5D6CB

Structure of 4497 fab bound to synthetic wall teichoic acid fragment
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
210
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCSASGFSFNSFWMHWVRQVPGKGLVWISFTNNEGTTTAYADSVRGRFIISRDNAKNTLYLEMNNLRGEDTAVYYCARGDGGLDDWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4497 antibody IgK (VL and CL)
publication title Novel antibody-antibiotic conjugate eliminates intracellular S. aureus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 210
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d6cB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d6cB01
3MNVB 2ID5A 3WIHA 3O2DH 3LY6A 1MHHB 2J1KA 5D7JA 1SBBA 1G0YR 1Y6MR 1JIBA 3GSRA 4ZOEA 1RUPH 1J0YA 1T1XB 4I4WB 4OCWH 5C0BE 1OF2A 5I1JH 3JWDC 2IANE 3VFVA 2VXSH 3HI5L 1J1XL 1L0QA 2ITCB 2FR4B 1DQMH 4OSUL 5IVXB 1ZT4A 5LBSH 1KIUA 1OQXA 5D1XA 3WFZA 1A4KB 1T3FB 1N0LA 4QF1B 5J13C 2BY2A 1NEZB 2FDBP 1QO3B 4XNZB 4NDMA 4GSDL 4D0DA 1QG3A 1XCQB 1IAII 4Y4FC 4PJAA 2IH1A 2VH5L 2FBJL 1OARH 4YBLC 1TENA 4Z8FH 3ZSSA 3VDCA 1MI5A 2EDKA 3BPLC 4QY8B 4H20L 4OQTL 1DQQB 5EU6A 5IHBA 4JLRA 4XGZB 1W2KT 4ODSL 2BNUB 1I4FB 1E4KC 4XPBH 5F7EL 4YE4L 4X9HA 3AC0A 5DC0A 4OKVB 4FQXC 4O9HH 5BVPL 3RZCB 5J6HB 4PGBB 3NCFB 2OR9H 5EZJA 4TULH 5LWYL 4DN3L 3FFDB 3LV3A 5D6CB 5MEOA 1S9VB 4HCRL 5J0BA 1Y18B 2PTTA 2V7NB 5EZIH 1QBBA 3U9UA 1Y6KR 1A6UL 1S9WA 2ZUYA 2BVOA 1BJ1H 2GFBA 3VFWA 4HUWB 3KGRA 1H8SA 5D2NA 1KN4L 5C71A 3LCYA 4WWKD 3O6LH 3KLSA 3QDGD 4K94L 1UWGL 3GSNB 1U9KA 1OCWH 4FXGB 2BDNL 4Y4HD 1WCBA 3E2HB 3T77B 1R3LA 2X4TB 3SE4A 1QVOA 2B5IB 2HFFA 4WFHE 1G9EA 2RJMA 4PJ5E 3NCJH 4ZTOH 3SDCC 3V5DB 4ZFOA 1KPVB 4YBQD 4MDIB 5K33A 2HLAA 1QNZH 1F3JA 4GXVH 1EHAA 1Z3GH 1CS6A 4Y7MA 5D72H 4EI5D 4AT6B 4JGUA 3MR9B 5BO1L 1U8IB 2DQFA 2G9HA 4GRWB 4P2OB 1S7SB 1QLFB 1I9EA 4TVSa 3OGCB 1W8NA 4OCMC 3C5ZA 1EPFA 4Y5XB 2IMMA 5D7SH 2IPUG 4JDTH 4ZUTB 4NRXA 1CXEA 1KCVH 1FFOA 1U93A 2B4CC 1PSKH 3I50L 3GBMH 3LEYL 4Z77B 4OCWL 1LO3H 3WO3B 1RZGA 5DJ6A 3DO7A 3I75A 1GIGL 4LDEB 1IM3B 2KPNA 3GSWA 4FXKB 5F7DA 3EKCA 4LLDA 3QI9C 4EXKA 3EYFA 4QLRA 4L9LB 2YZ8A 3HG1E 4QRRD 1YC7A 3U0TA 3VI3E 3DVIA 1FHGA 2VZOA 3FAWA 3SE3A 5IWLA 4NHUB 1OARL 1KOAA 1ONQA 2AJSL 4J6RH 1T2XA 2W92A 3B9AA 1J18A 1L0YA 2HJLA 4L4VE 3MCLH 2VXUL 4KJWD 3LMJH 2NNAA 2OMBA 43C9B 3V4VH 3DTXB 4F37F 2YD1A 1E6JH 2EXYD 4X6FB 3VXMA 1AO7B 4EXPX 1YNLH 2VQ1B 3UTSA 1U2HA 3PABB 2YR3A 5F7LB 2YN5A 4O9HL 1Z0NA 3MNZA 3QFJA 4OLXH 4KXZI 1EEYA 3AAZA 1PEWA 4GKNB 1TNMA 2YS4A 2OR9L 5C2BH 4TULL 2OTWA 3VFGH 3QP3A 1MUJB 1G7LB 2HFGL 3D3VA 3G6AB 5H8DA 3M1BB 3BQUC 5CP7B 1K2DB 3I84A 4L3EA 4K7PY 3NCCB 1KT2A 2PCPA 2OXHA 5DLMH 5L2KB 4LU5L 4N68A 5C09B 3CVIL 1JTPA 4NRYA 3UEZA 3X11B 4Z6AT 1YMMA 4I5BB 1M05A 3BDYL 1MRDH 3CLEL 4N1EA 4QNPF 1FNHA 1MHHA 4LAQH 4ZNCD 1OPGL 3ILQD 2ARJQ 3ULVH 2UWEE 1S9KC 2R0KL 4N8VB 4I4WA 2WINA 1T7VA 4AYFA 5JO5A 3P30H 4YEEA 1N4XH 5F7MC 2LVCA 2X41A 2DQCH 4M93C 2ITCA 2FR4A 5IVXA 2A6IB 4DUVA 4Q97A 1QNZL 4D3CL 1D5XB 4GXVL 1Z3GL 1KBGL 2VIRA 3MLTB 1UH4A 3I85A 3IDYC 5ENWB 2HVKB 5GS1B 4G7VL 1UWXK 1XCQA 4MQTB 4ZS7H 5EULV 1IGJA 2QV2A 3WNNA 2J8OA 4YHNA 2YA1A 5AZ2L 5IFHH 4QHNB 5D7SL 4POZD 1DQQA 2BERA 2BC4A 4JY6A 1DBBL 3I02B 1QA9A 3Q6GH 4NN7C 3ARDC 4F9LC 2AGJH 1VKXB 1F8TH 5D96B 4X0KB 3WBDA 2FNBA 3PGFH 5EOQH 1G7MA 1J12A 3DECA 1BAFH 4P2RD 4RX4A 4G3YL 1S7QB 3RZCA 4UOW1 2QHLA 5J6HA 2NZIA 3O6KH 3W82A 4P46B 4NPYB 3FFDA 2VKWA 1JVKA 3R0MA 1F4WL 4OUOA 5DJ2B 1TCRA 2B2XH 4Y19E 4Y5VA 2PETA 4F3FA 2VISB 3LMJL 5KS9F 1SEQH 4X7TB 1WISA 1F45A 4X7FC 4EOWH 1YNLL 1BFOB 1KUMA 3SCMD 2D31B 2NY2B 3EJJX 3O3DA 4WIQA 3MRQA 5H2BA 1J0KA 1HH9B 2VERN 4P4KA 5HHXL 4YDKL 3LZFL 2EC9T 1HHKB 3RVXC 2J8UF 4KJQD 4AEEA 5C7XH 4YNYA 2AK4B 4KDTC 4P9HH 2Y06L 4FQHA 3QUZD 3J7HA 1BQLH 1KENH 1OAUH 3GI9L 2X4TA 4URTB 2LABA 3E3QE 4CVUA 3KWWA 3OB8A 1HZHH 4MD5B 3U1SL 4MDIA 3TESA 4Y16D 4KHXL 3OPZL 5JQ6H 1N6QL 4L4TB 1S7TB 2A1WH 1KLUB 4NKOB 4XAWH 5EBMB 1S7SA 1QLFA 1XT5A 3WSQH 3QDGE 4O5LH 3EOYG 5BRZA 3LB6C 5CKGA 4OCXH 5CHNA 4Z7WF 4WHTA 1DBKH 1RZFL 25C8L 2NY3D 4Z77A 4M7JH 2HFEB 3CFIC 4LPUA 1MJ7L 5HGBB 1H9VA 2DM2A 4FXKA 2DQGH 1N4XL 1HINH 1WFUA 1IEBA 3ZDYE 4MA8L 3ZKND 1NBYA 5DUPL 4UQ2A 5GRJH 5I1EH 1QBML 5IMMB 1U2CA 1MCIA 3QIUD 2X44D 2YRZA 5C08B 4TQEH 1CE1L 3LS5L 4HT1L 3GHBH 2NXYC 4PGJA 4PP1D 5F3BB 1TJGH 1VCAA 4IRJA 3VDAA 5TE6H 3FZUD 4Z7QF 3MRRB 5FDWB 4KUCF 1MAML 3UBXB 4MNQA 2Y72A 1VEPA 2ERJC 2MPAH 2OK0H 5IMLB 1QFOA 4KROC 3DTXA 5TFSH 4C55A 2AGJL 3BN9D 1XGUB 1F8TL 2OX5A 3D0VB 4IM8A 4X6FA 4FQIH 1AO7A 2K7PA 4XX1G 4JO1L 4K23L 4LCWA 3O6FC 1IZKA 1NQBA 3PGFL 4HAFA 5EOQL 4QRRE 5CAYB 5BZWB 5EOTB 2EYSA 4DKEH 4KUZL 3P3YA 3GMLB 2NY1D 4B50A 5DJCA 3F7RA 3G6AA 1G7LA 3QJFB 4P57A 1DLFL 2CXKA 3L3OB 3RKDD 4HXAL 1NMAH 2XQBL 2B2XL 3CC5A 4LFHD 4LLVB 1K2DA 1QZ1A 3NACH 3K2UH 4L8SC 2Q7YB 4WI9A 2IQ9L 1N7MH 4TNWF 1RMFH 1ZGLM 4WEUD 5E5MB 3LSOB 1JI2A 4EOWL 3N1FC 3I6KB 5C09A 1MCOH 2EIZA 3BP6B 3EHBC 4UILH 3OXRB 1DVFB 4I5BA 3BEVB 2VLLB 3BZEA 1VEMA 1XGPB 4PRHD 5HHOA 4PTUB 15C8L 2E6QA 3ZHLA 4UUJB 5CJBA 1P5UA 2QJDA 4MQ7B 5T33H 5ADPL 3EDEA 1NGYB 4H8WC 2DD8H 4TRPH 3EW3B 3HZYB 3UYPA 3ARBC 3FHQA 4L3AA 3L1OH 5F6IC 2A6IA 4YGVA 3V4UH 5E8PB 4PJEE 4OF3A 2HTLC 2DI9A 1AR1D 2A1WL 1B0RA 2E6PA 4PJCF 3SDAB 2I9TA 3V6FB 1TNNA 4U6VH 1AXSB 4OFIA 5ANMB 3UO1H 1F90H 1J5OL 5E1HB 1FBIH 1JPGA 2VC2H 2P47B 1D5ZA 1TVBA 5I66B 1DBKL 1T2JA 5ID0B 4M7JL 1R6VA 2IQAB 5CWSB 2WSKA 1LQSR 5B3NA 3JWDL 3ILPB 5L6YL 1UYWH 3K74B 3CXHK 1X44A 3Q1SL 4J8RB 2NY4B 2OL3L 5DJXA 2HLFD 5C0AB 3B2VH 3LKSA 5GRJL 5I1EL 3DLQR 2L4OA 4JY4A 2DI8A 5ESAB 3GHBL 32C2A 3MCG1 4D8PA 4NPYA 5FGBA 1UJ3B 3MRFB 4GRLA 1IVLA 1MPAH 5F1IB 2WLYA 3RPIB 1BQHA 3VXPB 4X7TA 1A7OL 3TC9A 1RIVH 3DSFL 3PL6D 3MLZH 1FNSL 2I5YH 2VYRE 5FA3B 3IJHB 4P2RE 1D9KC 1ZSDB 3MJGX 4ZS6D 1W0YT 3FN3A 5D7KD 2AK4A 1IGTB 1N3NB 1K3IA 1P4BH 4PV9A 1S7XB 5JOFA 2NY6D 4UTAL 1NAMH 2FO4A 1GOGA 2APXA 3WJJA 5ETUA 1GGBH 4Z7UE 1T0NB 3NACL 1RFDL 1FSKB 1D5BA 5I30H 4K3EL 4GOSA 4ZXBD 2IAMB 4YK4C 5DMIL 2Q87A 4L4TA 1S7TA 1MCOL 2AABL 4ETQB 5EBMA 5TDOA 2XPGA 3HPJB 3STLB 2Z93A 4ALAH 2H3NA 4OZGB 2OM5A 3RNQB 1Z9OA 4YHZL 1EMTH 3DXAD 2OS7A 1D7FA 4KMQA 4RIRB 2HFEA 5IQ7L 2AJUL 5SWZA 4Q0XL 3MFFA 3I3BA 4J3UA 4MA1B 1QLRB 5DJZB 8FABB 5SWSB 2GJ6B 4IOFD 3QIBD 5J1TC 1DL7H 4OCYH 4M1CC 5IMMA 5C08A 2P8LA 2UYLB 2NY7H 4P3DB 1N6VA 5GRUL 3P0GB 4U6VL 1HHIB 4MD0A 4UIKL 1PG7X 4HS8L 4LCUB 2C3VB 4LSUL 3TBYB 2VC2L 2HKFH 5D7LB 2O5ZL 3UBXA 5JOEA 3F5WA 4LIQL 3FO0L 2B4CL 5DXWA 3IDGA 3V4PL 4F2MB 5EZLB 1MCPL 4RCAA 1XGUA 3MRDB 3QIWD 3UBXG 1FO0H 3EYVA 5JMOC 3ELAT 2N1KA 4OLZL 3WNKA 1YECH 3O3AB 3B2VL 2Q3AA 2YC1B 2B0SL 4PJDB 5D1ZD 5CJQL 3RVVD 2FX9H 4LDLB 1RJZA 5J12C 3EYQC 1EK3A 3SOBL 4OFPA 1BM3H 3H9YA 1BQSA 3IDNB 5KG9A 5MERB 2XZZA 1PG7H 5E2VH 4PJ7E 3WFBL 3QUKA 4WJ5B 4R3SA 3FRPA 1U92A 5JIKA 1T1ZA 1NANI 5C0CD 4GG6B 1TJHH 4XP6H 2P1YA 3LSOA 4S11A 1CDYA 1RIVL 2XWBB 5CZXD 3ARFD 1JHTB 3P0YH 1FIEA 2P48B 3IKCB 3MLZL 4RGND 5E00B 4AMKH 3BP6A 1ZHKA 5A2IH 3B2UD 5FOJA 4JRYD 3RVTD 3HAEB 1FFRA 2IALB 6FABH 4GMTH 5CBAB 3UPRB 2NZ9D 3QHZL 3W5MA 4CL7A 4MQ7A 5DJYA 4HLJA 5J6GA 4LRIC 2FZ3B 1A7QL 1NAML 1NGYA 3TT3H 1R3KA 3HZYA 4BYHA 4LLQA 2ZUQC 1KJVB 5DJAA 1KJ3H 2UZIH 2YRLA 1OTSD 2VTFA 2VL5A 4M7LT 5D4QA 1AY1H 5JW4N 4BZ2H 4XTRD 5JQHC 2D9CA 4ZNEA 5E8EB 2CDFB 3W2DL 3HE6C 3V6FA 1RJLA 4PRHE 5I1IL 2H9GB 4MA7L 5ANMA 2AJZB 4OZHB 5TPWL 4QHKI 5EU3A 4UU9A 5IP4A 1UM6H 2BX5A 4X6BA 5I66A 4KWUA 1BVKB 2VWEC 2IQAA 4AH2B 5KVMC 1ZS8B 3R06B 3G6DL 1N0XH 3ILPA 4PRPA 3T2QA 4G8IA 4OD3L 3BKJH 3GO1H 4ZFGH 4OKDA 1BBDL 5DUML 1NJ9B 1DL7L 1R5IB 3FL7A 3QEHA 1M7IA 3ARGB 4YHKH 1ORSB 1QQDA 3C09B 3QAZC 2O5XL 3LKQA 2OXGA 4HWBA 2NYYD 4JO3L 1WZKA 1UJ3A 4PJXB 5HI5C 4OI7A 4G7YH 3WFHB 3SE3C 5FDYA 2HKFL 4D0BA 3C60A 1X6NA 2AJXL 2DLIA 4IIQC 1JNLL 4MZ2A 3DUHA 1JPFA 2K1MA 2A6KA 2UZXB 1U8KB 5DK3A 4YUEH 4X8XA 5FA3A 2HTKC 3TO4B 4M03A 3TBTB 5J3HC 5K9JH 2A9NH 3VD9A 3BEWA 2YHGA 3HC4L 4UTBL 5IESL 3P4LA 1ZSDA 3NCYP 1IGTA 2EZ0D 4E42B 3SJVD 3QDAA 4M1DL 2ICWI 4NZTH 4ZFZB 1V3LA 5IW6A 3DI2B 1SYVB 4CVXB 3CDGA 3SDXF 1T0NA 2BSED 4LVHB 3HE7B 4N9GB 3AMLA 3A0OA 3VXRA 3CFBB 4XP6L 2IAMA 5J1SC 4L8BB 3WMSA 3W0WD 5K59F 2EECA 1FVEB 3LKPB 4N0CC 2VAJA 3TIEA 4ETQA 3QUYC 3HPJA 4M6NH 3STLA 3NCYS 4M3JA 3BVNA 1BX2A 1M6OB 5D8JH 5D7KE 1Q94A 3W11D 4GMTL 1FJ1B 3MA9L 3FB6A 4JB9L 1QSED 1XIWB 1AKJD 1VPOL 2ADGB 4P0DA 5JUEL 4NNXB 1GGYA 4YXLL 4PJBE 5GGQH 4OCNC 1U95A 3GMOB 5DJZA 4W4NA 2GJ6A 5DHVB 3W9EB 4LSSL 4M7LH 4KAQH 2JB6A 1KJ2A 1SJHA 4X4XB 1RHFA 3R0NA 5AUMA 5CD3A 3PDOB 4R96B 3MV7B 3RVWD 4ODXB 3U7AA 1AD0B 4XNZC 1FZJB 3D2UB 5DRXB 2BHUA 5DI8B 4K3JH 2HAZA 3DXAE 3VG0L 3X14A 2GTZA 4HIJB 2ZG1A 1FDLL 4X80H 2VNCA 1EBPA 3UTTB 5DS8A 3T8XB 3MRDA 1U8MB 5F3HA 5K9QG 1I8KB 3BKJL 5TDPB 5TDNB 4ZFGL 3G04A 1MCNA 2UY7A 1KCSH 4OLVH 4LBEA 4U6YA 3BUYA 1KNOB 4YHKL 3S36H 2CK2A 4PJDA 2R2HA 3UDWA 1LILA 2EIEA 2GUOB 3GMNB 2R15A 3MODL 3RZCC 1OQOA 3G5VA 3M8OL 3IDNA 4N0RA 2HMID 4G7YL 3U4EB 5DURD 2AEPH 3ULVF 4QHLB 5AG9A 4XCFL 3QQ3A 3ZKXB 1T1WA 2QKIA 4GG6A 5E2WL 3LRSA 2DLHA 4KZDL 2YPVL 2HRPH 2IPKB 5E00A 5EO9A 4JO2H 5JNYA 4RGMB 1CICA 5SX5K 2R0ZH 4G9FA 2JK5B 1EZVY 4MAYD 5SX4H 2XN9D 1FPTH 2APFA 4NQSB 4WFED 4QEGA 1I7UB 2IALA 4L5FL 1AGDA 2CLVB 2C1OB 3PP3H 3MGAA 4PLOB 1IQWH 2IBBA 4J3OC 3A6CH 2FZ3A 1F97A 3HAEG 1CLYH 2PO6D 5JORA 1MHPL 1FV1B 3E2HC 3NFSH 4ZUSA 4MJ6B 5LQBH 2B5IC 5C0CE 1KJVA 1S3KH 2R2BA 4V1DB 4NC2B 5F8QC 1HXYA 3GK8L 3DMMB 5DQJA 1I9IL 2ATPB 3QO0A 4RGNE 4OT1H 3T4AB 3RQ3A 3PWLB 1DE4A 4JRYE 5DO2D 4EKXA 5CKAA 1XGTA 3HKFA 3V52H 4NO2B 3BDXA 2H9GA 2VXVH 5L8KB 4LCIH 3DGGA 4WV1B 3S9DB 4I0PB 4HK3J 2F15A 4P2OC 4RFNB 4GXUN 3WIHH 5T1LA 1HQRA 4Y5XC 4P23B 1T5XA 3P4MA 4H8WL 4JGJA 3OKKA 2A0LC 4AH2A 1P7KB 2X1OA 2BHZA 4EI6A 1ZS8A 3DHMA 3R06A 3ZKQD 3TEUA 2LTQB 5GS2H 4MQXC 1MJJA 3OAUH 2UVFA 3A67H 5E0QA 2I25N 3VXNB 2ZKHH 4H5SB 1ZK9A 1KFAH 4LKXA 1NLDH 2R1XA 4ODTH 3U82B 3FONA 3DX6B 4L9LC 3VJ6B 4MNGB 5IBLD 1UWEH 5LVEA 5FYJU 1DUYB 4FZEH 2AP2A 2VDPH 3BZ4B 4XNUH 1IEHA 5D71H 1HSAB 1FIGH 5KSBF 1LK3H 1EFQA 4UV7H 2E9IA 5DZOA 3CDCA 4YDJA 3IF1A 4XC3H 5DRWB 4HD9A 1QRKA 5I1GH 1KCSL 4OLVL 1JK8A 3TBTA 6CGTA 5J89A 4N8PA 1KN2H 5BW7A 1IQDA 2DIAA 4RMWA 2O93L 3WHE1 1A64A 4XNXL 3CH1A 1MWAA 3CXDL 4JKMA 3MBED 4I0CC 3MJ8A 3GBNL 1PJ9A 4NC1E 1RURH 1XH3B 4CVXA 1NGPL 3EBAA 5HDBE 1FVCB 4RMRA 3HE7A 3QUXD 3N50A 4V2BA 4E41D 4ODVH 4G6AD 4S1QL 4F9PA 1KEGH 2YBRB 2GSIB 1AQKH 1NC4D 1A02N 3QDHA 4A2MA 5DJ8B 2W0LA 4WWKC 5I8KL 3PWNB 5EFIB 5FIEA 4XVUD 3Q3GA 4WRLA 4U0RB 1FJ1A 3JUZA 3SBWC 4RZCB 3SJVE 3K0WA 1IQWL 4Y4HC 4LEXL 4IOSD 5SWQB 4U3HA 1NCWH 3F12B 4NNXA 5FKAA 2MMXA 1I1YA 3N1MC 3NFSL 4LHQB 3QPQD 4EN3B 1S3KL 2R1YB 4PJ8A 1Q9LA 3BSZH 3LEVL 3W0WE 4X4XA 2FL5B 2C3XA 4DUWA 5C0DB 3EOBA 3STBA 4AG4L 4LASL 3UJIH 1IGFL 3WS3B 3AREB 4P2QD 3V52L 5F6HI 2FYYB 1AD0A 2CLRA 3IGAB 4UINL 1FZJA 3T08A 5GS1C 1C5CH 5DRXA 5E9DA 4KRLB 5EBLA 1QSEE 4HIJA 2FBOJ 3OAZH 4UOJA 2AW2A 4I3RH 1U3HD 2CRZA 3T8XA 1LHZA 3O41B 3S97C 1I8KA 1J8HA 5D96C 2L7JA 1NLDL 4LNRB 4J3XA 1V8HA 2YMXL 3L3DB 3S8WA 3KR3H 3IJSB 1YEDA 1ZVHA 4KVNL 3IFNH 1NUDA 1UWEL 4ONHA 5I1AB 5I18L 3NCMA 1U8LB 4P46C 2E3VA 1I1AD 3C87A 2BZDA 1MFCH 3QWRD 3HB3C 3U4EA 5CEZD 3GIVA 1DQDH 1CIDA 4IS6A 3MA7A 3AFLA 5KSUA 1FGVH 1B90A 2Y5TA 5ESVA 1C5BH 3HRZB 4YXKL 1X5YA 2CUHA 3QNZA 4UMGA 1LK3L 3B9KB 4GMSH 5CSZA 1ZA3B 1YEHL 3IDIB 4AEHH 4YAQB 4JFYB 3U2SB 1F6AA 3HI6H 1MCRA 1ZGLP 2NY2C 4MMZC 3BO8A 4H0HB 3DX7A 5DWUL 4UNTA 3V5KB 4KJYB 3D0LA 5F7UA 5ADOH 2J12B 2Q8AH 4R2GD 2IG2H 4GT7A 5E5RB 1JWSA 3DUUB 3BYTA 4N0UB 2PR4H 4HDIB 3IRZA 1I9RH 3O8XA 4NQUA 4WW2A 5C07B 1NMCB 4V1DA 5JZ7D 4PD4K 3DMMA 4QRUA 5CJXA 1JHLH 1J10A 1WWBX 3BIBX 3GMPB 1I3UA 4JHWL 3N0PB 1N59B 4CW1B 2XN9E 4WFEE 2J4WH 5HVHB 5AAWA 1ZHBB 1WAAF 5DJDB 4I8DA 3TYFA 1INQB 5HBBA 1Q72L 5C3TA 3QH3B 5C0BA 4MMXC 3BPCA 4TNWK 2J3SA 2IANA 4XBEH 4P23A 5BV7H 1NCWL 5GGSY 3WLWD 4R4FH 4UBDC 2F5AL 2PXYB 1NL0L 2ESVD 1J05A 4E0RA 4A6YA 3MZGB 3OKLA 3MRJB 3UTZA 3VE0A 4NSKB 5KS9B 1IL1B 2XZAL 1KPUB 3VJ6A 1MQ8A 1GGIL 4MNGA 2NX5B 5MEPB 3HFMH 5T1DH 5DRNA 4KI5D 1T03H 3TBVB 4NZRL 1CGUA 4F15B 1HHHB 3BZ4A 4YDIH 2E7LC 4KRPD 2J8UB 1L7TL 2F53B 4AJ0A 1QSZA 1UCBH 2AI0H 4XVJH 5DDHB 3DVGA 1DUZB 1QR1B 4QWWD 1QFPA 4Q6IA 4RFEA 3SDDB 5DRWA 5FYLL 3CMOH 3VXSD 2HA1A 3FO1B 1MVUB 1GPOL 1BWWA 3CVHA 5A2JH 4FFYH 3H42L 1SBSH 1V05A 3RTQD 4HS3A 4LSPH 1K8IA 4W81A 7FABH 5MEND 3WKNA 4S1DC 4PJIF 4JQXC 1I8MB 1CLZH 1I9JL 3PNWB 1KIQA 2H2PD 1XH3A 1JN6B 3EO1A 1T04A 3QG7L 5EUKB 3VU2A 3DX8B 1DQDL 2FECL 1QKZL 4JJHA 1KACB 4U7MA 3SDYH 3QXDA 2D4DA 4U1JB 4Z7WB 1YEIH 1PQZB 2APBA 4BFGA 3U46B 3VA2C 2YBRA 2GSIA 4KKBD 1BZ9A 1IM9D 3NIDE 3KLHC 1X5AA 4Y4KB 3MV8B 4W4OC 5DJ8A 4MXVF 2HT3C 1DVFC 5I8EB 1BGXL 3C08H 5ICZB 4HJ0C 4KJQC 1C1EH 1OT2A 5IQ9B 4FQPA 4PJ5A 4OFDA 4HKXA 5ADOL 2JKXA 3O9WB 1OTUC 4J2XA 1U3JA 5SWQA 3F12A 2W9EL 3MRPB 4Z7NE 1A6VH 1CTNA 1FZOB 4E41E 5K93A 4EN3A 2F8VA 5C70A 1YY9D 1PLGH 3P0VH 1MJ8H 4XP4L 5JW5B 4UIMA 3QEQD 2HJFB 1OGAD 3NZ8B 3MO1A 5EU7C 1Q9WA 1E4XH 2HN7B 2MHAA 3HUJF 3Q6FA 5CZVH 3VFSB 3L7EA 5E08H 1LK2A 5F9JB 5ICXA 1UM4H 2VXTH 2ZOKB 3IGAA 5JIHA 1T83A 3SDAC 4BSWB 4MS8C 4IRSB 2HFTA 4XI5C 4PRNA 5FA4B 5DVLA 3QXTA 1H3GA 3KNBB 1UGNA 5D9SB 3DSNA 3MRHB 1JNNL 4R4FL 3HG1A 3O41A 1FE8L 2AJ3A 2BOCB 5TGBA 3UX9B 1F2XK 3HPLB 4JHAL 5HGGS 3FT3A 3GKZA 4F33B 3ZKNC 4P99A 4NYLB 2NY4C 1NC2A 5I1HH 1YUHB 4PG9B 3IJSA 2H32B 3KYNB 3QIUC 4P2QE 4FQCL 5CUSH 5ICYA 3MOAL 1WUNT 3RPKA 4PP1C 5DF0A 3GMQA 5GGSB 3OJ2C 1U8LA 1L6XA 5AZEH 5KVDH 1SMAA 3RA7H 2J6EL 4YO0B 1OY3B 3TZVD 1MIEH 3RAJH 3IXAA 4APQB 2GITB 3HRZA 2CRIA 1VDGA 1NFDE 1ZA3A 4Q6YA 1T22B 1UB6A 2X4QB 1CFQA 4HQQL 3NFPA 5CSGA 1NH6A 3ZTJG 1FG2B 4QTIH 1MCHA 5DMGD 1G9NH 1CFSB 1SBSL 3GMRA 3ARZA 3VH8A 4FG6C 4KJYA 1MRCL 3BGAA 1M1SA 5GGVL 1T20A 4PJCB 5IV2A 1RVFL 5BVJB 3LKNB 4JM2D 5HYQB 1PKQB 1HH6A 4OBRA 4AEFA 1JHKL 5CEZE 3VH8G 2M1KA 4S2SB 3D69A 1OP3H 4N0UA 5DT1L 4KMTH 4X5WB 3ULUC 2VOTA 1BFVH 2Z31D 5HY9B 4XMKL 4X4YB 1FSKC 1W72A 5IOPB 4LCYA 3SGDI 4DTGH 4NNYB 5T1KB 1RPQA 1N59A 1IAKB 1YDPA 1A3LH 3MMEB 4WO4B 1ZHBA 1DP0A 5IMOB 1YQ2A 3C08L 2GSGB 1QFUL 4PIRF 3QNYB 1NCAL 4V2CB 3V6OA 5E4IA 3GSNL 2K3TA 1UCTA 4DN4L 4F57L 3OKNB 2P5WB 3BYYA 3ARTA 2YK1H 1DQJB 2PXYA 2JJTC 1I7RB 2YD8A 5HYIA 2V9RA 2DDQH 3LKRB 1PLGL 3KYMA 1MJ8L 4MA1C 2VLRB 3L3HA 1SY6L 2A6DA 2W0KA 2XNAB 4NSKA 1IL1A 4NM8H 1KPUA 2NY5C 3WD5L 1AR1C 3ZTNL 4KKLD 1OWWA 5HD8C 2FHCA 3RWJB 1A3RL 3QRGH 4PRID 5I1DA 2FSEA 3ZT5A 5FEBA 2VXTL 3IETB 5F88B 5F97E 2NTSP 1K5NA 4WTZA 4K3DH 1S7RA 1S7UB 4OGAD 1LEKB 2J8UA 5HYFA 2Z91B 2VLJB 2X4PB 3VFRB 3EYOB 4WTZG 4ZSOE 2ESVE 3HCVB 5IKCB 1O0VA 3HTLX 2PW2B 4UT7L 2EDJA 5F93C 3SEPA 4BFIA 3RIAF 1MVUA 2I60H 3OZ9H 3B5HA 3WL9B 2X10A 3FB7B 4DFIA 1VGKB 1DQLH 3EYUL 4Y19A 4KI5E 2XY2A 3H9HB 3OSKA 4JN1H 1JUFA 1HXMB 1FNGA 3DX8A 2FHBA 1IGIL 2V5TA 5I8OH 1PQZA 4KKAD 3FQNA 4OM0L 5K9KB 3QXAB 5C0JB 1P4IL 2QSTA 4X98A 3VXSE 4HWNA 1EO8H 2LU7A 5JHDD 1I3RA 4QTIL 4XCEA 5EU5A 1TXKA 4ELME 5I8EA 1KCRH 5DQ9B 4ZS6C 5MENE 4XXCC 4J12A 4OF6A 3L9RA 1U91B 4X6CE 4JFDD 1ZHLB 4EEEA 2C1PB 1JPSH 1VFAB 4N0FB 3RHWK 2AVGA 2KZWA 1ODAA 1JF5A 2AV7B 4I3SL 2NW2A 2VR4A 4ZXBC 3BISA 3QDGA 1CFVH 1N64H 3NZ8A 2NXZD 1YY8B 4PRAA 4Z95L 1JRHH 2V9QA 3REVA 4JVUA 1LVEA 3VFSA 1RIUL 4YQXL 3G6JE 2ZOKA 4H26B 3RDTD 4UI2A 2GTWA 4IRSA 4OGYH 3P9MA 1JYNA 3BRFA 4G8FB 5FA4A 3DGCR 5KANG 3BH9B 3BGMB 1MH5A 3QA3A 4L8DA 4OZ4B 1UA6H 4PGCA 2A74B 4F7CB 3X3FL 2OP4L 3BWUC 3HR5B 2D7TL 3GSXA 4EI5A 1VADB 4LCCB 3SY0B 3T65A 4JFPA 4K2UL 4JFQA 4IOFC 1YEGH 1H3PL 1F58L 3QEQE 5LAXA 3HMXA 1OGAE 4NYLA 5JLZB 1YUHA 3FAXA 2Z8SA 1OGTB 3ARGC 3QRGL 3THML 3ZSTA 1BREA 5FOBB 5IFJB 3GKWH 3MRNA 4H25B 5JA8B 4YO0A 1CVSC 5TE4H 2EE3A 5ELIA 1U6AL 1BF8A 2PYED 1MF2H 3RWDB 2GITA 3GIZL 4TTDD 5FAAA 5A16B 4KJPD 3BIKA 4H1LA 4X6DF 4QRRA 5KSVB 1CDHA 2AQ3A 4GS7B 4PTTB 4QYOA 1T22A 5DYOA 3QIWC 3P4OB 1EAPB 1LD9A 3FOLB 2GY7B 1RZKH 2B39A 4NFCA 1PW3A 1FG2A 1RUQH 4O2FA 4AM0B 1CFSA 5HI3C 3OMZA 3TO4C 3QHFL 2R8SH 1H3UA 3BJLA 4JHZA 1JYVA 4OAWA 1PVHA 3S3JA 5JA9A 4GAJH 4S2SA 1M7XA 3GM8A 4Y1AD 2ZOLB 4NP4L 2PNDA 3HNTL 3NIGE 5I8OL 5J1AB 2FJFB 3H0TB 4KK8C 2AK1H 5HY9A 5B3JE 5IOPA 1XCTA 1TVHA 5KN5A 4PB9H 3ARFC 1ZLVH 4ZMAT 1LO0L 4F9PC 3KPSB 5E8DL 3VFPB 3FOMB 2WLZA 1EO8L 1ROWA 3MUJA 5HYSB 1R3JA 2SEBB 3B2UC 2DTSA 1OW0C 4BELD 2ITDB 1K4CB 3MLYH 5DK2B 2GSGA 3UTOA 4HC1A 3VDBA 3SKOA 1JNJA 1BEYL 2AXGB 2ZPKH 5DC9B 2AQ2A 4PJAF 4LPTA 1CGTA 1XIWC 1NGQH 3MRBA 1DQJA 4PJEA 1EEQA 3SGKA 3FTGA 3HC3H 1QSFD 5EO1B 5JHLH 4PGEB 5IFAH 5DD1L 1OTSC 2QADB 2XNAA 1J7VR 1N64L 4WEBL 3GSUA 4NFDA 3RWJA 2D03L 4IOIB 3LN4A 4MD4A 5DMJB 3VGEA 4Q9RL 2JIXB 5F7HA 3LHPL 1G7PA 1GAFL 1S7UA 2Z92A 4U1NB 2WBWB 4R4BB 1TQBB 2Y36L 4K7PL 4JAMB 3PUCA 2X4PA 1AGCB 3TFKC 1R5WB 4LSVL 1ITBB 3TA3B 1GJIA 3FT2B 2PN5A 4RGOL 4RNRA 3SDXB 1BZ7A 1YEGL 5JIPA 1RZJC 1DBAH 3X13B 5FYKL 3UJJL 1BWMA 1OLZA 2RIKA 3IYLW 4ZOBA 4MJ4A 5HI4D 1G6RB 5FKPB 4PRIE 5FGRA 3LN5B 2OR7A 3KJ6H 5C8JB 2Z8VC 2NYYC 9CGTA 4HWBH 4JKLA 3SQOL 3TJEH 4KTEH 5TE4L 3DIFA 3WJLA 4O58L 5FUCE 4XP5H 2BNQB 3ECBA 3QJHB 3QZWB 1TETH 3MACH 1HOCA 4H88L 4P2RA 1NEUA 1YJDC 2BMKA 2DQEH 3ZKXC 1YZZA 1EEZB 4FQJL 1MOEA 4BM7A 2RBLA 3OAYK 4IHOB 4LPVA 1C08B 4WW1A 5JPNB 5DVOA 3HHRB 2LVEA 1NFIB 4YLQT 5A2KH 5IB1B 2EZ0C 1U91A 5IB3A 4YHML 1ZHLA 4DUXA 2C1PA 3ALXA 4LQFH 4QT5B 1VFAA 1JV5B 3MUGB 1G6VK 1QR4A 3KXFD 4GAJL 5E95B 1KPRA 3GHEH 3PG2A 3SCMA 4I2XE 1KYOJ 3KPMB 1UZ8A 4X8JB 4R0LB 4I48B 12E8L 2E27L 4JPIB 2MSPA 1ZHNA 4PB9L 5DMKB 5EO0B 3V95A 3DMMC 3X17A 2WBKA 5JHDE 4HJJH 4CDGC 3CCHA 3QUZA 1U8PA 3FFCD 3P9WB 3RGVB 5KZCD 4XPHL 4NM4H 2OCFD 4ZUVA 4CNIB 4JFDE 2D7PA 2N7BA 4WV1C 4I0PC 4ZQKB 2ZPKL 3KPOA 1BOYA 4RFNC 1U8QA 1AFVL 1I3GL 3UP1A 2A74A 4Y16A 5CBEB 4BFEA 4G6KL 3VMPA 3LKOA 4ODBD 3PHOA 4LCCA 4Q9CA 1CBVL 3HC3L 1TQCC 2LTQC 1BF2A 1TTFA 3C6LB 1EDQA 4JEGB 1OGTA 1KJ2H 3RVWC 2XQYK 2NLJA 4PJGF 5FOBA 5ESQA 4JDVB 4H25A 4KGJA 5C1MB 3D9AH 1MCDA 1DEDA 1GOFA 4Z76B 5DQDL 2ADIB 4IBLT 1VHPA 5MHSD 5A16A 4TTGA 1VFBB 3N1QC 4PTTA 4UB0L 1UQSA 2EO1A 4X7SH 5CJ5A 3UPAA 4GW1B 4ETYA 5KVEL 4HMCA 1GZQB 3K3QA 4C4KO 2VKXA 2H6PA 3PDDA 1LGVA 2VDML 1QRND 5A2LH 3GJFA 1F02I 4J23A 5L2JA 4PJ7A 4FTVB 2VZTA 2VDLH 3GB7A 3C8KB 2F58H 2Q76B 4NO3B 3WFEL 4C56B 3JV5A 3PQYB 4R26H 3TJEL 2HMIC 4Q2ZB 5DHYA 3QWOA 4XP5L 2PYEE 2ZOLA 1TETL 4MZ3A 2FJFA 3H0TA 5D70L 3SGEI 1CL7H 1S5IL 1BD2E 1QD0A 1GYAA 1NKRA 5IVZB 5CGYC 1ADQA 3AS0A 5HYSA 3PP4H 1MCLA 4HV8A 1NLBH 1AR2A 3DURA 4S1SH 5FO8B 1T1YB 4MJ5B 1LMKA 3AY4A 5HYSG 4U0RC 4G8EB 4Y1AE 1FFNA 4WFGD 5IHLB 4LFHG 4GW4B 4WEMB 1TLKA 4YDVA 5EO1A 3ULUL 1X5LA 4BH8B 2G60H 3TYGL 1E27B 1SHMA 4PRHA 3RNKB 5A1AA 1NBZA 5HHQB 5KSBB 4JHBA 1YEFL 4FOMA 1XR9A 3SDCD 4IOIA 1IZJA 4ONOA 5C0IA 4DW2H 2A77H 5DO2C 4HIEB 4NWUL 2JIXA 2CDGB 3OHXA 2YXFA 5GS0C 4OZIE 1YN7B 3AREC 1XR8B 3ZDZF 4R4BA 1T83C 4C83A 3KJ4B 4QCIB 4JAMA 1AGCA 1RUKH 3T4YB 1Q0XL 3E8UL 4PJ9B 3IVKB 1GC1C 4YPJA 1AI1L 3FT2A 2X70A 1QSFE 4FN0A 4FXLA 4LARL 4GJTB 3OTTA 2X4UA 4QXTB 4CMHB 4JFFD 2NY5L 4DGIH 1G6RA 3LN5A 3IU4L 4X9FA 5LCVH 5C8JA 4MJID 3QI9D 1PY4A 5E70A 4LGRB 2VR9A 4MGXA 1G1CA 4PFEA 4Z7OF 3EFFB 2FCBA 4IMLB 1I8IA 3BX7C 4WHCA 3TNMA 3AXLB 3IDMB 3UXFA 2EH8H 4JKWA 4DZBB 1UKTA 3WHE0 1YYML 3B9KC 5JW3H 1N2RA 3QZWG 5FYJH 1A9EB 5FV2A 2JE8A 4FQLL 4FMFA 5I1KH 1NFIA 2FATL 2O5YH 1QYGL 3MBEC 4X5XB 4I3GA 4NN6B 4G8GB 1MWAH 2WIIB 4QT5A 5E2UL 2XY1A 5B39B 3L5XL 1RSFA 1CGXA 1FAKT 4NNPL 3M07A 3O2VL 3PL6A 3FN0H 3DOSA 3JBG7 1CFTB 3FCTB 3KPMA 5EZOL 4M3KB 4R0LA 4I48A 5CP3A 4G6AC 3BQUD 1NMCC 1CD8A 4K8RC 5DMKA 3RIFF 3MQIA 2R56H 2DKMA 2GAZB 4P2YA 2A9ML 1RJYA 3T0XA 1TJIL 4XVUC 2Q86B 1YPZF 5D2LE 5HGHB 4CNIA 1CN4A 5HVHC 3EFDL 4UAOB 4ZQKA 2V5MA 2ZSVA 2P7TA 1JI1A 1YMHB 2LU4A 3MLSL 3KXFE 3RY5A 2CLZB 5GJTH 4AIZB 5E6ID 2YWZA 4DQOH 1P7QB 2NR6C 4HXBH 5E24E 2YKLL 3PJSB 4DAGH 2R4RL 4G42A 3NFNB 5JW4R 1KB9J 5F89A 3FFCE 3N85L 5DVMA 4WENB 2XFXA 3DXAA 1WZ1H 2BCKB 3KPLB 4Z76A 1H15A 4F15C 2XACC 1XFPA 2HVJA 3N06B 43CAB 3QIBA 3TBSB 1VFBA 4FZ8H 3U6RA 2Q8BH 1CGVA 1U3HC 2W91A 5F1KC 4EDXB 1KLGA 2VZUA 2X6MA 3D39B 4WVRA 1U41A 4U1LB 4NN5C 4AEIH 5AAMA 5E1AB 1LE5B 2BRRH 3SDDC 5D93B 1GZQA 3BP4A 4JPKL 4P5TB 1JGUL 3T1WA 4NWTH 3ARDD 5SX4I 5LCVL 5CZKA 5KSAB 5FGCB 4DGYH 2OTPA 3C8KA 3D87B 3PQYA 4HBCH 3U0WH 4M61B 4I18B 4YHYC 1NCDL 3VRLF 1KGCD 5JDSA 5MHSE 2JB5L 3HLAB 4FQ2L 5GRXG 2VMFA 2DI7A 1S9XB 1TMCB 5FUZH 3CFEB 2LV4A 5DEFB 3P73A 3RRQA 3OR6B 5FM5M 5IVZA 2VB5A 3DX9B 4LPCA 4O2EB 4P5MB 4QXUH 1QBLH 3C8HA 3OKMA 4KY1H 1TCMA 3FO2B 2OZ4A 1NDGA 5C9JA 1QRNE 4ZYKA 4Y4KC 2KKQA 4YHIA 3IJYB 3ABZA 1YYLH 1RULL 1K9TA 1ZTXL 3KPRB 5LKNA 2J88L 4R2GC 5C0CA 4K9EC 3O9WC 2EE9A 3TPUA 4CADA 3QCVH 3RVXD 1WGOA 4KHTH 3MCKA 3T3PF 1Q1JH 2DJUA 1T21A 3VXOA 5FF6A 5L8LB 2XZCH 4JRYA 5JZ7C 1E27A 2Z0BA 2EDTA 5JMRA 3KHOA 4ZAKD 5INCB 3BKCL 2R29H 5DD5L 4HIEA 1PKOA 2CDGA 2EDHA 1BIIB 1G1YA 1XR8A 3O4LE 2EDLA 3U36B 4G6ML 4NKDA 2C9AA 5I16B 4IDJH 4NUJA 1EGJL 4IRSC 4JG0H 4QCIA 2OSLA 5DHXB 1XGYL 3HI1B 3RWEB 1ES0A 1WJ3A 3IVKA 4WFGE 4PJIB 2YPLD 5GJTL 2JF1A 1RUMH 2DL2A 1YQVL 5IM7A 2AJVH 4U1GB 4PJHE 5I76A 4Y2DD 3LB6D 4X83A 2EYTA 4HUXA 4HH9B 4DAGL 4J1UB 4M1GL 5JR1H 4U6XB 5CFHA 4A6YH 3JV4A 4U49A 4GAYA 5IBTH 3MLVH 4MXQC 1MELA 4JM4H 4WUUD 4YFLF 1WZ1L 1BMGA 5DSCB 4XWOC 1YEEH 1JFQH 2V2WA 3EOTH 4HPOH 2JELH 2BP3A 4PJFE 3BD3A 4PG2C 1GCFA 3EFFA 2G75A 1J1OL 4TNVF 1KCUH 4HUMB 2QEJA 3BT2H 1BJMA 2BSSB 4XXDB 2Q8BL 2H41A 4APQC 2ADJB 4QWWC 5TE7L 2VLKD 1BLNB 5FUOH 5IVNA 4LIQE 3RZWA 4O51A 5EBWA 3INUL 5BQ7B 1RIHL 1RZJL 2OJZL 1NCCH 3M17A 4JFFE 3U30B 5KJRL 2XQYG 4KROD 3H9SD 4Z7VF 2BVQA 5HHVH 4MJIE 2YXMA 3CVHH 3MPCA 2WBJB 3O6FD 3HUJB 4M5ZH 5TF1H 4FFVD 4X5XA 4HW6A 4G8GA 2WIIA 1EFXD 1RK1B 4CDHA 1NCBH 4XBGA 4DVRH 4F58H 5IJVB 3FQXA 1AJ7L 4JRXB 3N9GL 2X4RB 1IC4H 4YXHL 3ESUF 3FCTA 4XP9L 1FFQA 3LQZB 3VXUD 2G2RB 1YJDL 4HJGB 2DQHH 4MXWH 3NGBC 4IMKC 4QXUL 1QBLL 1M71B 1F3RB 4OJFH 1XF5B 2GAZA 3SJVA 2C7UB 4FFZH 3FB8B 4WO4C 3LPGA 2IPTH 1B0GB 3VWKB 4QTHA 4FABH 2W9LA 4WHDA 4LF3A 3EHBD 2WZPD 4CN1A 4HKBA 4C4KT 5L9DH 1N5YL 3PDGA 2Y7QB 4NCC1 1ZVYA 3W0WA 3G08A 4YHPB 3GJEA 3UYRL 2OLDA 4MQSB 1BBJB 5BS0B 4DKDC 5I75B 1PGRB 4PREA 1KIPB 1JPTH 2P5ED 1F4XH 3ARBD 1E28A 4KVCL 1A7PL 1AKJA 3KPLA 4KKNA 2ZCHH 5CEXB 1SM3H 4K3HA 2HTLD 2W59A 3WEXB 5BJTA 4EBQL 1PBYA 4NQDD 4XWGH 1EUTA 2VN4A 1X4YA 2FECI 2F54D 1QPPA 1G9MC 3D39A 3H3PL 1ZANH 5E1AA 1LE5A 4HKJB 1RHHA 2CJUH 4P5TA 3MRKA 1FCGA 3LVEA 3WXWH 3WUWA 2ZUXA 5IBTL 2GT9B 5ISZD 4GAGL 3T2PA 5E94B 5KSAA 3W81A 1K3ZA 5JOPD 4EDWL 3T3ME 5J56B 3EOTL 4JO4L 4TUKH 3CDFA 3RX5A 4JJ5B 4FNLH 4DK3A 1SEBA 4I18A 4L3CA 1U8OB 4OD2A 2V2TB 2AEQH 2EKSA 2E8YA 2W0FB 4KV5E 3C5SB 4RBPH 3NAAH 3WIFA 3MLXH 3WLBB 3DX9A 4P5MA 1A5FH 1NCCL 3PP3K 4QOKD 2P24B 2BSTB 4ODWA 2CR6A 2D0HA 3IJYA 1XEDA 5DMGC 1I85A 1LO4L 5KW9L 5IIEB 3WXVH 2FEDC 3OR7A 2V5YA 3KPRA 4M9OA 1T89C 2X1XR 4DVRL 2HG5A 4X7DC 1D9KD 3F7YB 1KGCE 4P5KB 5C0GA 2ZCLH 1DDHA 2DWEB 1EBAA 4DK6A 3FQRA 1OSPL 4MAYA 2XN9A 5A3IC 2DQHL 3V6BR 1GL4B 3VWJB 1W72H 3FQTB 2XG5A 4OGXH 4YIQB 1KTRL 3MV9D 5IT2L 4NBZB 3L3KA 3U36A 2PO6A 5FHBL 2V2XA 1XF2B 1B4JL 4Z0XB 4FABL 5IHZA 2IFGA 1G7QB 3TVMB 1DZBA 1PX4A 2XTJD 3HI1A 3IFLL 2W60B 1B2WH 1FNAA 1Q9OA 4HGWB 1LP9F 3OB0H 2X7LA 2ZCKL 2CDEB 3QDMB 4NHCL 5EC2B 3O4OB 4HH9A 1N5AB 2F8XC 1CR9H 2F74B 2OQJA 2KUTA 1F4XL 1WQVT 4KKLC 4NQXA 5ERWB 5I8CA 3FO9B 1CXIA 2ZCHL 5GS0L 4M1CD 2QQQA 4CUCA 3IFOB 3KPQB 5GGTA 2KZ1B 4I77L 1NBVL 1KIRB 1UFUA 2YPLE 1CLOH 1TIUA 2BSSA 1GC1L 2XKSA 3U7YH 3QCTH 3MC0A 2ADJA 3I9GH 2DQUH 4WU5A 1BLNA 2DQTL 3BZDA 1A1OB 4QRPB 4DOHB 4O2CA 4HMDA 1CFBA 3B3IB 3QULB 2CJUL 4JKPH 4P4RA 4M6OH 5EU6D 5EWIH 2D7NA 3RUGE 4NJAH 4WUUE 4GKSA 1CD1B 5B8CB 3QFDA 2WBJA 3MJ7B 3HUJA 3QUMH 4RAVB 2H26A 1A4JB 5BXFB 3L3IB 1RK1A 5FO7B 1NSNL 3Q48A 1KJMA 4Z78B 1OAKH 1RZ7H 5LJYH 2X4RA 4HIHB 2VABB 3N1GC 3EYQD 4C59B 3LQZA 4LPXA 1ZVSB 4HX1A 2I9LB 2VLKE 4OTXH 3PWPE 4GKZB 3MLXL 1M71A 3MRIB 1IARB 3F6IA 3FKUS 3EOAB 3H9SE 2WP3O 3CAFA 4F7EB 1JGVL 3TN0B 3B8SA 2R1WA 2X09A 2IH3B 4R7NB 3ZE1F 4LGSB 3TJHC 1WEJH 4JFED 1LO5B 4PRDB 3QUXA 3S5LA 2ENYA 4E41A 3MLWH 4IRZL 3KDMB 2HH0L 3MXVL 4R7DA 4BH7B 1FYTB 5HYJB 4G6JL 4MSWB 2ZCLL 1NC4A 3GMMA 4BSVA 3VXUE 3S5LG 3B83A 4F7TB 1F2QA 5BS0A 2IPUK 4K8RL 1KIPA 4X6DB 4BZ1H 1WICA 5T5FL 1WTGT 4LHUD 2R0LH 3RDTC 3ZE0F 1O5DT 2EKJA 5FK9A 3VXTB 4K71B 3MNWA 2NY0B 4HPYH 3QYCA 2ICWA 4JG1H 4MA3A 3BJ91 1PZ5B 1BPVA 5I19H 1B2WL 1Z9SA 2N56A 3IU3A 4Z0BH 1TQBC 1K8DA 3X3GH 2EICA 1A0QL 5FM8A 1KG0B 5D7JB 3TA3C 4P2QA 3C5ZD 4HKJA 3ZDXF 3RL2A 4RWYL 4GBXB 4HSQA 2P5EE 5J11C 2VXQL 3STZA 2COQA 4U1HA 1OF2B 4JQIL 3MXWH 3L5JA 1RI8A 5FYLD 2D7MA 2F19L 3ZE2E 1ZT4B 3HNSH 1OAXL 4R8WL 5D1XB 2QHRH 4R6UA 1AGBB 3CFDA 3NA4A 2D7QA 1NFDA 2V2TA 4NQDE 1B6DA 3T09A 4NDMB 2YPKA 4D0DB 1D5IH 2F54E 3D5OF 4TTDC 3U7YL 4PJAB 1MQKL 2EIDA 5HI5D 1M7DB 3C5SA 2VITA 1G0DA 5D1QB 4H1LH 3WLBA 1MI5B 2C26A 3OV6A 4HIIA 5EU6B 2DAVA 2P24A 1MLCA 4NJAL 3QWRA 5ISZE 1EAJA 2FD6H 2EDRA 1IBGH 5IIEA 3PGCA 3CK0H 1G84A 2HTKD 5J3HD 4ISVA 1FH5H 5DR5L 3TCLB 4S1RH 5HHMD 3QFJD 2VN7A 3OF6D 5EZJB 1X5IA 2BFVH 3IAQA 3EO9L 3LV3B 1JTTA 3IXTA 3TP4A 4Y8AA 1XF1A 1REIA 5MEOB 1AC0A 1LDPL 2DWDB 4QOKE 2GJJA 4YIQA 4XVSH 3EJZC 5DJ0B 5F44A 2PTTB 4L3ED 1E4WL 4FRWA 3P4NB 2Y23A 3U9UB 1JZ3A 3NN8A 4N0CD 3RGVC 2BVOB 2GFBB 3LOWA 3VFWB 1LEGB 2JJUA 4HC1H 2FB4H 3QUYD 2DQJH 1HHJA 2W60A 4K9EL 2OTUA 2ICEA 2WV3A 1B9ZA 3DBXA 1YMMD 2YD9A 3QDMA 5EC2A 3WV0A 2QQLH 2ZJSL 4WY7H 4N0YH 1F3DJ 2H1PL 4OCRL 3MJ9L 2F74A 4U1SB 1WCBB 3ULVC 3QO1A 1QVOB 3MV9E 3C6LC 5EBGA 1NCUA 4ZFOB 3FO9A 4P3CH 4HWEL 5L7XH 1EJOL 2HLAB 1A7RH 1F3JB 3IFOA 4TUOA 4BFBD 4I0KA 3SPVA 5IF0B 3GNMH 2XTJE 3SE9H 2AJYL 2G9HB 2DQFB 3HZKB 5I19L 3ZO0A 3O0RL 4XPFH 4UT9L 1FYHB 4YHOH 1SQ2N 3X3GL 2AKRA 4RMVA 4W6YB 4NKIH 1WFOA 3SO5A 3QULA 1A2YB 3SKNB 4NRXB 4N1CA 5IK3A 4D9LH 2QSQA 4JFXA 3FMGH 2RCSH 1CD1A 3HMXL 5B8CA 1RZGB 5DJ6B 3MGTA 4UQ3A 3DO7B 3I75B 4RAVA 3GSWB 5F7DB 2BNRB 1A4JA 3EYFB 5BXFA 1AXTL 5FO7A 3CSPA 3F6LA 4Z78A 5D7IE 1FAIH 1VGEH 1MNUL 3MRLB 4CMMA 5KVGH 2MKWA 2ZUTA 3VXSA 3RZCD 4JZJC 3HS0A 3MOBH 1OVZA 1P9MA 4BQCA 5EUOE 2VDKH 1ONQB 5E6ZA 3CIQA 2DN7A 3MRIA 5MENA 2HJLB 4G80A 3I3EA 4X6CA 1JYWA 5F1SA 4NQEB 4U1MA 2IH3A 2Y6SC 4R7NA 3VXMB 1LO5A 1ZGLA 3UTSB 4RFOH 3DUSA 4PJGB 4XCCH 1IAIH 3C2AH 3KDMA 1N6UA 4BH7A 3MNZB 1EEYB 4MSWA 3AAZB 1DBMH 1IC5L 2QQNH 4P9HC 4F7TA 2OTWB 3D3VB 3G6JA 3O6MH 2YWYA 2AXJA 4HUUB 1X6LA 3V9FA 1OSZB 1KT2B 5GHWH 4EQ3A 1NMBH 3FRUA 4JFEE 1ZV5A 1PZ5A 2DQJL 1FLRH 2F9BT 4NRYB 5EG6C 3S35X 5D2NE 3RIFK 3KJ4C 5ACLA 3QEQA 3NIFF 3CX5J 4P2OD 4UDTB 3UBXI 1KG0A 4PJ9C 5J06A 1CXKA 1HIMH 5BV7B 5E2TL 1DSFH 2HYMA 1QACA 2I07A 4D9RD 4GBXA 2VDQH 5CEYB 3WNLA 2Y07H 4XNYH 4L29A 2A0LD 4FFWC 4CMHC 4EUPA 2WINB 1X7QB 5JO5B 4MQXD 5BOZG 5LXGH 3UJTL 1ACYH 1XGQA 4ZPVA 4NZUH 4FQ1L 1BVZA 1AGBA 3EDDA 3F7VA 1NGWB 4EUPG 2ADFL 3I2CH 3GNML 2VIRB 5T1MB 2DLTA 4LSQH 4WUKH 4OQTA 4N5EC 1IGJB 1G9ML 5TQ0H 3ARPA 1M7DA 4GQ9H 4YHOL 3S35H 4YHNB 3V79C 5D1QA 4QXGL 3CLFL 3VI4E 4WW2F 2BC4B 4JY6B 1QA9B 3NA9L 2D7OA 2VWEE 3N1PC 2CK0H 3T0VA 1MCWW 1EHLH 4PY8I 4YWGL 3HC0A 5FHAH 3TZVA 4JY5L 5FYLE 1OP3K 3GJFH 5C2UB 1AO7D 3IKKA 3K81A 1G7MB 1I3VA 1RU9H 3JUYA 2Y25A 3TCLA 1UACL 1RJCA 5JXEC 2W1NA 5CCKL 2YRPA 4ZUWA 2APVA 4ZDHA 3OKOA 3NCEB 4J4PA 1MEXH 1J86A 1QP1A 1TCRB 2DWDA 1CG9A 4LSTH 4Y5VB 1F13A 5DJ0A 4F3FB 1ADQH 4JM2A 1AE6L 2ZUUA 1WT5A 4WI2A 3NZHL 3QDJB 3P4NA 2V17H 3MOQA 3S37X 4F7MB 5IROA 1LEGA 1AIFA 3G9AB 3TV3L 3O3DB 3MRQB 5L2KD 5H2BB 3B6SA 2Z31A 4UAOC 5C09D 3E0GA 4P4KB 5HSFA 2E7CA 2WQ8A 5HHME 3GI8H 3QFJE 1VESA 1BVLA 4Q74A 4YNYB 5I6XB 1S5HA 2XZQH 5GJSH 3BUTA 1J1PH 4FQHB 3RY6A 4U1SA 1DANU 1OAYH 4MCZA 2IGFL 5DA4A 5H37G 1KXQE 3IB4A 3F7QA 1JWUA 2H2SD 3KWWB 1HQ4B 4L3EE 2CKBB 4RISL 5GHWL 3BKYH 2XRAL 3MBXL 5IF0A 3S37H 3F58L 2JCCE 3KG5A 4M00A 4WGWB 4KZEL 2ARJA 3HZKA 4XHJC 5DFTA 2WP3T 1EHNA 2W07A 1DFBL 2DBLL 4Q9QH 1YMME 3O2DL 5BRZB 4PRIA 2W65A 4J3VA 3VFNA 3OKEA 1A2YA 3SKNA 5CHNB 4WHTB 1RUPL 2NMSA 2XWTA 5D93C 2FO1A 1I8LA 5I1JL 5ITFA 2VXSL 4MX7B 1G6RH 4TSAH 3MV01 2BNRA 1IEBB 1DQML 1BHGA 1LNUA 1NBYB 5LBSL 4F7PA 4QHKJ 1EVTC 4UQ2B 5IVXE 3SKUD 5E6YA 4MJ2A 4OZFA 5BZDB 5JPMA 1YPZB 3MRLA 1VFUA 4IRJB 5GSRB 3PXHA 1IEAA 1A21A 4P46D 4GQ9L 4EJ1C 4Z8FL 4X99A 3HB3D 5I2IA 4EIGB 4MNQB 5DUBB 3RKPA 2X4NA 3JTTB 1OAZH 3IAPA 2NTFA 4NQEA 35C8H 4XPBL 5C86A 1WBXA 4LCWB 1YNTA 5EA0H 4PJGA 4I2XA 2C3GA 2NY2D 4JFHD 4LEOA 1CXLA 2M2DA 2ZZUT 1XMWA 2EYSB 2MFNA 3RWFA 4J3TA 3BPNB 5JHDA 5DJCB 1AHWA 3O81A 4P57B 2AK4D 1IKFH 4HWZA 2KL6A 5DZNA 5KVFH 5CP3H 3CC5B 5ALCH 1G7IA 5EN2A 2JJSA 3VI3F 4HUUA 1OSZA 2VLMD 5EZIL 5C0NC 1ETZA 1Y0LB 2EIZB 4KGLA 2ICWJ 1T2QH 4L4TD 3O6LL 3BZEB 5E6IC 1NKOA 5CD5C 5HHOB 5K9QI 4UDTA 4JCMA 1OCWL 3K4DA 4U1GC 5CEYA 1JGEB 4TSCH 1X7QA 4UBDD 2R0WH 3NCJL 4ZTOL 3L95A 1P53A 1CE6A 1HN1A 4YGVB 5FYKD 5IW1B 1NGWA 5D72L 5T1MA 2VDNH 2B1HH 1B0RB 2I9TB 5C08D 3C8DA 2MTPA 4GRWE 5IEHA 2CIKB 1EIBA 1JPGB 3DETC 4JDTL 3WN5A 4D9RE 1D5ZB 5F71A 1KCVL 1TVBB 3GBML 1PSKL 1H3TA 4P9MH 2G5BA 3RWHA 1LO3L 1NCNA 3U30C 5D6DA 1VACB 2AEIT 3ZT7A 5IJKA 1G6RL 2HRLA 1MCSA 2PYEA 1WC7A 5DJXB 4Y4FB 3VRJA 1A9BA 2UWEF 3WS6A 1QLEH 4YBLB 3LKSB 1BD2A 2PYFB 4JY4B 3BPLB 2QSVA 2GK0A 3BIAX 1ZLVK 32C2B 3K4ZA 4D8PB 4S1DD 1WITA 1LO2H 3AM8A 3BP5A 4GUPA 5EIVA 2DYPB 5CINH 1NGZB 3UROR 3S4SB 3MRMA 4J6RL 2P43B 4LLYA 3IAGC 4GRLB 4ONFH 1SVZA 5KAQF 4XX1E 2VQTA 3MCLL 3R1GH 4OCLC 1BQHB 1PG7W 3QDJA 1LDSA 3V4VL 2R69H 2QQKH 2OZ4H 2N4IA 1E6JL 4TUJA 4Y1AA 4F7MA 3KLHD 5DEGA 1AO7E 4WNQA 1IKNA 3VWKC 4OLXL 2HT3D 1DVFD 4HJ0D 3RWCA 1YEJH 2RGSA 5C2BL 4OV5B 1W0VA 5I17A 3VFGL 1OTUD 4PV9B 4QRQB 5JOFB 3MYZA 5L88H 2AQ1A 1JMXA 2OJEB 1BQUA 4XC1H 4OZIA 2FO4B 5ALCL 5DK0B 3O4LB 5I75C 3BKMH 4ZAKC 5ETUB 2FHFA 4U1IA 1HQ4A 3BXNA 1D5BB 3O3BA 5F96H 5LGHH 2CKBA 5C92A 1ACZA 2XOTA 4OB5H 4QRTB 3IDUA 1C7SA 5DLML 4HFWA 3ZL4H 4HZLB 4Z7VB 5L2KE 4DGVH 3B43A 1VEOA 3LH2H 3T2NH 4NJ9H 5C09E 4KTDH 5TDOB 2D4FA 2XPGB 1H5BC 3S96A 2Z93B 5IUSA 2H3NB 3SDAD 1MRDL 4MS8D 4XI5D 3R4DA 3U7WH 4Y2DC 4LAQL 4UNUA 1F3DH 3ULVL 1IC7H 1DBJH 3ES6B 5SWZB 3MFFB 3P30L 3ZMRA 4MX7A 2Q7NA 2B20A 2DQCL 1A6TA 4LAJH 4PRBA 5GRWA 2EDWA 2NY4D 5BZDA 5C0AD 1I7TA 2P8LB 1YPZA 2B1HL 4HKZB 4J3WA 3ET9F 4ZS7L 4HIXH 4MAUH 5GSRA 4MD0B 3L7FB 2WUCH 5IFHL 4HZAA 3DVNA 5DUBA 3F5WB 3JTTA 4N9OB 3Q6GL 3IDGB 4EQ2A 2DM3A 2R9HC 1HKLH 4TOYH 3BP7B 3EYVB 4FFVC 4Y5YA 1VFOA 1K4DA 1BAFL 4OFYA 2XKNA 4FG6D 3WFDH 3O6KL 4S10A 1RJZB 3EYSH 1OHQA 3UYOD 3BE1H 3ZDYF 5ALBH 2RHEA 1P84J 1J0HA 4NUGH 5KG9B 3U9PH 4ONFL 3QUKB 5D2LA 2JJVA 4YHLH 4R3SB 1U92B 3VWJC 1T1ZB 3ULUD 1SEQL 2HKHH 3UAJC 3KXFA 2YUVA 2J8HA 4QRSB 4XMLH 2IAMD 1BOGA 3NH7H 1Y0LA 2YZ1A 1KCKA 4OLYH 4JFHE 1ZHKB 5I0DA 1ZKAA 3VW3H 3TVMC 3TNNB 2VL4A 4PR5A 1CU4H 2HP4A 5C7XL 4P9HL 3FFCA 2AK4E 1JZ4A 5IR1A 1BQLL 1KENL 5DD6A 5L88L 5DJYB 5GXBB 1OAUL 1JGEA 3O4OC 5J6GB 1FZMA 1PEZA 3QNXA 1WIPA 5H94A 4MVBC 3SGJA 1HDMA 1KXTB 1R3KB 3U79A 4LLQB 5EPMB 1HZHL 3NCBB 5DJAB 2VLME 3VMNA 5IG7A 2FJGB 3W39A 2W0PA 4XPGH 3JVGA 5IW1A 2LAGB 5GRZA 5SWSD 2VL5B 4RMSA 2GJ6D 4MCYA 5JQ6L 3ZL4L 3HZMA 4KFZC 5HD8D 3S3SA 2WK2A 4L4TE 5EIIB 4XAWL 1RJLB 5T3XH 3WSQL 4O5LL 2CIKA 2VSDA 5EU3B 2DQIH 4OCXL 2R4SH 4UU9B 4X6BB 5D7LD 3OXSB 2OL3A 5BMFH 1IC7L 3LRGA 4ORGA 1VACA 4PRPB 4G8IB 4RRPA 2DQGL 1HINL 5F6HJ 5DVNA 4YFEA 4KDVA 5FYKE 1MFAH 4Y4FA 1OAQH 4CU7A 3QEHB 1M7IB 4JFOA 3CUPB 5AWNH 1QQDB 1G7HA 2PYFA 3DV4A 4TQEL 3LKQB 3LDBB 1V7NH 3QXVA 1TJGL 2C4XA 4MAUL 2DYPA 1NGZA 5TE6L 1BZQK 1M05B 4PJEF 1QRNA 1LP9B 4RAUA 2MQCA 3S4SA 1E4KA 4D0BB 3C60B 1JJUA 2MPAL 3V0WH 1T7ZA 5F7KC 2OK0L 3IS1X 5FECB 4FQXA 1JPFB 1MIMH 5TFSL 3S4SG 4B41A 5MP6H 2A6KB 4FQIL 1HKLL 2Q6WA 2C3HA 3TN0C 1AGFA 1GGCH 1BQHG 1IGMH 4XPAH 5C6TH 1WBZB 1CZ8H 3BW9A 1DEEA 3G5XA 3BEWB 3LD8B 2EDEA 4DKEL 5KBNC 1S7VB 1GHFH 1EERB 4OV5A 3G5ZA 3ZKSD 5IHUH 4QRQA 1JCKA 2OJEA 5IW6B 1NMAL 4Y89A 5DK0A 3O4LA 3CDGB 2P44B 4YHLL 3K2UL 3BZFA 3T0EB 4JDZB 4M8QA 4CVZB 3VXRB 1N7ML 1RMFL 4JQVC 4QRTA 1MLBA 4QKXB 4HZLA 4Z7VA 1E4JA 3TIEB 3REWB 4PJHA 4UILL 2NY0C 2XTJC 5SX5H 4MNHA 4R9HA 3VD4A 2ARWA 1T0MA 3BVNB 1BX2B 4XBPA 1IGCH 1Q94B 3SDCA 1B3JA 3LPFA 2DIJA 3FB6B 1VENA 2YUWA 3WHXA 3S88H 4NT6A 1NANH 5D7JC 5T33L 4WGVB 1I1RA 5F7YC 2XI9A 2DD8L 3ES6A 2GHWB 4XCYA 4TRPL 1U95B 4PJFA 3H9ZA 2F8OA 1SJXA 4ODHH 2XWJA 2VE6A 3L1OL 4W6WB 3V4UL 1ZAGA 4KRNA 5EU7E 2JB6B 1KJ2B 1SJHB 3MROA 5AUMB 2D0FA 3ALWA 5CD3B 5JXAH 3ARGD 3DI3B 4HKZA 5GGUA 4Z7UF 5D1XC 2D2OA 4OI9A 5KTEH 4PLKD 5T3XL 5DD3H 3PWUA 3HR6A 5GGTH 5J4MA 3UO1L 1F90L 4JFFA 2IFFH 3L7FA 5ANME 1FBIL 1KEMH 4R97B 4PPTA 3X14B 2GTZB 4MJIA 3QI9A 4DCQA 4M7KH 5K9OA 3LEXB 3BMVA 2FX8H 5DS8B 5F3HB 2WNGA 4N8CH 1H0DA 4PP2B 3TT1H 4GRMA 1R3IH 1UYWL 3BP7A 2HWZH 1JZ8A 2FRGP 4HBQA 2NXYB 3G04B 4U6YB 5IW3A 4LBEB 4RQQB 5B38B 1OAQL 1II4E 3BUYB 5C0AE 5HI3D 2R2HB 3TO4D 3PWPB 4KQ4H 3ZYZA 5F9DC 1T7YA 2DB8A 3G5VB 5SV3A 1TZGH 4GO6B 3O2WH 1ZLSH 1R3HB 1MPAL 4J4PC 3V0WL 1B0WA 4KK8D 3QQ3B 1T1WB 2QKIB 3HE7D 2QTEA 1K6QH 3LRSB 1UZ6E 4NKQB 4QRSA 5EO9B 5JNYB 2I5YL 3C5JA 3FRPG 1HWHB 1CICB 1OTTD 1E0OB 5TH2A 4G9FB 5C6TL 3BQUA 3TNNA 1CDIA 5D2NC 2FWOB 3U4BH 3ZHKA 4BKLB 1AGDB 5AYUH 1CDUA 4L8SB 4CN4A 1P4BL 5IHUL 2X4OB 1UVQA 1XIWD 3OKDB 4U4BA 5JORB 4ZD3H 1GGBL 1RUAH 4ZUSB 3ULUE 5EPMA 3SE4C 5I30L 2R2BB 1AGEA 2OMNA 2FJGA 2CUMA 3CD4A 1HXYB 5DQJB 1OP5H 3QO0B 4K7FA 4PJ7F 1C7TA 3DNKA 2HJKA 3UZEA 1DE4B 5EIIA 4PGDA 2BOBA 1XGTB 3MV7D 4ALAL 5AD0A 3QXWA 3DGGB 2YD4A 4OZGE 3C9NA 3D2UD 3VGGA 3S88L 1EMTL 5T1LB 4QO1A 1X5HA 1HQRB 3C5ZC 3HN3A 5F72S 1YNKH 5FCUH 3OXSA 3TFKD 1IE5A 1CGYA 4JZOB 5F70A 1T5XB 3P4MB 4HHAB 2EXWD 2X89D 3OKKB 4EI6B 5CS7A 3UTTD 2EDXA 1MJJB 1CGWA 1CWVA 4HF5H 5SWSE 4FP8H 5FFLA 2GJ6E 4LKXB 4OCYL 2R1XB 5DGQA 3CUPA 1A6WH 3TH3T 3FONB 1U3ZA 2APWA 2NY7L 4RMTA 5HJ3B 4NO0B 3ARDA 3NMEA 1LP9A 3P2TA 3P40A 4F9LA 4LVOB 1ZT7A 3LQAH 3TH2T 5IWLC 1INEH 2B8OT 4OUUA 3UPCA 5I71B 5D7LE 3WIIH 4JE4B 1BFTA 5FECA 2MCPH 4OM1H 1V3MA 3JWOH 1EVUA 2MQ0A 2M26A 4JGMA 1WBYA 2QLVB 1R3IL 4YDJB 3IF1B 1H8NA 1FO0L 1CT8B 3QT2A 5CEZH 1JK8B 1YECL 1WBZA 5E5UB 1IJ9A 5M7QA 1IQDB 3OKYA 3ARRA 2FX9L 3CH1B 1S7VA 4P49A 4PJDE 2P8PA 1MWAB 2R2EA 3MJ8B 1BM3L 4OCSH 4ACPA 1PG7L 5E2VL 2ZUSA 1DN0B 1ZLSL 4NOFA 4OBSA 1CIUA 3B9EA 3T0EA 1PX3A 3AVEA 4JDZA 1JTOA 4CVZA 5EDXA 1TJHL 4LOUD 4GG6E 1FORH 4V1DD 4I9WD 3P0YL 3DMMD 4KDTA 3REWA 4AMKL 3O11A 3LS4H 2GQHA 1OWRM 3U4BL 3Q3GB 6FABL 5AYUL 3MLUH 2RFXA 4I0PD 5TQ2H 1ND0A 4E5XB 4G5ZH 4U1KA 5BV7C 5FKAB 2X4SA 2Z35A 2FX7H 4YZFE 3TT3L 4P23D 1I1YB 1ZLWH 5E8NA 5INDB 4H0IA 1KJ3L 2UZIL 5DD0H 3CSBA 4PJ8B 1A14H 3V7AE 1ED3A 1Q9LB 1AY1L 3NTCH 4BZ2L 3EOBB 4K3GA 1FFPA 4EVNB 4LDOB 2WUBH 2UVEA 1WSST 2DS4A 2CLRB 5E9DB 4DVBA 4O02H 4OZHE 5EBLB 1UXSA 3WFCH 3RL1A 1MFBH 1UM6L 4YPGB 2RQ8A 3LEXA 1CF8H 3FHAA 2AV1B 1N0XL 4PP2A 3GO1L 1J8HB 2XXCB 1UM5H 4RQQA 5B38A 4FP8L 3GRWA 3QPXH 4WCYH 3AU1A 4YC2B 4LSDA 4PJBF 1YEDB 3PWPA 1AQDB 4NQCB 4ONHB 5B38G 4OGZA 2IADB 3H9SA 3KYKH 1LEIB 1WIUA 4PJXE 4HAGA 5B21A 4QHUB 3AM8C 4QGYA 3ZYJA 3O6FA 1R3HA 2EH7H 3GIVB 4IS6B 3MA7B 5KSUB 4KI1A 2Y5TB 5ESVB 1CDBA 3JWOL 3QNZB 4Y5VC 5CSZB 8CGTA 5KANI 2JLLA 2HT2C 5CGYD 1JE6A 4YUEL 5J12B 1DTUA 1F6AB 5HDLA 1TTUA 1IT9H 4R90H 3VXUA 2C5DC 5K9JL 3B4NA 1MFDH 1KYOK 2A9NL 3BO8B 1EX0A 5CIPA 2FWOA 2FH8A 3DX7B 3WDHA 4BKLA 3MFGB 4O4YH 4P4KC 4XVTH 4DZ8A 1MREH 4L8SA 3D0LB 2MQ3A 4YX2H 2X4OA 4JREB 4XB7A 1T4KA 4F37K 4OCSL 4NZTL 4P59H 5I6XC 3OKDA 3GSOA 1JWSB 5HHPA 4BZYA 1XF4A 3O8XB 4WW2B 5DFVC 4IJ3B 3FB5A 4QRUB 4EN3D 4DJMA 2P8MB 1FRGH 1H3XA 4ERSH 1FGNH 1C12A 4M6NL 1DANT 5GS0D 1AP2A 3ARED 5D8JL 3CSGA 2A73A 2P5EA 3TYFB 1OB1A 3ARBA 5TQ2L 5C0BB 3BPCB 2IANB 3X12A 2A6JA 1DR9A 1P1ZA 3HI5H 4JZOA 4HHAA 3T0DA 1J1XH 2DLEA 3T04D 1Z5LA 5GGQL 4OSUH 1HE7A 3HE6B 4EUPH 1J05B 4E0RB 4M7LL 4A6YB 4KAQL 4B0MM 3OKLB 2F54A 3UTZB 4GSDH 3VE0B 4RBPK 4M7ZB 3RBGA 5HJ3A 1VSCA 2FBJH 3MV7E 4NO0A 5FB8B 4H20H 4OQTH 5DRNB 1IRAY 3OGOE 5GGVY 4K3JL 4IRJC 3WFCL 3V6ZA 1MFBL 1F5WA 4XHQA 4X80L 3VFUB 5F7EH 3UTTE 3DVGB 3QAZB 4Q6IB 4RFEB 1CT8A 3B9KD 4G6FB 4BK4A 2X1QA 3WYRA 1FG9C 1MCWM 3S36L 5LWYH 3CVHB 1G9NC 2EEAA 4HS3B 2QBWA 1K8IB 4QOKA 2XXMB 3BPNC 4GH7B 4ELKB 1A1MA 2DTMH 1KIQB 1DN0A 3EO1B 1T04B 1BIHA 2AEPL 1NGXA 1HNGA 3OJDA 4FHBD 2EH7L 3PWVB 4NRZA 1A6UH 3BRGC 4RWHA 3QXDB 1D9KA 4MDJA 5C07D 3OB0K 4K8RD 2MKLC 2HRPL 1BZ9B 4JO2L 1HILB 2R0ZL 2QR0B 4K94H 1GXEA 3IS0X 4WI7A 1UWGH 1MFDL 3C2SA 1FPTL 5IEKA 2BDNH 1RK0A 4UT6H 5IGXH 5H37H 4PJ5B 4HKXB 4E5XA 1UB5A 3A6CL 3ZKMC 2ZNXA 5H35B 1CLYL 1S7WA 1JF6A 2IMNA 2NR6D 5INDA 2H2SC 3FQWB 5LQBL 1ORQB 1MCFA 2PXYD 4HK3N 3L6FA 4V1DE 5BO1H 4I9WE 4UIMB 2YD5A 4OT1L 3MO1B 3PWJA 1FGNL 1Q9WB 2MHAB 1Q9KA 3Q6FB 4EVNA 5HDBF 3L7EB 2FLRT 1LK2B 3BN3B 5ICXB 3AMKA 2ICES 2VXVL 2NX5D 5D5ME 3CFKA 4LCIL 4ODUA 3QEUA 1CXHA 3I50H 4LKCA 5HPMA 3LEYH 4PRNB 3WIHL 1JF1A 1UXWA 4YPGA 5C6WH 1GIGH 1FL6B 2AV1A 2F53D 3HG1B 2AJ3B 3OAUL 3VFOA 5D7IA 5TGBB 3A67L 2CIIA 2ZKHL 1U8JB 4MLSA 3SDDD 3FT3B 1KFAL 1KULA 4ODTL 1S78C 3EDFA 1NC2B 5EUOA 4AIOA 2YA0A 5E56A 1AQDA 4NQCA 4OZFH 5ICYB 4MNGE 2AJSH 2IADA 3D85B 3GMQB 4L4VB 5EC1A 3BAEH 1J11A 1LEIA 4FZEL 4Y19D 1QSVA 1HHGA 3CFCH 2VDPL 2VXUH 4QHUA 4M6MH 4XNUL 5FGBC 1EEUA 4L8CA 5D71L 3IXAB 3IT8D 4GRLC 1FIGL 3P9LA 5D5MF 3JSSA 5DEZA 4UV7L 5IB4B 2EEDA 5CMAA 1UB6B 4XC3L 1CFQB 3NFPB 5I1GL 2DBJA 1KN2L 4Y4KD 1BP3B 3MV8D 3GMRB 2HFGH 3VH8B 2JJWA 1T20B 3SQBA 4LSRH 4D2NA 2M8XA 5IV2B 4HG4J 2DTML 2AXFB 1WLHA 3O9WD 1HH6B 1RURL 1G7JB 3KPPA 3D69B 4JFEA 4LU5H 4LMQI 3WJJC 4ODVL 1FL3A 4KUCD 3CVIH 1P6AB 1W72B 1UENA 1KEGL 2P8MA 4LCYB 1AQKL 3BDYH 3OQ3B 3TGXA 3CLEH 1K85A 1YDPB 1TZHA 1H3VA 4LRIA 3OX8A 1OPGH 5DVKA 2UWEB 1IGYB 4AK1A 4UT6L 5IGXL 2R0KH 2FIKB 4IRSD 3AB0B 4RA3A 3QG6A 1KB9K 3WNMA 4POYA 1L7IH 4LHUA 1WWAX 1U8NB 3JTSA 4GQPH 5ITBH 1B88A 3HE6A 4D3CH 3ARXA 1KBGH 2CRMA 3KYMB 4ZFOL 4LHUG 3L3HB 3BSZL 3MRGA 2A6DB 4G7VH 3QRFM 5JDJA 4MXQD 5I1DB 3UJIL 5AZ2H 2FSEB 1EO5A 3K7UA 4XWOD 3ORJA 5FB8A 2BSRA 1C5CL 1DBBH 3C6SA 1K5NB 1S7RB 3W5NA 1I1FA 1NUNB 3OG6B 4JZNB 5B4MC 3VFUA 2DMKA 4I3RL 1U8HA 3RJQB 1ZT1A 4APQD 3JV0A 3V5HB 4M9PA 4PBXA 3BD5A 4WU7B 4G3YH 3BRDA 1RZKC 4BFIB 5HVFB 1CD0A 3KR3L 3QUMB 1GZPB 3MREB 1VERA 3IFNL 4IIQA 1F4WH 4Y19B 2H8PA 1X5FA 3BAEL 2CPCA 4ELKA 2XT1B 3CFCL 2BVPA 1MFCL 4M6ML 3DPBA 1FZKA 1JUFB 1FNGB 4PLJC 3PWVA 5I9QB 5TF0A 4QNPE 1FGVL 5DRZB 2WAHA 4CN6A 1C5BL 1D5MB 5LGJA 2R39A 3FQNB 4GMSL 1ZMYA 4AEHL 4X98B 5HHXH 4YDKH 1XF3A 3HI6L 1HILA 3OF6A 3LZFH 1F42A 1J0ZA 2EYRA 2QR0A 3PHQA 3TIDA 1I3RB 2DIBA 3CSYB 4HK0A 4XCEB 5EU5B 1A8JH 3FQUB 5T1KD 2Y06H 4WO4D 4GW5A 3GI9H 3L9RB 4LSRL 2Q8AL 1PD6A 2IG2L 4ZUUA 5H35A 1R24B 2ZSWB 4LLUB 3U1SH 1AC6A 2A38A 2ENSA 1WWCA 2PR4L 2P5WD 3OPZH 4KHXH 3FQWA 3QUYA 2I26N 1I9RL 1ORQA 2JCCA 4N0UE 4PBWD 4U6HA 5GZOC 4WWKB 1N6QH 5C07E 2NW2B 2GJZA 1JHLL 2YSSA 1QUNA 3MYJA 2CKBH 3QDGB 3VGBA 3P77B 2VLRD 4PRAB 3REVB 3MNVA 1MCJA 4Y4HB 2VO5A 1ITCA 2J4WL 2GTWB 3WO4B 1M4KA 3P9MB 1RZFH 2X2YA 25C8H 1T1XA 3NIDF 1MJ7H 5EORH 1MH5B 3V6OE 2WANA 3QA3B 4XBEL 1L7IL 5BV7L 4L8DB 3VGFA 4PGCB 1FL6A 3SGDH 4MA8H 1MY5A 2VLJD 5CSBA 3GSXB 4EI5B 5ITBL 5DUPH 1A4KA 1T3FA 1QBMH 3T65B 1U8JA 4JFPB 4QF1A 4JFQB 1V5JA 2XICA 1NEZA 1QO3A 5LAXB 1CE1H 3LS5H 4HT1H 5AEAA 2O61B 1J9CT 1ZXQA 5KS9E 2J6EA 3TCXA 4Z7NF 3HFML 5T1DL 2NX5E 3D85A 4L4VA 4QY8A 1NEZG 3MRNB 3LDBC 1FNEB 1MAMH 3CZFB 1T03L 4XGZA 4I13B 1HYSC 2BVEA 4YDIL 1UJ3C 2BNUA 3VRIB 3IFPB 1I4FA 2BHYA 2J8UE 5T3ZH 4JO1H 3C60C 4K23H 1UCBL 2AI0L 2F53E 3BIKB 4XVJL 4H1LB 4QRRB 3MUZ1 5IB4A 4QYOB 5DYOB 1KCLA 4OKVA 1LD9B 2BVTA 4EIZC 3CMOL 4KUZH 4PGBA 3V0VB 4G9DB 4O2FB 3ZT6A 3GUTB 4FFYL 1HKFA 5D6CA 1DLFH 4LSPL 1P4LB 7FABL 3LD8C 1S9VA 4HXAH 2FEDD 2XQBH 1QFWH 3RWGB 4OAWB 1CLZL 2AXFA 2YEZB 1JPST 1RQ5A 2IQ9H 1G7JA 1Y18A 1HCVA 2V7NA 3SDYL 4HUWA 1YEIL 2UUDH 4F8TA 3T0EC 5A3ID 1XCTB 4Z7WE 1TVHB 1YN6B 5KN5B 5T5NG 2IAMC 5M94B 4ENEC 2W9DH 3OAYH 15C8H 1R3JB 1NDMB 3MV8E 3GSNA 4FXGA 3ARUA 2UWEA 1IGYA 1UADC 1NFDF 3S3PA 2F5BH 1C1EL 3T77A 5ADPH 3SKOB 2FIKA 3V5DA 5IB2B 1KPVA 3NABH 4XCNB 1SY6A 3EZ8A 1U8NA 4NKMB 5I15H 3MRBB 4PJEB 1A6VL 4Z7QE 3FTGB 1A3QA 1A1NB 3P0VL 4AT6A 3MR9A 1U8IA 5C3LD 4P2OA 2CKBL 3K2MC 3GSUB 2ZUVA 1E4XL 5CZVL 2ED9A 3OGCA 1J5OH 2E9WA 3EO0B 5E08L 3LN4B 4MD4B 1UM4L 5KAQG 2EEBA 4Y5XA 5FM4A 4ZUTA 1G7PB 4TSBH 2Z92B 4AIXA 4JZNA 2L7UA 4POUB 3BESR 5EORL 3JWDH 4R97C 3GJFK 1NUFA 1IM3A 5L6YH 3Q1SH 2OL3H 3V5HA 4U2ZA 1CVRA 4M6AA 4L9LA 3VGAB 1XAUA 4RNRB 4HS6B 4WU7A 1BZ7B 4CRPA 3VMOA 1WZLA 3QUMA 5I1HL 1GZPA 4NHUA 3MREA 2XKUA 5CUSL 5CJOH 3UDWC 4LVEA 3BD4A 5F1NB 2WQRA 5ECJE 5KVDL 5AZEL 3RA7L 3DIFB 1MIEL 1A7OH 3RAJL 43C9A 4NBYB 3ECBB 5DRZA 5T3ZL 3DSFH 2VQ1A 1HOCB 2DJ4A 1D5MA 3PABA 1FNSH 1QHOA 4P2RB 2BMKB 1F6FB 1A6PA 3TPKA 2VJXA 4WW1B 3CSYA 4GKNA 3KPNB 2GY5A 3FQUA 3KPSD 1CICC 1G9NL 1FVDB 1MUJA 3DHJA 4M43H 3M1BA 1UT9A 3TJHD 3V7MA 4UTAH 5IB3B 1QFWL 4Z7UB 5CP7A 4PJCE 1R24A 5KOMC 1RFDH 2ZSWA 4LLUA 1PKQE 4K3EH 3SCMB 1KPRB 4KMTL 2KQNA 5L2KA 5DMIH 1UZ8B 4KI5F 4WWKA 1BFVL 2AABH 1FC2D 4MHHI 3X11A 1CFNB 4DTGL 3P77A 1ZHNB 2QADD 2CQVA 3SBWA 4QXWA 2PTVA 2W9DL 4Y4HA 4CU6A 3CCHB 1A3LL 3QUZB 1U8PB 4D9QD 1C16B 4YHZH 3T2OA 2JIXD 2F5BL 3JZ7A 4ZUVB 3WNOA 4N8VA 5IQ7H 2AJUH 4Q0XH 5IBUB 3KPOB 5GSVB 4X7CC 1U8QB 4MB3A 4ELMF 3NABL 4Y16B 1NUGA 5I15L 1W0WB 3KLDA 2YK1L 4XB8A 2P5WE 4XNQB 4N8VG 3LKOB 1D5XA 3PHOB 3TA3D 1TPXB 4X6CF 2DDQL 3MLTA