5D61A

Moa-z-vad-fmk complex, direct orientation
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
292
structure length
292
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Unusual Member of the Papain Superfamily: Mapping the Catalytic Cleft of the Marasmius oreades agglutinin (MOA) with a Caspase Inhibitor.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Hydrolase
molecule keywords Agglutinin
total genus 92
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5d61A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5d61A02
4KEJA 3FJHA 1IHKA 1TWMA 2MIBA 5EC5A 3VUOA 4I7IA 4EEEB 4F83A 2F2FC 3OJ2A 2KKIA 4QKSA 1AXMA 4OUJA 1TTUA 1BLAA 5DSSB 4QD2C 2RQ9A 1VCLA 3UD7A 5EHAA 4QBVA 2KI6B 1ISWA 4JPZA 1D0HA 4J2SA 5DUYA 1DQOA 1XG6A 3CU1B 4J2YA 2UUSA 2VSAA 3LLPA 1ONKB 4WBCA 4QKRA 4I0YA 4G6MA 4USOA 2FFUA 2DS0A 3AJ5A 2NZ9A 1XHBA 3Q7XA 1T4QA 1V6WA 4L4IA 3QYDA 3O49A 3UD8A 1HKNA 41BIA 3OJMA 1QXMA 2P39A 3BAOA 4EFPA 1E0OA 4I3NA 1S0LA 2RG9B 3FJFA 3RMYA 1IRAX 1ITBA 1FMMS 1JT3A 1L2HA 2X2TA 8I1BA 1RG8A 1HWOB 4HJJA 1DZDA 1Z0HA 1SR4A 3I29B 5BP5A 4J2XA 1GGPB 4OWLA 3BAHA 4KEKA 3AZWA 4ZGRB 4AN6A 1FV2A 1W3FA 4D0ZA 3OGFA 3QR5A 1PZZA 3BRGC 2YUGA 3HBWA 4Q9GA 2KI4A 2Z48A 4ZFUB 1S0DA 3O4OA 3FJ9A 2FGFA 3K1XA 3N7MA 3I2XA 3IM7A 3VEQA 3BAQA 5F90A 4IZXA 4FVVA 4GP0A 1OQLB 3CA5A 2AQZA 4JRAA 1W3AA 5JMCA 5E24E 3BAUA 2IWTB 3R4SA 1PUUB 2D44A 4J2KA 3BA4A 1Z2VA 2E4MC 4HA2A 2L5XA 2NP0A 3WO4A 2HWMA 3IM5A 3FGMA 3AZVA 1AF9A 3O4DA 3E8LC 3AKGA 4IQPA 4GAIA 4ZKTB 1YTOA 2HW9A 3FUOA 5F8SA 5DZUA 1ISXA 1DLLA 2KH2A 2D23A 3FJKA 1AVUA 3HALA 1HWNB 4I96A 3R4UA 1JT7A 4I4OA 1A8DA 1QQKA 3RMXA 4I4QA 3BA7A 2NVHA 2LIQA 3A22A 4LO0A 4Z8SB 5FZZA 5D63A 4IY9A 1IRPA 2ZR1B 4ZOTA 1ABRB 1PWAA 3CRIA 4I4YA 3S8KA 5D62A 2WRYA 4ZFWB 1RMLA 1G9CA 1NUNA 2VSEA 3JUTA 4I2SA 2VXTI 2HWAA 1DFCA 4F34A 3A21A 1DFQA 1Q04A 3AH2A 2E4MA 3A07A 3CA6A 3AH4A 9ILBA 3FJCA 4ISRA 4LO1A 4A7KA 3D7WB 1M2TB 2K43A 4GOYA 5BOWA 3H6RB 3WO2A 4JKQA 1BLDA 2WBCA 1BFGA 3MPPG 3UJ0A 1BFFA 1Z4SA 1S0BA 4I4XA 3AH1A 1BFCA 1TIEA 4HR6C 3SNVA 2D7RA 4G9MA 1MD6A 4OEGA 3FJAA 4A7ZA 3T8SA 4ZBVB 2AAIB 3O3QA 1P63A 1Q1UA 3HN1A 4CJMA 1R8OA 3FUQA 4IYBA 2Y9XE 4ZFYB 2D22A 1YF8B 3F1RA 3I2AA 4XFSA 2X2SA 3KMVA 5F8YA 4FGFA 2GZBA 2D24A 3JRRA 1YBIA 3WINC 2MLLB 4D0TA 1HCDA 2DRYA 3C9ZA 1IJTA 4LO1C 1AVAC 3Q7YA 3NJ5A 4USPA 4IY8A 2DRZA 3OBTA 4P0LA 5FZYA 4OWJA 3O4BA 3FJBA 1S0GA 3IIRA 5BXPA 2BEBA 1RZOB 5BXRA 3PHZA 4IHZA 2ET2A 1S0CA 4X3AA 5BXSA 1W3GA 2F2FA 4Z9WB 1G82A 2VXRA 1SZ6B 3HMYA 1FV3A 3ZC8A 2AXMA 3AKHA 3F62B 2DREA 3VT0A 4EKXB 4LO7C 3ILAA 1S0FA 2QYIB 3P53A 2Z49A 2FO1A 1FWUA 2GO2A 5BQUC 1AVWB 3VSFA 1DQGA 4Q9PA 3EF2A 4KEIA 4X39A 1F31A 4I6IA 3CQAA 2NYYA 5B2HA 4GAFA 3RSJA 1JQZA 1BFBA 3CAHA 2RSTA 3IAGC 1PUMB 1V6VA 3O44A 2NM1A 3VSZA 1TP0A 3BB2A 3HSMA 3ZX7A 4OW4A 1ISYA 3WINA 4G9NA 3P6JA 5I1BA 1KNMA 5FZUA 1WBCA 4QBCA 1NZKA 2MC2A 3AKIA 4JKXB 4XKIA 1WD3A 7I1BA 4YOLA 3BAVA 1TFMB 3A23A 3B9UA 4I4UA 2M49A 1JTCA 4I4VA 3CA1A 5EG6C 1V6XA 5DVHA 3WO3A 4A7YA 4XFUA 3NBNA 5FNXA 2D1ZA 2HZ9A 1N4KA 4ISQA 4JP0A 4P6AA 1G9BA 3BRDA 3V0BA 4QO3A 3Q7WA 4P0JA 3O5WB 2K8RA 5GAQA 1WD4A 3MALA 2Q3NB 1EVTA 2Y9WC 4AN7B 1J0SA 5FNWA 1CE7B 1XZZA 3VWCA 2D7IA 1JLYA 1S0EA 4Q91A 4DEPA 3FJIA 5BP5C 2D43A 1SR4C 1JT5A 3BX1C 4LO8B 1JY0A 1DIWA 3OGGA 3CRGA 1I1BA 4LO3A 3VT2A 3LTQA 1G9AA 1JLXA 4PC4A 4JAWA 3V79C 3N7JA 2XOAA 3V0AA 3RTJB 4EB2B 4X38A 4ZLBB 3WMVA 1K5UA 3ZC9A 2NTDA 2P23A 1QQLA 3UJ4A 4I1BA 2VU9A 4GOVA 5D61A 3CA0A 3NBEA 3PMEA 4II0A 1IOBA 5F8WA 2BEAA 3H6QA 1TOOA 1FQ9A 3WMUA 4OEFA 4I4PA 4KC3A 21BIA 3N0KA 3TC2A 1II4A 4I4SA 4I37A 4J23B 4LO0C 1BASA 2KLLA 1ISVA 4QALA 1G9DA 2LIEA 2Y9GA 3FJ8A 4LO2A 4IONA 3FJJA 3HOMA 1HWMB 4H9WA 3FJDA 2FDBM 3BRFA 3FFZA 1XYFA 2VLCA 4I8MA 2I1BA 4LO7B 3NBCA 1CVSA 1FGAA 1AFCA 2Q9XA 2ERMA 1FN0A 1JT4A 1PC8B 4TLPA 3S8JA 2ESUA 4GP3A 1FMZA 4ZA3B 1IT0A 1YYNA 3AJ6A 4KBBA 3IM6A 1DJSB 1V6UA 3BADA 1IILA 2AFGA 3CRHA 1ISZA 1HWPB 31BIA 4DENA 2IHOA 3NBDA 2R9KB 1RY7A 2VUAA 3O4CA 3OJVA 4LO3C 4IZEA 1ILR1 3H6SE 4G1RA 1DZCA 4OEEA 1WBAA 3P6IA 2D20A 1BA7A 3POKA 4P0KA 1HCEA 3PUBA 4EFQA 3V0BB 1HIBA 2QN4A 3ZXDA 2K4AB 2F8XC 4EFRA 2ZQNA 1BARA 3BAGA 3VT1A 4XFTA 4L4HA 3O4AA 4R6UB 3UD9A 1K5VA 1R8NA 1T9FA 4D8HA 4G6JA 3RTIB 3UDAA 4QC4A 3N7KA 5JLVA 5G00A 1FWVA 1Q03A 4I4RA 1YXWA 1EYLA 3H6RA 5BVPI 1M16A 1EV2A 3AKFA 5BXTA 2ZQOA 3PG0A 2Y9FA 3CA3A 3ZXGA 5HPZA 6I1BA 2J3PA 1UPSA 1AVXB 3V0AB 1MC9A 4DCKC 1TWEA 2FFVA 1EPWA 4OWKA 4JQ0A 3OBRA 3BTAA 4QD2B 5BQUA 3W9TA 4LO2C 3FJEA 3WA1A 4ENDA 4H04A 3CA4A 2BFHA 3N7LA 3BA5A 4I1EA 4X37A 1I1EA
chains in the Genus database with same CATH superfamily
4I2HA 4M9JA 4KEJA 4MFAA 3FJHA 3PMLA 1BPZA 1IHKA 1TWMA 4MZHA 2MIBA 5EC5A 5HRGA 3AQNA 8ICXA 3VUOA 3PNCA 5HRLA 8ICRA 3RJJA 4I7IA 4EEEB 4F83A 9ICSA 3K75D 3PMNA 2F2FC 3OJ2A 4I27A 4IQTA 5HRBA 2KKIA 4QKSA 1AXMA 4OUJA 1TTUA 3RJFA 4RQ8A 1BLAA 5DSSB 4IQUA 4QD2C 4LZDA 4KLGA 2RQ9A 2ZH9A 5HR9A 1VCLA 3UD7A 1TVAA 5EHAA 4QBVA 2KI6B 5J0TA 3MGIA 1VFGA 1ZQNA 1ISWA 4JPZA 2HHPA 5CFUA 4PHDA 1D0HA 4J2SA 5DUYA 1FA0A 4YD2A 5J29A 4DOAA 1ZQJA 2BCUA 3RJKA 1DQOA 1XG6A 3CU1B 4UB3A 4J2YA 4R65A 4K9AA 2UUSA 1MQ3A 3RH6A 9ICIA 2VSAA 5J0QA 3LLPA 4UB5A 8ICTA 5J0PA 1ONKB 4WBCA 4NLNA 4QKRA 7ICFA 5CP2A 4FHVA 4I0YA 2GAFD 5J2GA 4G6MA 4KLLA 7ICIA 1KEJA 4USOA 2FFUA 4O6AA 3C2LA 4X4OA 9ICFA 2DS0A 3AJ5A 2NZ9A 1XHBA 3Q7XA 4PHAA 5CA7A 1T4QA 2ZH8A 4EP7A 8ICBA 1V6WA 4L4IA 4FHYA 3QYDA 3LQCB 3O49A 4I2JA 9ICEA 3UD8A 1HKNA 41BIA 3OJMA 1QXMA 2P39A 3BAOA 4EFPA 4FHPA 4RT2A 4PGQA 5IIMA 1E0OA 4I3NA 2EWRA 4K4HA 1S0LA 2RG9B 3FJFA 1BPBA 3RMYA 1IRAX 1ITBA 1FMMS 1JT3A 4UD5A 3AQMA 3NKUA 1L2HA 2X2TA 2BBJA 4UB2A 1ZJNA 8I1BA 2BCQA 4KLEA 1RG8A 2M2VA 1ZQKA 4X4VA 2VANA 8ICKA 5J0OA 2ZH4A 1NO5A 1HWOB 4HJJA 1DZDA 1Z0HA 4PH5A 1SR4A 3I29B 5EOZA 5BP5A 4I29A 4J2XA 7ICMA 1GGPB 1JN3A 2ZH3A 4OWLA 1MIYA 3BAHA 4KEKA 3AZWA 3JPTA 4ZGRB 4AN6A 9ICBA 1FV2A 4X4TA 1W3FA 4D0ZA 1ZQXA 3OGFA 3QR5A 3H39A 4M47A 1PZZA 3BRGC 4I2IA 5IIKA 2YUGA 3HBWA 8ICSA 4O69A 2PXIA 4Q9GA 5HRHA 5DBCA 2KI4A 2Z48A 4ZFUB 4LZGA 3L9DA 1S0DA 3O4OA 4N7RA 4Z6FA 4MZFB 3UXNA 3FJ9A 2FGFA 3K1XA 3N7MA 3I2XA 3IM7A 2ZH2A 3OWGA 3VEQA 3K7DA 1ZQWA 3BAQA 3TFRA 4O5EA 4AT7B 5J2BA 4MFFA 1ZQFA 5F90A 4IZXA 4FVVA 4OAFA 2O1PA 4UAWA 4GP0A 1OQLB 4KB6A 8ICEA 1ZQZA 4WC7A 3CA5A 2AQZA 3JPSA 8ICJA 4JRAA 1VJ7A 1W3AA 5JMCA 9ICWA 5E24E 3BAUA 2IWTB 3R4SA 4KLMA 1ZQHA 1PUUB 2D44A 4J2KA 3BA4A 1R8CA 2GA9D 4EGWA 3MDAA 4I0UA 1Z2VA 2E4MC 4HA2A 2L5XA 4R66A 2NP0A 8ICZA 3WO4A 2HWMA 3IM5A 4NXXA 3FGMA 1V4AA 1MQ2A 4M04A 1UEVA 3AZVA 4QZGA 4K4GA 1AF9A 3O4DA 3E8LC 4K98A 4FHXA 3WFPA 3AKGA 4IQPA 4GAIA 1ZQCA 4I28A 4ZKTB 2Q66A 3ERCC 1YTOA 3NYBA 4YMNA 4IQWA 4QZ8A 1TFWA 3AQKA 5IILA 2DRBA 2HW9A 3FUOA 5F8SA 4FO1A 5DZUA 1ISXA 4PHPA 4QZHA 1DLLA 5CHGA 4M9GA 3AQLA 4FHWA 2KH2A 5HRDA 2D23A 4XJEA 4WC5A 4LT6A 4NKTA 3FJKA 4E8FA 1AVUA 3HALA 5J0UA 1HWNB 4UB1A 7ICPA 4NXZA 4I96A 9ICTA 3R4UA 3V7KA 5B3QA 4P4MA 1JT7A 4I4OA 1ZQVA 3TFSA 1A8DA 2I9GA 4I2GA 1QQKA 3RMXA 4YMOA 4QZ9A 4I4QA 3BA7A 2NVHA 5DBAA 4NLZA 4IG8A 2LIQA 3A22A 5J2KA 4LO0A 4Z8SB 5FZZA 5D63A 4OAGA 7ICGA 5HC9A 3V7LA 4IY9A 1IRPA 2ZR1B 4ZOTA 4TURA 2IHMA 1ABRB 1PWAA 1ZQQA 2BE3A 3CRIA 3NWIA 8ICOA 4K8VA 5JTGA 2O5AA 4I4YA 3S8KA 5HRKA 4GXKA 3AUOA 5D62A 2WRYA 4ZFWB 3H38A 1RMLA 3OVAA 1G9CA 1NUNA 2VSEA 3JUTA 3JCFA 4NXUA 3ISBA 3JPQA 4JWNA 4P2HA 4I2SA 2VXTI 2HWAA 4WBYA 1DFCA 4F34A 5HHHA 3JPPA 9ICQA 3A21A 7ICTA 4M9LA 1DFQA 1Q04A 2DR5A 2NS2A 5J2DA 5J2FA 4X4PA 3AH2A 2E4MA 3A07A 3CA6A 3HIYA 4NXVA 3B0YA 5J2IA 4X0AA 2ISOA 4QZCA 3AH4A 9ILBA 5DDMA 4QZIA 1KDHA 3FJCA 4ISRA 4LO1A 4A7KA 5IIIA 3D7WB 1XSNA 1M2TB 8ICNA 4IQVA 2K43A 2PFNA 3JPRA 4GOYA 5CR0A 5BOWA 3H6RB 4UB4A 1ZQBA 4K97A 3WO2A 4XA5A 1XSPA 3JZ0A 9ICGA 4JKQA 1Q78A 1BLDA 2WBCA 1BFGA 3MPPG 5HRFA 9ICVA 5D49A 4DOBA 3UJ0A 9ICRA 4KLUA 1BFFA 1Z4SA 1S0BA 4I4XA 3AH1A 1BFCA 1TIEA 4HR6C 3SNVA 5J0RA 4TUQA 4NY8A 2D7RA 4WC4A 2PFOA 4RWNA 4G9MA 1MD6A 4OEGA 4XUSA 3FJAA 4A7ZA 1UEUA 2BPGA 1R8BA 1RZTA 3T8SA 4ZBVB 2AAIB 3O3QA 3NVOA 1ZQMA 4LVSA 9ICJA 1P63A 1Q1UA 3HN1A 4CJMA 4MFCA 7ICVA 3UXOA 1R8OA 2HN2A 4YCXA 4LEYA 3JPOA 4X5VA 3FUQA 4IYBA 2Y9XE 4ZFYB 4YD1A 2D22A 8ICCA 1YF8B 9ICLA 3F1RA 3I2AA 4XFSA 2X2SA 4X4QA 3KMVA 5F8YA 4FGFA 4EBKA 5BPCA 4GXJA 2GZBA 4AT8A 8ICUA 7ICSA 2D24A 3JRRA 2RFFA 4KLDA 1YBIA 3WINC 2GWSA 2MLLB 4D0TA 1HCDA 5DECA 4WC1A 2DRYA 4UAYA 1ZQOA 1ZQPA 4X4UA 4RQ2A 3C9ZA 1IJTA 7ICJA 4LO1C 4TUSA 1ZQTA 2IUBA 3OUYB 1AVAC 3Q7YA 3NJ5A 1Q79A 2FMQA 4USPA 1PX5A 4X4SA 4IY8A 4K99A 2DRZA 5D4BA 3OBTA 3RJHA 4P0LA 5FZYA 5HRIA 4OWJA 4WOYA 4P4OA 4I2FA 7ICLA 3O4BA 3FJBA 4M9HA 5CWRA 1S0GA 3IIRA 5BXPA 2BEBA 3C2MA 1RZOB 2M2UA 5BXRA 1F5AA 3ER8C 3PHZA 4IHZA 2ET2A 1S0CA 4X3AA 5BXSA 4AT7A 1W3GA 2PBEA 2F2FA 4Z9WB 4ATBA 4K96A 1G82A 2VXRA 1SZ6B 3HMYA 4O68A 2PFPA 4I2BA 9ICMA 1FV3A 3ZC8A 4KLSA 2AXMA 3AKHA 3HX0A 5DB8A 3F62B 4UBCA 2DREA 3VT0A 5DB7A 4EKXB 4JWMA 4KM5A 5DKWA 4LEVA 3MDCA 2BBHA 4AT9A 2BPCA 4LO7C 1NOMA 3ILAA 1S0FA 2QYIB 3P53A 5B3PA 5J2CA 2Z49A 1ZQUA 4YMMA 3RH4A 2FO1A 4WH5A 4EEDA 7ICRA 1FWUA 2GO2A 5BQUC 4PGYA 4DOCA 3RH5A 1AVWB 8ICYA 3VSFA 1DQGA 4Q9PA 3GDXA 4YN4A 3EF2A 4KEIA 4X39A 1F31A 4I6IA 7ICEA 5J0YA 3CQAA 2NYYA 5DDYA 5B2HA 5J2HA 4GAFA 3RSJA 8ICWA 4WQLA 1JQZA 3OVSA 4WCWA 1BFBA 7ICQA 3CAHA 2RSTA 3V7JA 3IAGC 1PUMB 1V6VA 3O44A 2NM1A 3VSZA 4AT8B 4R63A 4GXIA 1TP0A 3BB2A 3HSMA 3ZX7A 4P4PA 4OW4A 4I2EA 1ISYA 4JLZA 3C5FA 3WINA 4G9NA 3OUYA 3P6JA 2ZHBA 1TV9A 9ICXA 5I1BA 1KNMA 5FZUA 1WBCA 3OGUA 4QBCA 1NZKA 2NRKA 4MZGB 5TZVA 4WBZA 2MC2A 3AKIA 4JKXB 4XKIA 4RQ5A 1XSLA 1HUOA 5J0WA 3V72A 1WD3A 7I1BA 4XRHA 4XQ7A 2DR7A 4YOLA 5D46A 5DB9A 3BAVA 1TFMB 3A23A 3B9UA 4I4UA 1R89A 2B56A 2FMPA 2M49A 1JTCA 2HN1A 4I4VA 1ZJMA 3CA1A 5EG6C 1V6XA 4I2DA 5DVHA 3WO3A 4A7YA 4XFUA 3NBNA 5J2EA 1BPXA 4KLJA 5FNXA 5IIOA 2D1ZA 5IIJA 4K9BA 4Z6CA 3JYYA 3WFRE 2HZ9A 8ICFA 1N4KA 4ISQA 4JP0A 4P6AA 1G9BA 3BRDA 1JMSA 3MBYA 4RQ7A 3V0BA 7ICHA 5CFSA 4QO3A 4E80A 1JAJA 1OU5A 4RPXA 3Q7WA 5HREA 4P0JA 4I2AA 5CHEA 4JLXA 3O5WB 4QZBA 2K8RA 5GAQA 4QZAA 1WD4A 2BCRA 3MALA 2Q3NB 4UD4A 1EVTA 2Y9WC 8ICQA 4AN7B 1J0SA 3RJGA 5FNWA 1CE7B 2DVIA 5CFTA 4UAZA 1XZZA 3VWCA 2D7IA 1JLYA 1S0EA 4Q91A 3MCRA 5F2VO 3ER9B 2ZH5A 4F5RA 4DEPA 3FJIA 5BP5C 2D43A 1SR4C 2BCVA 5J0SA 1HUZA 2DR9A 4S3NA 4DO9A 3OVBA 1JT5A 2FMSA 3BX1C 4LO8B 4EEBA 1JY0A 9ICUA 1DIWA 3OGGA 3CRGA 1I1BA 3C18A 4LO3A 3VT2A 3LTQA 1G9AA 1JLXA 2ID1A 4PC4A 4JAWA 3V79C 3ISCA 4KLTA 3N7JA 2XOAA 3V0AA 1ZQEA 3RTJB 2DRAA 4EB2B 4X38A 4ZLBB 4FH5A 4MKPA 8ICGA 3WMVA 1K5UA 3ZC9A 2BCSA 8ICIA 4F5PA 3UPQA 9ICHA 2NTDA 2P23A 1QQLA 3UJ4A 4I1BA 2VU9A 4GOVA 5D61A 3LK9A 4F5QA 8ICLA 3CA0A 3NBEA 3PMEA 4II0A 3H3AA 3OV7A 4NM2A 1IOBA 5F8WA 5BOMA 2BEAA 3H6QA 1TOOA 1FQ9A 3WMUA 4M0AA 4X4NA 9ICPA 4OEFA 1JQRA 2ZH6A 4I4PA 4KC3A 21BIA 3N0KA 3TC2A 4WC0A 1II4A 4I4SA 3HJ4A 5J0XA 4WC3A 4I37A 2FCLA 4I2CA 4LEWA 4NXWA 5BOLA 4J23B 3C2KA 4LO0C 1BASA 2KLLA 1BPEA 1UETA 1ISVA 4QALA 1TFYA 1G9DA 2LIEA 2Y9GA 3FJ8A 4LO2A 3MGHA 4IONA 1ZQLA 8ICMA 4QZEA 3FJJA 3HOMA 1HWMB 4H9WA 3FJDA 2FDBM 3BRFA 3FFZA 4QZDA 1XYFA 2VLCA 5DEDA 4KLIA 4I8MA 5J2AA 2BPFA 2I1BA 4LO7B 3NBCA 3RJEA 1CVSA 1ZQYA 4OAHA 1FGAA 5CJ7A 4O5CA 4MF2A 1AFCA 4XQ8A 1BPYA 3AU2A 4ATBB 2Q9XA 2ERMA 4KLQA 1FN0A 1JT4A 1PC8B 4TLPA 5HHIA 3S8JA 2ESUA 4RQ0A 4KLOA 4RQ6A 4GP3A 1ZQRA 1FMZA 1ZQAA 4R64A 2B4VA 4M5DA 4ZA3B 1IT0A 1YYNA 3AJ6A 4KBBA 4O9MA 8ICVA 3IM6A 1DJSB 1V6UA 3BADA 1IILA 2AFGA 3CRHA 1YLQA 4WC6A 1ISZA 1HWPB 4WC2A 4FO6A 4F5NA 31BIA 4LEZA 3HWTA 9ICAA 4DENA 8ICAA 2IHOA 3NBDA 2R9KB 1RY7A 2VUAA 4E7XA 3O4CA 3OJVA 4RQ1A 4MF8A 4M9NA 4O5KA 1R8AA 4RWOA 3UPSA 4LO3C 1RPLA 4IZEA 1ILR1 3H6SE 3WFQE 4G1RA 9ICOA 1DZCA 4OEEA 1WBAA 3P6IA 3UXPA 4X0BA 2D20A 1MIWA 1BA7A 3POKA 4P0KA 4RQ4A 3UQ2A 1HCEA 7ICOA 3PUBA 4EFQA 3V0BB 4H75A 1HIBA 2QN4A 3ZXDA 2K4AB 2F8XC 1BPDA 4HX0A 4QZFA 4RPZA 2PFQA 4NLKA 7ICKA 4RQ3A 3RJIA 3HJ1A 4EFRA 2ZQNA 1ZQDA 7ICNA 5DB6A 1BARA 3BAGA 3ISDA 1GPJA 3C66A 3VT1A 4RT3A 5J2JA 4Z6EA 4UY4A 1ZQIA 2ISPA 4XFTA 4L4HA 3O4AA 4R6UB 3UD9A 2M2TA 9ICKA 9ICCA 1K5VA 1R8NA 1T9FA 4D8HA 3C5GA 4G6JA 4NM1A 3RTIB 3UDAA 4QC4A 4FH3A 4PGXA 2P66A 3N7KA 4RWPA 5JLVA 5G00A 1FWVA 3HW8A 1Q03A 4I4RA 8ICPA 4WQKA 1YXWA 1KNYA 4K4IA 1EYLA 4EBJA 4KLFA 3H6RA 5BVPI 1M16A 4M2YA 1EV2A 3AKFA 5BXTA 4O67A 2B51A 7ICUA 2ZQOA 3PG0A 4RWQA 2ZH1A 2Y9FA 3CA3A 4AT9B 1ZQSA 9ICNA 1WOTA 4RPYA 4EV6A 3ZXGA 5HPZA 8ICHA 6I1BA 2J3PA 5CB1A 2ZH7A 1UPSA 1AVXB 3V0AB 1MC9A 4DCKC 1TWEA 2FFVA 1EPWA 4OWKA 3WFSC 2M2WA 4JQ0A 2W9MA 3JPNA 4F5OA 4TUPA 3OBRA 2ZHAA 3BTAA 3AU6A 2DR8A 4OAIZ 4QD2B 3WFOA 4Z6DA 1ZQGA 5BQUA 4NKUA 3W9TA 4LO2C 3FJEA 3WA1A 4ENDA 4H04A 3CK6A 5DBBA 4UBBA 3UQ0A 4PPXA 4PHEA 3CA4A 4KLHA 2BFHA 3B0XA 5IINA 3N7LA 4X4RA 1MIVA 3H37A 3BA5A 4I1EA 4X37A 4NXTA 1I1EA
chains in the Genus database with same CATH topology
4KEJA 3FJHA 1IHKA 1TWMA 4MZHA 2MIBA 5EC5A 3VUOA 4I7IA 4EEEB 4F83A 2F2FC 3OJ2A 2KKIA 4QKSA 1AXMA 4OUJA 1TTUA 1BLAA 5DSSB 4QD2C 2RQ9A 1VCLA 3UD7A 5EHAA 4QBVA 2KI6B 1ISWA 4JPZA 5CFUA 1D0HA 4J2SA 5DUYA 1DQOA 1XG6A 3CU1B 4K9AA 4J2YA 2UUSA 2VSAA 3LLPA 1ONKB 4WBCA 4QKRA 4I0YA 2GAFD 4G6MA 4USOA 2FFUA 4O6AA 2DS0A 3AJ5A 2NZ9A 1XHBA 3Q7XA 1T4QA 1V6WA 4L4IA 3QYDA 3O49A 3UD8A 1HKNA 41BIA 3OJMA 1QXMA 2P39A 3BAOA 4EFPA 1E0OA 4I3NA 2EWRA 1S0LA 2RG9B 3FJFA 3RMYA 1IRAX 1ITBA 1FMMS 1JT3A 3NKUA 1L2HA 2X2TA 8I1BA 1RG8A 1HWOB 4HJJA 1DZDA 1Z0HA 1SR4A 3I29B 5BP5A 4J2XA 1GGPB 4OWLA 3BAHA 4KEKA 3AZWA 4ZGRB 4AN6A 1FV2A 1W3FA 4D0ZA 3OGFA 3QR5A 1PZZA 3BRGC 2YUGA 3HBWA 4O69A 4Q9GA 2KI4A 2Z48A 4ZFUB 1S0DA 3O4OA 4N7RA 4MZFB 3FJ9A 2FGFA 3K1XA 3N7MA 3I2XA 3IM7A 3OWGA 3VEQA 3K7DA 3BAQA 5F90A 4IZXA 4FVVA 4OAFA 4KB6A 4GP0A 1OQLB 3CA5A 2AQZA 4JRAA 1W3AA 5JMCA 5E24E 3BAUA 2IWTB 3R4SA 1PUUB 2D44A 4J2KA 3BA4A 2GA9D 1Z2VA 2E4MC 4HA2A 2L5XA 2NP0A 3WO4A 2HWMA 3IM5A 4NXXA 3FGMA 3AZVA 1AF9A 3O4DA 3E8LC 4K98A 3AKGA 4IQPA 4GAIA 4ZKTB 3ERCC 1YTOA 2HW9A 3FUOA 5F8SA 4FO1A 5DZUA 1ISXA 1DLLA 2KH2A 2D23A 4XJEA 3ER8C 3FJKA 1AVUA 3HALA 1HWNB 4I96A 3R4UA 5B3QA 1JT7A 4I4OA 1A8DA 1QQKA 3RMXA 4I4QA 3BA7A 2NVHA 2LIQA 3A22A 4LO0A 4Z8SB 5FZZA 5D63A 4OAGA 4IY9A 1IRPA 2ZR1B 4ZOTA 1ABRB 1PWAA 3CRIA 4K8VA 4I4YA 3S8KA 5D62A 2WRYA 4ZFWB 1RMLA 1G9CA 1NUNA 2VSEA 3JUTA 4NXUA 4I2SA 2VXTI 2HWAA 1DFCA 4F34A 3A21A 1DFQA 1Q04A 2NS2A 3AH2A 2E4MA 3A07A 3CA6A 4NXVA 3AH4A 9ILBA 3FJCA 4ISRA 4LO1A 4A7KA 3D7WB 1M2TB 2K43A 4GOYA 5BOWA 3H6RB 4K97A 3WO2A 4JKQA 1BLDA 2WBCA 1BFGA 3MPPG 3UJ0A 1BFFA 1Z4SA 1S0BA 4I4XA 3AH1A 1BFCA 1TIEA 4HR6C 3SNVA 2D7RA 4G9MA 1MD6A 4OEGA 3FJAA 4A7ZA 3T8SA 4ZBVB 2AAIB 3O3QA 1P63A 1Q1UA 3HN1A 4CJMA 1R8OA 4LEYA 3FUQA 4IYBA 2Y9XE 4ZFYB 2D22A 1YF8B 3F1RA 3I2AA 4XFSA 2X2SA 3KMVA 5F8YA 4FGFA 2GZBA 2D24A 3JRRA 1YBIA 3WINC 2MLLB 4D0TA 1HCDA 2DRYA 3C9ZA 1IJTA 4LO1C 1AVAC 3Q7YA 3NJ5A 4USPA 4IY8A 4K99A 2DRZA 3OBTA 4P0LA 5FZYA 4OWJA 4WOYA 3O4BA 3FJBA 1S0GA 3IIRA 5BXPA 2BEBA 1RZOB 5BXRA 3PHZA 4IHZA 2ET2A 1S0CA 4X3AA 5BXSA 1W3GA 4K96A 2F2FA 4Z9WB 1G82A 2VXRA 1SZ6B 3HMYA 4O68A 1FV3A 3ZC8A 2AXMA 3AKHA 3F62B 2DREA 3VT0A 4EKXB 4KM5A 4LEVA 4LO7C 3ILAA 1S0FA 2QYIB 3P53A 5B3PA 2Z49A 2FO1A 4WH5A 1FWUA 2GO2A 5BQUC 1AVWB 3VSFA 1DQGA 4Q9PA 3EF2A 4KEIA 4X39A 1F31A 4I6IA 3CQAA 2NYYA 5B2HA 4GAFA 3RSJA 4WQLA 1JQZA 1BFBA 3CAHA 2RSTA 3IAGC 1PUMB 1V6VA 3O44A 2NM1A 3VSZA 1TP0A 3BB2A 3HSMA 3ZX7A 4OW4A 1ISYA 4JLZA 3WINA 4G9NA 3P6JA 5I1BA 1KNMA 5FZUA 1WBCA 4QBCA 1NZKA 4MZGB 2MC2A 3AKIA 4JKXB 4XKIA 1WD3A 7I1BA 4YOLA 3BAVA 1TFMB 3A23A 3B9UA 4I4UA 2B56A 2M49A 1JTCA 4I4VA 3CA1A 5EG6C 1V6XA 5DVHA 3WO3A 4A7YA 4XFUA 3NBNA 5FNXA 2D1ZA 4K9BA 2HZ9A 1N4KA 4ISQA 4JP0A 4P6AA 1G9BA 3BRDA 3V0BA 5CFSA 4QO3A 3Q7WA 4P0JA 5CHEA 4JLXA 3O5WB 2K8RA 5GAQA 1WD4A 3MALA 2Q3NB 1EVTA 2Y9WC 4AN7B 1J0SA 5FNWA 1CE7B 5CFTA 1XZZA 3VWCA 2D7IA 1JLYA 1S0EA 4Q91A 3MCRA 3ER9B 4DEPA 3FJIA 5BP5C 2D43A 1SR4C 1JT5A 3BX1C 4LO8B 1JY0A 1DIWA 3OGGA 3CRGA 1I1BA 4LO3A 3VT2A 3LTQA 1G9AA 1JLXA 4PC4A 4JAWA 3V79C 3N7JA 2XOAA 3V0AA 3RTJB 4EB2B 4X38A 4ZLBB 4MKPA 3WMVA 1K5UA 3ZC9A 2NTDA 2P23A 1QQLA 3UJ4A 4I1BA 2VU9A 4GOVA 5D61A 3CA0A 3NBEA 3PMEA 4II0A 1IOBA 5F8WA 2BEAA 3H6QA 1TOOA 1FQ9A 3WMUA 4OEFA 4I4PA 4KC3A 21BIA 3N0KA 3TC2A 1II4A 4I4SA 4I37A 2FCLA 4LEWA 4NXWA 4J23B 4LO0C 1BASA 2KLLA 1ISVA 4QALA 1G9DA 2LIEA 2Y9GA 3FJ8A 4LO2A 4IONA 3FJJA 3HOMA 1HWMB 4H9WA 3FJDA 2FDBM 3BRFA 3FFZA 1XYFA 2VLCA 4I8MA 2I1BA 4LO7B 3NBCA 1CVSA 4OAHA 1FGAA 1AFCA 2Q9XA 2ERMA 1FN0A 1JT4A 1PC8B 4TLPA 3S8JA 2ESUA 4GP3A 1FMZA 2B4VA 4ZA3B 1IT0A 1YYNA 3AJ6A 4KBBA 3IM6A 1DJSB 1V6UA 3BADA 1IILA 2AFGA 3CRHA 1ISZA 1HWPB 4LEZA 31BIA 4DENA 2IHOA 3NBDA 2R9KB 1RY7A 2VUAA 3O4CA 3OJVA 4LO3C 4IZEA 1ILR1 3H6SE 4G1RA 1DZCA 4OEEA 1WBAA 3P6IA 2D20A 1BA7A 3POKA 4P0KA 1HCEA 3PUBA 4EFQA 3V0BB 4H75A 1HIBA 2QN4A 3ZXDA 2K4AB 2F8XC 4HX0A 4EFRA 2ZQNA 1BARA 3BAGA 1GPJA 3VT1A 4UY4A 4XFTA 4L4HA 3O4AA 4R6UB 3UD9A 1K5VA 1R8NA 1T9FA 4D8HA 4G6JA 3RTIB 3UDAA 4QC4A 3N7KA 5JLVA 5G00A 1FWVA 1Q03A 4I4RA 4WQKA 1YXWA 1EYLA 3H6RA 5BVPI 1M16A 1EV2A 3AKFA 5BXTA 4O67A 2B51A 2ZQOA 3PG0A 2Y9FA 3CA3A 3ZXGA 5HPZA 6I1BA 2J3PA 1UPSA 1AVXB 3V0AB 1MC9A 4DCKC 1TWEA 2FFVA 1EPWA 4OWKA 4JQ0A 3OBRA 3BTAA 4OAIZ 4QD2B 5BQUA 3W9TA 4LO2C 3FJEA 3WA1A 4ENDA 4H04A 3CA4A 2BFHA 3N7LA 3BA5A 4I1EA 4X37A 4NXTA 1I1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KEJ A;  3FJH A;  1IHK A;  1TWM A;  2MIB A;  5EC5 A;  3VUO A;  4I7I A;  4EEE B;  4F83 A;  2F2F C;  3OJ2 A;  2KKI A;  4QKS A;  1AXM A;  4OUJ A;  1TTU A;  1BLA A;  5DSS B;  4QD2 C;  2RQ9 A;  1VCL A;  3UD7 A;  5EHA A;  4QBV A;  2KI6 B;  1ISW A;  4JPZ A;  1D0H A;  4J2S A;  5DUY A;  1DQO A;  1XG6 A;  3CU1 B;  4J2Y A;  2UUS A;  2VSA A;  3LLP A;  1ONK B;  4WBC A;  4QKR A;  4I0Y A;  4G6M A;  4USO A;  2FFU A;  2DS0 A;  3AJ5 A;  2NZ9 A;  1XHB A;  3Q7X A;  1T4Q A;  1V6W A;  4L4I A;  3QYD A;  3O49 A;  3UD8 A;  1HKN A;  41BI A;  3OJM A;  1QXM A;  2P39 A;  3BAO A;  4EFP A;  1E0O A;  4I3N A;  1S0L A;  2RG9 B;  3FJF A;  3RMY A;  1IRA X;  1ITB A;  1FMM S;  1JT3 A;  1L2H A;  2X2T A;  8I1B A;  1RG8 A;  1HWO B;  4HJJ A;  1DZD A;  1Z0H A;  1SR4 A;  3I29 B;  5BP5 A;  4J2X A;  1GGP B;  4OWL A;  3BAH A;  4KEK A;  3AZW A;  4ZGR B;  4AN6 A;  1FV2 A;  1W3F A;  4D0Z A;  3OGF A;  3QR5 A;  1PZZ A;  3BRG C;  2YUG A;  3HBW A;  4Q9G A;  2KI4 A;  2Z48 A;  4ZFU B;  1S0D A;  3O4O A;  3FJ9 A;  2FGF A;  3K1X A;  3N7M A;  3I2X A;  3IM7 A;  3VEQ A;  3BAQ A;  5F90 A;  4IZX A;  4FVV A;  4GP0 A;  1OQL B;  3CA5 A;  2AQZ A;  4JRA A;  1W3A A;  5JMC A;  5E24 E;  3BAU A;  2IWT B;  3R4S A;  1PUU B;  2D44 A;  4J2K A;  3BA4 A;  1Z2V A;  2E4M C;  4HA2 A;  2L5X A;  2NP0 A;  3WO4 A;  2HWM A;  3IM5 A;  3FGM A;  3AZV A;  1AF9 A;  3O4D A;  3E8L C;  3AKG A;  4IQP A;  4GAI A;  4ZKT B;  1YTO A;  2HW9 A;  3FUO A;  5F8S A;  5DZU A;  1ISX A;  1DLL A;  2KH2 A;  2D23 A;  3FJK A;  1AVU A;  3HAL A;  1HWN B;  4I96 A;  3R4U A;  1JT7 A;  4I4O A;  1A8D A;  1QQK A;  3RMX A;  4I4Q A;  3BA7 A;  2NVH A;  2LIQ A;  3A22 A;  4LO0 A;  4Z8S B;  5FZZ A;  5D63 A;  4IY9 A;  1IRP A;  2ZR1 B;  4ZOT A;  1ABR B;  1PWA A;  3CRI A;  4I4Y A;  3S8K A;  5D62 A;  2WRY A;  4ZFW B;  1RML A;  1G9C A;  1NUN A;  2VSE A;  3JUT A;  4I2S A;  2VXT I;  2HWA A;  1DFC A;  4F34 A;  3A21 A;  1DFQ A;  1Q04 A;  3AH2 A;  2E4M A;  3A07 A;  3CA6 A;  3AH4 A;  9ILB A;  3FJC A;  4ISR A;  4LO1 A;  4A7K A;  3D7W B;  1M2T B;  2K43 A;  4GOY A;  5BOW A;  3H6R B;  3WO2 A;  4JKQ A;  1BLD A;  2WBC A;  1BFG A;  3MPP G;  3UJ0 A;  1BFF A;  1Z4S A;  1S0B A;  4I4X A;  3AH1 A;  1BFC A;  1TIE A;  4HR6 C;  3SNV A;  2D7R A;  4G9M A;  1MD6 A;  4OEG A;  3FJA A;  4A7Z A;  3T8S A;  4ZBV B;  2AAI B;  3O3Q A;  1P63 A;  1Q1U A;  3HN1 A;  4CJM A;  1R8O A;  3FUQ A;  4IYB A;  2Y9X E;  4ZFY B;  2D22 A;  1YF8 B;  3F1R A;  3I2A A;  4XFS A;  2X2S A;  3KMV A;  5F8Y A;  4FGF A;  2GZB A;  2D24 A;  3JRR A;  1YBI A;  3WIN C;  2MLL B;  4D0T A;  1HCD A;  2DRY A;  3C9Z A;  1IJT A;  4LO1 C;  1AVA C;  3Q7Y A;  3NJ5 A;  4USP A;  4IY8 A;  2DRZ A;  3OBT A;  4P0L A;  5FZY A;  4OWJ A;  3O4B A;  3FJB A;  1S0G A;  3IIR A;  5BXP A;  2BEB A;  1RZO B;  5BXR A;  3PHZ A;  4IHZ A;  2ET2 A;  1S0C A;  4X3A A;  5BXS A;  1W3G A;  2F2F A;  4Z9W B;  1G82 A;  2VXR A;  1SZ6 B;  3HMY A;  1FV3 A;  3ZC8 A;  2AXM A;  3AKH A;  3F62 B;  2DRE A;  3VT0 A;  4EKX B;  4LO7 C;  3ILA A;  1S0F A;  2QYI B;  3P53 A;  2Z49 A;  2FO1 A;  1FWU A;  2GO2 A;  5BQU C;  1AVW B;  3VSF A;  1DQG A;  4Q9P A;  3EF2 A;  4KEI A;  4X39 A;  1F31 A;  4I6I A;  3CQA A;  2NYY A;  5B2H A;  4GAF A;  3RSJ A;  1JQZ A;  1BFB A;  3CAH A;  2RST A;  3IAG C;  1PUM B;  1V6V A;  3O44 A;  2NM1 A;  3VSZ A;  1TP0 A;  3BB2 A;  3HSM A;  3ZX7 A;  4OW4 A;  1ISY A;  3WIN A;  4G9N A;  3P6J A;  5I1B A;  1KNM A;  5FZU A;  1WBC A;  4QBC A;  1NZK A;  2MC2 A;  3AKI A;  4JKX B;  4XKI A;  1WD3 A;  7I1B A;  4YOL A;  3BAV A;  1TFM B;  3A23 A;  3B9U A;  4I4U A;  2M49 A;  1JTC A;  4I4V A;  3CA1 A;  5EG6 C;  1V6X A;  5DVH A;  3WO3 A;  4A7Y A;  4XFU A;  3NBN A;  5FNX A;  2D1Z A;  2HZ9 A;  1N4K A;  4ISQ A;  4JP0 A;  4P6A A;  1G9B A;  3BRD A;  3V0B A;  4QO3 A;  3Q7W A;  4P0J A;  3O5W B;  2K8R A;  5GAQ A;  1WD4 A;  3MAL A;  2Q3N B;  1EVT A;  2Y9W C;  4AN7 B;  1J0S A;  5FNW A;  1CE7 B;  1XZZ A;  3VWC A;  2D7I A;  1JLY A;  1S0E A;  4Q91 A;  4DEP A;  3FJI A;  5BP5 C;  2D43 A;  1SR4 C;  1JT5 A;  3BX1 C;  4LO8 B;  1JY0 A;  1DIW A;  3OGG A;  3CRG A;  1I1B A;  4LO3 A;  3VT2 A;  3LTQ A;  1G9A A;  1JLX A;  4PC4 A;  4JAW A;  3V79 C;  3N7J A;  2XOA A;  3V0A A;  3RTJ B;  4EB2 B;  4X38 A;  4ZLB B;  3WMV A;  1K5U A;  3ZC9 A;  2NTD A;  2P23 A;  1QQL A;  3UJ4 A;  4I1B A;  2VU9 A;  4GOV A;  5D61 A;  3CA0 A;  3NBE A;  3PME A;  4II0 A;  1IOB A;  5F8W A;  2BEA A;  3H6Q A;  1TOO A;  1FQ9 A;  3WMU A;  4OEF A;  4I4P A;  4KC3 A;  21BI A;  3N0K A;  3TC2 A;  1II4 A;  4I4S A;  4I37 A;  4J23 B;  4LO0 C;  1BAS A;  2KLL A;  1ISV A;  4QAL A;  1G9D A;  2LIE A;  2Y9G A;  3FJ8 A;  4LO2 A;  4ION A;  3FJJ A;  3HOM A;  1HWM B;  4H9W A;  3FJD A;  2FDB M;  3BRF A;  3FFZ A;  1XYF A;  2VLC A;  4I8M A;  2I1B A;  4LO7 B;  3NBC A;  1CVS A;  1FGA A;  1AFC A;  2Q9X A;  2ERM A;  1FN0 A;  1JT4 A;  1PC8 B;  4TLP A;  3S8J A;  2ESU A;  4GP3 A;  1FMZ A;  4ZA3 B;  1IT0 A;  1YYN A;  3AJ6 A;  4KBB A;  3IM6 A;  1DJS B;  1V6U A;  3BAD A;  1IIL A;  2AFG A;  3CRH A;  1ISZ A;  1HWP B;  31BI A;  4DEN A;  2IHO A;  3NBD A;  2R9K B;  1RY7 A;  2VUA A;  3O4C A;  3OJV A;  4LO3 C;  4IZE A;  1ILR 1;  3H6S E;  4G1R A;  1DZC A;  4OEE A;  1WBA A;  3P6I A;  2D20 A;  1BA7 A;  3POK A;  4P0K A;  1HCE A;  3PUB A;  4EFQ A;  3V0B B;  1HIB A;  2QN4 A;  3ZXD A;  2K4A B;  2F8X C;  4EFR A;  2ZQN A;  1BAR A;  3BAG A;  3VT1 A;  4XFT A;  4L4H A;  3O4A A;  4R6U B;  3UD9 A;  1K5V A;  1R8N A;  1T9F A;  4D8H A;  4G6J A;  3RTI B;  3UDA A;  4QC4 A;  3N7K A;  5JLV A;  5G00 A;  1FWV A;  1Q03 A;  4I4R A;  1YXW A;  1EYL A;  3H6R A;  5BVP I;  1M16 A;  1EV2 A;  3AKF A;  5BXT A;  2ZQO A;  3PG0 A;  2Y9F A;  3CA3 A;  3ZXG A;  5HPZ A;  6I1B A;  2J3P A;  1UPS A;  1AVX B;  3V0A B;  1MC9 A;  4DCK C;  1TWE A;  2FFV A;  1EPW A;  4OWK A;  4JQ0 A;  3OBR A;  3BTA A;  4QD2 B;  5BQU A;  3W9T A;  4LO2 C;  3FJE A;  3WA1 A;  4END A;  4H04 A;  3CA4 A;  2BFH A;  3N7L A;  3BA5 A;  4I1E A;  4X37 A;  1I1E A; 
#chains in the Genus database with same CATH topology
 4I2H A;  4M9J A;  4KEJ A;  4MFA A;  3FJH A;  3PML A;  1BPZ A;  1IHK A;  1TWM A;  4MZH A;  2MIB A;  5EC5 A;  5HRG A;  3AQN A;  8ICX A;  3VUO A;  3PNC A;  5HRL A;  8ICR A;  3RJJ A;  4I7I A;  4EEE B;  4F83 A;  9ICS A;  3K75 D;  3PMN A;  2F2F C;  3OJ2 A;  4I27 A;  4IQT A;  5HRB A;  2KKI A;  4QKS A;  1AXM A;  4OUJ A;  1TTU A;  3RJF A;  4RQ8 A;  1BLA A;  5DSS B;  4IQU A;  4QD2 C;  4LZD A;  4KLG A;  2RQ9 A;  2ZH9 A;  5HR9 A;  1VCL A;  3UD7 A;  1TVA A;  5EHA A;  4QBV A;  2KI6 B;  5J0T A;  3MGI A;  1VFG A;  1ZQN A;  1ISW A;  4JPZ A;  2HHP A;  5CFU A;  4PHD A;  1D0H A;  4J2S A;  5DUY A;  1FA0 A;  4YD2 A;  5J29 A;  4DOA A;  1ZQJ A;  2BCU A;  3RJK A;  1DQO A;  1XG6 A;  3CU1 B;  4UB3 A;  4J2Y A;  4R65 A;  4K9A A;  2UUS A;  1MQ3 A;  3RH6 A;  9ICI A;  2VSA A;  5J0Q A;  3LLP A;  4UB5 A;  8ICT A;  5J0P A;  1ONK B;  4WBC A;  4NLN A;  4QKR A;  7ICF A;  5CP2 A;  4FHV A;  4I0Y A;  2GAF D;  5J2G A;  4G6M A;  4KLL A;  7ICI A;  1KEJ A;  4USO A;  2FFU A;  4O6A A;  3C2L A;  4X4O A;  9ICF A;  2DS0 A;  3AJ5 A;  2NZ9 A;  1XHB A;  3Q7X A;  4PHA A;  5CA7 A;  1T4Q A;  2ZH8 A;  4EP7 A;  8ICB A;  1V6W A;  4L4I A;  4FHY A;  3QYD A;  3LQC B;  3O49 A;  4I2J A;  9ICE A;  3UD8 A;  1HKN A;  41BI A;  3OJM A;  1QXM A;  2P39 A;  3BAO A;  4EFP A;  4FHP A;  4RT2 A;  4PGQ A;  5IIM A;  1E0O A;  4I3N A;  2EWR A;  4K4H A;  1S0L A;  2RG9 B;  3FJF A;  1BPB A;  3RMY A;  1IRA X;  1ITB A;  1FMM S;  1JT3 A;  4UD5 A;  3AQM A;  3NKU A;  1L2H A;  2X2T A;  2BBJ A;  4UB2 A;  1ZJN A;  8I1B A;  2BCQ A;  4KLE A;  1RG8 A;  2M2V A;  1ZQK A;  4X4V A;  2VAN A;  8ICK A;  5J0O A;  2ZH4 A;  1NO5 A;  1HWO B;  4HJJ A;  1DZD A;  1Z0H A;  4PH5 A;  1SR4 A;  3I29 B;  5EOZ A;  5BP5 A;  4I29 A;  4J2X A;  7ICM A;  1GGP B;  1JN3 A;  2ZH3 A;  4OWL A;  1MIY A;  3BAH A;  4KEK A;  3AZW A;  3JPT A;  4ZGR B;  4AN6 A;  9ICB A;  1FV2 A;  4X4T A;  1W3F A;  4D0Z A;  1ZQX A;  3OGF A;  3QR5 A;  3H39 A;  4M47 A;  1PZZ A;  3BRG C;  4I2I A;  5IIK A;  2YUG A;  3HBW A;  8ICS A;  4O69 A;  2PXI A;  4Q9G A;  5HRH A;  5DBC A;  2KI4 A;  2Z48 A;  4ZFU B;  4LZG A;  3L9D A;  1S0D A;  3O4O A;  4N7R A;  4Z6F A;  4MZF B;  3UXN A;  3FJ9 A;  2FGF A;  3K1X A;  3N7M A;  3I2X A;  3IM7 A;  2ZH2 A;  3OWG A;  3VEQ A;  3K7D A;  1ZQW A;  3BAQ A;  3TFR A;  4O5E A;  4AT7 B;  5J2B A;  4MFF A;  1ZQF A;  5F90 A;  4IZX A;  4FVV A;  4OAF A;  2O1P A;  4UAW A;  4GP0 A;  1OQL B;  4KB6 A;  8ICE A;  1ZQZ A;  4WC7 A;  3CA5 A;  2AQZ A;  3JPS A;  8ICJ A;  4JRA A;  1VJ7 A;  1W3A A;  5JMC A;  9ICW A;  5E24 E;  3BAU A;  2IWT B;  3R4S A;  4KLM A;  1ZQH A;  1PUU B;  2D44 A;  4J2K A;  3BA4 A;  1R8C A;  2GA9 D;  4EGW A;  3MDA A;  4I0U A;  1Z2V A;  2E4M C;  4HA2 A;  2L5X A;  4R66 A;  2NP0 A;  8ICZ A;  3WO4 A;  2HWM A;  3IM5 A;  4NXX A;  3FGM A;  1V4A A;  1MQ2 A;  4M04 A;  1UEV A;  3AZV A;  4QZG A;  4K4G A;  1AF9 A;  3O4D A;  3E8L C;  4K98 A;  4FHX A;  3WFP A;  3AKG A;  4IQP A;  4GAI A;  1ZQC A;  4I28 A;  4ZKT B;  2Q66 A;  3ERC C;  1YTO A;  3NYB A;  4YMN A;  4IQW A;  4QZ8 A;  1TFW A;  3AQK A;  5IIL A;  2DRB A;  2HW9 A;  3FUO A;  5F8S A;  4FO1 A;  5DZU A;  1ISX A;  4PHP A;  4QZH A;  1DLL A;  5CHG A;  4M9G A;  3AQL A;  4FHW A;  2KH2 A;  5HRD A;  2D23 A;  4XJE A;  4WC5 A;  4LT6 A;  4NKT A;  3FJK A;  4E8F A;  1AVU A;  3HAL A;  5J0U A;  1HWN B;  4UB1 A;  7ICP A;  4NXZ A;  4I96 A;  9ICT A;  3R4U A;  3V7K A;  5B3Q A;  4P4M A;  1JT7 A;  4I4O A;  1ZQV A;  3TFS A;  1A8D A;  2I9G A;  4I2G A;  1QQK A;  3RMX A;  4YMO A;  4QZ9 A;  4I4Q A;  3BA7 A;  2NVH A;  5DBA A;  4NLZ A;  4IG8 A;  2LIQ A;  3A22 A;  5J2K A;  4LO0 A;  4Z8S B;  5FZZ A;  5D63 A;  4OAG A;  7ICG A;  5HC9 A;  3V7L A;  4IY9 A;  1IRP A;  2ZR1 B;  4ZOT A;  4TUR A;  2IHM A;  1ABR B;  1PWA A;  1ZQQ A;  2BE3 A;  3CRI A;  3NWI A;  8ICO A;  4K8V A;  5JTG A;  2O5A A;  4I4Y A;  3S8K A;  5HRK A;  4GXK A;  3AUO A;  5D62 A;  2WRY A;  4ZFW B;  3H38 A;  1RML A;  3OVA A;  1G9C A;  1NUN A;  2VSE A;  3JUT A;  3JCF A;  4NXU A;  3ISB A;  3JPQ A;  4JWN A;  4P2H A;  4I2S A;  2VXT I;  2HWA A;  4WBY A;  1DFC A;  4F34 A;  5HHH A;  3JPP A;  9ICQ A;  3A21 A;  7ICT A;  4M9L A;  1DFQ A;  1Q04 A;  2DR5 A;  2NS2 A;  5J2D A;  5J2F A;  4X4P A;  3AH2 A;  2E4M A;  3A07 A;  3CA6 A;  3HIY A;  4NXV A;  3B0Y A;  5J2I A;  4X0A A;  2ISO A;  4QZC A;  3AH4 A;  9ILB A;  5DDM A;  4QZI A;  1KDH A;  3FJC A;  4ISR A;  4LO1 A;  4A7K A;  5III A;  3D7W B;  1XSN A;  1M2T B;  8ICN A;  4IQV A;  2K43 A;  2PFN A;  3JPR A;  4GOY A;  5CR0 A;  5BOW A;  3H6R B;  4UB4 A;  1ZQB A;  4K97 A;  3WO2 A;  4XA5 A;  1XSP A;  3JZ0 A;  9ICG A;  4JKQ A;  1Q78 A;  1BLD A;  2WBC A;  1BFG A;  3MPP G;  5HRF A;  9ICV A;  5D49 A;  4DOB A;  3UJ0 A;  9ICR A;  4KLU A;  1BFF A;  1Z4S A;  1S0B A;  4I4X A;  3AH1 A;  1BFC A;  1TIE A;  4HR6 C;  3SNV A;  5J0R A;  4TUQ A;  4NY8 A;  2D7R A;  4WC4 A;  2PFO A;  4RWN A;  4G9M A;  1MD6 A;  4OEG A;  4XUS A;  3FJA A;  4A7Z A;  1UEU A;  2BPG A;  1R8B A;  1RZT A;  3T8S A;  4ZBV B;  2AAI B;  3O3Q A;  3NVO A;  1ZQM A;  4LVS A;  9ICJ A;  1P63 A;  1Q1U A;  3HN1 A;  4CJM A;  4MFC A;  7ICV A;  3UXO A;  1R8O A;  2HN2 A;  4YCX A;  4LEY A;  3JPO A;  4X5V A;  3FUQ A;  4IYB A;  2Y9X E;  4ZFY B;  4YD1 A;  2D22 A;  8ICC A;  1YF8 B;  9ICL A;  3F1R A;  3I2A A;  4XFS A;  2X2S A;  4X4Q A;  3KMV A;  5F8Y A;  4FGF A;  4EBK A;  5BPC A;  4GXJ A;  2GZB A;  4AT8 A;  8ICU A;  7ICS A;  2D24 A;  3JRR A;  2RFF A;  4KLD A;  1YBI A;  3WIN C;  2GWS A;  2MLL B;  4D0T A;  1HCD A;  5DEC A;  4WC1 A;  2DRY A;  4UAY A;  1ZQO A;  1ZQP A;  4X4U A;  4RQ2 A;  3C9Z A;  1IJT A;  7ICJ A;  4LO1 C;  4TUS A;  1ZQT A;  2IUB A;  3OUY B;  1AVA C;  3Q7Y A;  3NJ5 A;  1Q79 A;  2FMQ A;  4USP A;  1PX5 A;  4X4S A;  4IY8 A;  4K99 A;  2DRZ A;  5D4B A;  3OBT A;  3RJH A;  4P0L A;  5FZY A;  5HRI A;  4OWJ A;  4WOY A;  4P4O A;  4I2F A;  7ICL A;  3O4B A;  3FJB A;  4M9H A;  5CWR A;  1S0G A;  3IIR A;  5BXP A;  2BEB A;  3C2M A;  1RZO B;  2M2U A;  5BXR A;  1F5A A;  3ER8 C;  3PHZ A;  4IHZ A;  2ET2 A;  1S0C A;  4X3A A;  5BXS A;  4AT7 A;  1W3G A;  2PBE A;  2F2F A;  4Z9W B;  4ATB A;  4K96 A;  1G82 A;  2VXR A;  1SZ6 B;  3HMY A;  4O68 A;  2PFP A;  4I2B A;  9ICM A;  1FV3 A;  3ZC8 A;  4KLS A;  2AXM A;  3AKH A;  3HX0 A;  5DB8 A;  3F62 B;  4UBC A;  2DRE A;  3VT0 A;  5DB7 A;  4EKX B;  4JWM A;  4KM5 A;  5DKW A;  4LEV A;  3MDC A;  2BBH A;  4AT9 A;  2BPC A;  4LO7 C;  1NOM A;  3ILA A;  1S0F A;  2QYI B;  3P53 A;  5B3P A;  5J2C A;  2Z49 A;  1ZQU A;  4YMM A;  3RH4 A;  2FO1 A;  4WH5 A;  4EED A;  7ICR A;  1FWU A;  2GO2 A;  5BQU C;  4PGY A;  4DOC A;  3RH5 A;  1AVW B;  8ICY A;  3VSF A;  1DQG A;  4Q9P A;  3GDX A;  4YN4 A;  3EF2 A;  4KEI A;  4X39 A;  1F31 A;  4I6I A;  7ICE A;  5J0Y A;  3CQA A;  2NYY A;  5DDY A;  5B2H A;  5J2H A;  4GAF A;  3RSJ A;  8ICW A;  4WQL A;  1JQZ A;  3OVS A;  4WCW A;  1BFB A;  7ICQ A;  3CAH A;  2RST A;  3V7J A;  3IAG C;  1PUM B;  1V6V A;  3O44 A;  2NM1 A;  3VSZ A;  4AT8 B;  4R63 A;  4GXI A;  1TP0 A;  3BB2 A;  3HSM A;  3ZX7 A;  4P4P A;  4OW4 A;  4I2E A;  1ISY A;  4JLZ A;  3C5F A;  3WIN A;  4G9N A;  3OUY A;  3P6J A;  2ZHB A;  1TV9 A;  9ICX A;  5I1B A;  1KNM A;  5FZU A;  1WBC A;  3OGU A;  4QBC A;  1NZK A;  2NRK A;  4MZG B;  5TZV A;  4WBZ A;  2MC2 A;  3AKI A;  4JKX B;  4XKI A;  4RQ5 A;  1XSL A;  1HUO A;  5J0W A;  3V72 A;  1WD3 A;  7I1B A;  4XRH A;  4XQ7 A;  2DR7 A;  4YOL A;  5D46 A;  5DB9 A;  3BAV A;  1TFM B;  3A23 A;  3B9U A;  4I4U A;  1R89 A;  2B56 A;  2FMP A;  2M49 A;  1JTC A;  2HN1 A;  4I4V A;  1ZJM A;  3CA1 A;  5EG6 C;  1V6X A;  4I2D A;  5DVH A;  3WO3 A;  4A7Y A;  4XFU A;  3NBN A;  5J2E A;  1BPX A;  4KLJ A;  5FNX A;  5IIO A;  2D1Z A;  5IIJ A;  4K9B A;  4Z6C A;  3JYY A;  3WFR E;  2HZ9 A;  8ICF A;  1N4K A;  4ISQ A;  4JP0 A;  4P6A A;  1G9B A;  3BRD A;  1JMS A;  3MBY A;  4RQ7 A;  3V0B A;  7ICH A;  5CFS A;  4QO3 A;  4E80 A;  1JAJ A;  1OU5 A;  4RPX A;  3Q7W A;  5HRE A;  4P0J A;  4I2A A;  5CHE A;  4JLX A;  3O5W B;  4QZB A;  2K8R A;  5GAQ A;  4QZA A;  1WD4 A;  2BCR A;  3MAL A;  2Q3N B;  4UD4 A;  1EVT A;  2Y9W C;  8ICQ A;  4AN7 B;  1J0S A;  3RJG A;  5FNW A;  1CE7 B;  2DVI A;  5CFT A;  4UAZ A;  1XZZ A;  3VWC A;  2D7I A;  1JLY A;  1S0E A;  4Q91 A;  3MCR A;  5F2V O;  3ER9 B;  2ZH5 A;  4F5R A;  4DEP A;  3FJI A;  5BP5 C;  2D43 A;  1SR4 C;  2BCV A;  5J0S A;  1HUZ A;  2DR9 A;  4S3N A;  4DO9 A;  3OVB A;  1JT5 A;  2FMS A;  3BX1 C;  4LO8 B;  4EEB A;  1JY0 A;  9ICU A;  1DIW A;  3OGG A;  3CRG A;  1I1B A;  3C18 A;  4LO3 A;  3VT2 A;  3LTQ A;  1G9A A;  1JLX A;  2ID1 A;  4PC4 A;  4JAW A;  3V79 C;  3ISC A;  4KLT A;  3N7J A;  2XOA A;  3V0A A;  1ZQE A;  3RTJ B;  2DRA A;  4EB2 B;  4X38 A;  4ZLB B;  4FH5 A;  4MKP A;  8ICG A;  3WMV A;  1K5U A;  3ZC9 A;  2BCS A;  8ICI A;  4F5P A;  3UPQ A;  9ICH A;  2NTD A;  2P23 A;  1QQL A;  3UJ4 A;  4I1B A;  2VU9 A;  4GOV A;  5D61 A;  3LK9 A;  4F5Q A;  8ICL A;  3CA0 A;  3NBE A;  3PME A;  4II0 A;  3H3A A;  3OV7 A;  4NM2 A;  1IOB A;  5F8W A;  5BOM A;  2BEA A;  3H6Q A;  1TOO A;  1FQ9 A;  3WMU A;  4M0A A;  4X4N A;  9ICP A;  4OEF A;  1JQR A;  2ZH6 A;  4I4P A;  4KC3 A;  21BI A;  3N0K A;  3TC2 A;  4WC0 A;  1II4 A;  4I4S A;  3HJ4 A;  5J0X A;  4WC3 A;  4I37 A;  2FCL A;  4I2C A;  4LEW A;  4NXW A;  5BOL A;  4J23 B;  3C2K A;  4LO0 C;  1BAS A;  2KLL A;  1BPE A;  1UET A;  1ISV A;  4QAL A;  1TFY A;  1G9D A;  2LIE A;  2Y9G A;  3FJ8 A;  4LO2 A;  3MGH A;  4ION A;  1ZQL A;  8ICM A;  4QZE A;  3FJJ A;  3HOM A;  1HWM B;  4H9W A;  3FJD A;  2FDB M;  3BRF A;  3FFZ A;  4QZD A;  1XYF A;  2VLC A;  5DED A;  4KLI A;  4I8M A;  5J2A A;  2BPF A;  2I1B A;  4LO7 B;  3NBC A;  3RJE A;  1CVS A;  1ZQY A;  4OAH A;  1FGA A;  5CJ7 A;  4O5C A;  4MF2 A;  1AFC A;  4XQ8 A;  1BPY A;  3AU2 A;  4ATB B;  2Q9X A;  2ERM A;  4KLQ A;  1FN0 A;  1JT4 A;  1PC8 B;  4TLP A;  5HHI A;  3S8J A;  2ESU A;  4RQ0 A;  4KLO A;  4RQ6 A;  4GP3 A;  1ZQR A;  1FMZ A;  1ZQA A;  4R64 A;  2B4V A;  4M5D A;  4ZA3 B;  1IT0 A;  1YYN A;  3AJ6 A;  4KBB A;  4O9M A;  8ICV A;  3IM6 A;  1DJS B;  1V6U A;  3BAD A;  1IIL A;  2AFG A;  3CRH A;  1YLQ A;  4WC6 A;  1ISZ A;  1HWP B;  4WC2 A;  4FO6 A;  4F5N A;  31BI A;  4LEZ A;  3HWT A;  9ICA A;  4DEN A;  8ICA A;  2IHO A;  3NBD A;  2R9K B;  1RY7 A;  2VUA A;  4E7X A;  3O4C A;  3OJV A;  4RQ1 A;  4MF8 A;  4M9N A;  4O5K A;  1R8A A;  4RWO A;  3UPS A;  4LO3 C;  1RPL A;  4IZE A;  1ILR 1;  3H6S E;  3WFQ E;  4G1R A;  9ICO A;  1DZC A;  4OEE A;  1WBA A;  3P6I A;  3UXP A;  4X0B A;  2D20 A;  1MIW A;  1BA7 A;  3POK A;  4P0K A;  4RQ4 A;  3UQ2 A;  1HCE A;  7ICO A;  3PUB A;  4EFQ A;  3V0B B;  4H75 A;  1HIB A;  2QN4 A;  3ZXD A;  2K4A B;  2F8X C;  1BPD A;  4HX0 A;  4QZF A;  4RPZ A;  2PFQ A;  4NLK A;  7ICK A;  4RQ3 A;  3RJI A;  3HJ1 A;  4EFR A;  2ZQN A;  1ZQD A;  7ICN A;  5DB6 A;  1BAR A;  3BAG A;  3ISD A;  1GPJ A;  3C66 A;  3VT1 A;  4RT3 A;  5J2J A;  4Z6E A;  4UY4 A;  1ZQI A;  2ISP A;  4XFT A;  4L4H A;  3O4A A;  4R6U B;  3UD9 A;  2M2T A;  9ICK A;  9ICC A;  1K5V A;  1R8N A;  1T9F A;  4D8H A;  3C5G A;  4G6J A;  4NM1 A;  3RTI B;  3UDA A;  4QC4 A;  4FH3 A;  4PGX A;  2P66 A;  3N7K A;  4RWP A;  5JLV A;  5G00 A;  1FWV A;  3HW8 A;  1Q03 A;  4I4R A;  8ICP A;  4WQK A;  1YXW A;  1KNY A;  4K4I A;  1EYL A;  4EBJ A;  4KLF A;  3H6R A;  5BVP I;  1M16 A;  4M2Y A;  1EV2 A;  3AKF A;  5BXT A;  4O67 A;  2B51 A;  7ICU A;  2ZQO A;  3PG0 A;  4RWQ A;  2ZH1 A;  2Y9F A;  3CA3 A;  4AT9 B;  1ZQS A;  9ICN A;  1WOT A;  4RPY A;  4EV6 A;  3ZXG A;  5HPZ A;  8ICH A;  6I1B A;  2J3P A;  5CB1 A;  2ZH7 A;  1UPS A;  1AVX B;  3V0A B;  1MC9 A;  4DCK C;  1TWE A;  2FFV A;  1EPW A;  4OWK A;  3WFS C;  2M2W A;  4JQ0 A;  2W9M A;  3JPN A;  4F5O A;  4TUP A;  3OBR A;  2ZHA A;  3BTA A;  3AU6 A;  2DR8 A;  4OAI Z;  4QD2 B;  3WFO A;  4Z6D A;  1ZQG A;  5BQU A;  4NKU A;  3W9T A;  4LO2 C;  3FJE A;  3WA1 A;  4END A;  4H04 A;  3CK6 A;  5DBB A;  4UBB A;  3UQ0 A;  4PPX A;  4PHE A;  3CA4 A;  4KLH A;  2BFH A;  3B0X A;  5IIN A;  3N7L A;  4X4R A;  1MIV A;  3H37 A;  3BA5 A;  4I1E A;  4X37 A;  4NXT A;  1I1E A; 
#chains in the Genus database with same CATH homology
 4KEJ A;  3FJH A;  1IHK A;  1TWM A;  4MZH A;  2MIB A;  5EC5 A;  3VUO A;  4I7I A;  4EEE B;  4F83 A;  2F2F C;  3OJ2 A;  2KKI A;  4QKS A;  1AXM A;  4OUJ A;  1TTU A;  1BLA A;  5DSS B;  4QD2 C;  2RQ9 A;  1VCL A;  3UD7 A;  5EHA A;  4QBV A;  2KI6 B;  1ISW A;  4JPZ A;  5CFU A;  1D0H A;  4J2S A;  5DUY A;  1DQO A;  1XG6 A;  3CU1 B;  4K9A A;  4J2Y A;  2UUS A;  2VSA A;  3LLP A;  1ONK B;  4WBC A;  4QKR A;  4I0Y A;  2GAF D;  4G6M A;  4USO A;  2FFU A;  4O6A A;  2DS0 A;  3AJ5 A;  2NZ9 A;  1XHB A;  3Q7X A;  1T4Q A;  1V6W A;  4L4I A;  3QYD A;  3O49 A;  3UD8 A;  1HKN A;  41BI A;  3OJM A;  1QXM A;  2P39 A;  3BAO A;  4EFP A;  1E0O A;  4I3N A;  2EWR A;  1S0L A;  2RG9 B;  3FJF A;  3RMY A;  1IRA X;  1ITB A;  1FMM S;  1JT3 A;  3NKU A;  1L2H A;  2X2T A;  8I1B A;  1RG8 A;  1HWO B;  4HJJ A;  1DZD A;  1Z0H A;  1SR4 A;  3I29 B;  5BP5 A;  4J2X A;  1GGP B;  4OWL A;  3BAH A;  4KEK A;  3AZW A;  4ZGR B;  4AN6 A;  1FV2 A;  1W3F A;  4D0Z A;  3OGF A;  3QR5 A;  1PZZ A;  3BRG C;  2YUG A;  3HBW A;  4O69 A;  4Q9G A;  2KI4 A;  2Z48 A;  4ZFU B;  1S0D A;  3O4O A;  4N7R A;  4MZF B;  3FJ9 A;  2FGF A;  3K1X A;  3N7M A;  3I2X A;  3IM7 A;  3OWG A;  3VEQ A;  3K7D A;  3BAQ A;  5F90 A;  4IZX A;  4FVV A;  4OAF A;  4KB6 A;  4GP0 A;  1OQL B;  3CA5 A;  2AQZ A;  4JRA A;  1W3A A;  5JMC A;  5E24 E;  3BAU A;  2IWT B;  3R4S A;  1PUU B;  2D44 A;  4J2K A;  3BA4 A;  2GA9 D;  1Z2V A;  2E4M C;  4HA2 A;  2L5X A;  2NP0 A;  3WO4 A;  2HWM A;  3IM5 A;  4NXX A;  3FGM A;  3AZV A;  1AF9 A;  3O4D A;  3E8L C;  4K98 A;  3AKG A;  4IQP A;  4GAI A;  4ZKT B;  3ERC C;  1YTO A;  2HW9 A;  3FUO A;  5F8S A;  4FO1 A;  5DZU A;  1ISX A;  1DLL A;  2KH2 A;  2D23 A;  4XJE A;  3ER8 C;  3FJK A;  1AVU A;  3HAL A;  1HWN B;  4I96 A;  3R4U A;  5B3Q A;  1JT7 A;  4I4O A;  1A8D A;  1QQK A;  3RMX A;  4I4Q A;  3BA7 A;  2NVH A;  2LIQ A;  3A22 A;  4LO0 A;  4Z8S B;  5FZZ A;  5D63 A;  4OAG A;  4IY9 A;  1IRP A;  2ZR1 B;  4ZOT A;  1ABR B;  1PWA A;  3CRI A;  4K8V A;  4I4Y A;  3S8K A;  5D62 A;  2WRY A;  4ZFW B;  1RML A;  1G9C A;  1NUN A;  2VSE A;  3JUT A;  4NXU A;  4I2S A;  2VXT I;  2HWA A;  1DFC A;  4F34 A;  3A21 A;  1DFQ A;  1Q04 A;  2NS2 A;  3AH2 A;  2E4M A;  3A07 A;  3CA6 A;  4NXV A;  3AH4 A;  9ILB A;  3FJC A;  4ISR A;  4LO1 A;  4A7K A;  3D7W B;  1M2T B;  2K43 A;  4GOY A;  5BOW A;  3H6R B;  4K97 A;  3WO2 A;  4JKQ A;  1BLD A;  2WBC A;  1BFG A;  3MPP G;  3UJ0 A;  1BFF A;  1Z4S A;  1S0B A;  4I4X A;  3AH1 A;  1BFC A;  1TIE A;  4HR6 C;  3SNV A;  2D7R A;  4G9M A;  1MD6 A;  4OEG A;  3FJA A;  4A7Z A;  3T8S A;  4ZBV B;  2AAI B;  3O3Q A;  1P63 A;  1Q1U A;  3HN1 A;  4CJM A;  1R8O A;  4LEY A;  3FUQ A;  4IYB A;  2Y9X E;  4ZFY B;  2D22 A;  1YF8 B;  3F1R A;  3I2A A;  4XFS A;  2X2S A;  3KMV A;  5F8Y A;  4FGF A;  2GZB A;  2D24 A;  3JRR A;  1YBI A;  3WIN C;  2MLL B;  4D0T A;  1HCD A;  2DRY A;  3C9Z A;  1IJT A;  4LO1 C;  1AVA C;  3Q7Y A;  3NJ5 A;  4USP A;  4IY8 A;  4K99 A;  2DRZ A;  3OBT A;  4P0L A;  5FZY A;  4OWJ A;  4WOY A;  3O4B A;  3FJB A;  1S0G A;  3IIR A;  5BXP A;  2BEB A;  1RZO B;  5BXR A;  3PHZ A;  4IHZ A;  2ET2 A;  1S0C A;  4X3A A;  5BXS A;  1W3G A;  4K96 A;  2F2F A;  4Z9W B;  1G82 A;  2VXR A;  1SZ6 B;  3HMY A;  4O68 A;  1FV3 A;  3ZC8 A;  2AXM A;  3AKH A;  3F62 B;  2DRE A;  3VT0 A;  4EKX B;  4KM5 A;  4LEV A;  4LO7 C;  3ILA A;  1S0F A;  2QYI B;  3P53 A;  5B3P A;  2Z49 A;  2FO1 A;  4WH5 A;  1FWU A;  2GO2 A;  5BQU C;  1AVW B;  3VSF A;  1DQG A;  4Q9P A;  3EF2 A;  4KEI A;  4X39 A;  1F31 A;  4I6I A;  3CQA A;  2NYY A;  5B2H A;  4GAF A;  3RSJ A;  4WQL A;  1JQZ A;  1BFB A;  3CAH A;  2RST A;  3IAG C;  1PUM B;  1V6V A;  3O44 A;  2NM1 A;  3VSZ A;  1TP0 A;  3BB2 A;  3HSM A;  3ZX7 A;  4OW4 A;  1ISY A;  4JLZ A;  3WIN A;  4G9N A;  3P6J A;  5I1B A;  1KNM A;  5FZU A;  1WBC A;  4QBC A;  1NZK A;  4MZG B;  2MC2 A;  3AKI A;  4JKX B;  4XKI A;  1WD3 A;  7I1B A;  4YOL A;  3BAV A;  1TFM B;  3A23 A;  3B9U A;  4I4U A;  2B56 A;  2M49 A;  1JTC A;  4I4V A;  3CA1 A;  5EG6 C;  1V6X A;  5DVH A;  3WO3 A;  4A7Y A;  4XFU A;  3NBN A;  5FNX A;  2D1Z A;  4K9B A;  2HZ9 A;  1N4K A;  4ISQ A;  4JP0 A;  4P6A A;  1G9B A;  3BRD A;  3V0B A;  5CFS A;  4QO3 A;  3Q7W A;  4P0J A;  5CHE A;  4JLX A;  3O5W B;  2K8R A;  5GAQ A;  1WD4 A;  3MAL A;  2Q3N B;  1EVT A;  2Y9W C;  4AN7 B;  1J0S A;  5FNW A;  1CE7 B;  5CFT A;  1XZZ A;  3VWC A;  2D7I A;  1JLY A;  1S0E A;  4Q91 A;  3MCR A;  3ER9 B;  4DEP A;  3FJI A;  5BP5 C;  2D43 A;  1SR4 C;  1JT5 A;  3BX1 C;  4LO8 B;  1JY0 A;  1DIW A;  3OGG A;  3CRG A;  1I1B A;  4LO3 A;  3VT2 A;  3LTQ A;  1G9A A;  1JLX A;  4PC4 A;  4JAW A;  3V79 C;  3N7J A;  2XOA A;  3V0A A;  3RTJ B;  4EB2 B;  4X38 A;  4ZLB B;  4MKP A;  3WMV A;  1K5U A;  3ZC9 A;  2NTD A;  2P23 A;  1QQL A;  3UJ4 A;  4I1B A;  2VU9 A;  4GOV A;  5D61 A;  3CA0 A;  3NBE A;  3PME A;  4II0 A;  1IOB A;  5F8W A;  2BEA A;  3H6Q A;  1TOO A;  1FQ9 A;  3WMU A;  4OEF A;  4I4P A;  4KC3 A;  21BI A;  3N0K A;  3TC2 A;  1II4 A;  4I4S A;  4I37 A;  2FCL A;  4LEW A;  4NXW A;  4J23 B;  4LO0 C;  1BAS A;  2KLL A;  1ISV A;  4QAL A;  1G9D A;  2LIE A;  2Y9G A;  3FJ8 A;  4LO2 A;  4ION A;  3FJJ A;  3HOM A;  1HWM B;  4H9W A;  3FJD A;  2FDB M;  3BRF A;  3FFZ A;  1XYF A;  2VLC A;  4I8M A;  2I1B A;  4LO7 B;  3NBC A;  1CVS A;  4OAH A;  1FGA A;  1AFC A;  2Q9X A;  2ERM A;  1FN0 A;  1JT4 A;  1PC8 B;  4TLP A;  3S8J A;  2ESU A;  4GP3 A;  1FMZ A;  2B4V A;  4ZA3 B;  1IT0 A;  1YYN A;  3AJ6 A;  4KBB A;  3IM6 A;  1DJS B;  1V6U A;  3BAD A;  1IIL A;  2AFG A;  3CRH A;  1ISZ A;  1HWP B;  4LEZ A;  31BI A;  4DEN A;  2IHO A;  3NBD A;  2R9K B;  1RY7 A;  2VUA A;  3O4C A;  3OJV A;  4LO3 C;  4IZE A;  1ILR 1;  3H6S E;  4G1R A;  1DZC A;  4OEE A;  1WBA A;  3P6I A;  2D20 A;  1BA7 A;  3POK A;  4P0K A;  1HCE A;  3PUB A;  4EFQ A;  3V0B B;  4H75 A;  1HIB A;  2QN4 A;  3ZXD A;  2K4A B;  2F8X C;  4HX0 A;  4EFR A;  2ZQN A;  1BAR A;  3BAG A;  1GPJ A;  3VT1 A;  4UY4 A;  4XFT A;  4L4H A;  3O4A A;  4R6U B;  3UD9 A;  1K5V A;  1R8N A;  1T9F A;  4D8H A;  4G6J A;  3RTI B;  3UDA A;  4QC4 A;  3N7K A;  5JLV A;  5G00 A;  1FWV A;  1Q03 A;  4I4R A;  4WQK A;  1YXW A;  1EYL A;  3H6R A;  5BVP I;  1M16 A;  1EV2 A;  3AKF A;  5BXT A;  4O67 A;  2B51 A;  2ZQO A;  3PG0 A;  2Y9F A;  3CA3 A;  3ZXG A;  5HPZ A;  6I1B A;  2J3P A;  1UPS A;  1AVX B;  3V0A B;  1MC9 A;  4DCK C;  1TWE A;  2FFV A;  1EPW A;  4OWK A;  4JQ0 A;  3OBR A;  3BTA A;  4OAI Z;  4QD2 B;  5BQU A;  3W9T A;  4LO2 C;  3FJE A;  3WA1 A;  4END A;  4H04 A;  3CA4 A;  2BFH A;  3N7L A;  3BA5 A;  4I1E A;  4X37 A;  4NXT A;  1I1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...