5D6DA

Crystal structure of gasdalie igg1 fc in complex with fcgriiia
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
209
structure length
209
Chain Sequence
b'AGPDVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPLPEEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Structural characterization of GASDALIE Fc bound to the activating Fc receptor Fc gamma RIIIa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d6dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d6dA01
5IJVA 4LF3A 4G43B 4OF0A 3DX7A 1AC6A 2W65A 2MKLC 3DVFA 1OOAA 4APQC 4AEEA 4AQ1B 3TJHC 4N0UB 3L3IA 1UA6H 3BISA 3MBXH 1JBJA 3NPSB 2HKFH 2AEQL 2C9AA 3CSYB 3ROLB 3SGEI 4PJAA 3F8UB 1E4XI 2UWEB 5HHME 4DKEH 3NOIA 1ROWA 3S37H 2P5EA 3AUVA 1JGUH 2AI0L 4Y16D 4C83B 1ZTXL 2APBA 4NP4H 4PJDA 3L1OL 2R2HA 4KVNL 4KQ4L 4MNGE 5J9PB 4PJ8B 4WUUB 4TUKL 1GPOL 1I9JL 2EDKA 5GSRB 3IETB 1OF2A 5C0CE 2DQHH 5C3LD 5CJOH 4HIIB 3VGBA 3TPKA 1FORH 3DETC 4GMTL 5E6IB 5FCUH 3ZYOA 4HS6A 4FTVA 3D2UB 4OTXL 4E42B 1UB6A 2XY2A 2FWOA 2FGZA 2ARJA 3KWWA 1NCDH 5FHBH 3VG9C 3A0OA 3D0LA 4K9EC 2UYLA 3BPNB 2IAMC 5D96C 3QO1B 1JI2A 5SWSB 4C56A 3PWLB 5BJTA 8FABA 4Y5XC 4K7PY 3QXDA 3PHSA 4UAOB 4KZEL 4DVBA 5L2JA 1F97A 2HTLD 3PXHA 2I07B 3EYUL 3OG6B 4WI7A 5E6YA 4WEUD 5M7QA 2MCPH 4CNIB 3CFDA 3FT3A 4ISVA 4PLNC 2D4DA 3VXRA 5IBLC 4MAYC 4QRSA 4PR5B 4BZYA 1DFBH 1L7IL 5BZDA 1QSVA 1JNJA 4JKPL 2HJKA 3QCUL 1A5FL 3FRPG 3VDAA 5HVGB 2QSCH 3PWPD 1OAZL 1K6QH 2A0LC 3F6IA 4GLRI 4DGIL 3L95A 4OM1L 2CDFA 3QSKB 3RUGB 3V6FB 1XF2B 4WHYG 3U30B 1MRFL 5E4EB 3MRJA 1QLRB 3QO0B 2BFVL 3X17A 1ZVHA 5E8OA 1EEUA 3IDNB 3P9LB 5C0IA 1EPFA 2O5XL 3MLPA 1C5DA 4PJ5D 5IB3A 1AIFB 3FZUD 4WO4C 5CFHA 5C71A 3HZKA 4JB9H 5F97E 5I18L 1W0WA 3HMWH 3LSOB 4F2MA 1IM9A 3VD4A 1T2QH 2JK5B 5F21B 2AVGA 5IB5B 4ZG1A 4ZUUB 1HN1A 2YUZA 2X1OA 2E27L 4ALAL 4KRNA 5BS0E 5FUCC 4K9EL 3T0WA 5BW7C 3BKJH 3MQIA 3NAAL 1QFWM 1W8OA 3LPGA 1HSBA 2XTJE 1ZVSA 3J7HA 3S36X 1KB5B 1FYTA 1AO7E 1IJ9A 5IQ7L 4RQQB 4K2UH 4CVWA 1KLFA 1CD8A 4QRTB 3G5YB 5MEOA 2X4UB 4OZGB 3S88H 5C6WH 3QIWA 4JZJB 3I50H 2AV1B 5T1LD 1WIPA 2A6IA 4Y8AA 2F53E 5F9JA 5FA3B 3ZKXB 1VERA 5DDHA 2IALB 3WNOA 3K4DA 4HMDA 4WTWA 3SDDB 3QUZC 3FKUS 4MAUL 4FQQB 2V7NB 4F57H 3OX8B 1UWGL 1ZLVH 5D71H 2VOTA 4JAMA 2VXSL 3E6FA 3X3GL 1Z0MA 2FHCA 3O4LA 4I4WA 1YJDH 2CLVB 2PCPB 4J2XA 1CD9B 3GJEB 4L5FL 4JHWL 4MYWB 5D1ZC 1FIGH 3PE9A 4FABH 1T1ZA 5IK3B 5TGBA 5MENB 5DVMA 3NIGF 3NFPB 4HFWB 5BV7H 1A9EB 4RGNB 2ZPKH 4AEIL 1FZKA 4LPYA 4EOWH 3SEPA 3KGRA 4S1SL 4OF6A 3U4EB 4NZRL 3EOAB 2NY1B 3QBTB 4NQEA 5FOJA 3OXSB 2HFGH 4U1SB 1IGYB 2I9TA 2D7TL 3S35X 4EVNA 1JGEA 1CGSH 2D7OA 2YMXH 4RAVB 4RNRB 4MD4B 1Z5LB 3U2SA 1OTTC 4OV5A 1RMFL 1ULVA 3G5XA 2G2RB 43CAB 3ET9F 5EPMA 4U49A 1OGAB 1QSZA 1C1EH 2F5BH 1ADQA 2ORBL 2SEBB 1BQLL 4ODTH 5A2FA 5JW5B 2AERT 4LP5A 4O9HH 4W6YB 1CT8A 2VDNL 4NWTH 1MCOH 1HYSC 3RVUD 3QEGL 4KUZL 2FBJH 3IVKB 2IPUK 3P4NA 1BIIA 1YC8A 4G80A 3T3PE 2MJWA 4DZ8A 1AQDA 1QFOA 4FFWD 2GUOA 3F5WA 4JPWL 1IT9L 3T4YB 3WJJC 1SYVA 2GFBB 4ZDHB 4HSQA 5EU6B 3GRWA 4Z8FL 1JTPA 5CAYB 3D1MC 4X99A 2XZCH 1ZXQA 1AKJD 1WEJL 3DX6A 4AEHL 1OAKH 2W60B 4RMQA 3F7YB 3OXRA 4WTXA 1QBBA 2EH8L 3HE6B 1UM4H 3BPLC 3LKPA 3INUH 1HDMB 4Q6IA 2R2CA 4WV1A 5GJSH 4JN2B 4WEMB 4ZUWB 1J1OH 4PB0L 1R3LA 5AG8A 2DWDB 4P2CG 2R1WB 4P4RB 4XHQA 2X7LB 3ZDYE 4AIXA 1CF8L 5E8NB 3FQUB 1ZHBB 3RGVA 4PY7B 2X5PA 4PRHA 1U93B 3QULA 1ZGLA 1DQJA 1VFBB 4OD3L 1SHMA 1QNZH 3RAJL 5FXCH 2CR6A 4RFOH 4NUGH 5DO2D 5IWLA 4I0PA 2AJ3B 4GQ9H 4R7DA 1JUFB 5D1QD 1OQXA 4UDTB 4KTDL 4ZUVB 3TPUA 5J6HB 5F8QC 5BO1L 1P5UA 3MC0A 1SM3H 5HHMB 5KVDH 2EDTA 2CDGA 1I8MA 1QRKA 2NY2D 1HQRA 4UV7L 2FIRT 2CJUH 3MBXL 3PHQA 3VFGH 1FBIL 1MAJA 1WFNA 3RWGB 4MNGB 3MROB 4JPIA 4LASL 4JRXA 1S7SA 3IKKA 3LQZB 2BJMH 2NYYC 5C08E 5C0CB 1JGUL 1MVFA 3S4SA 3DSNA 3WFDH 4JHZA 3DRQA 5F1NB 4U6HA 1P7QB 3D0VB 2JF1A 3VFOB 5KW9H 3RKDD 3R06A 3H7BA 4QTHA 3NIDF 5T33H 2OXGA 1EUUA 2P8LA 3LRSA 2DM4A 3ULSA 5CCKH 3E1F1 2EICA 4WW1A 4N0CC 2XZQH 3MRIA 5SWQB 1YPZF 4J3OC 2DQJH 2X1QA 2FL5A 5DGRA 4O2FB 3FQXA 1FL5A 5FHBL 2LQRA 4IJ3B 5EOTB 5IMMA 2IANE 2CLZA 1BAFL 4ETYA 2Q6WA 3FQTB 5HI5C 2Y4SA 4LOUC 4NSKA 3WO4C 1OLZA 5IKCA 5K59E 1VADA 1F2QA 1U9KA 1YEKH 1C16B 1YDPB 4RMTA 1GXEA 2W59A 3MV11 4NQDE 2OK0H 1B0RA 5FK9B 4PLOB 1KPRB 1YEIL 4CVZA 2CIIB 5T1KA 3IU4H 3TNNA 5ERWB 3UDWA 1V3JA 1KCSL 3HC0A 3OJVC 3MX0A 4WEBH 1JZ6A 2ZOKB 3GMOB 4R2GC 4POZD 4PIRF 4LBEA 3D69A 4GMSL 3NN8A 3P73A 4XPAL 2OZ4H 1NDMB 4Q58C 4JKWA 1UCBL 2CO6B 3DUSA 3ARBD 2QSCL 4XRCB 4ZQKB 1K6QL 5B22A 3PWJB 3V6OE 5IP4A 3JTTB 4MQXC 1C7SA 1D3CA 4G8EB 2EDQA 4Y19D 1RUQH 1KB9K 1U41A 1UKSA 4ODWB 5KVFH 1JPFA 2GSGB 1S7TA 4G8FB 4OGZA 1FSKC 1N2RB 2VR5A 5BV7C 1RUAL 4R3SB 5EWIH 2Q8AH 1Z9SA 3D18B 1LO0H 1YQ2A 4YPGB 3O45B 3LKNA 2BCKA 4JB9L 4Z5RB 5CZVL 3RDTD 5MEQA 3HMWL 4DTGL 5BS0B 4FQHB 1T2QL 4ZTOH 2Q87A 1HHGA 2JJSA 1XIWD 1KIPB 3ROOA 1YPZE 4NO2B 3E3QE 2ADFL 1AO7B 1BQHB 4LRNH 5AWNH 1PBYA 3HAEB 2EO1A 4PRBB 1LDSA 2GEEA 5B38A 3BKJL 2QQQA 5E56A 4KKNA 5IBUB 4XXDB 3VFRA 4QHLB 3UPRA 2N1KA 3HE7B 4WFFD 1JL8A 1UXSA 3X13B 5C0BD 1BWMA 2F53B 4Y2DA 3W5MA 3G6JA 1DVFB 4JPKL 4X5XB 4K2UL 2D03H 1RIHL 4YZFE 3G04B 4XCEA 1T7VA 4C55A 3S88L 4M7KL 1XGRB 4U1MA 1CXFA 2BY2A 2V2XA 2W0PA 5C0AD 3ILQC 1FAKT 4MJ5B 3QH3A 5C09D 5HYJE 3L3JA 5JQ6L 1X5XA 3UTPE 5AD0B 5MP6L 3WL9B 5E1AB 1XR8A 1NBVH 4WCYH 5LGKA 5DHVB 12E8H 4LGSB 5CIPB 1SEBB 4F57L 2YR3A 1GGIH 2FZ3A 3IDMB 3WO3B 2N56A 3OMZA 3PL6C 5HYQB 1AGCA 3WFCH 1FFOB 2BNQE 2UUDK 5IIEB 5INDA 4NO3B 3MNWB 3MV8A 3SE4A 2BVQB 2ADIA 1G0XA 1FN4A 4KROC 5GGUB 3V95A 3SKMA 1QQDA 1MFAL 5GISH 1FIGL 3T77A 4XNQA 1FE8L 5B21A 5C0GB 3S98A 3RBGA 3GSRA 2R2EA 3KNBA 1QYGH 4O5LL 3HZVB 2K7PA 1WAAE 1U3HB 1NCWH 3DXAD 4WI8A 3LS5H 1CXIA 5F1SA 5FM5O 3W9DA 2J2ZA 2HFGL 4G8GA 4K3DH 1JRHH 5AZEH 3CX5K 2P8PA 2N4IA 2HFEB 1HHHB 4U7MA 2YMXL 3I02B 1BQHG 1FNHA 2D7MA 1U91A 3HAEG 2IAMA 2BSRB 2OP4H 4HKJB 4L3AA 5IBUG 4L29A 5FDWB 1HI6A 1J0YA 3MOAH 1BD2B 1MOEA 1HHJA 1TZHB 2F5BL 5GS1A 2BHZA 4JY6B 5F3BA 5K9QG 2BC4B 1F4YH 1HKLH 4WW2C 2EXYC 2MQCA 2B1HH 1MCOL 4NN6C 5AEAA 4L9LB 4MX7B 3P9MB 3MRRB 2FBJL 2AKRB 2JKXA 1QPXA 4OKDA 4MA1B 1IBGH 2PW1A 3DWTA 1KLGA 4K7PX 1ND0A 3NGBB 1EH9A 3IFPA 2XWTA 2YKLH 4X6FA 2CDEA 5DUPH 5J0BA 1QHPA 4XC3H 2FIKA 4NKQB 1OAKL 2AK4A 2ICES 2J6EH 3MNVA 1I7TB 3LOWA 1U8PA 4CRPA 3IDXL 4G8IB 1OB1A 4LPTA 2ESVE 2XFXA 5D1XB 1F3JB 2Q86B 2RAMA 3BSZH 4FQJH 1MFBL 1NSNH 3HI6L 5IR1B 5D2LF 1A7RL 1HH6A 1N8ZB 1EBPA 3T1FB 2NY0C 1HXYA 1QNZL 4LLMA 4K3JL 4I1NB 3GI9H 4NUGL 4RFOL 4XHJC 4MDIA 1JIBA 3O6FD 4GRMA 4D9RE 3BGMA 4LKCA 4GQ9L 5T3ZL 4H8WH 1MRCL 4HH8A 1NCTA 1OARH 2HLFC 4JO2L 4KZDL 4E5XA 1RZIB 3A6CL 1WBYB 1SM3L 1J9CT 5C08B 1A7QH 2AJUL 2ICWA 2CJUL 2Q7YB 4EI5C 4U1IA 2V17L 5CJQH 2R29H 1KYOJ 5ISZE 2IQAA 2HWZL 3QDGA 1WFUA 2G75B 4O2EB 1AXTH 2YD8A 3P77B 3QUZA 1IEHA 1OAXH 3WUZA 2ZZUT 2GI7A 3LEVL 5KW9L 3V0WH 3LKSB 1OM3L 3GBMH 3GMPB 3MBEA 2DLIA 2CSPA 3NZ8A 3CFJB 4IBLT 1P2CB 3DVNA 1RFDH 2IANB 1R3HA 5CCKL 5IOPA 4HG4K 3RIFK 2B4CH 3PABB 5GRJH 1CLZH 2BVPA 3H7LA 5EO1B 4I48A 1RPQA 4DQOH 5F7UA 3VXSD 4PJCE 2BRRH 2WBJC 5EZOH 1DANT 4NQDB 3UTOA 3EO1A 3CC5A 4MWFB 1KXVC 2M2DA 3D39D 5DRWA 4FQXC 5D2LE 3NVQA 3RWDA 4HH9B 4P4KD 1QR1B 4OUOA 4BH7B 2F58L 3L5IA 4PJ8D 1ETZA 2VL4A 3MYJA 4X9FA 4WUUD 1XGPA 4CW1A 2OL3B 4KUCD 1IGIL 2EDWA 3WN5A 3ARTA 5KJRH 2NY6D 2PXYA 3DGCR 4WEBL 3TV3H 4KI5E 5HGBA 3RWCA 3T0EE 5AAMA 4ELMA 4C59B 2OZ4L 3DMMB 2R15A 5HGGS 1H5BB 2HT3C 5EU5A 1TQCB 3QCVH 1JNHB 5HI3C 3KPLB 3O2WH 2ZP0T 2ZOLB 3BHBA 4N8CL 4JRYA 3N1QC 3STZA 3V5DB 3RNKB 4JFQA 5HDBE 2DLEA 3WYRA 4KY1H 3BKCH 1J5OH 4PJEA 3V6ZB 1DBML 1YPZB 1LO0L 5CEXA 4LLVA 5H8DA 5JNYA 4ZTOL 5DA0B 1U8NA 4HDIA 3IKCA 4QCIA 1S7XB 5D7KD 3RA7L 4HK3J 2Y7QA 2OJZH 1C5CH 3DSFH 4IIQC 4AMKH 2YA2A 4M1GL 4U1JA 3DYOA 1PKOA 4LSDA 3TJHD 4AIZB 5DK3A 1YN6A 1F6AB 5F7HA 5C0DA 3T4AB 1F58L 3LV3B 3UZQA 3M1BA 2KQNA 1NBYB 4H26B 5HYJB 4ZOEA 1G7JA 4NC1C 1JF1B 5EO0A 2Y06H 1MEXL 4PRNA 3O8XD 4F8TA 2EEAA 3E2HB 4OLVH 3VRJA 5DFVD 1V7NH 2BNQB 3RWHB 4PTUB 3CH8A 5LXGH 5EFIB 4WCYL 5I19L 4JFHE 12E8L 3IRZA 3D87B 5JIPA 1DJSA 2O5ZH 1H8NA 4MJID 4OCNC 1WLHA 3WFCL 4HWNA 4WENB 1K4CB 1FFRA 3IXAB 3GGWB 2R1YB 4S1QH 5KZCD 3H3BC 2BVOA 1VFAA 5ICZB 3C9NB 3W2DL 1KJ2L 1Z2KA 1ZA3A 4FFVC 5GISL 1A7OL 5HHPA 2W9EL 3EYOB 1QYGL 2JE8A 1ORSB 1T22A 5F7LB 4PJBE 4G6JH 4DW2H 3D25A 3MJ7A 2XPGB 2WV3A 3SDDD 3LS5L 2B0SH 5BQ7B 3MLVL 3QUYA 4K3DL 1JRHL 5AZEL 5C0JB 3GHBH 2FB4H 2OTUB 1JPST 4XBEH 1HYRC 3FQRB 5TE7L 4H8WC 3HZMA 2OP4L 1NCBH 5TDPB 1ORQB 2B20A 3FB8B 3IDYB 5FYJH 5JHDD 4YJZL 3OKEB 4XX1E 5F7YC 4OGYH 2AK1H 5CJ8A 5MI0B 4D8PA 5MEND 4J3SA 3D5OF 5LGJB 1UACH 4RGND 4WGVB 4JO1L 3N85H 3VA6A 2ICWI 5HYFA 2PKDA 4MS8C 3MV7E 1MHPL 1XAUA 4HUNB 1VKXB 3AS0A 2NY1D 1WWAX 43C9B 1IBGL 1DQQA 4Y16A 4TYUA 5CGYC 5JHLH 4F7CB 3L3GB 4Y7MA 1R5IA 2YKLL 3W39B 2ESVB 4TSAL 4M62H 1UWXH 4HEME 1SJEB 3BQUB 4AM0B 1RUML 1FVEB 3MSPA 1FZOB 3SKJH 5IB4B 1GGTA 1KLUB 5FO8A 1NKOA 1PAMA 2P43B 1CI5A 4NRZB 4RDQG 5IROA 1GZPB 3CVHH 3TBVA 1F4AA 4FQJL 1NSNL 2A6DA 4C4KO 1KIUA 4XCYB 1A7BA 2H9GB 4ZYKA 1BZ9B 4XB7A 1X5LA 3DV4B 3GI9L 3EO0B 5SWZA 4O02L 4RX4D 3QI9C 4OBSA 5ITFA 1QHOA 4MDJB 1OARL 4L3EE 1U3YA 5ISZB 2NX5D 1MHHB 1L0YA 2PN5A 1FAIH 4BZ2H 4OGAD 1WGOA 2A38A 3WJLA 4OCSL 3PWPA 2COQA 4HF5H 1WF5A 2Z91A 4MJ4A 5CJQL 2R29L 1IMHC 3OKKB 4MXWL 1T04B 1PYWA 5INCB 1FO0L 4H5SA 2AABH 3QPQC 1TJIH 4MB3A 4RRPG 4ZPTA 1I8LC 4IMKC 3NA4A 3V0WL 4PJ5A 3GBML 3SOBH 5DVNA 4UINH 4PJCB 3B9KC 1I8IB 1IEBA 1RFDL 3MOBL 3C5ZB 2VWEC 3MCLL 5D2LB 5GRJL 1CLZL 4KKLD 4WIQA 5GRUH 3IU3A 2EDRA 4YHPB 5KTEH 2BRRL 5EZOL 3X11A 2QHRH 3B83A 1F6FB 1Q9OA 2BVYA 4XCFH 3MMEB 2BSTA 2ICWJ 1WWBX 2FJFB 3FFDA 4M6MH 6FABH 3EYQD 4L8CA 2WBWB 4Q9RH 3BZFA 1P7QD 2VE6B 2IADA 3LB6C 4NKOA 5IMKB 3T0EB 1QEWA 3O3EB 1ES0B 5KJRL 5IB1B 1UB5A 5T1LA 2X4PA 4M5YH 3TV3L 1OD7A 4U1NA 1EXUA 2AJYH 4GBXC 1CVSC 3E0GA 1MREH 1B90A 1OP3K 4GG6E 5IHBA 3OF6D 1VGKB 4WW2A 3LD8C 1GZQA 1QPPA 3QCVL 1QSFE 3SE3A 1OAQH 5FGSA 3O2WL 4Q9BA 1WZLA 4Q0XL 5CP7A 4ZFZB 2ZUQB 1ZANH 2EE9A 3IFNL 3LH2L 4K94H 1BJMA 2YZ1A 3BWUC 3V7MA 4ZFGH 3BKCL 4MQSB 1MLBA 5I1DA 1HKFA 3V4VL 4D0BB 5HHXH 1NCAL 3SCMC 1ZLVK 3LPFA 5EIIA 1FZJA 2CMRH 1MCJA 3PIQA 2FJGA 2HTKD 4LHUD 1JN6A 2KQMA 4NQTA 1C5CL 3S37X 1CVRA 4AMKL 5J6GB 3UTZB 3F7RA 1LK3H 4PJ9B 2C5DC 3X14B 3VFMB 3RVXC 3NA9H 5ICYA 2GYSA 4ZAKD 5E6IC 5GXBB 3C8KA 3GB7B 3FQNB 1NGPH 5KVMC 1BLNB 4LMQI 3N9GH 1EEZB 4PTTB 4JDZB 1X5KA 4LVOC 4U0RB 2N7AA 1NGZB 1MJJB 1V7NL 2RIKA 5GS3A 4K7FB 3VWKB 3MJ8A 2B39A 3OHXB 1QBMH 2VQ1A 4Y4FB 1KC5H 4LNRB 5EC2B 3U1SH 5F1IB 1YEGH 4XPBH 4EI5A 4PP2A 3VFVB 1AKJA 2AXFB 3GSNA 3MRCB 1NFKA 3VMNA 1T89A 4RZCB 3VD7A 3TIEA 3QNXB 3HE7D 4PJBB 5DJ2B 1W72B 4U1LA 1DVFD 2UVEA 5EBLB 2R4RH 4YHNA 1T21A 2C26A 4RAUB 5TJWK 4X6CA 2LU4A 2P7TB 3OKOA 3U30C 4R6UA 4Z7VA 4JO3H 1KJVA 2K1MA 1F11A 3B9EA 4KGLA 5IVXF 4QEGA 3QZWA 2B0SL 4QHNB 4NQXA 4U6XA 3GHBL 4EBQH 3VXOB 4BSVB 3RWEA 3KPNA 1BGXL 4XBEL 3VWJD 3BDXA 3W5NA 4HUUA 3G6DL 3QQ3A 2I5YL 5A16B 1XF4A 5HI4D 4JDTH 3GSXB 1IKFL 3MV7B 3EJYD 4B50A 4HKZA 4ZNEE 3RU8L 3DUUA 3KPTA 4PRDA 4OGYL 1G1YA 5E5MA 1UACL 3N85L 2P5WD 3CFCH 3AXLA 1EAJA 32C2B 1U3HD 4B41A 3RVWC 3AU1B 1CFVH 3F6LA 3VXQA 5EOQH 4LSSH 2FH8A 4GW1A 2OJEB 4NRXA 2DQCH 1ZA6B 2AV7B 4NZDA 2F5AL 1T3FB 2ITDA 3QRGL 4RAHA 1JPGB 2MMXA 3WDIA 4CAGA 3ZKXC 1IC1A 1DLHB 5EN2B 1BEYH 1G0YR 2VZ1A 3FT2A 1BD2D 3MJGX 3SKJL 1GOGA 5JDSB 4F58L 1KJ2A 4AT6A 4DOHE 1LO5A 3GMMA 1FV1B 2YSSB 5TH2B 2I9LB 1MIEH 2CUIA 1TLKA 4LSTH 2C4XA 4IMLB 4KRMB 1LDPH 5IVXE 4L3EB 2AJZA 5L0QB 4ONHB 1M7IA 2EE2A 4XX1G 2RJMA 3KR3H 5KSUB 1ZMYA 4ZOAA 1BBJB 1FFNA 1FLTX 1RAMA 3BDYH 4ODSL 4MD5A 1U95A 5JOFB 4PJHF 3PL6D 4GKNB 3S9DB 5DMIH 4ZFOA 2Y07L 1EK3A 2BXYA 2IMNA 1FAIL 2EYTA 3WXWH 4BZ2L 3EFFA 4P3CH 3ARBA 1MF2L 3ULUE 2DM7A 1Y18B 2DD8H 3HTLX 1DE4B 3QPXH 2F8VA 3CXDH 1MI5E 1VENA 3PNWB 4Y19A 3IF1B 4MJ6A 1XZ0A 1BJ1H 1LP9F 5I1EH 1KB5L 4NQEE 4A2MA 1TJIL 3QT2A 5FOBB 5HGHB 1PG7H 2BDNL 3GHEH 5FDYA 3O3BB 4HWEH 4YAQA 1QKZH 4D0DA 4DEPC 3WLWC 3FO9A 4UINL 4BJLA 4EDXB 3RDTA 1T1XA 1AHWB 3B8YA 3IRPX 1OP9A 4XCNB 5DHVH 1ACYL 3HI5H 5GRUL 3CDFA 4A6YB 2FRGP 4OCRH 5KTEL 2WSKA 5E08H 3BE1H 4M48L 3ZHLA 4IRJB 2QHRL 2EH7H 4GUPB 2VXVH 5DMJB 5DFWH 3OJ2C 2JB6A 4HIJA 4NPYA 3PP4H 3M07A 2RQ8A 4PD4J 5C0BA 3EDFA 3JTSB 3WFEH 3HR6A 4GG6B 4LSUH 3AAZB 3V2AR 5I66B 1WC7B 4KGJA 3WIFB 5C0AA 5DZLA 3MLYL 5C09A 1P1ZA 3EKCA 4HIEB 4M5YL 1CS6A 2AJYL 4QO1A 1QSFB 4F9LA 2H26A 1Q0YL 2HVKA 3PWVB 1MREL 2QADB 3MRPB 4WHCA 2H6PB 1IGCH 3M17B 3WDHA 4HHAA 3ZMRA 2Y1VA 2V9TA 3B2VH 2GW5A 4RWHA 1AXSB 4LVHB 3NTCL 3U6RA 3RBSA 5TQ0L 4YUEL 3KYMB 4F7EB 1FO0A 4KFZC 1SJVA 3SPVA 5ADOH 5KS9A 2ADGB 5ACZB 1JFQH 3BEVA 3U36B 1BHGA 3QIUD 4YHLH 2E9JA 4PRPE 3TBWA 2BNUA 5HY9A 3GSWA 2JJTC 5ANMA 3MLTA 1B88A 1Q9LB 1BVKA 5HHXL 1DLFH 4N1HB 4NN5B 1MCWM 2BSSA 2WINB 4GOSA 4WJ5A 4YXLL 2HLFD 1X7QA 4IRSB 4PRIA 1U8QB 2W92A 5ICXB 5KBNC 3DI3B 2C3VA 4XBPA 2R2HB 4YBLB 4FP8H 1QRNE 5FHAH 4JRXE 3NA9L 3SDCD 3ZT7A 3WE6A 1U8KA 5SX5H 4QRRE 4PGEA 1NGPL 3JWOH 2FGWH 3VG0H 3C6LB 5I76B 5I1CL 1KTDB 3N9GL 2GCYA 4HV8B 3QFDA 4IJ3C 5ID0B 4HS6B 2NY4B 1D5ZB 3OKNA 2BRQA 5HXMA 1NLDL 3QHFH 4LQFL 4QGYA 2DJUA 1F90H 4HAFA 2AXGA 2CIKA 2V6HA 3KWWB 4BK5A 1F02I 1IAIM 1TZIB 5KG9A 1QBML 1NLBH 4NUJA 3DX8B 4XCCL 2EECA 1YEGL 2PTTB 5DEGA 3VGAC 3EHBC 1MFNA 3QXDB 5F1KC 1SEQL 3QUKB 2H32A 3HCVA 3C60D 1NBZB 4KKBC 5HYJD 3DRTA 4WFGD 4X7CC 4B5EA 1FVCA 1V5JA 3VXUA 3N06B 4O4YL 2Z9TA 4QRSB 2YD5A 4R4NC 5I1AA 1CFTB 3ZKMD 4CU8A 5BZDB 4XP1H 5GGSA 5E2TH 4UOW1 1WBZB 3FO0L 3KPSA 2LTQB 2LAGB 1RHFA 1ZOXA 3ZTJH 4GW4A 2ZJSH 1GGCH 1MHEA 2WBKA 4QF1A 3D85A 3MRLA 2DIBA 2ZCKH 3O6FA 1P4LB 1IC7H 4G5ZL 1JRHI 3UAJC 1H8SA 5GGQH 4R90H 5JR1H 1J18A 4M3KB 4L4JA 2AP2A 1WCQA 4YK4B 2FX9H 2GJJA 1YEHH 5IB3B 4JDTL 4NC2B 5FYLE 2XTJC 3HG1D 3LEXA 5JPNA 4OB5H 2EDJA 2VDRL 4BFGA 2VAAB 1FZMA 1QSEE 4G6AC 1NGYA 4MCZB 4P49A 1PKQA 5I1KH 4LSPH 1CICB 4ONGH 2OTWA 3Q6GH 2J5LB 2BMKA 5DURB 2RGSA 1CE1L 4DKDC 1D5IH 3SDAC 1ZVSB 4J6RH 1I7UA 3B6SA 4UBDD 4DOHB 3JVGC 1H3GA 4G43A 5MEOB 3UBXI 4M9PA 3EYSH 1BEYL 2WQRA 4OLEA 4N0UA 3FRPA 5IVXB 5A40E 5CEZE 3B9VA 3ROLA 5GRVL 1U36A 2VDKL 2UWEA 1YQVH 1KGCE 4J23A 4LSTL 1EGJH 1LDPL 2F19H 1GIGH 1P53A 2HYMA 3MRGB 3QNZB 1AGBA 1A6VH 2L4OA 1DANU 5J9PA 4PJ8A 4I4WB 4WUUA 3KR3L 2ESVD 5GSRA 3IETA 3BDYL 3MXWH 2DTSA 1T1ZB 4HIIA 2VN4A 4QYOB 5E6IA 4MMZC 1MI5B 1KOAA 2FHBA 4LCCC 3WXWL 4E42A 3AGVA 4OZIF 1LVEA 4NQEB 4UT7L 4TNWF 5B8CA 4P23C 3A6BH 3MLWH 4HMCA 4XMPH 3QO1A 3CXDL 4PJIE 5SWSA 3L7EA 3U2SB 3OB0H 5F96H 5I1EL 1IL1B 1JGVH 4MZ3A 1PG7L 4LRIC 1G6RH 1NMAL 3RI5F 4ENEC 5HGAA 3T2NH 1HH9B 2FO4B 4JVPA 1X4ZA 2I26N 3H9SB 3WBDA 3ZSTA 5DD3H 3DURB 4MA1C 1CT8B 4LARH 4PR5A 4TPRH 1GHFH 3CFBB 1ZEAL 3EOTL 4G80B 5EBWA 3RL2B 4HXBL 4OCRL 5KSBF 4DKFH 5E08L 2EZ0D 3QEUB 1NMCB 4M1DH 1SYVB 3RUGA 2EH7L 3V6FA 4HC1L 3Q5YA 3ME0A 4ELKA 4NQVA 5KVEH 2XN9B 3QO0A 4X99B 5MEPA 3MRQB 2M26A 3DX6B 2WP3T 3JWOC 2EDYA 4PY8I 3IDNA 1ONQB 2AXJA 3MGAA 2VN7A 1B2WH 1FNLA 5D1XC 5M95B 2X6MA 3WFEL 1AIFA 4NCC2 4PRAB 2WWMC 1RV6X 4J3WA 4WI4A 3L5JA 4WV1B 4UTAL 3LSOA 1K85A 2JK5A 4TVPE 1R3LB 5IB5A 3BPCB 2WWKO 4F7TB 3TGXA 2R8SH 1Q9WA 4JFPB 3ZO0A 1EFQA 2A74B 4MJIA 4ODUB 4R9HA 5BRZE 1IGCL 4OZIE 3HR5B 4FNLH 1NFDE 4PRPB 3RIAF 3BDBA 3B2VL 3QR2A 4I0PB 1CE6B 4JFOA 4R0LB 1KB5A 4RQQA 1F2XK 3TPUB 4YHLL 4QRTA 3G5YA 2NXYD 1VPOH 2X4UA 4OZGA 4QNPF 3T0ED 4JN1L 2G9HB 4JGMA 3LKRB 2CDGB 1BX2B 1U2HA 4JZJA 4RGMB 4EDWH 5I30L 2AV1A 1I8MB 1RU9L 4WFED 1TENA 1KN4H 2DBLH 3F7VA 4TRPH 3EJJX 3DV6A 5FA3A 2IALA 5ALCL 3EDKA 5C07D 3SDDA 1QRNB 4HLZG 1B6DA 4GRLC 4JRXB 4FQQA 2V7NA 4NYLB 3ECBB 3QIBD 4XZUB 4QRRB 3MLZH 3BKYH 5HHNB 3S4SB 5GJTH 2J88H 1CLOH 2P1YA 2BK8A 4JPVH 5FHAL 4TUJB 4WHTB 1OP5H 2CLVA 4OSUH 5KSAC 2PCPA 3HNTL 1BP3B 4QTHB 3GJEA 3QDAA 2DTML 4PYGA 2FGWL 3JWOL 4XWOD 2P4AB 5IK3A 5MENA 4R97B 2EE6A 3ES6B 4NQUA 1A9EA 3ZT6A 3MRIB 1YMMD 5E9DE 1E4JA 2ZWLT 4NCDA 3IFLL 3EOAA 1F90L 2IBGA 3FQXB 1T4KA 5FEBA 2ZSVB 1H0DA 2WAHA 3OXSA 3ZE0F 3OAZH 3DLQR 5IMMB 1IGYA 4HUWB 3IJHB 4N5ED 4KMQA 4JFYB 5IKCB 4RAVA 4RNRA 1VADB 3IGAB 1Z5LA 3GK8L 3GI8H 4MD4A 4PBVC 1GOFA 3WFBL 5I71C 2F74B 2G2RA 2R56H 3U0WL 3ZE1E 43CAA 2CK2A 1A9BB 3G6AA 3MUGB 1OGAA 3BOVA 3L5XH 5DXWA 2SEBA 2YRZA 2VISA 1MWAH 5JW5A 2XV6B 3GJFH 4PY8J 1GAFH 2FJHB 3BX7C 1U2CA 4NZJA 3RFZC 1TQCC 4BSWB 3VI3E 3IVKA 2Z8SA 5E2TL 4Y2OA 2QSQA 4WNQB 4Y4FD 2ZJSL 3DYMA 5E6ZA 3T4YA 4Z6AT 5HBBA 2GFBA 2IFFH 4ZDHA 5EU6A 3BWAB 3EYFB 2MSPA 2B7DT 2ZCKL 1P4IH 3OBAA 4RX4A 5DC4B 3S4SG 1I85C 3HPJB 4P5TB 4LSQL 5JR1L 1S7TB 1E4KC 1QSEB 2W60A 1CDHA 3F7YA 1NKRA 1S7RB 3HE6A 2YXFA 2FX9L 3HRPA 4X83A 1HDMA 4JY4B 2DQEH 1M7DA 3PHOA 4OB5L 1TQBB 3IS0X 4JN2A 1IGJA 4ZUWA 3AREC 3ULVE 2DWDA 2R1WA 4P4RA 1T1WB 2X7LA 5CILH 5I1KL 2IBZY 5E8NA 3FQUA 1ZHBA 4LSPL 3GO1H 4FZEH 4PY7A 1LHZA 1U93A 2HFFB 5IEHB 4UNTA 1VFBA 3Q6GL 3QCTH 1MHCB 5CLWA 1NCNA 3W0WE 4U6TA 3V52L 4W4OA 5DJ0B 4JKKA 3UPRB 4J6RL 2BNRE 1UXSB 2OL3L 3AM8C 3O2DA 4DN3L 4UDTA 4ZUVA 2NTFB 5J6HA 2N7BA 1IC5H 1DQMH 2OMBA 3EYSL 5DJ6A 2V2XB 1CN4A 1KT2A 1PZUB 3TJEH 1AH1A 3L3JB 4NJAH 2AQ2A 2APTA 4LVNC 4MNGA 3U9UB 2A6KA 2VZSA 1L6XA 4BA8A 1YQVL 2X2YA 3LQZA 1H3XA 5CSBA 1EGJL 3F7PC 4QWWD 4M7JL 4LPVA 5DSCB 5F1NA 5INDB 3FCTA 1A6VL 4FZ8L 4XP5L 4UIMB 1P7QA 4NZUL 2V5YA 3D0VA 3TCXA 4RSVA 4KK9C 1CGXA 5IW3A 4EZMA 4Y4HB 3FB5A 3T77B 3X12B 2QBWA 3GSRB 5AYUL 4PJIB 4DGYL 5SWQA 2BY0A 4KK6D 3MGOB 1NAMH 4WI9A 2YEZB 1YMHB 4O2FA 2VH5H 3UJTL 3I6GB 4KC3B 4HEPG 3OF6A 1DBAL 2GJ6E 1B4RA 3MLWL 4XMPL 3FQTA 3IXTB 5C8JA 5E7BA 4JQXA 1JNLH 1C16A 1YDPA 3UTSD 1A1MB 2NW3B 2CR3A 4EXKA 1ZVYA 5FK9A 1JGVL 5DS8A 4MXVF 1KPRA 3B8SA 1CFBA 2CIIA 5D7SL 2BXZA 3T2NL 1HI6B 5ERWA 5C0ND 4OZHF 3HB3D 1FNEB 4XPTH 4YHZH 3BGFC 1GGBL 3D3VE 3HI1A 5IMOB 1JV5A 5TE6H 5KOMC 2ZOKA 3GMOA 1R24A 5L9DH 4LARL 4TPRL 4YO0B 5KVGL 5L8JB 2ZKHL 4XPFH 1EEYA 2A1WH 1NDMA 5JTWA 4LHUA 4XRCA 4ZQKA 5B3NA 2PW1B 4DKFL 3PWJA 4V1DD 3JTTA 3O3AB 4G8EA 3BQUC 4LP4A 5HSFA 3MCG1 4X6FB 2CDEB 5CJXA 2D31B 3VRLE 4OCMC 3MXVL 1MCFA 4ODWA 1QA9B 3BZEB 2GSGA 1VFMA 4G8FA 5D8JH 5I1JH 5I8KL 1KELH 1N2RA 4G42A 3TNMB 1M71B 4R3SA 5FV2A 4X7TB 5DR5L 3D18A 2ERJB 1CFQB 1GCFA 3U0TB 3O45A 5DUMH 4Z5RA 5BRZB 4OZIB 4ZMAT 4NQCB 4W81A 3SGEH 3SJVD 5BS0A 1E4XH 3IAGC 1NFDB 1J1XH 1SBSH 1ZLWH 4JG0H 1BIHA 2J8UF 2A77H 3LCYA 4GAFB 4XAKD 1KEGL 3QXVA 4NO2A 2YOCA 3ZSSA 1HH6B 4IRJD 1A22B 1QD0A 3HAEA 4PRBA 1G9EA 4LLMB 1YC7A 3JWDL 3PQYD 5FO9A 4K3EH 2ZUSA 3UEZA 4MDIB 3EW3B 5EO9B 2FX7H 4XXDA 4QHLA 4NRYA 3HE7A 1UYWH 3FAWA 3M8OL 4FQ2L 2F53A 1DVFA 4X5XA 4XNUH 3H9YA 5FYKD 1N3NA 1VPOL 3G04A 2FH6A 3EFDH 5F71A 4KDVA 1KN4L 2DBLL 2VZTA 4TRPL 5AD0A 4YXHH 3WL9A 1RJYB 5E1AA 3AFLA 1OSZA 1L0QA 1I1AB 5CIPA 1SEBA 1UZ6F 1MCIA 4M61B 3IDMA 3MLZL 5HYQA 4TTDD 1WT5A 4GXVH 5GJTL 2J88L 5GRXG 5IIEA 4YEEA 2YBRB 3PWPE 4NO3A 2YUVA 3F12B 3MNWA 5T1DH 4JPVL 5D7LE 2R69H 5E9DB 2R23B 4OSUL 4N9GA 4PLKD 5GGUA 3MBEB 3WSQH 2APVA 4ZODA 4R7NB 1IC4L 2CXGA 4WFHD 5C0GA 3ZL4H 4DGVH 5FM4A 5IOPB 2CGRH 1AI1H 3SKOA 4XVSH 4GLRH 2P5WA 3DECA 1KN2H 4ZXBC 2BVPB 4PJ5E 4I48B 4MNHB 1TDQA 1U3HA 2Z8RA 3EO1B 1EO5A 1NDGB 3CC5B 2NW2B 1FPTH 1UT9A 5DRWB 4IRSD 4KI5C 4J4PD 3TA3D 1HHHA 3L7FA 2W0KA 1CBVL 3I02A 3TN0C 3HZYA 4XAWH 3GI8L 1CDCA 3IAPA 1CXEA 1KTLB 2BSRA 1UM5H 2JELH 4HKJA 5JO5B 4JM2C 1RI8A 3X3FH 5FDWA 1OAYH 5T5FH 1BD2A 4KRPB 1TZHA 3L5XL 1ZAGA 3QJFB 4JY6A 1L6ZA 3I75B 2BC4A 3HLAA 1WWWX 2NY4D 4Y1AE 5D9SB 4L9LA 1XGTB 3MRRA 4FQ1L 2AKRA 4OCXL 1J10A 3P30H 5JIKA 3ARWA 1E4WH 4HWBH 3TVMD 1RZJH 2NXZB 1P4IL 4LLUA 2AGJH 2AJSL 3U7WH 4EJ1C 1IZJA 2EXWC 2OBGA 1I7TA 3TP4A 1WTGT 3STLB 4G8IA 1SYSB 2DQEL 4LLVB 1OWRM 4LPXA 4N0YH 2WK2A 3I85A 4PJ9C 2Q86A 3ORJA 3Q6FA 1RIVL 1NJ9B 3W0WB 4L4TE 3LDBB 4CJ0A 4OIIH 1OAUH 3O3UN 2R0ZL 3GO1L 2BNRB 1N8ZA 4FZEL 4KKCC 4HK3N 4X7EC 4U1JB 3VGDA 3T1FA 5IHZB 3QCTL 4K23L 4GSDL 4L8SB 4CDGC 2IH3A 3M1BB 3KHOA 2MQ3A 3TEUA 5I1HH 2VTFA 4PJDF 3QQ4B 1CG9B 1N7MH 1RZIA 3VWKC 5D7JD 3MRFB 1WBYA 4RFNB 1J0KA 2IC2A 2QR0B 2X4QB 5C08A 1XT5A 3I6KB 3VRJB 4NJAL 2FEDC 4S0SD 2Q7YA 2J8HA 3RTQB 1IEAB 5IFJB 5ITBH 4EIGB 2J4WH 4QRPD 1NANI 2G75A 4O2EA 1CICD 1C7TA 5I8EB 5HVHB 2GK2A 3P77A 4JZOB 2AJXH 3MJ6A 4G7VH 4M3JA 4X4YB 5DURD 2X4NB 3MRDB 4FQCH 1K4DB 2CQVA 3WHE1 1JF6A 5GHWL 4CGTA 2BVOB 4JM4H 4RA3A 5BXFA 3CFJA 5C7XL 1G9NL 1OWWA 1P2CA 1ZA3B 5GGRY 4DFHA 5HHPB 2GJ6B 2IANA 3EHBD 3TT1H 4S1DD 4POYA 4YBQC 3PABA 5H2BA 3AC0A 4X6BA 5GRWA 5LKNA 5EO1A 1JPTL 3D25B 3MJ7B 2XI9A 4PG9B 5LJYH 4F9PC 4ONFH 1H3PH 3GMLA 5FGRA 3QUYB 4MWFA 4X6CE 4HIXH 5A2LH 4IOSD 4AH2A 2HT4C 5ECJE 4YPJA 4S1RH 4HH9A 3H42H 4HGKC 2H41A 1QR1A 4BH7A 3D3VB 3RZCB 2XT1B 5JW4M 2PYED 4HFUH 4U1GC 3TLRA 3HZMB 4E41D 4OZ4A 3QIUA 2FD6H 4X80L 2OL3A 5K9QI 5LBSH 4YHZL 1I1RA 1D6EA 2YC1A 3V6OA 4D8PB 4Y5VC 5DQDH 5TE6L 3HFMH 5L9DL 3UAJD 4KHXL 2VUOA 3DMMA 3QAZB 4NHCH 1DQQB 4Y16B 1H5BA 3HNVL 3V4PL 4U1KB 1OPGH 3KPLA 3SDCA 1HK6A 2ZCLH 5CGTA 3TZVD 1W72L 3RNKA 3V5DA 5D8JL 5DJCB 5I1JL 1DQLH 1KCVH 1KELL 1T03H 2VLKD 1P84J 4FFYL 2I24N 1EAPB 2DLHA 3V6ZA 1V3MA 1YPZA 4LDOB 3H9SD 3BUTA 3AY4C 1HHIB 1BF2A 3MOQA 3DYPA 1J1XL 1SBSL 2Z31C 3ARGD 5BZWB 5DQJB 2XXMB 3KLAB 3THMH 1S7XA 3UZEA 2A6DB 4MNQD 4UT6L 4UV4H 5SX5K 4FG6C 3GM8A 1UWEL 4H1LB 1FGNH 4M7LT 1JI1A 3SDXF 5JUEH 2XN9D 4JFDE 2J7LA 3T4AA 3DVGB 2FX7L 3LV3A 5HYJA 1NBYA 4H26A 1IVLA 4HT1H 4Z7NF 1UYWL 1MCBA 1JNNH 2W91A 4FQLL 1JF1A 5B39B 2E5EA 5DF0A 4XNUL 4ZO8A 5FGBA 1BM3L 1VDGA 1GSMA 5JW4R 4BSJA 3AM8A 2JCCE 2YS4A 5LAXB 4I9WD 3L9RB 2IBZX 3GM0A 3RWHA 4PTUA 4YXHL 5JXEC 2NCMA 5EFIA 5D7LB 1RZJC 3LKQB 1K4CA 2Y6SC 3CPLB 1HINH 3IXAA 1IGTB 3RY6C 1KULA 1OSPH 1AHWC 2R1YA 2KPNA 2R69L 5DHXB 3K3QA 5C2BH 4PJ5B 1WAAA 1BMGA 3WSQL 3V5HA 3SBWA 1A7NL 1T0NB 3C9NA 1F42A 1IEBB 5C70A 1QLEH 2J8UB 5EU4B 3VD5A 3DBXA 1X4XA 2CGRL 3EYOA 1YYMH 4XNMB 2O93L 4XVSL 2DIAA 2R0KL 1BJ1J 4NO5B 2YPVL 2XPGA 4H0IA 1QRND 4X6EB 5CMAB 5KOVC 1MCKA 2HRPH 4XNXL 4QRRD 1HCVA 4OZFB 5C0JA 2OTUA 3QUXC 2BSTB 4Y5YB 4H20H 3FFDB 4P2YA 3FQRA 1I3RB 4WI5A 1G7LB 4H1LG 1ZHKA 4Y1AB 4HS3B 5TDPA 5E2WL 1ORQA 3X3FL 4WHDA 3ULUH 4IM8A 3OKEA 5T5FL 1ODAA 2QADC 1ZS8B 1UB5B 5D7IF 3GSVB 5T1LB 4YDVB 3KLHD 5B39G 4MHHG 4WFFE 5LGJA 4U1NB 5C0BE 4I3GA 4I5BB 5JXAL 3PGCB 4P46D 5DMGD 4LVHC 1JTOA 2NY3D 1VKXA 4LFHD 1OTSD 2VLRE 4MXQD 5C0AE 4Z0BL 43C9A 1DBJH 3EOYG 5C09E 1R3KB 4LIQH 1T6VN 1RSFA 5DJXB 4KKAC 5FYKU 4RRPA 4F7CA 5CJ5A 3L3GA 4HWZB 4O2CB 5E8DH 4OI8A 1SJHA 3W39A 3S34H 5E8PB 2ESVA 2D3VA 3LEYL 4PJFE 4G9FD 4B53A 4AM0A 1FVEA 4L4TB 4NN5C 2WZPD 1C5BL 1FZOA 1KLUA 1MCQA 4NRZA 1SVCP 1X3DA 5I1DB 5KS9E 2XKNB 1AY1H 1OW0A 2XY1A 4R96B 4N0YL 1RZGB 1FZJB 3SQOH 1ACZA 2FJGB 3GRWH 2XYCA 1OAUL 4R4FH 4L8BA 3UPCA 4D9LH 1FP5A 4P2OD 1A1NB 1MJ7L 1BZ9A 3DXAE 4OZFG 5EU3A 3EO0A 4OFDA 5IFAL 1AP2A 1V3KA 1QSED 1BOGB 2Z0BA 5IJKA 3ZDXF 1T66C 4OF7A 3ZDZF 3UJIH 3HMXL 5KSVA 5ISZA 2DOCA 3MUY1 1MHHA 4I0CC 1KUMA 1YY9C 5JMRA 1A3QA 5D7IE 4PS4L 2F54D 3MJ8B 5ITBL 4G3YH 3OKKA 2WM0A 1T04A 4AK1A 4I3SH 1KIRB 2FECL 1MAMH 15C8L 5KANG 2AJXL 4H0HB 4LPWA 5HGDB 4FQCL 4R8WL 4ETQB 1Z3GH 3VH8A 1J0IA 4I77L 3DNKA 3BMWA 2MOVA 4Z7UF 3NCBB 4OLZH 3LZFH 1PY4A 3VW3H 5I74B 2LTQC 4X6CB 1QFUH 3BYYA 3TT1L 3GNMH 3C5ZA 4G7YH 4X8XA 5D2LA 5ILTH 5FA4B 4GH7B 1WBXA 4YHPA 4WI6A 3TBYA 1CFSB 4GKOA 3ZHKA 3MLUH 1GVIA 1S3KH 4YHYC 4I18B 1BREA 1I1FB 5JDJA 4HIXL 4HXAH 1JGDB 3NH7L 3MMEA 3KPNB 4TNWK 3WLBA 4LLQB 3H42L 3BH8A 3OGCB 1ZLSH 2LE9A 1A1OA 1GC1L 3UTTD 2W38A 4MA8H 1IILE 2VE6A 5D1QB 1EFXD 5F7DB 2XZAH 5IMKA 4S11A 1X44A 3T0EA 2DYPD 1ES0A 2NY2B 4Y4HD 5IB1A 5LBSL 3RI5K 4KUCF 4OGXH 2CPCA 4OCLC 4KK5C 3ZDZE 3L3KA 1WUNT 2C3XA 3AXLB 5I17B 3QIBA 2QQNH 4U3HA 4NO0B 2H2SC 1OTUD 5A2JH 5EDXA 1Q0XH 1VGKA 4V2CB 4ZD3H 4GW1B 3WIHH 2IWGA 5CP3A 5ALBL 3BP4A 1RZ7H 4ZFZA 1TZGL 2EC9T 2APFA 3QIWC 4Z7OF 1JHKH 1KCVL 3BN9C 3IDGB 1T03L 5TF1L 1JMXA 2NR6C 3DX9A 1IAKA 2FO1A 1NGQH 3U83A 3G6JF 2AEQH 2ICEB 3WIIL 2EDDA 2DIJA 3NCYP 4JFDB 3V8OA 4MQ7A 5FYLH 3BKMH 2AI0H 4P5KB 1T7XA 1ZTXH 1N6UA 3UTZA 3X14A 3L1OH 1HZHH 4KVNH 3VXSE 1W0VB 1YEEL 1M7IB 1IAIL 1KBGH 3D48R 5JUEL 3ULUC 4TUKH 1GPOH 2JCCB 3ARQA 3D39E 3FQNA 4X98B 4XVUC 3RIAK 3GBLA 1BLNA 2GTWA 4XTRC 5CUSH 2IH1B 1I9EA 1EEZA 4PTTA 4K8RL 4GMTH 2IF7A 1NGZA 4PLJC 4OTXH 3BD4A 4NQCD 4U3CA 2KDGA 3B2UD 3PV6B 4K7FA 4KK9D 5DMKB 1LEKB 5J1TC 4Y4FA 1BOYA 4QRQB 4RFEB 5EC2A 1TFHA 2YXMA 1XR9B 2Z93B 5F1IA 2VERN 4MJ6B 3PDOB 1D9KB 4KZEH 3VFVA 3MRCA 2AXFA 4RZCA 3EYUH 1EEQA 1XF5A 4YAQB 3IS1X 4P2RD 3MFGB 5DJ2A 1W72A 3FO9B 4Z18A 5EBLA 2IPUG 2K3TA 1P9MA 2CH8A 3VFWB 4RAUA 4MQTB 4Y4KD 1QLEL 1ZGLP 4KMTH 2P7TA 1YYML 1HWHB 2WIIB 4JKPH 4RIRB 2GK0B 1A5FH 1XIWB 2D9CA 4WTZA 3NACH 5D5ME 1IFHH 1FNGA 3UC0H 2HRPL 4QHNA 3LRGA 3IB4A 4BSVA 1MRFH 4KXZI 4H20L 5D7KE 2BFVH 4JO4L 4OI9A 1BWWA 1LNUB 1G7QB 3ARFB 4Q6IC 5A16A 4WV1C 5C0BB 4U2ZA 2O5XH 3HN3A 1HSAA 3ULUL 3MV7A 4JJ5A 3LY6A 5L2KD 5L7XH 4RWYL 3RVVD 4LEXH 2VLRB 5C0AB 5HPOA 5I18H 4IOIB 4NJ9H 5I1LA 1FC1A 1G0DA 2H26B 1O5DT 2X4TA 32C2A 5IWLC 4YGVA 4I0PC 3WNLA 4MB5A 4HHAB 4PJFB 4FMFA 2OJEA 1W8NA 1KTRL 1ZA6A 1XFPA 1YUHA 2AV7A 5J11B 5DMYA 4RGMC 3U79A 1T3FA 4LCWB 1BJ8A 2F15A 2X1WL 3S34L 4MJIE 3WS6A 2HT2D 3BEVB 1ADQL 2HG5B 1FNFA 5C9KA 2FDBP 1DLHA 3DVIA 4M7ZC 4KRPD 2BNUB 3TH3T 5I6XC 5JDSA 4UB0L 1U8LB 1BVKB 2VNCA 3DXAB 4MAUH 1FV1A 3BJLA 2YSSA 2OCFD 5TH2A 2I9LA 1MY7A 2P8MB 4NDMB 4W4NA 2EIBA 4X0KB 3VE0B 2V7HA 4WJ5B 3C2AH 1UWGH 3GRWL 4IMLA 2R4SL 4L3EA 2VXSH 1P4BL 3X3GH 4ONHA 4HUVA 4HJ0D 2P42B 4R97C 3EDJA 4F7MB 2R9HC 5KSUA 3ILPB 1BBJA 2V2TB 5D7IB 1QZ1A 2X1PA 3LKOB 5J1SC 2GCYB 3F7QA 5DD1L 3UJIL 4Z77B 4YC2B 5CBAA 4JHAH 3AROA 4AEIH 5I73B 3I3EA 4S1SH 4NZRH 4KV5F 5JHDE 2HMIC 2BVEA 1PW3A 1PGRB 2DDQL 4PV8B 5EORL 3W0WD 2CKBA 4V1DA 4C4KT 5IMLB 1Y18A 3N0PB 4G3YL 1DE4A 5HD8D 2DQDH 1QVOB 1MCEA 5DEGB 3PNWA 4I3SL 3IF1A 4JE4B 4QXTB 3UDWC 1RMFH 1MUJB 3FB6B 3G08B 5FOBA 4ZXBD 5HGHA 3SO5A 1RZKH 3HCVB 4M1CC 2VXTL 2HVJB 2I25N 1Z3GL 3O3BA 4XNZB 2YWYA 6CGTA 1BQLH 3LZFL 4IEFB 4EDXA 4Z78B 3VW3L 1AHWA 3SJVA 3JUYA 3UTQB 3GNML 1EMTH 3KPMB 4QXUH 3CU1A 5ILTL 1MFDH 5JOPD 4A6YA 1IGFH 3RTQD 5FUCE 4JZNB 4JGUA 4JPWH 4IRJA 2APWA 4PJ7F 2GTZA 3MLUL 4P5TC 4Z0XA 4GUPA 1MHEB 4HXAL 3MRLB 3L3OB 4ELMF 5I9QB 1ZLSL 2HLAB 1WEJH 5LCVH 4AEHH 3WMSA 1G7HB 4X9IA 5IVZB 1TQBC 2VKWA 3KVQA 2EH8H 2XZAL 3JTSA 3RWFB 1KV3A 2JJSC 3RVTC 1W0YT 2ZSWB 5I66A 5JIHA 1S7QB 1WC7A 2MKWA 3WIFA 3VU2A 5JORB 3HMXA 2GJ6D 4OGXL 2MQ0A 4HIEA 4PB0H 4ZS7L 5GGVL 1QSFA 1CWVA 1CF8H 3WCYA 3MCKB 3SE9H 2NX5E 3MFFB 1FCGA 4GAGH 1FGVL 4J3VA 1DTUA 2J12B 2RCSH 2UY7A 2XKUA 4Y2DC 4JFZL 4ZD3L 1AXSA 2H45A 5GQBA 3BAEH 4F7EA 1K8IB 4XC1H 3T0XA 5ACZA 1WK0A 1S7UA 2JB5L 4KTDH 1KEMH 3U36A 5BO1H 1JHKL 3QG6B 2ARJQ 2DI9A 2O26U 4JFFE 4R26H 2B1AH 3FRUB 4UV7H 1NGQL 3QWOB 1Q9LA 1FBIH 3VXSB 3H8NA 4LASH 2Q7NA 5AZ2L 2WINA 3ARRA 1AR1D 1ZHLB 3D39B 4DK3A 2AW2A 1PDKA 4IRSA 3CXHK 1QG3A 1U8QA 5CHNB 4J4PA 5FYLL 3SE4C 5I16B 3BKML 5ICXA 1RK0B 4P4KB 4YWGL 1AGBB 1HZHL 1XH3B 4PJ7E 2ENSA 3QWRD 3K2UH 2MPAH 1KBGL 3E6HA 4DUVA 4KK8C 3LHPH 1HOCB 1A6UH 3DJ9A 1EHXA 3C6LA 5I76A 5CUSL 1KTDA 2NY6B 4HV8A 2C3HA 5ID0A 2ED9A 2Q8BL 1D5ZA 2I60L 1RJCA 1BFSA 1EVUA 4LHQB 3Q5OA 5ESQA 1F8TL 2VLJE 2DQGH 3H9ZA 5B8CB 2EDNA 1TZIA 5DC9B 3W9EA 1BAFH 1GJIA 4KPHL 3GMQB 3DX8A 3L7EB 4P0DA 2CRMA 2LV4A 2PTTA 3KPPA 4YQXH 3TVMA 3PP3H 2LVCA 2XQYG 3HS0A 1KENL 2ZNXA 3WNMA 4XBGB 5GS1C 3QUKA 4M9OA 3WV0A 5CEZL 4K3HA 3UZVB 1MJ8H 1NBZA 4P59H 1YEIH 5GS0H 4YXKH 5HGAB 2P49B 3F58H 4HX1A 1KCSH 4E0RB 5D5MB 3KPOA 3FHQA 4BQBA 1FFPB 4UOW0 4H25B 4HWUA 4ERSH 4XXCA 3VDCA 4KMTL 1CFTA 4GMSH 4IDJH 4XPAH 5JLZA 2PO6B 3GUTB 1UCBH 2VDLH 1WBZA 4IOFC 5EBWB 1N5AA 3NACL 1IFHL 5D7LD 4APQB 4YE4L 4MB4A 3UC0L 3VI4F 1VEOA 4ELKB 4ZNEA 4NQVB 5FF6B 1P4LA 5HHQA 4EN3D 3OSKA 5MEPB 1FH5L 3RWJB 4CVUA 4LCIL 1L4IA 3ZKND 7CGTA 1RUAH 5D6DA 3OR6B 4NKDA 1C08B 5L7XL 3QDMB 4PG2C 4LEXL 5CZVH 2VSDA 3O8XB 4XVTH 4DTGH 4NJ9L 2VAAA 2X41A 2C4FU 3IJYB 1PD6A 1Z9OA 4MCZA 1S78C 1QLFB 3NIFF 2XOTA 1Q9WB 3WD5L 4FXLA 2ADFH 2XWBA 5CLTA 1X5ZA 4MJIB 1CICA 5F8RC 2BY3A 2GSIB 5F93C 1HXMB 1RZKC 2OLDA 4KQ3H 1J88A 3MV9D 3V8CA 4JFOB 5FUZH 3S7GA 5KZCB 2B2XH 4JPKH 4Y1AD 1RIHH 4M7KH 4FG6D 4PJGF 4F15B 2NY7H 3BRDA 1PG7W 3F7VB 3MGTB 3QDJD 4XP6L 5JQ6H 3V79C 3DV6B 5IVXA 5MP6H 3CFEB 2VUYA 1YEFL 3QQ9C 3R0MA 3VRIB 4LMQE 1CFNB 1YN7B 3FB7A 2AQ1A 5DJYA 3T04D 4BQ6A 1V7MH 3C2AL 5D72L 5K9OA 4CN4A 3Q48A 3MBEC 4MAYB 2UZIH 1EHNA 3MRGA 3QNZA 3C09B 4TVPL 1T83A 2ZUVA 2PR4L 1E28B 4YHIB 3OAYH 3RNQA 5JHDB 5HTSA 1CR9L 4YFDB 1MFAH 4JREC 1FE8H 4L4TD 1SMAA 4QYOA 4O5LH 1MI5A 4JHAL 3STBA 1CGYA 1T4KB 3VXMD 1H0DB 3DHJA 1T5WB 4WO4B 3N50A 1OT1A 4QHKI 1R3JB 1RVFL 3H3PL 2DQDL 2P5WE 1RHHA 3CLEH 4CUCA 3WN5C 3HUJF 1IL1A 1DCLA 3H0TB 1TNNA 1RZKL 2PXYC 2XQBH 2FECI 4PGBB 5DK0B 3QWQB 3G6AB 4JRWA 1HH9A 1UC6A 3DARA 2FO4A 1J1PL 3TO4D 3TC9A 4JFED 3H9SA 2VISB 4M03A 3DURA 5EOCH 3ARGA 4OLUH 4PJGE 3I84A 1EMTL 3CFBA 2H1PL 3FN0H 1N64L 1S8DB 4MVBC 4QXUL 4MNQA 1TCMA 5J57B 1MFDL 1BD2E 1IGFL 4KJWC 3RL2A 2NXZC 2LVEA 5IESH 3QEUA 1UADC 1IKNA 3QFJD 4RCAA 5FUOH 3ULVC 3EJZD 3SY0B 4RGOH 2XN9A 5C0RL 3MRQA 3O9WD 1CL7H 5LCVL 4WW2F 4OD2B 4JANB 4PJHA 1ONQA 5GRYA 3TFKC 2XZZA 5F6IB 3OKMB 3S3SA 1SMOA 2NX5B 1I3GL 3IDXH 3OR7A 4PRAA 5F7EL 2E6PA 2VQTA 1M7DB 3PHOB 2E7LA 1IGJB 1MRDL 3G9VA 1A6ZB 3NIGE 3BPCA 1J0HA 1MFBH 3HI6H 4F7TA 5EUKB 1P6AB 4B7IA 4JFPA 1S9VB 1A7RH 3QUMB 4L8SC 2A74A 5D1ZB 3SE9L 1WVZA 4GAGL 4ODUA 5E94A 3HR5A 2RCSL 4K3JH 4PRPA 1R3IL 4JFFB 5GS0C 3K8KA 1JE6A 1CE6A 2QEJA 3BAEL 4XC1L 2H3NB 5T3ZH 2WANA 1NGWB 4R0LA 3MUJA 1MRCH 4NIKB 2EYRB 3HUJE 1KEML 4JO2H 4KZDH 3SKNB 2WUCH 3A6CH 2G9HA 3LKRA 1BX2A 5DJ6B 4R26L 2B1AL 1KT2B 2AJUH 4MA7L 1DBBH 4ZPVA 1WQVT 4PJ7B 1QRNA 2C7UB 1K9TA 4FTVD 2V17H 2A6KB 4LNVA 4YDLC 3W11C 4NYLA 3ECBA 5EZJB 3IDIA 4NO0D 4XZUA 4QRRA 2HWZH 1ZLUH 4KJPC 2D4FA 4QHMB 2W9DH 2VAJA 4PP1C 5HHNA 1OCWL 5GZND 5I8CB 3FCTB 1Y6MR 4TUJA 1BBDH 4WHTA 4C56D 3K2UL 3LEVH 2V2WB 2MPAL 3ULVL 4QHKJ 1OM3H 3LHPL 1SQ2N 3MODH 2VLJB 1A6UL 3BW9A 3CH1B 1IAII 5FCSH 4UTBL 3FB5B 3ES6A 5A1AA 1JZ8A 1HE7A 2ID5A 1DUZA 2VDML 4O00A 3JWNC 3QUYC 1YNLH 2ENYA 3QEHB 4P46A 1JP5A 3T09A 2DQGL 2ZSVA 3BPLB 4JFDD 4HUWA 3IJHA 4YDIH 5BMFL 2M8XA 4JFYA 3NABH 3VD3A 5C8JB 3IGAA 4YQXL 3TCLB 3T2OA 2F58H 2F74A 3KPRE 1AD9B 5DS8B 1MJ8L 1A9BA 1AGFB 4P59L 3MUGA 4G9FA 4HUXB 4YXKL 5GS0L 3NPZB 1IGIH 3F58L 1M05A 4QGTA 3HI1B 2VC2H 2YD4A 1JV5B 5CD5C 1IZKA 1R24B 4Y16C 4ERSL 2FJHA 1I3VA 3O41B 4BSWA 4IDJL 5EIVA 1EV2E 4M6NH 1EEYB 1IM9D 1NBQA 3NFSH 2VDLL 1UH3A 3S97C 4LHUB 4WNQA 1JZ3A 2BERA 3TM6A 5DEFA 4P2OA 3GSNH 3T65B 1NC4D 3BWAA 2CKNA 4U4BA 3EYFA 2H2PD 4N8CH 3OJMB 1D9KD 4ZAKB 3HPJA 4P5TA 1QSEA 5IROC 1S7RA 4G42B 5T3XD 3QDHA 1DBMH 1FYTD 5TE4L 4JY4A 3V7AE 3MYZA 4WWKD 3NIDE 4XVTL 1U3JA 4OIAA 3QIWD 1J05A 1Q8MA 1T1WA 4KRLB 3RA7H 4I3RL 1UENA 2HTLC 5DZNA 4M1GH 5CINH 2HFFA 5IEHA 3V5KB 1KYOK 5ETUB 5FO9B 1MHCA 2A9MH 2AQ3A 4KQ3L 1NUFA 1F58H 4NRYB 2XNAB 5DJ0A 3ARFD 5FUZL 2B2XL 3TT3H 5DVKA 4MLIA 2VZUA 4HJGA 3BVNA 2NTFA 3O4LD 3WJLC 1N3NB 3WO4B 3ARPA 1MEXH 1DSFH 2VLRD 2NY7L 2YA0A 3O0RL 3RPIB 1RURL 3SGDI 1FYHB 2Z4QB 4WFGE 4ZSOA 3BT2L 3U46B 5I19H 4XVUD 3U9UA 4KU1A 1OSZB 4KJQD 4QXGH 2VL5B 1V7ML 4WDIB 4LHUG 3VWJB 4R2GB 3MRKB 5DD5L 4CMHB 1XCQB 3BXNB 5DSCA 1DP0A 3FZUC 2D0FA 2UZIL 3R0NA 2K7QA 3UTTA 4UIMA 1E6JL 2R2BB 3CVIL 1EFXA 4YDJB 4LCWD 2DI8A 4N9GB 3CCHB 3GSQA 2AJVH 2DYPA 1N4XL 4HJJH 4GRWF 3W2DH 1KJ2H 4Y4HA 1A7OH 3X12A 1U92B 4KTYA 1A3LH 2W9EH 4LSVH 5SX4I 3T8XA 4NFCA 4Z7WF 3SKOB 2VDOL 4PJIA 2P5WB 3MGOA 4HW6A 2YEZA 1YMHA 2F8OA 3I6GA 1FSKB 3HG1E 5BV7B 3P0VH 4PFEA 4W6WB 3MLVH 1QO3B 4KJYB 3L7FB 3IXTA 5GZOD 1Y0LB 3UO1L 3HZYB 3CLEL 5TE7H 1A1MA 2NW3A 4FXGB 4FQIL 2L7JA 1Q1JH 1UJTA 2XQBL 3BESR 4PJGB 2XQYK 3S36L 1FNEA 2EC8A 2KZWA 5ENWB 5FO7B 5EULV 1CDBA 5IMOA 4ZOBA 3C6SB 1I9RL 4QKXB 3HLAB 4JO1H 5EOCL 3QP3A 4YO0A 3LMJH 4OLUL 4HGWB 3FN0L 1MHPH 3SE3C 1C8PA 3VGEA 2DL9A 4KHTL 5IESL 4GRWH 3O3AA 5FUOL 2VIRB 3RGVD 2VMFA 2E9BA 3MLXH 4QRUB 4PRHD 2IQ9H 2D31A 2EIDA 3U7AA 4RGOL 2OSLB 4LLUB 4TSAH 1QA9A 3DIFA 3BZEA 1CL7L 4QOKE 2X05A 1RUMH 3TNMA 3DROB 1M71A 3PL6B 4X7TA 1PEZA 1CFQA 1I1YA 3U0TA 5BRZA 4OZIA 4NQCA 1NFDA 3CZFB 4MD0B 5GGRA 3U82B 3Q6FB 4Z7WE 3QXUA 4PG2A 2K9UA 2Q3ZA 3MO1B 1CYGA 3FO2B 3HUJB 2M1KA 1F45A 5CEYB 4NWUL 5IVOA 4O02H 5EO9A 2OMNA 3S35L 1A6AB 1RUKL 2IH3B 3ARDD 2YD6A 4P2RA 1NFIA 3RVUC 1MAKA 2WUCL 1G9MH 4M93B 3PF2A 4FFWC 1RD6A 5F9AC 1MCPL 1N6QH 1FG2B 1DBBL 3ZYZA 2ADJA 1RJYA 3WS3B 4OCSH 2WWKT 1I1AA 1T89C 2GAZB 4M61A 1PZ5B 4MXWH 2PW2A 1S7VB 1N6VA 4UDUB 2W9DL 2D0HA 5E4IA 3B5TA 1FO0H 1CXHA 2W0LA 4LKXB 4HKBB 4N1EA 3VFUB 1IARB 3GKWL 2YBRA 3N1MC 3F12A 3HPLB 4X8JB 1BBDL 5E9DA 2R23A 1INEH 3EBAA 3MODL 1T0PB 4KTEH 2NZIA 4LCUA 1AJ7L 4R7NA 5HHVH 4F7PA 1EDQA 5BXFB 3BD5A 4KI1A 3MOBH 3QHZH 3HC4H 1W2KT 1WZMA 3O6LL 4I18C 3MCLH 5H2BB 4X6BB 5HPMB 1YNLL 1ZT7A 3ZYJA 5DO2C 4MNHA 2VXQL 4BQ9A 4LAJH 4WU7B 3HC3H 3GMLB 1NDGA 3KPRB 1LEGB 1O7VA 2NW2A 4YDIL 2Y23A 5CZXD 5D1QC 4AH2B 1SY6A 4PJXF 3UROR 4LLDB 4CADB 3NABL 1F4WL 4GXUM 5FKPB 1VFUA 2NY2C 3Q3GB 1KTLA 4OZ4B 5JO5A 3QIUB 3T08A 1BZ7A 1FCCA 1NC2D 3QJFA 1D6EB 2YC1B 3DGGB 2VC2L 3I75A 4OD1H 2CLRB 3WFZA 3GMNB 5D9SA 4JDVA 1XGTA 2CRYA 4M6NL 1S5IL 3NFSL 3IDJB 3JSSA 5GSVB 4WFEE 3RKDC 1YEJL 3RVTD 5K9JL 1CGVA 4IS6B 3GSNL 5C07E 2H32H 4U2YA 4Z7QF 4X9HA 4Q0XH 3ARXA 3SDCB 3BN3B 2R39A 4HPYL 4ODVH 3IFNH 3FFCE 3LH2H 4LDLB 1GOHA 3H6JA 1RJLB 5T5NF 3GSUB 3STLA 1SYSA 1Y6KR 3V4VH 1NCAH 4P9MH 3SN6N 4PYHA 1I9IH 1NJ9A 3W0WA 2PO6D 4HGMA 2KUTA 4AQOA 1P7HL 1UJ3B 1M4KA 5F3HA 2BNRA 1T0MA 2HJLA 1YMME 3MA9H 5CINL 4APQD 5GIRB 5DRXA 5IHZA 2VDPL 1R0AL 2A9ML 4L8SA 2UWEF 4PJXE 3C60B 3BP7B 4X6DF 3L5HA 4YHMH 4U7SA 5J12B 3L3DB 3CD4A 2LAAA 3TT3L 5JW3L 3IYLW 3QQ4A 4FQXB 1CG9A 3MV8D 3ARBC 3MRFA 1DSFL 3QDMD 2X4QA 2QR0A 3I6KA 3V6BR 5BVPH 3RTQA 4PB9L 1LMKA 1IEAA 5IFJA 1YY8B 4QXGL 5I8EA 3DETD 5HYIA 2DF3A 4JZOA 4G8GD 1YZZA 3FOMB 4NOFA 2DKSA 3WHE0 4X4YA 4WY7H 2X4NA 3MRDA 5J89A 1K4DA 3MJ9L 3RDTC 1FJ1B 4PGJA 4Q2ZB 4Z7QE 4OCYL 5F89B 4OIBA 3V7AG 2IAMD 3V5HB 1L9MA 2AJVL 3R8QA 1CK0H 3HG1B 4HJJL 1XIWC 4X7SL 5EUOF 5EB9A 4OQTA 4HCRL 4LSVL 2E6JA 1A3LL 2GJ6A 4M5ZH 3DBXB 4MSWA 3OB8A 1S9WB 4XVJH 1I7ZA 3KXFE 2QKIB 5LG1A 1JHLH 4WHYH 2P47B 4PG9A 3SGJA 1B6UA 5DEZA 1DL7L 3P0VL 1V05A 1BGXH 5IBLD 3G6DH 4FMKA 4MAYD 3D3VA 3RZCA 2I5YH 1Q1JL 1ZHKB 3RUGF 1QACA 3MA7A 1G9MC 2ZUWA 2A0LD 4IIQB 1IKFH 5JW4Q 5IG7A 4F9LC 4ZFOL 4ZS6C 3RU8H 3TO2B 1MIML 4EI6B 2AK4D 1U42A 2F9BT 1YNKH 2B5IB 3LMJL 3RPKA 5D6CB 2VR9A 2RFXB 4TNVF 3OPZL 4S10A 4QOKB 3ESVF 4WO4D 5E00A 5IV2B 5FYJE 2ARWA 4U1KA 4FHBD 1C12A 5KAQF 3MLXL 3QWRA 2F5AH 2IQ9L 1SJHB 3QRGH 1J8HD 5DJAB 2VJXA 3QRFM 1KCRH 4ORZC 5DJCA 1FDLH 4Z7WB 1TTFA 5DJZA 1EAPA 1EVTC 4F58H 1HHIA 35C8H 5EUOE 5BZWA 5DQJA 4D0CA 4OZGF 3KLAA 2WUBL 3NBNA 1UVQB 2XACC 2FLBT 4L8BB 1S7WA 3JBG7 4BFIA 2ZCHL 2Q1EA 4RMRA 2OR7A 4H1LA 3JV6B 1AFVH 3QDGD 5EU3B 1I7RA 2X4OB 3DVGA 2GT9A 4OZHA 4HQQH 3QUZD 1AP2B 4KVCL 4ODSH 5I73C 5B39A 3UTSE 4MZ2A 4JJHA 5KSVB 1G9ML 2Y07H 3Q2CA 2Y25A 1AR2A 5LAXA 1N6QL 1ZKAA 4Q9CA 3L9RA 4ZUTB 3OTTA 4FS0A 5F9WB 1MF2H 3JV4B 4L3CB 3BH9A 3FONA 2FYYB 5D7LA 5D1ZD 1TCRB 2GITA 3TH2T 3AMLA 3I9GL 2O61B 3LKQA 5E95B 4EN3A 4XNZC 5FB8B 2PF6A 1KB5H 3CPLA 3HRZB 4JFFD 4X4ME 1IGTA 2BDNH 1ZSDA 3AB0C 2VXUL 4K7PL 4V1DE 3V0VA 3VH8B 5I8OL 2FHFA 1K3ZA 1INEL 5LQBH 4KTEL 5HHVL 1T0NA 1BFVL 1H3UA 1MQ8A 2J8UA 5EU4A 5I1GL 1MCHA 3QHZL 3HC4L 1AGEB 4RISH 2XA8H 4XNMA 1OTTD 2E7BA 1ACYH 2DMBA 4NO5A 1WBXB 2VITB 3O6FC 3TBYB 4X6EA 5CMAA 4M48H 3HC3L 3SJVE 4OZFA 2G60H 4EUPA 2MNUA 3PGFL 4Y5YA 3WLBB 3BH8B 3MV9A 4B7LA 4XAKE 1HYSD 1A1OB 1I3RA 5AUMB 2W0FB 4P9HH 2X70B 4HUKB 1G7LA 4MVBD 4OUUB 4PBWD 4M6AA 1PLGL 4Y1AA 4HS3A 4JQVA 4KJWD 4MGXA 2NXYB 3T2PA 3PQYE 2I27N 2VLJD 3VFSB 4HBQA 1QFWH 1MFCH 1ZS8A 3L6FB 4CU6A 3MLYH 3GSVA 3MUHL 3QDJA 4YDVA 4XMKL 3VXPB 4OD1L 1N5YH 3L3KB 1Q0YH 4I5BA 5C07B 3PGCA 5FYKE 1JK8A 4RMUA 3QIBB 1DR9A 3FFCB 4FXKA 3VDBA 2ITCB 1R3KA 3VGHA 2E8YA 5DJXA 2AEWA 3NTCH 4HWZA 1WSST 3NCEB 5TQ0H 3BP4B 3ABZA 4O2CA 4YUEH 1EJOH 2DLFH 4ODVL 5E8PA 5D70L 3B4NA 1CDUA 1HEZB 3BO8B 2X42A 3NPSC 5F7FA 3VH8G 4YX2H 1CGTA 4L4TA 3T0DA 3DX9B 4OLYH 1IAKB 5J3HC 1XCTB 1YMMB 5L8KB 2XKNA 5FECB 5E2UL 4R96A 4P9ML 4WRLA 1RZGA 4YFEA 1T6WA 4P4KC 1I9IL 4PJXB 4WFHE 1MLCB 4YXLH 4MQ7B 4PJ8C 1URLA 2OI9B 3MA9L 2A83B 1A1NA 1YYLL 3C5SB 1A0QH 5IFHL 4XPHL 3UYPA 4DVRL 1JWSB 2NY6C 4TULH 2FATL 1G7IB 3LN4B 4YHML 3QB7C 2YWZA 5GGTL 1BOGA 4EXPX 3TO4A 2GTWB 5I1CH 4JFEA 2NYYD 3LQAH 5B8CC 3BPNC 4ODHL 1NLDH 4LQFH 3EDDA 1J87A 4N1CA 5BVPL 4AY0A 4UAOC 1LO2H 4G6FD 1A14H 5CSZA 3VCLA 3QFJA 4XCCH 5DT1L 3TH4T 2F8XC 1KIRA 4N0CD 4GBXB 1EBAA 1SEQH 2W9LA 4WY7L 5HGDA 5TPWL 5TDOB 2YPLD 4ETQA 1WCBB 1F13A 1XF5B 5C0FA 3KXFB 3CUPB 4PD4K 1KIQA 1U8JB 4AYFA 2YN5A 5FGCE 5HI5D 1CK0L 1MCWW 4LOUD 3A67L 2VRAA 4O4YH 1Y6NR 4M5ZL 1RK1B 4BK4A 4XVJL 4OFIA 5FA4A 1JHLL 2DL2A 3FO0H 5E4EC 1CFSA 5I0DA 1FNGB 5HVWA 2E8ZA 1I75A 4I18A 1I1FA 3RP1A 4X4XB 1JGDA 3OAUL 4X6DB 5GS2H 4R2GD 5CD5D 4G5ZH 4LLQA 3OGCA 4G6KL 1DN0B 1XMWA 3SCMB 5CBEA 3VFTB 3O8XC 5D1QA 5F7DA 5DFVC 1HSAB 1CZ8L 3S96B 1AE6H 2ILLA 4NZTL 4JJ5B 5DI8A 4MQXD 3S3PA 4ZFFB 4MHHI 5F9DC 3BEWB 4UU9B 3UMTA 2VDRH 1CTNA 5I2IB 4XMLL 1II4E 4M8QA 5I1LB 1YNKL 5I17A 2X4TB 5DYOB 4YGVB 4NO0A 3SO3B 4P48A 2ATKB 4LVOB 1HIML 1R6VA 4POUB 3O3DB 5I1IL 4X7FC 1T20B 1B4JH 1CE1H 1DEEA 1YUHB 25C8L 4F15C 4JZJC 4QRPE 4YBHA 2XICA 4CVXA 1KCRL 3MJ9A 2D9QB 5EUOB 3MNZB 5SWZD 4K3GA 4XP9H 4NHUB 1FDLL 4GS7B 5T5NG 5IB2B 1PEWA 3IDGA 3MRMB 1CL7I 4OBRA 3SDDC 1NCCH 3VMOA 1BVZA 3KYAA 4I2XE 1PQZB 1ZLUK 35C8L 4HCRA 3U7YL 3OKLA 3BZ4B 1NANH 2PYFA 1OL0A 3CFIC 2ICEA 2VDKH 4JFDA 3C09C 2V7HB 4WTZG 3CVHB 1JGLH 1R5WB 4P5KA 4Q9QL 2HFTA 2WLYA 3UTSB 4P9HC 5C9JB 5ESAB 3LIZH 3ILQD 1W0VA 1AFVL 4HUVB 1XGQB 5HHOE 5DA4A 2JCCA 4RGNC 4HQQL 4X98A 2IH1A 1TVHB 2IG2H 4L9DA 2NY1C 2PYEE 3K8LA 5CBAB 4E41E 2GY5A 3BD3A 3PV6A 4UT7H 5DMKA 4L1DA 1LEKA 2B8OT 2CKBB 4KROD 3HAEH 4V1DB 4QRQA 4RFEA 2C1PA 2Z93A 4GT7A 1NC4A 1XR9A 5KANI 1JCKA 1LE5B 3F62A 3ISWA 1D9KA 3PDOA 3GSOB 3UYRL 4GKSB 1OP3H 1KJ3L 1NMAH 4S0TD 2JJVA 2EEBA 1A8JH 3VFPB 4XI5C 1T2XA 2XRAL 4KH2A 5LQBL 3VFWA 1K2DB 4WWKA 4KWUA 3SJVB 4NN7B 5T3ZD 4RISL 2XA8L 3PG2A 5GGSY 1ZEAH 2WIIA 3NCJH 2VLKE 5CIPH 3OZ9H 5A3IC 4RIRA 4S2SA 2GK0A 3EOTH 3WKMH 1XIWA 4XWGL 3T3PF 4HXBH 5IF0A 2EE3A 3H9SE 5HJ3B 3RY4A 4ORGA 4D94A 2GTZB 4Z0XB 3SDXA 1LO4L 4HC1H 2YK1H 2G60L 3PQYB 3UXFA 3HE6C 5F6IC 2EXYD 4MNQE 2HA1A 2W1NA 5T1MA 3ARFA 1LNUA 1G7QA 5EOCJ 1KG0B 2GHWB 2NNAB 1J0ZA 4P9HL 4AJ0A 4EEEA 4OQ1A 4OGAC 3LQAC 2VB5A 1CDIA 3MRHB 3AS2A 4AZ8A 5FM8A 3SGKA 4NKIL 2VLRA 2XN9E 1QFWL 1MFCL 4UTAH 4IOIA 2IPTL 2IPKB 4PJHE 1B0GA 1N5YL 3CJJA 3ZDYF 3PXJA 2FR4B 4HKXA 4W4OC 1DUYA 5EU7E 3CXHJ 3CFKB 4TOYL 3IFOB 3KPRD 5DD0L 4I9WE 4PJFA 5KAQG 3BJ91 3V4UH 3WEXA 5F72S 3F65A 1EJOL 1X5JA 4LCWA 1H15B 1IGML 2DLFL 1S7UB 3Q0HA 1LP9E 5D2NA 2HG5A 4KKLC 3TIDA 3CX2A 1GYAA 4JN1H 4YX2L 5I30H 2NY0D 1RU9H 4OLYL 1UM6H 5KN5B 3OL2A 4J1UB 4O51B 2LU7A 4XHJD 5DUBA 5ESVB 1U8LA 5ALCH 4CMMA 4L8DB 3DXAA 4YHOH 1TPXB 3EYQC 4DEPB 2P8MA 4NDMA 2P24B 3VE0A 4X0KA 5CGMA 3TA3B 3C8HA 2BOCA 1F5WA 4UQ2A 1PSKL 2CXKA 4D9QD 4R4BB 1QBAA 1A0QL 3QXAB 1K5NA 4PREB 4EI5D 4F7MA 3E6HB 3HNTH 4TULL 4GAJH 3ILPA 1X6LA 2V2TA 5I15L 5D7IA 2DTMH 2MCG1 3LKOA 1FQ9C 1A02N 2HRLA 1A4KB 5K9KB 3LQAL 4Z77A 4OKVB 2J1KA 1MVUB 5HDQL 4LGPB 3MLSH 1N59B 1ERNA 4GW5A 3IFLH 5IHUL 5ESQB 1WFTA 5HVFB 3QUML 2HP4A 4PV8A 1T1YB 4JQXC 2VKXA 3NCMA 1IM3A 3W9EB 4OLXH 5IMLA 1LO2L 5EC1A 1A14L 4CKVX 5K59F 2V5MA 1QVOA 3KPPB 3GK8H 3O6KL 3TVMB 5FGCB 4QXTA 3HS0B 3WFBH 1MUJA 3FB6A 3G08A 3U0WH 3O2DL 2HVJA 1REIA 1M6OB 2WBJD 1JZ7A 4HX1B 1HHKA 4FQXD 2HTKC 3KPOB 3Q1SH 4Z78A 3QXTA 4YR6B 1JPSH 3K4ZA 3VA2C 4XPGH 3UTQA 3KPMA 1PJ9A 4G9FE 1FL3B 5JLZB 1CGUA 2VO5A 1IAOB 2QQKH 2QV2A 1UA6L 3ZE2F 1N5AB 5CJXC 4JZNA 4ZAKC 2HKFL 5EZLB 5DJ8B 3ARYA 3K8MA 2V5RA 1KJMA 4Q97A 4DKEL 2VSCA 3L3OA 5HHQB 3S37L 3ARDA 2HLAA 4NP4L 4LSQH 4GG8A 2EKJA 1G7HA 1P7KB 5E99H 5IVZA 3BPOB 3RWFA 1AE6L 5D7JB 4BH8B 5GGTA 2HT3D 4NKDB 2ZSWA 1S7QA 5JORA 2DQHL 5HI3D 4HUMB 5CJOL 3RZWA 1FORL 1RJZB 3P4MB 5FCUL 3MCKA 3MFFA 3PWNB 3GZKA 4QRPB 2XWBB 1O0VA 1NCDL 3HE7C 5IM7B 3M45A 1DVFC 3QEQE 2F54E 5C0EB 1B4JL 3V52H 4I2XB 4Z7UA 4Z76B 3UX9B 1K8IA 3WNKA 2OL3H 4DN3H 4P5MA 3WIHA 4XP9L 4YZFF 2A6JB 3QG6A 2PUQT 4YEFA 3VGAB 1NCCL 3FRUA 2MCPL 1UCTA 3QWOA 1ZWIB 1WT5C 3VWJC 3VXSA 3RY5A 4CMHC 3PGDA 4OT1H 5EBMB 1D5XA 1DFBL 5HHOB 3I3BA 3BP6B 3MR9A 3O6MH 3FB7B 5H37G 1MCSA 1ZHLA 5DJYB 3D39A 3K1DA 5CHNA 4NQSB 4QOKD 5I16A 1JGLL 3ZE2E 5K9OB 5HI4C 4M7JH 1RK0A 4ZSOE 3EJYC 5EZIH 1UFUA 4P4KA 1ZK9A 3KDMB 1XH3A 3LIZL 4FZ8H 4XP5H 2PYEB 4NZUH 4N0FA 4K71B 2EKSA 1YJDC 4E41B 1LWRA 1U58B 5FFLA 1HOCA 3RNQB 5E70A 5IEKB 4F33B 1NC2A 1U3HC 2IG2L 4XP4H 2ATPA 3UTTE 1CDYA 5AYUH 4DGYH 4YNYB 3OGOE 1WAAF 2X09A 5DGQA 2X9XA 4NOBA 3EYVB 2L0DA 4RDQF 3UJTH 2YD3A 3RJDA 1DBAH 3MRNB 5DHYB 2XTJB 3GMQA 3MRBA 4FFVD 1RHHB 1GH7A 1CIDA 2PNDA 2DLTA 2KL6A 4XBGA 3TZVB 1J7VR 5J56B 2V9RA 2HN7B 5D7SH 2VLKB 4L9LC 3CDGB 3O11B 4E0RA 4J3UA 1GGBH 5D5MA 4JY5H 4HD9A 1FFPA 4K55A 4H25A 3SDAB 1D5MB 5KVGH 3ARGB 1X6NA 2ZKHH 3I50L 3NCJL 3NGBC 5F88B 2PO6A 3OZ9L 4HZAA 4WU5B 4MNQB 3GUTA