  1HWP B;  4HJJ A;  3PHZ A;  2AFG A;  2RG9 B;  4IY8 A;  4KEJ A;  4ISR A;  3TC2 A;  1VCL A;  2FO1 A;  3FUO A;  3AJ5 A;  1TP0 A;  3NJ5 A;  3CA5 A;  4I4O A;  1SR4 C;  1FGA A;  1XHB A;  4J23 B;  4QKR A;  1IT0 A;  4F83 A;  1PZZ A;  4KC3 A;  1RG8 A;  1XYF A;  4P6A A;  4Z8S B;  2VSA A;  3FGM A;  4P0J A;  2RQ9 A;  1BFG A;  1W3A A;  1IRP A;  1R8O A;  1I1B A;  2AAI B;  3BRD A;  3NBD A;  3FJ9 A;  3BA7 A;  2NM1 A;  1QXM A;  3BRF A;  5JLV A;  4ZKT B;  3FJ8 A;  3CRH A;  2F2F C;  1TWE A;  2J3P A;  4I4X A;  3FJB A;  2HW9 A;  2D7R A;  4KEK A;  4OW4 A;  3BA4 A;  1AVA C;  1Q04 A;  4X39 A;  5F8S A;  3BAH A;  2VU9 A;  3JRR A;  9ILB A;  4Z9W B;  4JP0 A;  1DLL A;  4LO3 A;  4QKS A;  4WBC A;  3BAD A;  2DRZ A;  2D22 A;  4FVV A;  4GOV A;  3UJ0 A;  2MLL B;  1G9A A;  2Y9F A;  1G9C A;  3WO4 A;  2ZQO A;  2ZQN A;  2K8R A;  3WA1 A;  1ISZ A;  3WMV A;  1QQL A;  1G9D A;  4JKX B;  5F8W A;  3FJF A;  1FV3 A;  1ABR B;  1YBI A;  3N7K A;  4HA2 A;  4EFP A;  4I4P A;  3BB2 A;  4ISQ A;  4OUJ A;  4EEE B;  2BFH A;  2HWA A;  3CRI A;  4ZA3 B;  1V6V A;  2ET2 A;  4H9W A;  1RML A;  2K4A B;  3FUQ A;  3O4C A;  1NUN A;  31BI A;  2P39 A;  2X2T A;  1YYN A;  4I4U A;  4Q9P A;  3Q7Y A;  4I3N A;  4ZGR B;  1WD3 A;  1DJS B;  3H6R A;  3OGF A;  2QN4 A;  1JY0 A;  3BRG C;  1HCD A;  5DSS B;  3AKH A;  5FNW A;  4I2S A;  1II4 A;  3EF2 A;  1GGP B;  3FJJ A;  4XKI A;  1JLY A;  3WO3 A;  1Z2V A;  1AFC A;  2FFU A;  2NVH A;  3N7M A;  3N7L A;  2D7I A;  3N7J A;  5BP5 A;  5DVH A;  1ISW A;  4A7K A;  1DIW A;  3V79 C;  5FZZ A;  5DUY A;  4IQP A;  2IHO A;  5FZU A;  2M49 A;  3R4S A;  3OGG A;  2BEB A;  5BXP A;  3O49 A;  1YXW A;  1BAS A;  5F8Y A;  3O4B A;  1IHK A;  2HWM A;  4I4Y A;  4JKQ A;  3UDA A;  4TLP A;  1ISY A;  4QAL A;  2R9K B;  3P53 A;  3FFZ A;  1ISX A;  4OWL A;  3CAH A;  2I1B A;  2KKI A;  3CA0 A;  4GOY A;  3T8S A;  41BI A;  3BAV A;  3SNV A;  3JUT A;  5BXT A;  2XOA A;  3H6Q A;  2BEA A;  4LO8 B;  2MIB A;  1G9B A;  3AKF A;  1BLD A;  1AXM A;  2ZR1 B;  1HWM B;  1JT5 A;  3O5W B;  1PC8 B;  2E4M A;  3I2A A;  4I6I A;  1FMM S;  1WBC A;  5E24 E;  3CRG A;  4OWJ A;  4XFU A;  2Y9W C;  3OJ2 A;  3RMY A;  1TOO A;  1SR4 A;  3FJK A;  4ZBV B;  1S0F A;  3F62 B;  4L4H A;  5BXS A;  2VSE A;  4P0L A;  6I1B A;  4EB2 B;  3BAO A;  1TWM A;  3Q7X A;  4ZOT A;  3I2X A;  3HBW A;  4OWK A;  3P6I A;  4YOL A;  1BFF A;  4Q9G A;  1Z4S A;  3A07 A;  3UJ4 A;  1S0B A;  2LIQ A;  1ITB A;  1HWN B;  1IOB A;  2FGF A;  4G9N A;  5DZU A;  1QQK A;  1BAR A;  2HZ9 A;  3ILA A;  3BA5 A;  1A8D A;  1V6U A;  3FJD A;  1EVT A;  3WIN C;  5BOW A;  2NTD A;  5BQU A;  1EV2 A;  4AN7 B;  5HPZ A;  1BLA A;  5D63 A;  3VUO A;  4J2X A;  2KI4 A;  1JLX A;  1PUM B;  5EG6 C;  2D43 A;  3AZW A;  4XFS A;  3H6R B;  3IM6 A;  3O4A A;  1T9F A;  3E8L C;  5BVP I;  2NZ9 A;  5EC5 A;  1IJT A;  4AN6 A;  4USO A;  2ERM A;  1JT7 A;  4ZLB B;  4IHZ A;  1SZ6 B;  2VUA A;  4END A;  2KH2 A;  3VT0 A;  1I1E A;  1IIL A;  3UD9 A;  3HN1 A;  4GAI A;  4OEF A;  2YUG A;  1PUU B;  2Y9X E;  4H04 A;  4QO3 A;  4I37 A;  4KEI A;  3IM5 A;  4DCK C;  1DZC A;  3AKG A;  3HAL A;  4D0Z A;  2K43 A;  5BXR A;  2DS0 A;  4G1R A;  4J2K A;  3A23 A;  3FJE A;  1NZK A;  3IAG C;  1UPS A;  3VEQ A;  2P23 A;  4LO7 B;  4HR6 C;  5G00 A;  4QC4 A;  4LO1 A;  4I0Y A;  4X37 A;  5F90 A;  1DFQ A;  4F34 A;  3BAU A;  2NP0 A;  4IY9 A;  1S0E A;  1S0G A;  4GP3 A;  3VWC A;  3CQA A;  3W9T A;  2F8X C;  1V6W A;  4IYB A;  1MD6 A;  4I96 A;  4EKX B;  4D8H A;  4QBV A;  1FQ9 A;  5B2H A;  4L4I A;  1K5U A;  1Z0H A;  3S8K A;  3UD8 A;  1EPW A;  4LO2 A;  4Q91 A;  3CU1 B;  3A22 A;  4DEN A;  1S0D A;  4I8M A;  3V0B A;  2VXT I;  1HWO B;  2VLC A;  3QYD A;  4QBC A;  3B9U A;  2KI6 B;  4OEE A;  4IZE A;  3V0A B;  3NBE A;  2Z48 A;  1S0L A;  3BX1 C;  4XFT A;  4J2Y A;  3RSJ A;  5D62 A;  2DRY A;  2L5X A;  4LO0 A;  3WO2 A;  1XG6 A;  3AJ6 A;  4ION A;  5JMC A;  1L2H A;  3AKI A;  1BFB A; 
#chains in the Genus database with same CATH topology
 3HOM A;  2QYI B;  3POK A;  3ISC A;  1ZQF A;  4GP0 A;  3RH4 A;  2M2V A;  4O9M A;  1HKN A;  3C5G A;  3RH5 A;  4Z6E A;  5DDY A;  3C18 A;  2KLL A;  4UD4 A;  1ISV A;  1DQG A;  7I1B A;  4KLD A;  1CVS A;  3JPT A;  3BTA A;  4PGQ A;  4EEB A;  3IIR A;  3CA6 A;  1T4Q A;  3R4U A;  1HIB A;  1ONK B;  7ICJ A;  1R8N A;  3RJI A;  7ICU A;  4I4Q A;  2Q9X A;  3UQ2 A;  3I29 B;  4NY8 A;  4ZFU B;  5EHA A;  1JT4 A;  2DRE A;  3BAG A;  3RMX A;  4M2Y A;  4QD2 B;  3RH6 A;  2Q66 A;  3OWG A;  5HRK A;  1EYL A;  2LIE A;  4KM5 A;  3WFR E;  4I2I A;  3AH1 A;  3O4D A;  4I29 A;  5J0R A;  3WFS C;  2DRA A;  2IWT B;  3GDX A;  3RTJ B;  2ZH7 A;  4KBB A;  3NBC A;  4RQ2 A;  4I1E A;  4ZFY B;  4NKU A;  1HCE A;  5HR9 A;  2NRK A;  8ICJ A;  2NYY A;  3VT1 A;  2B56 A;  4D0T A;  4RPX A;  1WD4 A;  3K1X A;  3OUY A;  2RST A;  2D24 A;  5J2I A;  3CK6 A;  2VXR A;  1YTO A;  3TC2 A;  3FUO A;  9ICB A;  4NKT A;  5DDM A;  3TFR A;  1XHB A;  4QKR A;  5J0O A;  4F83 A;  1PZZ A;  8ICH A;  1ZJN A;  1XYF A;  4P6A A;  4R64 A;  2VSA A;  4P0J A;  4FHY A;  2RQ9 A;  5D4B A;  1IRP A;  1TFW A;  1I1B A;  2AAI B;  5DBA A;  3FJ9 A;  9ICC A;  1QXM A;  1JAJ A;  9ICA A;  2F2F C;  1TWE A;  4I4X A;  4FH3 A;  4XQ8 A;  8ICF A;  4KEK A;  3WFP A;  1Q04 A;  5DB7 A;  5B3P A;  3JRR A;  1DLL A;  2DRZ A;  4RT2 A;  3MGH A;  4GOV A;  3RJE A;  2MLL B;  4WC3 A;  1G9C A;  3WA1 A;  2DRB A;  1G9D A;  4JKX B;  5BOL A;  4EED A;  1ABR B;  4WH5 A;  9ICW A;  5DKW A;  1YBI A;  3V7J A;  4HA2 A;  3UPS A;  2ISP A;  2FMP A;  2K4A B;  3FUQ A;  2BBH A;  31BI A;  4I4U A;  4Q9P A;  4FO6 A;  4X5V A;  1UEV A;  3WO3 A;  3OVS A;  2FFU A;  1AFC A;  2NVH A;  3N7M A;  5IIL A;  5BP5 A;  4RQ1 A;  4PHD A;  1ISW A;  1ZQK A;  3C66 A;  5CFT A;  5FZZ A;  4AT7 B;  2M49 A;  4I2J A;  7ICE A;  3K75 D;  2HWM A;  8ICY A;  9ICV A;  1ZQS A;  4QAL A;  1ISX A;  3SNV A;  2BEA A;  3AKF A;  4RQ7 A;  1BLD A;  8ICM A;  2ZR1 B;  1HWM B;  1JT5 A;  4MZH A;  4X4O A;  1PC8 B;  1FMM S;  1WBC A;  8ICQ A;  4OWJ A;  4QZI A;  4XA5 A;  1TOO A;  1S0F A;  4E7X A;  6I1B A;  2ZH1 A;  5J29 A;  4ZOT A;  5HRG A;  3I2X A;  2O1P A;  4RQ6 A;  4OWK A;  4YOL A;  4M0A A;  8ICU A;  4XUS A;  3MGI A;  5DED A;  7ICF A;  5J2B A;  1ITB A;  1HWN B;  4IQW A;  7ICM A;  4P2H A;  2M2W A;  1QQK A;  1XSP A;  2BCS A;  3BA5 A;  2BE3 A;  2NTD A;  1EV2 A;  5D63 A;  3VUO A;  4J2X A;  9ICO A;  2KI4 A;  1JLX A;  4M04 A;  1RZT A;  3AZW A;  1ZQT A;  3IM6 A;  3LQC B;  5EC5 A;  1JT7 A;  1TV9 A;  1IIL A;  4H04 A;  3ER9 B;  4PGY A;  3K7D A;  4G1R A;  4Z6D A;  1NZK A;  2DR7 A;  8ICO A;  2ZHA A;  4LO7 B;  4HR6 C;  4K97 A;  4LO1 A;  5F90 A;  1DFQ A;  5CR0 A;  4GXJ A;  4R63 A;  2F8X C;  1ZQG A;  4WC0 A;  1MD6 A;  4I96 A;  4EKX B;  3S8K A;  1Z0H A;  3NWI A;  4LO2 A;  1UET A;  1R89 A;  2B4V A;  2VXT I;  1HWO B;  4NXW A;  3QYD A;  3H38 A;  4WC4 A;  1PX5 A;  1S0L A;  4XFT A;  2PBE A;  3RSJ A;  4RQ3 A;  4LO0 A;  3WO2 A;  1ZQW A;  3AQM A;  4N7R A;  4OAI Z;  3AKI A;  3ZXD A;  1KNM A;  1GPJ A;  3V0A A;  2AQZ A;  1P63 A;  5J2A A;  3ZC9 A;  4JQ0 A;  3C9Z A;  2E4M C;  5HRF A;  2ZH6 A;  1JQR A;  4AT9 B;  5J0U A;  2BPC A;  5HRL A;  4EV6 A;  4LO3 C;  1ZQQ A;  3F1R A;  4I2D A;  4F5N A;  2FFV A;  4HX0 A;  3A21 A;  1KNY A;  1W3G A;  4A7Z A;  5D61 A;  4II0 A;  2ZH3 A;  1HUZ A;  1RZO B;  4KLT A;  1D0H A;  1N4K A;  5BQU C;  3PME A;  3C2L A;  4I28 A;  4FH5 A;  5FNX A;  4NM2 A;  4YMM A;  3NBN A;  3WIN A;  1BA7 A;  1ZQX A;  1ZQL A;  2B51 A;  4JPZ A;  1CE7 B;  2AXM A;  1AVU A;  4I2A A;  4LEV A;  1ZQN A;  4RQ0 A;  2ZH4 A;  4K9A A;  3CA4 A;  3O3Q A;  5J0T A;  1TIE A;  3OBR A;  4LZD A;  1IRA X;  1E0O A;  3ISB A;  9ICQ A;  4JAW A;  3FJI A;  1MC9 A;  4MKP A;  2FMQ A;  4LO7 C;  4JLZ A;  4WQL A;  4I1B A;  1YF8 B;  1ZQA A;  4IZX A;  2D1Z A;  5HRH A;  1FMZ A;  2EWR A;  4X4S A;  4X3A A;  4X4T A;  1WBA A;  1BFC A;  2MC2 A;  8ICX A;  3JZ0 A;  1MQ3 A;  1DQO A;  3RTI B;  3HSM A;  3AUO A;  1PWA A;  2FDB M;  3PMN A;  4I7I A;  2Z49 A;  1Q03 A;  3L9D A;  1HWP B;  4KEJ A;  3PHZ A;  2GWS A;  2RG9 B;  4ISR A;  1VCL A;  4DOC A;  4X4Q A;  4LT6 A;  4J23 B;  7ICK A;  4PHA A;  4WC1 A;  4KC3 A;  4ATB A;  1VFG A;  4UD5 A;  2FCL A;  2M2U A;  1W3A A;  4Z6F A;  4M9G A;  3BRF A;  5JLV A;  4ZKT B;  3RJK A;  7ICR A;  3MDA A;  1AVA C;  4X39 A;  5F8S A;  3BAH A;  3ERC C;  8ICG A;  1ZQP A;  4OAF A;  4PPX A;  1G9A A;  2PFP A;  4S3N A;  4RPZ A;  2PFN A;  2K8R A;  8ICI A;  3C2K A;  5EOZ A;  2ZHB A;  3FJF A;  2DR9 A;  5JTG A;  4DO9 A;  3BB2 A;  4OUJ A;  2BFH A;  1RML A;  5J2D A;  1NUN A;  2P39 A;  5J0Q A;  4I3N A;  2IUB A;  3V7L A;  4ZGR B;  3RJJ A;  3H6R A;  3OGU A;  2QN4 A;  5J2C A;  4RWN A;  3BRG C;  1HCD A;  1NOM A;  4Z6C A;  3AKH A;  4RPY A;  5J2K A;  3EF2 A;  1GGP B;  1BPD A;  2PFO A;  2ID1 A;  3ER8 C;  5DVH A;  4WBY A;  4KLH A;  1DIW A;  3V79 C;  5DUY A;  4IQP A;  5FZU A;  2IHM A;  5CP2 A;  5BXP A;  3O49 A;  1BAS A;  5F8Y A;  4F5P A;  3NKU A;  3P53 A;  5III A;  9ICR A;  2I1B A;  2DR8 A;  3CA0 A;  4AT8 A;  4MZG B;  3BAV A;  3JPS A;  3I2A A;  4I6I A;  5E24 E;  4EBJ A;  3RMY A;  4L4H A;  2VSE A;  7ICH A;  4QZ9 A;  4E80 A;  3Q7X A;  4YD1 A;  1BPB A;  3P6I A;  5HRB A;  4Q9G A;  3UJ4 A;  2HN2 A;  1S0B A;  2LIQ A;  3WFQ E;  5HRI A;  4IQU A;  2ZH8 A;  5DZU A;  5HHH A;  1BAR A;  2HZ9 A;  3ILA A;  1A8D A;  5HPZ A;  4I27 A;  4XFS A;  3JPO A;  1T9F A;  5BVP I;  2NZ9 A;  4XRH A;  4AN6 A;  4LEY A;  5IIM A;  3HJ1 A;  5J2E A;  9ICP A;  4ZLB B;  2VUA A;  3VT0 A;  3UD9 A;  4GAI A;  4K99 A;  1PUU B;  4QO3 A;  4OAG A;  4KEI A;  4M9N A;  4DCK C;  2K43 A;  1YLQ A;  1ZQI A;  4J2K A;  3FJE A;  4QZF A;  2P23 A;  4KLQ A;  3TFS A;  4I0Y A;  5J2J A;  1ZQE A;  3CQA A;  3W9T A;  1V6W A;  1MIV A;  4D8H A;  4QBV A;  1FQ9 A;  1K5U A;  4NXT A;  1EPW A;  3AU6 A;  4DEN A;  8ICB A;  4I8M A;  2M2T A;  2KI6 B;  1ZQD A;  1ZQY A;  3V0A B;  3NBE A;  2Z48 A;  5DB6 A;  5TZV A;  3AJ6 A;  3NYB A;  4ION A;  5JMC A;  3CA1 A;  1JTC A;  4KLF A;  2D44 A;  5D46 A;  1RY7 A;  1OU5 A;  5HRD A;  4WC2 A;  4H75 A;  4NLZ A;  1S0C A;  1MQ2 A;  4JRA A;  1ZJM A;  1R8C A;  4FGF A;  3MPP G;  1AF9 A;  1NO5 A;  1RPL A;  4NM1 A;  1ILR 1;  8ICW A;  3AH2 A;  4GXK A;  3VSF A;  3P6J A;  1M2T B;  3C2M A;  4OEG A;  3H3A A;  4GXI A;  3H6S E;  3HMY A;  2I9G A;  5GAQ A;  3JPQ A;  4O68 A;  4OAH A;  4EBK A;  3RJF A;  1K5V A;  5B3Q A;  1JQZ A;  2P66 A;  7ICV A;  3HWT A;  3RJG A;  4UBC A;  1FV2 A;  1J0S A;  3S8J A;  8ICL A;  4DEP A;  1DFC A;  4UB2 A;  8ICC A;  3AQK A;  1TFY A;  4WC5 A;  2GO2 A;  4G6J A;  2WRY A;  3V0B B;  4LO1 C;  4I2B A;  5DEC A;  1FN0 A;  5J2H A;  4UAZ A;  3KMV A;  4X4R A;  3QR5 A;  3HIY A;  1W3F A;  3C5F A;  4P0K A;  2D23 A;  1FWU A;  4ZFW B;  4FO1 A;  2UUS A;  4I4V A;  1TTU A;  8ICT A;  3AU2 A;  1M16 A;  4EFQ A;  4LO2 C;  5CA7 A;  4PC4 A;  1Q1U A;  3D7W B;  9ICS A;  1R8B A;  3LLP A;  8ICN A;  2ESU A;  4YN4 A;  1AVW B;  1OQL B;  2GZB A;  4FHW A;  4I4R A;  3FJA A;  3ZX7 A;  3B0X A;  5I1B A;  1DZD A;  3O4O A;  4EFR A;  4LO0 C;  3PG0 A;  7ICS A;  4J2S A;  4HJJ A;  4IY8 A;  2FO1 A;  4QZC A;  4M5D A;  4RWQ A;  3CA5 A;  4QZA A;  4AT7 A;  1SR4 C;  4YD2 A;  7ICP A;  1ZQM A;  1RG8 A;  3PML A;  4Z8S B;  4I2H A;  3V7K A;  4K98 A;  7ICL A;  1R8O A;  2NM1 A;  4QZH A;  1TVA A;  5IIK A;  8ICR A;  5HHI A;  2VU9 A;  9ILB A;  2DR5 A;  4Z9W B;  3JPR A;  4JP0 A;  4RQ4 A;  4WBC A;  4LO3 A;  3BAD A;  2D22 A;  2HHP A;  3NVO A;  4FVV A;  2Y9F A;  5BOM A;  2ZQO A;  2ZQN A;  1JN3 A;  1ISZ A;  9ICK A;  4EFP A;  1ZQO A;  4ISQ A;  2HWA A;  1BPZ A;  3CRI A;  5J2F A;  1V6V A;  1UEU A;  1BPX A;  1BPE A;  1YYN A;  4LZG A;  4PGX A;  1BPY A;  4I2C A;  1WD3 A;  2PXI A;  3OGF A;  3OUY B;  1JY0 A;  5DSS B;  2ZH2 A;  4I2S A;  9ICL A;  3FJJ A;  4KLI A;  1JLY A;  1Z2V A;  3N7L A;  4NXZ A;  4FHV A;  4XJE A;  4X4N A;  8ICS A;  3RJH A;  4P4M A;  4I2G A;  4NXU A;  3R4S A;  3OGG A;  2BEB A;  1YXW A;  2BBJ A;  8ICK A;  3O4B A;  4K8V A;  4I4Y A;  4K9B A;  3UDA A;  2R9K B;  4F5R A;  3CAH A;  3JUT A;  3H6Q A;  3OV7 A;  1G9B A;  1AXM A;  4KB6 A;  1VJ7 A;  4RQ8 A;  3AQN A;  4IQV A;  3CRG A;  3OJ2 A;  1JMS A;  4JWN A;  4ZBV B;  3F62 B;  5BXS A;  3UXP A;  4P0L A;  3HBW A;  3HJ4 A;  9ICH A;  1BFF A;  4UB1 A;  4YCX A;  2ISO A;  1Z4S A;  3A07 A;  4PHE A;  3AQL A;  4WC6 A;  1IOB A;  2FGF A;  4AT9 A;  7ICT A;  4G9N A;  3UXO A;  4MF8 A;  2RFF A;  4I0U A;  4E8F A;  1EVT A;  4AN7 B;  4UAW A;  2BCQ A;  4UB3 A;  4KLL A;  1PUM B;  5EG6 C;  2D43 A;  4EGW A;  3O4A A;  5CB1 A;  4RQ5 A;  1IJT A;  9ICI A;  2ERM A;  3MCR A;  1SZ6 B;  4END A;  8ICE A;  4OEF A;  2YUG A;  4YMN A;  2Y9X E;  4I37 A;  3HAL A;  5BXR A;  4WQK A;  2DS0 A;  1KEJ A;  4KLO A;  4M9L A;  3IAG C;  3VEQ A;  1ZQB A;  4O67 A;  4QC4 A;  4RWO A;  4O5E A;  4LEW A;  2NP0 A;  4IY9 A;  4KLJ A;  2BPF A;  1R8A A;  4K4G A;  1S0G A;  4GP3 A;  3VWC A;  4IQT A;  4IYB A;  3LK9 A;  2DVI A;  4JWM A;  2BCU A;  3CU1 B;  2VLC A;  3B9U A;  4MFF A;  7ICO A;  4NLK A;  2GA9 D;  4IZE A;  2GAF D;  4X0A A;  4J2Y A;  1F5A A;  5D62 A;  1ZQJ A;  2L5X A;  1ZQR A;  2PFQ A;  9ICE A;  1L2H A;  5D49 A;  5CWR A;  4XFU A;  1BFB A;  3LTQ A;  4LEZ A;  2NS2 A;  3IM7 A;  3OJV A;  4FHP A;  8ICZ A;  3UXN A;  4KLU A;  4WC7 A;  4TUP A;  1F31 A;  4YMO A;  4I4S A;  4R6U B;  3AZV A;  2ZH5 A;  4TUR A;  2WBC A;  2HN1 A;  4QZE A;  1MIW A;  4CJM A;  4O5K A;  7ICN A;  7ICQ A;  4G6M A;  3WMU A;  3OJM A;  2F2F A;  3OBT A;  2Q3N B;  4IG8 A;  4QZB A;  4P4O A;  2X2S A;  2D20 A;  2W9M A;  5FZY A;  1AVX B;  4GAF A;  2FMS A;  1TFM B;  5J0X A;  21BI A;  4X38 A;  3ZXG A;  4QZD A;  4QZG A;  2Y9G A;  4R65 A;  8I1B A;  4X0B A;  4RT3 A;  9ICT A;  9ICX A;  4QD2 C;  4MF2 A;  1HUO A;  1V6X A;  4M9J A;  1V4A A;  3MAL A;  2VAN A;  3N0K A;  1G82 A;  3FJH A;  4KLS A;  4WOY A;  2BPG A;  3AH4 A;  1XSL A;  3ZC8 A;  4A7Y A;  4EP7 A;  3BAQ A;  5BP5 C;  4USP A;  3CA3 A;  4NXX A;  3JYY A;  4G9M A;  5CFS A;  5CJ7 A;  1FWV A;  7ICG A;  3Q7W A;  1JT3 A;  7ICI A;  1MIY A;  4X4U A;  3FJC A;  4UAY A;  3UD7 A;  1XZZ A;  3VSZ A;  3VT2 A;  3O44 A;  3PUB A;  9ICM A;  3UPQ A;  4P4P A;  8ICP A;  9ICN A;  2AFG A;  1FA0 A;  2O5A A;  3AJ5 A;  1TP0 A;  3NJ5 A;  4K96 A;  5J0W A;  4I4O A;  3HW8 A;  1FGA A;  4FHX A;  9ICF A;  1IT0 A;  5IIJ A;  5IIN A;  1ZQZ A;  4RWP A;  4WCW A;  3FGM A;  3PNC A;  4KLE A;  3OVA A;  1BFG A;  3BRD A;  3JPP A;  3NBD A;  3BA7 A;  5CHG A;  3FJ8 A;  3CRH A;  2J3P A;  3FJB A;  2HW9 A;  2D7R A;  4OW4 A;  3BA4 A;  1ZQV A;  4TUS A;  4QKS A;  3MBY A;  4UY4 A;  1ZQU A;  3UJ0 A;  3H37 A;  3WO4 A;  3H39 A;  3WMV A;  4NXV A;  1QQL A;  5F8W A;  1ZQC A;  1FV3 A;  3B0Y A;  4NLN A;  4KLM A;  4PH5 A;  8ICV A;  3N7K A;  4I4P A;  5IIO A;  4EEE B;  3MDC A;  4O5C A;  4ZA3 B;  4O6A A;  2ET2 A;  4KLG A;  4H9W A;  5DBB A;  3O4C A;  4R66 A;  2X2T A;  1Q79 A;  3Q7Y A;  4F5Q A;  4QZ8 A;  1DJS B;  4M9H A;  5F2V O;  5FNW A;  1II4 A;  4XKI A;  3OVB A;  2D7I A;  3N7J A;  2ZH9 A;  4A7K A;  4MFC A;  4X4V A;  3WFO A;  2IHO A;  5J0S A;  4I2E A;  4ATB B;  1IHK A;  5HC9 A;  4JKQ A;  4TLP A;  1KDH A;  1ISY A;  3FFZ A;  4OWL A;  4XQ7 A;  2KKI A;  4GOY A;  3T8S A;  41BI A;  1WOT A;  5BXT A;  2XOA A;  4LO8 B;  2MIB A;  3O5W B;  2E4M A;  2BCR A;  4I2F A;  5J2G A;  2Y9W C;  1SR4 A;  3FJK A;  4UBB A;  4EB2 B;  3BAO A;  4MFA A;  1TWM A;  4MZF B;  4DOB A;  8ICA A;  4X4P A;  3V72 A;  5CFU A;  5DB8 A;  5HRE A;  9ICG A;  9ICU A;  4UB5 A;  1V6U A;  3FJD A;  3WIN C;  4WBZ A;  5BOW A;  5BQU A;  5BPC A;  1BLA A;  5J0Y A;  5J0P A;  3H6R B;  3E8L C;  4F5O A;  5CHE A;  4USO A;  4IHZ A;  3ISD A;  4K4H A;  2KH2 A;  1I1E A;  3HN1 A;  3IM5 A;  1DZC A;  3AKG A;  4D0Z A;  9ICJ A;  3A23 A;  4O69 A;  3HX0 A;  3UQ0 A;  4LVS A;  1UPS A;  5G00 A;  4M47 A;  4X37 A;  4F34 A;  3BAU A;  1S0E A;  3JCF A;  1Q78 A;  5B2H A;  4L4I A;  4DOA A;  3UD8 A;  4Q91 A;  3JPN A;  4K4I A;  4AT8 B;  1ZQH A;  3A22 A;  1S0D A;  5DBC A;  2BCV A;  3V0B A;  4QBC A;  4OEE A;  4JLX A;  3BX1 C;  4PHP A;  5DB9 A;  2DRY A;  4TUQ A;  1XG6 A;  1XSN A;  4UB4 A; 
#chains in the Genus database with same CATH homology
 3HOM A;  2QYI B;  3LTQ A;  2NS2 A;  1KNM A;  3POK A;  3CA1 A;  4LEZ A;  1GPJ A;  1JTC A;  3IM7 A;  3V0A A;  3OJV A;  4GP0 A;  2D44 A;  2AQZ A;  1P63 A;  1RY7 A;  3ZXD A;  3ZC9 A;  4JQ0 A;  1HKN A;  2E4M C;  3C9Z A;  1F31 A;  4I4S A;  4R6U B;  3AZV A;  4H75 A;  1S0C A;  2WBC A;  4JRA A;  2KLL A;  1ISV A;  1DQG A;  4CJM A;  7I1B A;  4FGF A;  1CVS A;  4G6M A;  3MPP G;  3WMU A;  1AF9 A;  3BTA A;  3OJM A;  4LO3 C;  2F2F A;  3F1R A;  3IIR A;  3OBT A;  3CA6 A;  1T4Q A;  2Q3N B;  2FFV A;  4HX0 A;  3A21 A;  1ILR 1;  3R4U A;  3AH2 A;  1HIB A;  1ONK B;  1W3G A;  4A7Z A;  3VSF A;  5D61 A;  2X2S A;  1R8N A;  2D20 A;  1M2T B;  3P6J A;  4II0 A;  4I4Q A;  2Q9X A;  5FZY A;  1AVX B;  1RZO B;  3I29 B;  4GAF A;  4OEG A;  4ZFU B;  1TFM B;  5EHA A;  1D0H A;  1JT4 A;  1N4K A;  2DRE A;  3H6S E;  3HMY A;  5BQU C;  21BI A;  4X38 A;  3BAG A;  3PME A;  3RMX A;  3ZXG A;  4QD2 B;  5GAQ A;  5FNX A;  4O68 A;  4OAH A;  1K5V A;  3WIN A;  3NBN A;  1BA7 A;  5B3Q A;  1JQZ A;  3OWG A;  1FV2 A;  2B51 A;  4JPZ A;  1CE7 B;  1EYL A;  2AXM A;  1J0S A;  1AVU A;  3S8J A;  2Y9G A;  2LIE A;  4KM5 A;  3AH1 A;  4LEV A;  4DEP A;  3O4D A;  1DFC A;  8I1B A;  2IWT B;  4QD2 C;  2GO2 A;  4G6J A;  1V6X A;  4K9A A;  3CA4 A;  3O3Q A;  3RTJ B;  2WRY A;  3MAL A;  1TIE A;  3N0K A;  3V0B B;  3OBR A;  4LO1 C;  1G82 A;  3FJH A;  1IRA X;  4WOY A;  1E0O A;  3AH4 A;  1FN0 A;  4KBB A;  3KMV A;  3QR5 A;  3NBC A;  3ZC8 A;  1W3F A;  4A7Y A;  4JAW A;  4P0K A;  2D23 A;  1FWU A;  3BAQ A;  4ZFW B;  4FO1 A;  2UUS A;  4I1E A;  4ZFY B;  5BP5 C;  3FJI A;  1MC9 A;  4I4V A;  1TTU A;  4MKP A;  4USP A;  1M16 A;  3CA3 A;  4LO2 C;  4EFQ A;  4NXX A;  4LO7 C;  4PC4 A;  4JLZ A;  4WQL A;  1Q1U A;  4I1B A;  3D7W B;  4G9M A;  1HCE A;  5CFS A;  1YF8 B;  4IZX A;  2D1Z A;  3LLP A;  1FWV A;  2NYY A;  1FMZ A;  2ESU A;  3Q7W A;  3VT1 A;  2B56 A;  1JT3 A;  2EWR A;  1AVW B;  1OQL B;  2GZB A;  3FJC A;  4X3A A;  4D0T A;  1WBA A;  4I4R A;  1BFC A;  2MC2 A;  3FJA A;  3UD7 A;  1XZZ A;  3VSZ A;  3VT2 A;  3O44 A;  3ZX7 A;  3PUB A;  5I1B A;  1DZD A;  1WD4 A;  3K1X A;  3O4O A;  1DQO A;  3RTI B;  4EFR A;  3HSM A;  4LO0 C;  1PWA A;  2FDB M;  2RST A;  4I7I A;  3PG0 A;  2D24 A;  2Z49 A;  1Q03 A;  2VXR A;  4J2S A;  1YTO A;  1HWP B;  4HJJ A;  3PHZ A;  2AFG A;  2RG9 B;  4IY8 A;  4KEJ A;  4ISR A;  3TC2 A;  1VCL A;  2FO1 A;  3FUO A;  3AJ5 A;  1TP0 A;  3NJ5 A;  4K96 A;  3CA5 A;  4I4O A;  1SR4 C;  1FGA A;  1XHB A;  4J23 B;  4QKR A;  1IT0 A;  4F83 A;  1PZZ A;  4KC3 A;  1RG8 A;  1XYF A;  4P6A A;  4Z8S B;  2VSA A;  3FGM A;  4P0J A;  2RQ9 A;  4K98 A;  2FCL A;  1BFG A;  1W3A A;  1IRP A;  1R8O A;  1I1B A;  2AAI B;  3BRD A;  3NBD A;  3FJ9 A;  3BA7 A;  2NM1 A;  1QXM A;  3BRF A;  5JLV A;  4ZKT B;  3FJ8 A;  3CRH A;  2F2F C;  1TWE A;  2J3P A;  4I4X A;  3FJB A;  2HW9 A;  2D7R A;  4KEK A;  4OW4 A;  3BA4 A;  1AVA C;  1Q04 A;  4X39 A;  5F8S A;  3BAH A;  2VU9 A;  5B3P A;  3JRR A;  9ILB A;  3ERC C;  4Z9W B;  4JP0 A;  1DLL A;  4LO3 A;  4QKS A;  4WBC A;  3BAD A;  4UY4 A;  2DRZ A;  2D22 A;  4OAF A;  4FVV A;  4GOV A;  3UJ0 A;  2MLL B;  1G9A A;  2Y9F A;  1G9C A;  3WO4 A;  2ZQO A;  2ZQN A;  2K8R A;  3WA1 A;  1ISZ A;  3WMV A;  4NXV A;  1QQL A;  1G9D A;  4JKX B;  5F8W A;  3FJF A;  1FV3 A;  1ABR B;  4WH5 A;  1YBI A;  3N7K A;  4HA2 A;  4EFP A;  4I4P A;  3BB2 A;  4ISQ A;  4OUJ A;  4EEE B;  2BFH A;  2HWA A;  3CRI A;  4ZA3 B;  4O6A A;  1V6V A;  2ET2 A;  4H9W A;  1RML A;  2K4A B;  3FUQ A;  3O4C A;  1NUN A;  31BI A;  2P39 A;  2X2T A;  1YYN A;  4I4U A;  4Q9P A;  3Q7Y A;  4I3N A;  4ZGR B;  1WD3 A;  1DJS B;  3H6R A;  3OGF A;  2QN4 A;  1JY0 A;  3BRG C;  1HCD A;  5DSS B;  3AKH A;  5FNW A;  4I2S A;  1II4 A;  3EF2 A;  1GGP B;  3FJJ A;  4XKI A;  1JLY A;  3WO3 A;  1Z2V A;  1AFC A;  2FFU A;  2NVH A;  3N7M A;  3N7L A;  2D7I A;  3ER8 C;  3N7J A;  4XJE A;  5BP5 A;  5DVH A;  1ISW A;  4A7K A;  1DIW A;  3V79 C;  5CFT A;  5FZZ A;  4NXU A;  5DUY A;  4IQP A;  2IHO A;  5FZU A;  2M49 A;  3R4S A;  3OGG A;  2BEB A;  5BXP A;  3O49 A;  1YXW A;  1BAS A;  5F8Y A;  3O4B A;  1IHK A;  4K8V A;  2HWM A;  4I4Y A;  4JKQ A;  4K9B A;  3UDA A;  4TLP A;  3NKU A;  1ISY A;  4QAL A;  2R9K B;  3P53 A;  3FFZ A;  1ISX A;  4OWL A;  3CAH A;  2I1B A;  2KKI A;  3CA0 A;  4GOY A;  4MZG B;  3T8S A;  41BI A;  3BAV A;  3SNV A;  3JUT A;  5BXT A;  2XOA A;  3H6Q A;  2BEA A;  4LO8 B;  2MIB A;  1G9B A;  3AKF A;  1BLD A;  1AXM A;  2ZR1 B;  4KB6 A;  1HWM B;  1JT5 A;  3O5W B;  4MZH A;  1PC8 B;  2E4M A;  3I2A A;  4I6I A;  1FMM S;  1WBC A;  5E24 E;  3CRG A;  4OWJ A;  4XFU A;  2Y9W C;  3OJ2 A;  3RMY A;  1TOO A;  1SR4 A;  3FJK A;  4ZBV B;  1S0F A;  3F62 B;  4L4H A;  5BXS A;  2VSE A;  4P0L A;  6I1B A;  4EB2 B;  3BAO A;  1TWM A;  3Q7X A;  4ZOT A;  3I2X A;  4MZF B;  3HBW A;  4OWK A;  3P6I A;  4YOL A;  1BFF A;  4Q9G A;  5CFU A;  1Z4S A;  3A07 A;  3UJ4 A;  1S0B A;  2LIQ A;  1ITB A;  1HWN B;  1IOB A;  2FGF A;  4G9N A;  5DZU A;  1QQK A;  1BAR A;  2HZ9 A;  3ILA A;  3BA5 A;  1A8D A;  1V6U A;  3FJD A;  1EVT A;  3WIN C;  5BOW A;  2NTD A;  5BQU A;  1EV2 A;  4AN7 B;  5HPZ A;  1BLA A;  5D63 A;  3VUO A;  4J2X A;  2KI4 A;  1JLX A;  1PUM B;  5EG6 C;  2D43 A;  3AZW A;  4XFS A;  3H6R B;  3IM6 A;  3O4A A;  1T9F A;  3E8L C;  5BVP I;  2NZ9 A;  5CHE A;  5EC5 A;  1IJT A;  4AN6 A;  4LEY A;  4USO A;  2ERM A;  1JT7 A;  3MCR A;  4ZLB B;  4IHZ A;  1SZ6 B;  2VUA A;  4END A;  2KH2 A;  3VT0 A;  1I1E A;  1IIL A;  3UD9 A;  3HN1 A;  4GAI A;  4OEF A;  2YUG A;  1PUU B;  4K99 A;  2Y9X E;  4H04 A;  3ER9 B;  4QO3 A;  4OAG A;  4I37 A;  4KEI A;  3IM5 A;  4DCK C;  3K7D A;  1DZC A;  3AKG A;  3HAL A;  4D0Z A;  2K43 A;  5BXR A;  4WQK A;  2DS0 A;  4G1R A;  4J2K A;  3A23 A;  3FJE A;  4O69 A;  1NZK A;  3IAG C;  1UPS A;  3VEQ A;  2P23 A;  4LO7 B;  4HR6 C;  4K97 A;  5G00 A;  4QC4 A;  4LO1 A;  4O67 A;  4I0Y A;  4X37 A;  5F90 A;  1DFQ A;  4F34 A;  3BAU A;  2NP0 A;  4IY9 A;  4LEW A;  1S0E A;  1S0G A;  4GP3 A;  3VWC A;  3CQA A;  3W9T A;  2F8X C;  1V6W A;  4IYB A;  1MD6 A;  4I96 A;  4EKX B;  4D8H A;  4QBV A;  1FQ9 A;  5B2H A;  4L4I A;  1K5U A;  1Z0H A;  3S8K A;  4NXT A;  3UD8 A;  1EPW A;  4LO2 A;  4Q91 A;  3CU1 B;  3A22 A;  4DEN A;  1S0D A;  4I8M A;  2B4V A;  3V0B A;  2VXT I;  1HWO B;  2VLC A;  4NXW A;  3QYD A;  4QBC A;  3B9U A;  2KI6 B;  2GA9 D;  4OEE A;  4JLX A;  4IZE A;  3V0A B;  3NBE A;  2Z48 A;  2GAF D;  1S0L A;  3BX1 C;  4XFT A;  4J2Y A;  3RSJ A;  5D62 A;  2DRY A;  2L5X A;  4LO0 A;  3WO2 A;  1XG6 A;  3AJ6 A;  4N7R A;  4ION A;  5JMC A;  1L2H A;  4OAI Z;  3AKI A;  1BFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...