5D6DA

Crystal structure of gasdalie igg1 fc in complex with fcgriiia
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
209
structure length
209
Chain Sequence
AGPDVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPLPEEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Structural characterization of GASDALIE Fc bound to the activating Fc receptor Fc gamma RIIIa.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d6dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d6dA01
4S1QL 3VI4F 4YGVA 1FH5L 4E41E 2QKIA 2CDGB 4ODUB 1U8JB 1QRNA 1QHPA 3QCUL 1P7QB 1JUFB 5JQ6L 4ZSOB 2OTWA 4XP9L 3L6FA 2OK0L 3JV6B 2A83B 5F88B 3SDAC 1RIHL 1X7QB 4FG6C 2EH8H 2IBZY 2A73A 4NQDE 4NRXA 2BOBA 3BEWB 1UH2A 2A77H 5HDOA 3RUGF 4M48L 1NCTA 1UEYA 2ORBH 1MHCB 3HE7B 1MIEL 1NKOA 3OAUL 4YHPA 5IW1B 1ZHBA 1C16B 4ORZC 3D25B 2CGRH 1SEBB 5IVNA 3RFZC 3PL6A 1RIVH 4W4OA 1YN7A 5C86A 3LRGA 3VXRA 4JRWA 1DL7L 2PF6A 3DUUA 3HCVB 1OQXA 2VAAA 4GKSB 2UVFA 4B53A 4P4RB 4NQEE 2NTSP 1U8QB 3H9SD 4KQ3L 3ULVC 3BH8A 5BMFL 1FDLL 4X5WB 2VLKB 1Z3GL 2OJZL 3L3HA 4QHUA 1H3PL 3BH9B 3OR6A 5H35A 4FQ2H 4N5EC 2DMBA 3DJ9A 4DN4L 4O51B 3O8XB 4ALAH 1HQRA 4KTDH 5HDBE 3TO2B 2WBKA 3MFFB 4JHAH 2KKQA 1XF2B 1FCCA 5EO1B 1DQDH 2XIDA 2ERJB 3O3AB 4NBXB 5FYLE 5MP6L 1NCCL 3QUZA 4TUJA 3IDXL 5ETUB 3DARA 5TE6H 5DC9B 2OL3L 3DYMA 3NA4A 1SJVA 4Y4KD 3KPTA 5E2JA 3CU1A 4ZNCD 4PGBA 4ZFZB 1J11A 3UTQA 5CCKH 4IHOA 4WDIA 5GGRY 1RU9H 3DX8A 4YHYB 3DTXB 4QT5B 1YJDC 2ENSA 1RK1A 3W9EA 5BVJA 5CJOL 4JQVC 3KPQA 1I8MB 1CBVH 4P9HL 2FECL 4O9HH 1ZA6B 1NBZB 3S8WA 1K8IB 4ONHB 3EOAB 2XT1B 5FGCB 1MCWW 5JUEH 4LAQH 1S5HA 4KK8D 3EO1A 1OWRM 2E7BA 2R2HB 3WKMH 3H0TA 5I66A 2HWZH 2J1KA 2OSLA 1A1MB 4DTGH 4Y7MA 1GZQB 1P7KA 3JBG7 1D3CA 5D7IF 3TBYA 5HDLA 4NO0D 4DGVH 2FLBT 4EDXA 3WSQL 5IR1A 2AV7A 1OW0C 5C09E 4TVSa 1RVFL 4G9DA 3VGGA 1ZLUK 1F8TL 3KLHC 4WJ5B 4S11A 1DN2A 3QDAA 1IBGH 2VDRL 4TSCL 1FYHB 5GGVY 2P45B 1G6RA 4H0GA 1T22A 1BVKB 2FX8H 2J5LB 4IIQA 1VGKB 1U95A 1A3QA 3JXAA 1S7WB 4WTZG 2JCCF 3MGTA 3IRZA 3P30L 3SY0A 1IEAB 4PJ7F 4KJYB 2EDDA 1EO8H 2FH6A 1T83C 3GMPB 1TLKA 3DV4A 4I18C 4AIOA 2CDEB 3OJ2C 1SYVB 5SWSA 2CLVB 1G7QA 1HXYB 1F3JB 1A6UH 4X80L 3MNWA 4ZAKB 3ULVE 2LVCA 3MGOB 5MEOA 2YD5A 1G7PA 4Z18A 3B3IB 3WFHB 2SEBB 5HYJA 4NNPH 3C09C 4XVTL 3CMGA 3HR5A 4FQXA 1II4E 5T3ZD 2UZIH 1N64H 3K2UH 3QIWD 1YN6A 4JFYB 2R8SH 4DK3A 4JFDE 2X4OA 4LLYB 3DXAA 3IFNL 5JNYB 4HAFA 1QQDB 2XN9A 1LDPL 1UM4L 3T3MF 3QP3A 3I6GA 4IEFB 4DUWA 3BWUC 2WBJB 3UTSB 2BOCB 5K59E 4BZYA 3C8KA 1QSFD 4HIEA 4PPTA 5EG6C 4CU8A 1KIPB 4MJIE 3I85A 1XF4B 5L6YL 1F02I 1F90H 1Q72L 2O26U 4L8DA 2HFEB 4RDQG 1HSAA 2AEPH 3IF1B 5DD0H 4JPKH 4K55A 1AO7E 1UVQA 4JDZA 4HKZB 5F8RC 3T3PF 1URLA 5EBGA 3VGAC 2BHYA 4K2UL 4QXTA 1J0JA 5SWZA 2VL4A 4G9FA 3VXTA 4TPRL 2PXYD 1CDBA 4MQSB 1HHJA 1NFDA 4MAYB 5DRZB 5BJTA 4M7LT 1FGNH 2NY4D 4P5KA 3K7UA 1E4XL 1T20A 3S3JA 3KJ6L 1A7NL 1XMWA 1BJMA 5I15L 1MNUH 1J18A 2J4WH 1TQCB 3FO9B 2VXVH 3RNQA 3ZKSD 1FO0B 3GDBA 1AD9A 4HS3B 4JLRB 4WEMB 1JYWA 3DGGB 4Z7WA 3B9KA 3IKCA 5D71L 1RUKL 4XRCB 4E0RB 3CLEH 1I1AD 1LK3H 4JRYB 4AT6A 1AXTH 2AK4E 1G9EA 4FTVE 3VRIB 4OZGA 4Q6YA 2P5WE 2GJ6A 5CHNA 3W81A 3RX7A 3UJTH 1BIIA 2X4PB 2IGFH 3VI4E 1IVLA 4MZ3A 2H2PD 2CD0A 3PWUA 1HDMB 6FABL 5GS3A 3S5LA 2VZ3A 4X4YB 3HTLX 3OX8B 2G2RA 2MJWA 1AGFA 1FYTB 1N5AA 4APQD 5GGTH 3WFDL 3D5OF 5KZCD 2ICWA 4GAJL 3TN0C 2GT9B 3KPSD 2R29L 5J1AA 3KPLB 3RUGE 1K8DB 1QSEE 2X7LB 4ORGA 4JFFD 5CJQH 4LASL 3MRLB 4MB3A 4X99B 1FH5H 3EYQD 3PG2A 1DLHA 1IKNA 4R4BA 1JHLL 2KBGA 4PBVC 2NY5C 4HUUB 2W60A 3WV0A 3X12A 5JR1L 3NH7L 2FO4B 3MUHL 1QLRA 1NH6A 4HFWA 3GSNH 4D94A 3MLTA 3OR7B 1I9JL 5I1EH 4OF0A 4M48H 1NPUA 3TCXA 1T1ZB 2AW2A 1MIEH 4G43A 2Y25A 5HHME 1DZBA 3NZHL 3HZKA 1OVZA 1H3XA 5DZOA 4BA8A 2EH7L 5DDHB 5CKAA 4PJHF 4PGCA 2E6QA 4POZD 1WFUA 3QSKB 5J6GB 1UJTA 3U30C 1YNLH 3GMOA 3PHOB 4ZTPH 3NTCH 1C5BH 1I7ZA 3EOBA 3NACL 5GHWL 3EFFA 3LKOA 3IDIB 3HUJF 4PV8B 3AB0C 1OAUL 1FQ9C 2YMXH 3A6OA 3V5HA 2VZUA 5FGRA 1PLGL 1I1FA 5GS2D 1FVDB 4OQ1A 2JIXB 1TXKA 1ZGLM 4M7KL 1Z3GH 1K3IA 4HT1H 2IALB 2OJZH 1SJHB 2YC1A 3F7YA 4Y4KC 1BOYA 2EICA 3OTTA 5HVFB 3MJ7B 4OBRA 4FQIH 3GM0A 1BQLL 2YK1L 4PTTB 3TBVA 3L5IA 1J1XL 2OQJA 1IQWL 1MCPL 1QBBA 4LLVA 3EJYC 3N50A 4W68A 4MXQD 4I3GA 3U83A 4FQ1L 2V5RA 4NN5C 4ZFFA 3T0DA 3E8UH 5EOTA 4F3FA 4RX4A 3QEQE 4Q6IA 4M6NL 1YECL 4KK8C 1AGBA 2ATKA 3MODL 3PQYE 2BNRE 1FPTL 3R1GL 1JYXA 1ZT7B 2AQ2A 3FMGH 5CJOH 3RKDD 5CP7A 5TQ0L 4JQXA 3TNNA 3GMRA 2G75A 2IH1A 5CD3A 4MNQA 2VDLH 3I9GH 3HNTH 1IM3B 1MCIA 1JNJA 5ADPL 5KSUA 1YPZA 4KROC 1YC7A 5FM4A 2GUOB 1JRHH 4J6RL 3QULB 2Z93B 4WI4A 1ZA3A 1IM9B 5BW7A 1F4YL 3Q5OA 5SWQA 1KNOA 1RPQA 5IFHL 5GJTL 1IC5L 1IC7L 4PJ7E 3UZQA 2XPGB 3RWFA 4PP1D 1WT5C 4NN6C 2PTTA 5I1KL 4BFEA 2LTQC 3P9LB 5C9JB 4HS6B 5E8EB 3H9SE 5JHDB 5F7WC 1KBGL 5C2BH 5GZOC 4MJ2A 4K94L 4P2CG 5D7JD 5F9JB 1A7OL 4NQSA 3ZLQC 4JJ5A 5D8JH 4CU7A 4Z7UB 3G6AB 4CVUA 3NCCB 1IILE 3P30H 3Q3GB 3S4SB 3IXAB 3S9DB 4MA3B 2BVQA 2XYCA 3QIWC 3TN0B 2ZUVA 2AJUL 4QRRA 5IIEB 1MAJA 4U1HA 3BW9A 4Q7DA 4O2FA 2GIYA 1J1PL 5MEQB 4JFPB 3RWHB 1RUPH 4BH8A 2MKWA 3HMXL 4MJ6B 4NRYB 3ARFD 3SKNB 1EXUA 1TPXB 3GUTB 2J8UA 1X5FA 4NM8H 4KDTA 1XGYL 3LEXB 1OB1B 3BIKB 5CP3H 1I7TA 4XVTH 4G3YL 1EUTA 1CCZA 2ZCLH 5EU6B 3P0YL 2BRQA 4JPIB 4P23A 2N4IA 5IROA 2EIBA 4L3EB 1CFQA 3FFDB 5FXCH 3IFNH 3LKNB 1RUQL 4JFOA 4K7PH 1LDPH 1IARB 2CK2A 2JJTC 3VMPA 1IAOB 4ZDHB 4WU7B 2RFXB 1ED3B 2PXYC 2WAHA 1IGFH 1ZLUH 5AG9A 3O2WL 5LKNA 3LKRA 4NN7B 5ID0A 2GITB 2X44D 4S0TD 3U30B 1UZ6F 4HK3N 1XGPB 4K9EH 3EYFA 1F3DJ 1J8HB 4JPWL 1PJ9A 3OJMB 3N9GL 5D5MA 1G7MA 3AB0B 2H32H 3ALWA 2DYPB 2UWEB 3STZA 2CKBB 2EO1A 1JN6A 3H3KA 1B88A 4TPRH 2YD8A 3UO1H 2X4QA 4CW1B 2WW8A 3LDBC 1B0GA 1OGAD 1HXMB 4P49A 1NC4A 1KJ2B 1I1AC 3SDYL 3UBXG 4DZBA 1ONQB 4Y1AB 1A7NH 2CDFB 4HWNA 3RZCA 1UJ3A 3T1FA 1GGBL 2D9QB 3I84A 3DROA 3OKNA 2BC4A 4PJFF 5DMIL 1V3LA 4YO0B 2NY6D 5FYJD 1T5XB 1Y6KR 3ABZA 4OFIA 3PABB 5D7SH 4GAYB 2WNGA 5DD5H 2O5ZL 3AVEA 4GRWH 1KPVA 4HGMA 3BKJL 1OAYH 3VRLE 4NN5B 3CVIL 1F97A 4H5SB 2H2PC 4WNQB 4H1LH 2DIAA 4RGOL 2HYMA 4L4VB 1U8LA 5HGHB 3TO4D 2IBZX 4CADB 1WUNT 4APQC 2JELH 2X4TA 2YWYA 3HFML 1I4FA 3P2TA 1OP5K 1Y18B 1T04A 3G5YB 1BJ8A 4EI5B 1CF8L 3EYQC 5BQ7B 4OD1L 2DLIA 1HOCA 1CG9A 4LP4A 4GO6B 2ZNWA 1G1CA 1BM3H 3NZ8B 1NAML 4DKDC 1Q9LA 1S7RB 1N26A 5T3ZE 1JNNL 1YZZA 4FQJH 4GAJH 1KJVA 1DBKL 3MRMB 4JY5L 2AS5M 2R29H 5CKGA 4KROB 1G0DA 4BUHA 1KIQB 4KGLA 4LASH 4V1DB 2DM4A 4OF5A 3IJHB 5T1MA 1XFPA 1W0WB 4X5XA 1CS6A 1T89C 3T2QA 1F3DH 1UC6A 1QNZH 2QJDA 5EFIA 4O2EB 1PKQA 3ARGC 5JR1H 4POZC 3NH7H 4L8BB 1PG7X 1JGUH 1U9KA 3EJJX 3R06B 5HHNA 5FOBA 4IRSB 4POUB 3JVGC 3HUJE 3VFPB 5T5NF 1BFVL 4LIQE 3G5ZA 4X6DA 5CBEB 4B50A 2MHAA 1NGZA 4PYGA 2ADGA 3O6KL 4MAUL 5SV3A 1BREA 3B9AA 3FB5B 3HE7D 1A6WL 4Y19B 2Q6WB 4NRZA 1M6OB 5EZJA 4ODVL 4MVBC 4QY8A 2K7PA 4ZD3L 4CN1A 3ILQC 1JYVA 5CEYA 5J11C 3BZEB 1FJ1A 3O4OB 4NP4L 4MXQC 3A67L 4XGZA 5DRXA 3RL2B 3RRQA 3GMNA 5C8JB 2WINB 2Z31D 4FQLL 5DJCB 1MWAL 2VLJB 3WNNA 2PTUA 2F54A 2YK1H 1BZ7A 4OZHA 5LCVL 1J1XH 1CGTA 1MCPH 4XMKH 3GIVB 4CVWA 3P3YA 4DGIL 4FQ1H 4AYFA 4P4KD 4WW2A 4FQHA 2P5EB 3FONB 1FORL 4HS8L 5C0CE 1TJGL 4LL9A 4N8CL 3SKMA 3C5JB 3FTGB 3HC3L 3IKKA 1DQTA 3BGAA 1YYML 4RISL 3QUML 3KPSE 4LARL 3KPRD 5JA9A 1U8MB 3MLZL 3N1GC 3MODH 3D3VD 4HIHB 4U1GB 3WIHL 2Y5EA 3WN5A 3IU3B 5D1QB 4LCYB 4JFFE 4EN3A 1OT1A 1NDMB 3R1GH 4HCRH 4UMGA 4P2YA 4X9FA 5MI0C 4KJPD 4MNGB 4LPYA 1V7NH 4YNYA 4HV8A 1DTUA 1ROWA 1W72L 4TOYL 2M8XA 1FZKA 4NC1C 3RWDB 5FCUL 3VXMB 3QFDB 4MLIA 4ODXA 3JV4A 4PP1C 4YXKH 1T7YA 1CFBA 1N0XH 3VFTA 3KPNA 2W0FA 5ADPH 4I77L 5DEFA 5IMMB 3KAAA 4PFEA 4F7CB 3MNZB 5AYUH 1KF9B 4NOBA 1ZT4B 4NUJA 3NCYP 4M4RA 4U6HA 5D7JC 2BERA 3IT8D 2HVKB 4R2GD 2PYED 1KOAA 4U7SA 1T7XA 4NQXA 1F3RB 1D5IL 1IC7H 5FB8B 1UKQA 2V7HB 2C3VB 4M62H 3RVTD 2JK5B 3ULSB 2R4RH 5L88L 3P4NB 1KBGH 3AU1A 1AJ7L 5ISZB 4K94H 3ARFC 1HSBB 4OFYD 3GSNA 1RZ8A 2VDNH 5A2IH 3CH1A 4F9LA 5LAXB 4ENED 4S1DD 2APBA 5E2WL 2JJVA 5ID1B 1RZJC 4EJ1C 4XB8A 2IFFL 3BD4A 5IEHB 5FO9B 2AJUH 3BZFA 3SDDD 3P9MA 5DYOB 4Z78A 2BP3A 4YK4B 3BP5A 5JPNB 1J1PH 4GOSA 3HMXH 5E8DL 5BZDB 1S7SB 1U8PA 4U49A 3LV3B 4BSWB 4OZFG 4PJBA 1S9XB 4O02L 1UM6L 2DQTL 3SGJC 4PGDB 4ZPTB 1GCFA 3WXWL 1YEGL 2OBGA 2Y36H 1AHWC 5ICZB 3QUKA 1UZ6E 4WUUE 1KPRA 3F12A 3DV6B 5FYLL 1L0YA 1WZMA 3LPGA 5C0RH 1RZIA 3SCMA 4NWUH 1RUQH 2X4NB 3GI8H 2WANA 4RFEB 2QQNL 4HH8A 1P4LB 3HAEH 4GRLC 3FQNA 4KQ4L 4LGPB 3T77B 5L2JA 3X13A 3RJQB 3TBSB 5JDSB 4FABL 2V2WA 1T3FB 1HKFA 4KI5D 5BS0D 4W4NA 1A1OA 1CICD 5FHBL 2YZ8A 1LEGB 2EKSA 2CRIA 1NUGA 1B6DA 2CIKB 4WHYH 5F1KC 3N9GH 3FN0H 1A3LL 4HKXB 5HTSA 4C56B 5I18L 3V6OC 5JW4Q 4MXVF 2A6JB 1J8KA 1JGDB 4P59H 3MROA 5HYSA 5KSVA 3VXSA 4LHUA 3IGAB 1KJ3H 3MRCA 4NC1E 2EEAA 2P4AB 3U0PA 1D5ZB 3TO4C 4XWOD 3RGVA 5DJZB 3DIFA 4I0PD 2ZOKA 3EKCA 4OUOA 2HP4A 4F57L 5DMIH 2DS4A 1T1YA 3T0EA 2RR3A 1MUJA 1P84K 2MQ0A 2O5ZH 1M71B 4I5BB 3BKJH 3ZTJH 5KVMC 5F3BB 5CGYD 3CVIH 3SGKC 1YNKL 3WHXB 3B5HA 4J1UB 4Z77A 3S5LG 3FT4B 5ITBH 4OCYL 4DK6A 1WWAX 2FHCA 4IOFD 3BGMA 3MBEB 4I13B 1S9YB 3MACL 3LKSB 1ZMYA 4ZXBC 1JHTB 4UILH 1CF8H 3L3OB 3MCG1 4OD1H 1JMZA 5E4EB 4ZPVB 3F7PC 3IAGC 3BFOA 1AY1L 1O7VA 3KPPA 3O41A 3JTSB 5IW6A 2X89D 1J0HA 4LEXH 3GBLA 3UTZA 2A6IB 3TIDA 3NA9H 1ORQB 3ULVL 4LLDA 1V7ML 4TVPD 1XCTB 4KHTL 2CQVA 4CKVX 5TDNB 1UWGL 4JKMA 5BXFA 4X0KB 1BBDL 4H20L 4MYWB 3AUVA 3WJLC 1A22B 1BLNA 4F2MB 4EI6A 1CDUA 1T6WA 4HKJB 1KIRA 7FABH 3AY4A 3RGHA 1HHHA 4PUBL 1QO3B 1ULVA 4AM0A 3V52L 3QEHA 3Q6FA 1CFNB 5CP3A 2DQGH 3MNVB 4HFUL 4ETQA 4LVNC 1T80A 5INCA 4OM1L 5DTFA 1NBVH 1OGAE 3VXOB 5I8OL 2AJSL 3DRTB 1CU4L 5L7XL 4OCWL 1P9MC 3H8NA 3U9UB 2FHBA 5J6HB 1MHPL 3O6KH 2YRPA 4FP8H 3VXQA 3FOMA 3C5ZA 4RA0C 2BHUA 1YJDL 2Z31C 4X6FB 3LRSA 3LY6A 5I74C 5I71C 3QT2A 1OP5H 4OGAC 4ODVH 4FXKA 5CINL 3V6OE 4MB4A 1MI5E 2YUWA 2YN3A 2VZOA 3RKPA 1TZHB 5EU5A 1B4RA 5HSFA 3PGDB 4KK5C 1H5BA 1Z2KA 5MHSD 1A9BA 1PQZB 4P4KC 1TQBC 1L7IL 3PWLA 1DBJH 5HYQA 3L95B 3ZYZA 3BQUC 2DBLH 3QI9D 1MWAH 5E6ZA 4ZUUA 4KRPD 4RAUB 1AE6L 1HHGB 5EB9A 5DJXB 1T21B 5D7KD 3VMOA 4NQTA 2YA1A 3KXFD 4XNQA 3X11B 3VA2C 4IOIA 4KJPC 3W0WA 2NMSA 4GRLB 4ELKB 1UT9A 5C08D 3VXPB 1FORH 1X9QA 5GGSY 1J12A 1OAXH 4N8CH 4RRPA 4NQVB 4XPBH 3TT3L 1CLCA 3T0BA 1YYMH 1BMGA 3OF6D 4H1LA 4LKCB 5DK0A 3WIHH 4K3JH 4JJHA 4U4BA 4R7DB 4FQCL 5E9DD 2ADIB 5DRNA 5DD1L 2NXZD 3V7AG 3AXLA 4QTHA 3CC5B 4I3RL 1I8IA 4EUPH 1IGJB 4PJ5B 1IQDB 4R2GC 3BPNC 4EDWH 3KLAB 3VFNB 5M94B 3WS3A 1UB5A 2NX5A 3TA3A 1Q9WB 3E0GA 1XIWD 4RMVA 4BH7A 3GJFB 1NLDL 1VADA 4QRSA 3O3DB 3RVTC 4JN2A 2ZSWA 4X8JA 5EN2A 3SKOA 1EERB 4RWHA 1WICA 1NUDA 2VJXA 4ZSOE 3VD5A 3W2DL 4QOKA 1UGNA 3MRPA 4M3KB 3BGFC 5FO8A 2OR7A 4X6CB 1FFQA 3AREB 4ENEC 4S1DC 5IKCB 3A6BH 1Q9KB 1XGUA 2A74A 1R5IB 1D9KC 4KU1A 3SDDC 3VXUD 4ZNEE 4U7KA 5I0ZA 5EU3A 3UPRA 5BV7C 1MJ8L 3RTQD 4PRAB 2J88L 1IM9D 3HRPA 4YJZL 5DHVB 5IVZA 2P49B 1DP0A 3QZWA 3B8YA 1RHHA 1XZ0A 3SPVA 3OPZL 4Y8AA 1LHZA 1PY4A 3QPXH 4JM4L 2BSTA 1CLOH 1NGQH 1SMAA 4JR9L 4LDLB 4I2XE 5CJXA 1U8HB 3TVMC 3P77A 5DUBB 1AXIB 2QR0B 3AS2A 1I3GL 2IJ0C 1P6FA 2UYLA 1DEEB 5MEPB 2E8ZA 5I0DA 3WFEL 1MFAH 5FEBA 4J3OC 5JQHC 2H8PB 4X98A 4O02H 2DQTH 5E2VL 3ET9F 5KG9A 3K46A 3Q0HA 2V2TB 1YEGH 5GRVK 2AJ3B 4JZOA 3ROOB 4KI5C 5DRWB 2B5IC 3KPRE 1GGIL 5IMKA 4QXUH 5FYLH 1MLCB 1E4WL 3L3GA 3OAYK 4G6ML 4LVNB 5KOMC 4K71C 1F42A 5E8NA 4JFEB 3CFJA 2N7AA 3MMEB 4ODHL 3GZKA 1GGCH 4JVWA 2IAMA 4XWOC 4Y2DA 3GNML 4I0PC 5AYQA 2B1AL 4QHLB 2XKUA 3QIUB 3LN5A 4G6JL 2NY0D 5E7FA 3PE9A 2YPLB 1YEDB 3OGCA 4LPWA 4OSUL 3CFBA 5TPWH 2ATPB 4YHIB 5JPMA 1P84J 5HY9B 4PV9B 3BDYH 3QDMA 2A1WH 5CGYC 5KVDH 1TQBB 2PYEE 5CWSB 4P2RD 3H6JA 1A6ZB 1QLEL 1DVFB 1F13A 1A1NA 3REWB 4HCRA 1KYOK 1ZS8B 4OZIB 4JFXB 2B2XL 4IOFC 4A6YL 1QR1A 3CSGA 3EAKA 3ES6B 3HC0A 4JG1L 4NHUA 1ITCA 5C0ND 3RWEA 5F96L 4J7RA 5I1HL 2DQHL 3IXTA 4UINL 3LZFH 2F19H 1HQ4B 4R26L 3T4YA 4AQ1B 4W6YB 1NMCC 3RWGB 4HLZH 2G60L 3OB0K 4GJTB 1XR8B 4OCYH 1RJLA 5F89B 4UQ3A 5I16B 5D2LB 5EC2B 5IM7B 4QCIA 4Y16B 3ARDC 4DN3H 1H3WM 2R23A 3MACH 3GSQB 1HH9B 4LSUL 1HINL 3MOBL 4BSVB 2XA8L 2OI9C 4I4WB 4EOWL 5TF0A 2E6PA 3L7EB 1C08A 3E6FB 2ZCKL 3INUH 1NAKH 1M05A 5HHVL 5GRYA 4LCWA 5HPOA 3ROLA 3RDTC 3ULVH 1V7MH 1ZHLA 4KHTH 1YY8B 1PG7L 4M5YL 3QO0B 1SEQL 3FRUA 1BBDH 3SQOL 4JPVH 2P24B 4YE4L 1W8NA 1BFSA 3PWJA 3QEGL 2HH0H 3IDNB 3QUYD 4XHQA 5T5FH 1Z9MA 5T1KA 1A6TA 3K3QA 4RCAA 1FO0H 4XX1G 1DN0B 3CZFB 1LD9B 3N06B 4KI5E 4XPFL 3HMXA 3MLWL 4YIQB 1D9KB 4Y4FD 4V1DD 3I6KB 2IG2L 3GMQB 1G7LA 1HHKA 1KC5H 5F71A 1S7QA 2HMID 1XGRB 4HFUH 5F6HI 3HI6H 3MQIA 1YMMB 1U8OB 4U6VL 4ODSL 3VWKA 4B41A 3VFOA 2MQ3A 4OFVA 4OCWH 3BD5A 1GAFL 3B6SA 1JWSA 3CSBA 3VFGL 5FA4B 5KJRL 1ZSDB 4Z76A 1JZ5A 3NN8A 5FM8A 2P7TA 1YJDH 4GUPA 3K2MC 5BRZD 3QI9C 1E6OL 3HAEA 4KRPC 5E08L 2VL5B 1KB5B 3MYZA 2ESVA 3HB3D 5DK3A 4KXZI 1N5YH 5GGUA 3BPOC 2X05A 1R5WA 4LU5H 4N1HB 4U1IB 3P4MB 1N6QL 3EBAA 2ZUWA 3SE8L 1EFXA 2Z4QA 3TC9A 2HLAB 3I3DA 4H88L 2MCPH 1P5UA 2UWEF 1JNLL 4WHTB 5ICXB 4IMKC 1AE6H 2EIEA 3VWJA 1OD9A 3UBXB 1MAMH 1I8KA 5F9AC 4DVRL 5I1AB 4RMWA 4LRIC 3V7MA 2NXZC 5C6PB 5HHQB 4NPYB 1SMOA 1VFMA 1EJ6A 3QNZB 3NABH 3NPSB 4ELMA 4UDUB 2CUHA 4JFHD 4RGNC 3TT3H 1CXIA 4TVPE 1MLBA 2F9BT 1FNLA 5JW4M 1XIWC 5C0AA 2DI9A 3IDGB 5EUOA 4YXLH 3OKOA 3U7YL 2P8PA 4Z7VB 5ENWA 5EZOH 3N1PC 1GC1C 1F11A 5D2NA 1BEYL 3TYGL 2DI8A 2JTDA 3WXVL 5BZWB 3HNSH 2KL6A 1C7SA 2DICA 4LNRA 2QHRL 5FOJA 2QKIB 4XHJC 5ESVA 1QRNB 1WAAF 2ID5A 1ZK9A 1U92B 1AXSA 1J88A 1MFCL 2MQCA 1RZ7H 2OTWB 3RTQC 4CN4A 1Z9OA 3L6FB 3W2DH 1H3UA 2A73B 1TVHA 5E8OA 4NRXB 4NKMB 2BOBB 3HHRB 5IVXA 3DI2B 4L4TA 4F8QA 4YHPB 3RBSA 4JB9H 3GSUA 4YFLF 3CIQA 3PL6B 5HD8D 5KSAC 1YN7B 32C2A 3JUYA 5JXAL 1MJ8H 3HMWL 3VXRB 3U1SH 1JF1A 1NC2D 1D5XA 3L3KB 3DUUB 3BESR 4LCCA 5MHSE 3CX2A 5K9JL 3D18A 2XWJA 1WCBA 1VDGA 2XNAA 4I3SH 4N9OB 1MJUL 3MLVH 5GGQL 1I9RH 2R9HD 5DVOA 4Z6AT 1OHQA 3BH8B 1KFAL 4JR9H 5IOPA 2XXCB 5C7XH 5D7KE 1R24A 1YEKL 3SDXE 1FGVL 3KXFE 4TSBL 4YHOL 3L3HB 2V17H 4YBQD 1EFQA 4QHUB 4TNWK 4A2LA 3AC0A 4Y89A 1VHPA 2DLHA 3OR6B 4DUXA 1X4YA 5C08E 3GI9L 5DGQA 1HQRB 4Q2ZA 5B4MC 2HLFD 4OCXL 3OWEA 5DJYA 1OAZL 3PP4L 3QUZB 4TUJB 5DUPH 2DIJA 4LLWA 1A3RH 2NY0C 3DX7A 3NFSL 3QDGD 3MV7A 5E9DE 5J89A 2XTJD 4PGBB 1DFBL 3UTQB 4JY4A 3TBWB 4IHOB 1MWAA 4WDIB 4ZMAT 5K9QG 4MQ7A 1CE6A 1U8JA 3TCLB 3DX8B 3QFJA 4LHUG 4ODHH 3BP6A 3IU4L 3CFKA 5DZNA 4P3CL 4R8WL 3AM8C 1RK1B 3GNMH 3W9EB 5BVJB 5C92A 1KYOJ 3KPQB 3WFCL 2I27N 2KZWA 3VFVA 5J1SC 3BPOB 4HWZA 4YBLC 3ZKXB 4XVUD 4UNVA 5TFSL 1S5HB 2GHWB 3HI5H 3EO1B 5TH2A 3ZHDA 1MCHA 3MLSL 2LQRA 1SYSA 3WIHA 1QLEH 4XCCH 5K93A 2NXYD 5I66B 2PW2A 1BBJA 2OSLB 4XCEA 5L2KD 3DO3A 1P7KB 2B2XH 3TBYB 3VXUE 1J05A 1CLYH 4EUPA 2FEDC 1H15A 5EIIB 4EDXB 5IR1B 2NY5H 2FRGP 4G9DB 1LO0L 3TWCH 2OTUA 3MJGX 1WBYA 5I1HH 1HI6A 4V2CB 4E41A 1TZIA 1Q1JL 5GRWA 2VLKA 1IAIL 3DMMD 5HYIA 4R0LC 1T22B 5I6XB 4IIQB 2EEDA 1EX0A 2Q3AA 3BH9A 3BP4A 3TH3T 1U95B 4MMXC 4PJ9D 4QRPD 1EAJA 4AMKL 4NQDA 2AXGA 1D6VL 1FG9C 3MGTB 5I9QC 1NANI 2YRLA 4N0CD 3SY0B 3WLBA 4KJWC 3TGXA 3WE6A 2VNCA 3QUYC 3DV4B 4IOSD 1TJIH 1G7QB 5HHVH 3MNWB 4UBDC 5MEOB 5JTWA 2UZYB 1BFOA 1G7PB 3ZL4H 4S0SD 5HPMA 2AJYH 4Y4FC 5F21B 3WLWD 4GBXA 5B39B 5HYJB 2BZDA 1A7BA 4JY6A 3HR5B 3LHPL 4NC2B 4GSDL 1YN6B 3QEGH 1HKLL 1KXVC 2HKFL 3RWIA 2X4OB 3DXAB 2R2EB 2XN9B 4K8RD 4L8CA 4G7YL 4XPFH 5FYKH 3MLWH 4JHZA 1R0AH 5JORA 4JO3L 1JIBA 4KAQH 4WO4C 3KLDA 4AIZA 5J4MA 5KSAB 2IG2H 3C8KB 3GM8A 4HIEB 1MCDA 1S7VA 1U3HA 2HG5A 3MA9H 3ARXA 1KCSL 4R97C 1EGJH 4U6VH 4L8DB 1HSAB 1UVQB 4BZ2L 4JDZB 3OB0H 5DVLA 1OLZA 1GAFH 2Z8RA 4P2RE 1JGVL 1ZXQA 1JCKA 2HA1A 5KJRH 4FNLH 4QXTB 5SWZB 3VXTB 4G9FB 1E6OH 2UWEE 1HHJB 1X5AA 5BJTB 3TLRA 1GGYA 1IGIL 1K9TA 3PHQA 4P5KB 4P2OC 4WV1C 2DN7A 5DD3L 5C6TH 1WIUA 3EHBD 3HE6A 1T20B 3GHBH 1UYWH 5DJ2A 4IRJD 1VGKA 4CNIA 1PEWA 1FRGH 3RNQB 1N6QH 1QKZL 1S7WA 1AD9B 1WTLA 1BOGA 1NCWH 4WI9A 4XVJL 4Z7WB 3B9KB 3P0VL 1JNLH 3ME0A 4JANA 4PJDE 5CUSH 4WVRA 1MCEA 4PJXA 1SYVA 4AT6B 3DLQR 3OKKA 5GGVH 4DVRH 1MEXL 4KZEL 2CR6A 4HSQA 4OZGB 4ONGL 4XTRD 2GJ6B 1X4ZA 3A6CH 2NNAA 5CHNB 4OFDA 1BIIB 3FQWA 3RJDA 4LCUB 4FA8A 2V2XA 4ZOBA 1JGLH 5DWUH 4HUXA 3SDAA 4AENA 4XC3L 4JM2D 4H8WC 1WAAE 4IRZL 4MA1B 2XXMB 2ZJSH 3IJSA 3PWUB 3S5LB 2JJSC 5E56A 2XKNA 1W0YT 3AAZA 4J3TA 4LLYA 4WY7H 5IJVA 4OAWA 2G2RB 3GSRA 1AGFB 1RZJL 2NY3D 1N5AB 4G6AC 5F7EL 5T3ZH 2G5RA 2CK0L 2ICWB 3LKPA 3OKDA 5HJ3A 3Q1SL 3P9WB 1X5GA 3TYGH 1I9IH 4O4YL 5EOQH 3WS6C 5J1AB 4K7FA 4LLMA 3WXVH 4D8PB 5E2UL 4ORGB 5E6ID 3GJFK 2QHRH 4RMTA 1SM3L 2DJSA 1DLHB 3RIFK 3VJ6B 2HJLA 4R4BB 3MRKA 4V1DE 5LVEA 5HD8C 3GSWA 4M6ML 2F53D 1MFCH 2W60B 1CFSA 2VDPH 4P46C 1HN1A 2FX7L 3X12B 3G5VA 4G8IA 5FECA 4O5LH 3EJZD 1QLRB 4HFWB 1J0IA 3MLTB 3QZWG 2FH8A 4QTIH 5FM5M 5IB2A 1VGEL 4G43B 5A2JH 2W9DL 5BRZE 4F15B 4LIQH 2YSSA 3HZKB 3V6BR 5JXAH 4R3SA 4PGCB 3TP4A 1F4AA 4NZRH 4JFDA 4QYOB 4OGYL 3GMOB 4XNZC 3PIQA 4M7ZC 4IS6A 4OCNC 4U3CA 3ARED 4RA3A 1I7ZB 5K9JH 3BP7A 3EOBB 5B3NA 3EFFB 3LKOB 1OGTA 2YUXA 3WDHA 1B2WH 2VWEC 5DHYA 1ZE3C 4PJCE 2HLFC 3V4VL 2V9TA 4MJIA 1UACH 2EE6A 4JREC 3V5HB 2VN7A 1I1FB 3LQZA 1YEKH 1FGVH 2YC1B 5T33H 3F7YB 4BYHA 1LK2A 2XTJC 5I75C 5FA3A 4JQVA 2HFGL 3TBVB 4OIBA 2A9NH 4JFHE 3U0WH 1LO2H 4LLVB 2R39A 1FYTA 1OAZH 3PP4H 4RDQF 4ZFFB 3GMLA 5EOTB 4F3FB 2M1KA 4EQ3A 5J9PA 3KPLA 3ZKQD 4R97B 4Q6IB 3D9AL 4KH2A 4XVUC 4JHWH 2DJUA 4PRIA 3ESVF 4J3SA 1AGBB 3PDDA 4NT6A 4J12A 4CMHB 1A6AA 1S9VA 2COQA 3IU4H 1JPSH 2NXYC 1OW0A 1FIGL 4R8WH 1FFRA 1P4IL 3DHJA 4JM2F 5CP7B 4WV1B 1FP5A 2EDNA 2NR6D 2WK2A 3TNNB 4LEOA 3GMRB 4G7VH 3L1OL 2G75B 1T1ZA 2IH1B 5CD3B 4MNQB 1LP9F 1SBSH 1IZJA 4XNUL 4O58L 5TDOA 3CFCH 3CD4A 5KSUB 1YPZB 2WUBL 3GKZA 4QGYA 4Z8FL 1A5FH 1ZA3B 4NGHL 5SWQB 1T83A 5EOCJ 4I18A 1EHNA 4PJ9C 2VISA 1KNOB 3SKUD 4TULL 5EPMA 2ARJQ 4N0CC 1QSEA 4ZTOL 3RWFB 4PGEA 3VGBA 2WWKT 3LRHA 4P48A 4DKEL 5E24E 3L5HA 2PTTB 5D70H 4OV5A 4RIRA 2E9BA 4HQQL 4MXWH 3LQAC 4TTGA 2EECA 4OLZH 1YMHA 4NQSB 2CLRA 2DQFA 3MJ7A 2CSPA 2RCSH 3WLWC 3KYOA 5GRUH 4JJ5B 1D6VH 2WBWB 12E8L 5GS0D 1CE1L 4X6CF 4UT7H 2BVQB 5L9DL 3FKUS 4QRRB 4U1HB 3BW9B 5J56B 1Q94A 3H9ZA 5T1LD 4O2FB 4RWYH 1EZVX 3E3QE 4K8RC 4LPTA 4BH8B 3TM6A 2IPKB 1T1XA 4KV5F 1EXUB 2J8UB 4Q0XL 3QDGE 3FZUD 5F3HB 1I7TB 2XTJE 5AZ2L 5TGBA 1JJUA 3MZGB 1U8KA 1N0LA 4P23B 3C08H 3X17A 2HKFH 1CFQB 2YUZA 3MV8B 1IGYA 4JFOB 4G6FD 3BSZL 3NIDF 3DX9A 1DEDA 3CX5J 3KYKH 2W07A 4JO3H 1ZANH 3HAEG 4GMTH 4U6TA 3TPUA 1ZGLB 1WFNA 2JF1A 2DOCA 3LKRB 5M95B 5E5MA 3EHBC 5F6HJ 2BCKA 2PR4L 5I8KL 5I1LA 1P4BL 3EYFB 1B3JA 5CJ8A 4ODTL 1TETL 5FUOL 4WU5A 1WK0A 4IRJC 5D5MB 5HGDA 3OL2A 1G7MB 5EOCH 4HH9A 5L2KE 3STZB 1D5MA 1JN6B 2LAAA 3ARZA 3D0VA 4YDIH 2K9UA 5D1ZD 2X4QB 5F7YC 1B0GB 4JVPA 3HPLA 1NC4B 2X4UA 4PREA 5JOPD 2ZNXA 3I6LD 1MVUA 2BNRA 4GMSL 3RZCB 4M6OL 5JHDA 1UJ3B 2DQDL 3T1FB 4IJ3B 3DROB 3OKNB 4KMTH 2BC4B 4XTRC 5F9JA 5CILL 1G7HA 2D4FA 5HHPA 1QKZH 5CZVH 1KPVB 1WZKA 4ZO6A 4L1HA 3ZTJG 1VPOH 1HEZA 1ZKAA 2MMXA 3FO0H 4JM2C 3TN0A 1RURL 3UJJL 3MYJA 1U8LB 3MCKA 2VB5A 4KZEH 4OLXL 2NY3C 3MZTA 1MQKL 3GKWL 4QXGL 2X4TB 2ZPKL 1I4FB 5FYKU 4OIIL 1WIPA 5BV7L 4N0FA 4JO4H 4OLWH 4WFFD 3CNKA 1T04B 2VXTH 5E6IC 4KMQA 2BSED 1CG9B 1NCAL 2C26A 2YD6A 2GEEA 5JW4N 3BIBX 1Q9LB 1RZJH 3H9SA 1ZVHA 3QB7C 4YR6A 4ZDHA 3EJZC 2CK0H 2Z0BA 1KJVB 4MA7H 5D2LF 4N90D 5KTEH 4O4YH 4U1KA 5E2UH 1O5DT 3DNKA 5I73C 1VFBA 5L0QB 3O2VH 3RL1A 4X5XB 2MTPA 2D4DA 4F37F 5D7LD 1KENL 1J8HA 5JDJA 1KPUA 2GAZA 5EFIB 1PKQB 2DQIL 4YGAB 2W0KA 4NZTL 2DYPA 1FZOA 3P0GB 2XQBH 5HHNB 2D7OA 4OIAA 5C0GA 1K6QL 1YEJL 5FOBB 3FB8A 1A7QL 3V6FA 3SDCD 2Y07L 3G5ZB 2CDFA 4KXZH 4Y4KA 1Z9LA 3QUXD 3FN9A 5C0IA 5F7HA 3CFIC 4FFZH 3QWRD 3QAZB 3QXUA 2MHAB 4H0IA 1NGZB 1UG9A 4Q58C 5C0BD 2ADGB 2OXGA 5HDQL 4YHZL 4PRHD 3QA3A 2FNBA 5C1MB 1GZPA 4NRZB 1FVEB 5EZJB 5FYJH 1W2KT 4QY8B 3PL6D 5CEYB 1FJ1B 1JPST 4NWTH 4PJGF 4XGZB 4AEHH 5DRXB 3H9YA 1B4JH 1F4WH 3GMNB 3SE4C 1FFOA 4BELD 1N6UA 1JL8A 2E8YA 2LVEA 3PWPD 3H2WA 1H3TA 4GQPH 2F54B 5BQ7A 5EO9A 5E70A 3GJFH 1ACYL 1BZ7B 4NO0A 4OZHB 1LILA 4P9HC 3C6SA 3BXNA 1ADQH 4MB5A 3QO1B 1QHOA 4WW2B 4FQHB 4PBWD 1L6ZA 4XCFH 2NR6C 4TNVF 4G8EA 5IHUH 3SKMB 3K4DA 5GRJL 4KY1L 1LP9E 5IK3A 4TVPL 2FZ3B 4ONFL 1N3NA 1EHXA 4L8SC 5DD6A 3WN5B 1FVCA 2J6EL 3GHEL 3O2DH 3IDYB 4EN3B 1S8DA 1FIGH 4M5ZL 1P4IH 4YNYB 4HV8B 1R3IL 2V9QA 1YDPA 3BI9X 1WT5A 4YHKL 4UB0H 3UCRA 4R6UA 1MPAL 2QADC 1J9CT 2ICES 1FAKT 1T4KA 4ODXB 1AR1C 1T7ZA 2VQ1A 3VFTB 5D96C 3KPNB 2W0FB 2CUMA 4O58H 3WIIH 1BZQK 1ZAGA 5DEFB 2WUBH 4D9LH 3O6ML 5K9OA 1KLGA 2FX9L 5BVPH 4HXBL 4NUJB 4F58L 4U6HB 3QIWA 4LPUA 4Y19A 5DS8A 4UIKH 2HTLD 5J12B 4JDTL 1KN4H 4TULH 1EEUA 4NQXB 4YQXL 1IAIM 5GS0C 2XY1A 3VDCA 3RIAF 3RVXD 5T3XH 3SKJL 4B7LA 1FLRL 3ZDXF 4MX7A 1K4CA 1QSFA 4Z5RA 3QYCA 4HQQH 1BQHA 3AU1B 1FG2A 4KV5E 4N0UE 3GSNB 1RZ8B 3NCJH 3G08B 3O6LH 4I8DA 4ZG1A 2A9MH 3CH1B 1CFTA 12E8H 2JJTA 4LGSB 5L9DH 3BZFB 2H41A 3P9MB 2PXYA 4Z78B 5AD0A 1RFDL 3MRGA 1NBQA 3BP5B 1NDGB 2J2ZA 2DM3A 4KC3B 2AKRA 3CLFH 1W0VA 4TUKL 2VZ1A 4HWEH 1JI2A 4Q0XH 1U8PB 4PJBB 1FL5A 3SO3C 2VR9A 3X3GH 1CXHA 3O45B 1TTGA 3QUKB 4UOJA 5IBTH 5SWSD 3UC0H 5IF0A 1KPRB 3F12B 5CSBA 1RZIB 3SCMB 4NZUL 3UYPA 1I1AA 3FO2A 2KPNA 5HYJD 3FB7A 3FQNB 5D1ZC 3U82B 4FQXD 4H25B 2ZUSA 2HVJA 2WWKO 5L2JB 4JFEE 4CMMA 4MA8H 3X13B 2V2WB 3OB8A 2PR4H 3M07A 4F7CA 3UYRH 3UTTD 5I30H 1A1OB 4WI6A 5E95B 5DJAA 3MNZA 5FUOH 5F9WC 2EKSB 2YXMA 2FJFA 1BIHA 1LO3L 3D39D 3HPJA 3IYLW 3G6JA 2ITDA 4APQA 1GC1L 3MROB 5A2FA 5HYSB 5KSVB 1NMBL 2H6PA 5I1DA 4GXVL 3MRCB 3QWQB 3H9HA 4DZ8A 3U0PB 3RGVB 3FT2B 4M6OH 2Z8WC 3WUWA 2ZOKB 4BK4A 5IEKA 5JZ7D 1KCUH 5CILH 5SWZD 1T1YB 1N59A 3T0EB 4XPHL 1MUJB 5AAWA 5FO7A 1WEJH 2D2OA 5F7MC 2XA3A 5F6IB 1NANH 3VG0H 4GW5A 4UV4L 3JSSA 1RURH 2FJGA 4HLZG 5I76A 1OF2A 4OLXH 2APVA 2UY7A 5A16A 1MQKH 2C1PA 1ZGLP 3GKWH 3LD8C 3BGMB 2ZPKH 4ODWA 1T89A 3IFPA 3B9KD 4OIIH 1S7SA 2O5YL 3DX6B 1U58A 4PGDA 3ARGA 4NSKA 3IS1X 1B0RA 2FR4A 3NGBC 1NCAH 4PG2C 3Q6GL 4PJEA 4HIXL 5IP4A 3JVGA 3KPPB 1EBPA 1RZKC 4NHCL 3O41B 5IW6B 1JZ8A 3UTZB 3TIDB 4L3CA 4LLDB 3SE9H 3T04D 5MEND 3HZVA 1LVEA 3H7LA 5BXFB 1R5VA 3SDCC 5JDSA 1H3GA 4UDTA 3U4EA 3PWVA 4HK0A 3GBML 5KAQG 4LLUA 3QUXC 1LEGA 1U91A 2FL5A 4YDKL 2XZQL 1OQOA 2VLRA 1BLNB 4EI6B 2EDFA 2DQIH 5H94A 5F8QC 5AZEL 1KIRB 4RBPK 1HHHB 1MAKA 4AM0B 3TBTA 1K6QH 1JGEA 3BT2L 3Q6FB 2W9LA 3QEHB 3X3FH 3LIZH 3C6LD 2X1QA 1A2YA 4LLQB 4ETQB 3IDJA 1B90A 2D7TL 5INCB 2Z8VC 5DTFB 2CMRL 3LVEA 1KJMA 1CTNA 5AAMA 5JOPE 4PJGE 4OQTL 1DSFL 3I6LE 2R0WL 3LEVH 4LVHB 3VXQB 4HC1L 3C5ZB 3K1KC 5B8CC 3LRSB 4F80A 4M61A 2CKBL 1A7PL 2XRAL 4FXKB 5GISL 3FT4A 5EU5B 3MUJA 4HXAH 2AABL 3BKCH 1FCGA 1H5BB 3PV6A 3BOVA 1A9BB 4PY7A 5HYQB 1F2QA 2ED8A 2PO6D 3LKSA 1UQSA 3F7QA 1JHTA 3TZVC 4ZUUB 5JOEA 2AQ3A 2AK1H 5DQJB 3MOAH 2Q7NA 1ACYH 3CFDA 1NFDF 2CLZB 1VB9A 4WFFE 3S97C 3QIBC 1UCBL 4IOIB 4KDWA 2A6DA 3W0WB 3UYOD 1RZFL 4YEEA 2GJZA 3BN9C 4OD3H 1QUNA 1AKJA 5DVNA 4WEUD 4TN9A 1H3VA 1A21A 1UKTA 5GRJH 4GRWB 4KY1H 4OF3A 3OHXA 5F9WB 2WSKA 4N90E 5D7JA 2FBOJ 5DK0B 4H1LB 1L0XA 4PBXA 3CDYA 3VE0A 5DRNB 5DR5H 2YN5A 4F9PC 3AXLB 4QTHB 1KEGL 2R0ZL 1I8IB 4YHKH 2AV1A 4M1DH 1TENA 2AERT 5D7LE 4OZGF 4WFGD 2HTLC 1MPAH 2XZCL 5TE4H 4PRNA 3ZT5A 3DUSB 1ORSA 1CXFA 1QBLL 2DAVA 5FYJU 1NKRA 3WS3B 1KTRL 3ARFA 3RVXC 3TA3B 4HIIA 4BH7B 1VADB 1KUMA 1YC8A 3DRTA 4QRSB 3MCLL 4JN2B 2ZSWB 3ZDXE 4KTEL 4X8JB 3O6MH 1QRNE 5EN2B 3SKOB 3ZDZE 3KPMA 1LO4L 5IFAL 4M02A 4NUGH 5ELIA 4F58H 4S2SA 3MRPB 3MLRH 5FO8B 5C0BE 4JDTH 2W65A 4ODBD 2NY2D 1RI8A 2AEIT 3N0PB 5FUCC 1AP2B 1BAFL 3K81A 4PRHE 5KOVC 3BJ91 2A74B 2NW2A 2OLDA 3QG7L 3SKJH 1FNHA 3ULUF 2C3WA 3V0VA 2E7LC 1RUML 5EU3B 3VGDA 4P0DA 3SGJA 2JB5H 3QPQC 4MLSA 3H7BA 5IVZB 3IJYA 1AHWA 4UAOC 3QZWB 5FAAA 4FFWC 2ARJA 1PFCA 1RHHB 4RAUA 1XZ0B 2DM7A 2FEEL 3SPVB 2WZPD 1DQQA 3PWPE 1BECA 2WQRA 4X9HA 2BSTB 4DGYL 3D6GA 5LBSL 1IFHL 4GRLA 1XF3B 2Y6SD 3P77B 3BPCB 1ODAA 1FNSL 3SJVD 4K23H 4JGJA 1E4KC 2DQEH 5J13C 4GG6F 3QJFA 4JZJC 5D93C 1SHMA 2Y23A 4Y2OA 4XP5L 3U9PL 5E8PA 1BZ9A 4S1RL 2VZVA 4JZOB 3V6OA 5ABDE 3UPCA 5IMKB 1DUZB 3VG9C 2LE9A 4PS4H 3L3GB 4PJ5A 1IQDA 4GS7B 5J8OA 4YXHL 2C4FT 1RMFL 2RHEA 3TO4A 4JO1H 5E8NB 4JKPH 5C3TA 1QD0A 1JZ6A 2MKLC 3GIZH 2NYYD 1IZKA 4NKIL 1MCOL 2IAMB 4U2ZA 3EDJA 5LGHL 4Y2DB 1MCKA 4LHJB 1S5IH 1HH6A 4MJ4A 1ADQA 3B83A 3C87A 1A6VL 1CIUA 4N0YL 3SGKA 3LN5B 3PDOA 4H8WL 2FECI 4QXWA 3CFBB 1LO3H 4I0KA 5E2TL 5JPMB 4ZS6D 2WLZA 1OTUD 1GC1H 4ZUWA 3S4SG 3OJDA 2KUTA 3UXFA 3BZDA 3O2DA 4EEEA 1A1NB 4PRAA 4Y4HC 4ZXBA 1U8NA 3QXDA 1OLLA 1QR1B 1JMXA 3H3PH 2R0KH 3HC0B 1M7XA 4NHUB 2HRPL 4OCSL 2WUCH 2UVEA 4PJIA 1VENA 4YWGH 2DWEA 3B8SA 3RWEB 2YD1A 1DBMH 4LSSL 3IXTB 3T4YB 1MIML 3C60D 1F4XL 5FUCE 2BY1A 1YPZF 1RJLB 4UQ3B 5JXED 4NO3A 1KXTB 2GCYA 3GBNH 4XVSL 1KG0A 4QCIB 3AS0A 3WJLA 4P99A 1X6LA 2IEPA 2R23B 3VGFA 2YBRA 2ICEA 2V2TA 1FHGA 3EYSL 3HA0A 1CZ8H 2R1YB 3O0RL 1CLZL 1C08B 4HIXH 1M05B 2DLEA 4OLVH 4QHKI 4LCWB 1OM3L 2OYPA 5SWSE 3ROLB 4XNYL 1ZHLB 5F7NC 2VE6A 2P48B 1P9MA 3C6LC 4U6XA 2QL1A 2YKLL 3RWCA 5HYJE 1BPVA 3GBMH 4ZUTA 2Z31A 4TQEL 3PWJB 1Q0YH 4IBLT 3MR9A 5T1KB 3VDAA 4I2XA 3QHTC 4C59B 5D9SA 4MJ5A 3UTTE 3DXAE 2C4FU 3BRFA 2ATPA 1LE5B 5LGJA 1R6VA 4RGMB 3S37X 3BT2H 4RFNB 1G7LB 2VXUL 1HHKB 4P4KA 2J8UF 1S7QB 4WHDA 3OAZK 3O81A 3BQUA 4Y5VC 4XPGL 3VWKB 3VFOB 2WQ8A 2RGSA 4IDJH 4X7TA 4HPOL 1K2DA 2CRZA 4OJFL 4GT7A 3KPRA 3B6SB 1JWSB 4OQTH 3D3VA 2Z35A 3MUZ1 4FFYL 4P3DA 4Z76B 2PO6C 2P7TB 4AEEA 4GUPB 3HAEB 4EBQL 5SWZE 4C54A 1BF8A 3FQUA 1M7IA 2C3GA 2ZKHL 2L7UA 2ESVB 1A7PH 1E4XI 2CIIB 3CK0H 4ZFGH 1NFDE 2OTPA 1NCDL 5GGUB 2AABH 3REVA 4JZJB 1MJ7H 4LQ1A 3ZE2E 1R5WB 5I16A 4LQFL 4XAWL 4M3JA 3F5WA 5A3IC 4DW2L 2IF7A 1EFXB 2Z4QB 3WFZA 2AK4D 5GSVA 1QFHA 4MZ2A 4NOFA 4BM7A 2NZIA 3AROA 3VWJB 3OKEA 1ZEAL 3FQTA 5HI4D 1I8KB 3E6FA 3CU7A 1EHLL 5DT1H 1UCBH 3IDUA 4AZ8A 4AK1A 1RZFH 3D1MC 2YXFA 4N0RA 1INDL 4ELMB 4RBPH 2F54D 1IGTA 3W9DA 3LQAL 1MLBB 2FIRT 3AS1A 3BPLB 3PJSA 4OGZA 4HF5L 5ANME 4YDLB 5MENE 5C0AB 5EUOB 3BO8A 5SX4I 3NIFF 4DQOL 1X3DA 4X7CC 5FUZH 2VO5A 3OKOB 1KACB 2P8PB 5IQ9A 3EDDA 1E27A 2VDMH 4XMPL 5ENWB 5D2NB 1F11B 2R0ZH 5HHXL 5FV1L 3D2UD 1D9KA 4HPYH 3SDDA 3AGVA 2GFBA 2D03H 4LSPL 2NY2C 4K8RL 1BD2D 4UIMA 4W6XB 2CXGA 4LNRB 4Y4HB 1QBLH 3N1MC 3CGTA 5ESVB 3DRQA 2DDQL 1AXSB 1R3JA 4NQCD 1VFOA 1RSFA 4KRLB 1NAMB 4AL8L 4U31A 5FA4A 1NEZA 4MNHA 3KHQA 1RQ5A 1BQHG 3I2CL 1JZ7A 5E8OB 1TVHB 3O9WD 1MFDL 4U1LA 3RI5F 5IVXB 4WTXA 5D1XC 4L4TB 3TVMA 1OP9A 1NCBL 1FBIL 4LDEB 1AI1L 2F5BL 3TF7C 1BAFH 3B2VL 3GSUB 4HX1A 4HMEA 2HTKD 3QG7H 2R2CA 1RUMH 4WGWB 32C2B 3P4MA 1AD0A 1K4DA 1JF1B 2QSVA 4J3UA 5EWIH 1I1YA 4JRXA 1D5XB 3DETC 3V4PL 2HLAA 4LCCB 2QBWA 4LBEA 4GG6E 5BS0A 2VZSA 2YD9A 1JI1A 1BWMA 3MJ8A 3D18B 2XWJB 1WCBB 3QQ9C 2Q8AL 2XNAB 3EOTL 4XPTL 5IB5B 3HZMA 4DGYH 2I5YH 3CVHH 5LBSH 4X6DF 4L9DA 3OQ3B 5HHQA 5IOPB 1R24B 1YEIL 1FNSH 4M8VA 4KZDL 2E6JA 3LB6D 4NDMA 2VRAA 5EULV 4HBCL 1MREL 5E99L 4NC0B 4Q97A 1I7UA 2BDNH 1FZJA 1WGOA 1YNTA 4I0PA 2APXA 3PWNA 4Q2ZB 1SJXA 1A6PA 4S1RH 1IGML 4XAKD 5DJYB 1A14H 3QEQD 1YYLH 5HHOA 2BRRH 2FYYA 3BE1H 3I02A 3DX7B 5F7DA 3E2HC 1KGCD 4JY4B 2GJJA 4X6EA 4YX2L 3F58L 4U1SA 4ZS6C 1MWAB 4YFDB 4WI2A 1QBAA 5GRXG 4WFGE 4HZAA 3OXSA 1YEHL 5HYEA 4MQ7B 1CE6B 4WEBL 3QFJB 1U92A 3BP6B 4NKIH 1MCOH 3CFKB 4OZHF 3O6FD 5LGHH 4AG4H 4J2XA 3WUWG 3MRFA 4N0YH 4H8WH 3NCEB 4NKMA 1X5JA 3VFVB 4LSRL 4LFHG 4WW2F 4OCLC 4HWZB 5E2TH 4UTAL 2X89A 2YEZB 1XCQA 5TH2B 3SO5A 1NCNA 4XP6L 3VI3F 1IGCL 1SYSB 3ARDA 1JNHA 3C60C 2PW2B 1BBJB 1LO5A 4XCEB 5H37H 1JZ2A 1WQVT 5EBLA 1YPZE 5JXEC 3L3KA 1RULL 1J05B 3IETA 4OKDA 2JB6A 3MRDA 5E03A 3V7AE 1H15B 1LGVA 4EUPB 1HYSC 4KHXL 2FATH 3MRRA 4DEPB 5I8CA 3RX8A 4R90L 3VXSD 3WO4B 4LHUD 1JPGA 2OTUB 1WBYB 3RDTA 1HI6B 4LSSH 5CBAA 4HGKC 4E41B 2UY6A 1TZIB 1X5XA 1MIMH 3DSFL 4XP4H 4OM0L 3FT3A 2J3SA 3RHWF 2YWZA 1XAUA 4Q9RL 3OZ9L 3BP4B 5IG7A 4D9QD 3QDJD 1EEYA 3MO1A 4NQDB 3SJVE 2AXGB 2OZ4L 3OMZA 5DMGD 2GKIA 3WLBB 3WE6B 35C8H 3EYSH 4HJJL 3O0RH 4ERSH 5ICYA 1M1SA 2Y72A 1BGXL 4WCYH 4AY0A 2ENYA 1I3RA 3B9DA 1BFOB 1RY7B 5HPMB 3KGRA 2K7QA 3TBWA 2AJVL 5ACMA 1HHIA 4GBXB 4JY6B 2J8UE 2YKLH 3TCLA 3LAFA 2FGZA 2HJFA 1TNMA 3STLA 4TQEH 3QI9A 4M93C 5EIVA 2X6MA 4LHQB 3RWIB 1OTSD 1NMAL 4MD0A 4L8CB 2H2SD 3SDXA 3KYAA 2MNUA 3KXFA 2H26A 4PLOB 5JORB 4PJAF 4AIZB 4S1SH 1BWWA 4XBEL 5DI8B 1S7VB 4KUZH 4P5TD 1U3HB 5C08A 3V4UL 2BNQA 2HG5B 4TRPH 4PJBF 4LSTH 3B9EA 1BHGA 4PYHA 1DLFL 4DAGH 1VACA 4IMKA 2IAND 4OJFH 2W91A 1EMTL 1X4XA 1INEL 4JG0L 2EIDA 3IAQA 4U0QB 4F7TA 3OF6A 5EIIA 4JFZL 5HGBA 4PB0H 5GGSA 1YQVL 2D3VA 4AEIL 5E9DA 5AG8A 4LRIA 3SBWC 4R7NA 5J3HD 4DFIA 1CK0H 3PHQB 2C9AA 5HI4C 4OB5L 3HE6B 3QISA 3ESUF 5DJ2B 3S36X 4XBGB 43CAA 4CNIB 1XIWA 3BIAX 1MY5A 5LQBH 1BOGB 2R69H 4E42B 3TT1L 4JANB 4UUJA 5AWNL 1VKXA 5HI5D 1O7SA 4PJXB 3NIFE 3OKKB 1EHLH 5A2KH 5GS0L 5DURB 1KELH 1NUFA 2FD6L 3THML 1INDH 3TV3L 3VXUA 1IMHC 2NNAB 1CIDA 5B39A 5IB1B 1A02N 2F74B 3RTQA 3FQWB 2G9HA 2V2XB 3LQAH 3V5DB 3GSVB 4HUXB 3SDAB 5T1DL 1R3KA 3VFUA 2F5AH 2HT4C 4HF5H 4AENB 3BKML 3JWNC 5KN5A 3ZE1F 3OAZH 3IJSB 3W0WD 4DQOH 4LNVA 2XKNB 3AAZB 5J0BA 3BHBA 5IJVB 2J8HA 4OAWB 2RBLA 3GSRB 2R2EA 4KKNA 2BVTA 5KSBA 1QVOB 1MF2H 1TJHL 3LKPB 2VC2H 2EE9A 3OKDB 1XF5A 1YA5A 3O9WC 1RJZA 3I3BA 5HJ3B 3TJEH 5KSAA 4K7FB 4LLMB 3IFLH 5EZIH 3ARWA 2HKHH 4K8RH 1T1WA 3VD9A 3G04A 5HGGS 3EYUL 2CR3A 5ALBH 3G6DL 2HJLB 2HTKC 3MRKB 1QA9A 3WNPA 1A0QL 2DDQH 3GSWB 4XWGL 3KYMA 3HZYA 3HG1D 1CFSB 1JYNA 3MRNA 3G5VB 4G8IB 5IT2L 5FECB 4RAVB 3D85D 3MJ9L 2NW3A 3NAAL 1KTDA 1N2RA 3KDMA 3BX7C 4BZ1L 1FBIH 5IB2B 5DFTA 4G8FA 2NX5D 1PG7W 3B2VH 2YSSB 4KPHL 1CDHA 4X6DE 4XBPA 4FN0A 1DBAL 4R3SB 4XT1C 4QOKD 4JFDB 3L3JA 2PTVA 2Z92A 3LB6C 5GPRA 3PIQB 2BVOB 4IS6B 4XX1E 3R8BB 4CAGA 1S3KL 1QTYT 3BP7B 1CL7I 2WMPA 1F58L 4NZDA 1OGTB 4JO2H 2HT3D 4DFHA 1J0KA 4J4PD 5DHYB 2OR9L 2ZUUA 4MJIB 2EDKA 4PRBA 2AAVA 1KB5L 2JJWA 3LQZB 5IBLC 3FOLA 5TQ2L 1YEIH 4QHNA 2X41A 4OQTA 1GRWA 1I3VA 3G9AB 1LK2B 4UT9L 3T0XA 3AM8A 4LCUA 1TMCB 5FA3B 5C0EA 3N85L 3BAEL 1CYGA 2F54E 4WWKD 4CGTA 5C0CD 3O6FC 1WWBX 1AQKL 2AQ1A 4L9LC 15C8H 1QLFA 3VFMA 3GMLB 2PETA 4L3AA 3MPCA 4QO1A 3KR3L 3JV0A 5J9PB 1GHFL 4D8PA 3T8XA 4S1QH 5KVFL 4PRIB 2BHZA 4UTBL 4NT6B 3VJ6A 2XKSA 4WEBH 2QTEA 2FJHA 1A6AB 1PD6A 2DD8L 3QCUH 1S9VB 4PJDA 2X70A 4PR5B 5JQ6H 1BD2E 4XP9H 3PGCA 2OK0H 3HC4L 4U2YA 2BFVL 5ECJE 4HUVA 1RIHH 1PSKL 1P53A 2IC2A 1NGWA 4RQQA 2A6KA 4NQCE 4LEOB 4OZ4A 4Y5YC 1IC1A 1RZKL 3OAUH 4R0LA 2FHFA 4S10A 2R15A 5B21A 4GRWF 3RZWA 1DDHA 5TDOB 3CSYA 2NY1D 4JZNA 4QYOA 1Q9OA 6CGTA 1DL7H 3QUYA 4I18B 3W39A 2VISB 4ZUSA 3QDMD 1CXLA 4XXDB 5EPMB 4U33A 1QSEB 1A4JA 4JVUA 1U93A 4KQ3H 2VQTA 4PGEB 5CEXA 1G9NL 5BMFH 8CGTA 4Y4FA 3LMJL 1WZLA 1FDLH 4OV5B 5DJ8A 4RIRB 3QWOB 1QPXA 3C09B 5CZKA 2V9RA 2E3VA 5HVWA 1H3PH 3OZ9H 1YMHB 4C58B 3BWAA 2CLRB 3J7HA 2DQFB 2WWMD 4DN4H 3KYOB 2ADJA 1PEZA 1CGVA 1IAKA 2Y5TA 4FZ8L 4PJ8D 1OSZA 1E4JA 4HJJH 5MP6H 4WO4A 5BRZA 5HHMB 1NCCH 3IDXH 1OTSC 1BGXH 1BF2A 1Q94B 2XZAL 5IWLC 1OPGL 4QHKJ 2OL3H 2H2SC 4XAKE 5KBNC 1C1EL 5L8LB 1T1XB 4PJAE 4AEFA 4WUUD 2BK8A 1KGCE 4P5TC 4ETYA 2DL2A 3VGAB 5TGBB 3S37L 2F58L 4PJCA 1U8KB 3HLAB 3CVHA 4OTXL 5D7IE 4WV1A 4P2OA 1IGYB 5F7UA 4L4JA 1FAIL 4P9HH 2C4XA 3DX9B 1QSZA 1JWUA 1X5HA 5J3HC 3TPUB 3ARBD 5E5MB 3K74B 4LKXB 2BCKB 3F7VA 3BKYL 5I1LB 4GQ9L 4WU5B 1OCWL 1B9ZA 5HGDB 4N8VA 3FRPA 4HH9B 3DYPA 3WSQH 1D5MB 4JFZH 1IC4L 1RVFH 3D0VB 1YQVH 1F8TH 4AEIH 2JCCE 2VDOL 5D6CA 2D0GA 3HPLB 3U2SA 3S98A 5HI5C 2X4UB 2VDRH 4PREB 4TSCH 2IQAA 1NSNL 2CO6B 1MVUB 3PQYB 2BNRB 3VXSE 1FFNA 3AS3A 2ZG1A 2EZ0D 4KTYA 1G7HB 1MFBL 2NQCA 5HHPB 2IBBA 2JJSA 1N7ML 3T2NL 3X14A 4NM4L 2ESVD 3UTPD 1I85C 1BJ1J 1HEZB 3TT1H 3ZYJA 5AWNH 4D9QE 2IMNA 3L7FA 3QDJE 3ZE1E 4TYUA 3WS6A 3MYJB 4MD5A 3MCKB 4N1CA 1JWMA 2W1NA 4X80H 2OJEA 3RX5A 3T3ME 1UFUA 2IPKA 1G6RL 1QFWL 1EFXD 3THMH 5MERA 4N9GA 1JBJA 4N0FB 5F3HA 4P46A 1G7JA 1NC2A 2K1MA 5T1DH 3BKMH 4MS8D 3VD7A 2EKJA 3T3PE 2GK0B 3MRHA 3MV8A 1EVTC 1UM4H 3H9SB 1LE9A 5D4QA 4YR6B 1M7DA 2LAGB 1ZVSA 1Q0XL 4U1KB 1ZGLA 4OCRL 2NY4C 2B0SL 1AR2A 1VFBB 3MRJA 3R0NA 5C07A 5L6YH 1ZHKA 4DKFL 5HVHC 3RL1B 3EYUH 1Q72H 3G6DH 1A0QH 5TE7L 3VRJA 1UWEL 1HE7A 1KPUB 2GAZB 3J8F7 4EXKA 4K2UH 1FZOB 3MJ9H 4V2BA 2IANE 2G5BA 5C0GB 1VEPA 4CVXA 3FB8B 2HT3C 3V6FB 2ZUQC 4J4PC 1E4XH 2XZZA 3QDGA 3KJ6H 4Y4KB 5IQ7L 4CJ0A 4KPHH 5C0IB 4KMLB 5I15H 1GH7A 3T2PA 2Y7QA 1DBAH 4LSQL 2F8XC 1X5YA 4MMZC 4MQXD 4YUEL 1MI5D 3SOBL 3QA3B 1S3KH 1AFVL 1RUKH 5D71H 1GZPB 1BJ1H 2DTML 4PD4K 5GGRB 2OR9H 5CSZA 4WWKC 5DK2A 1PX4A 4X4XA 4XI5D 4Y0GA 5GQBA 4OT1L 1EEZA 5IB3B 1X6NA 1FFOB 4EIGB 4M03A 1RIUL 3NFNA 5L2KA 4XCYA 5B3JF 1CN4A 5EO9B 4NO0B 1DR9A 3BAEH 3WDIA 6FABH 3C6SB 2AEWA 3FHQA 3GK8L 3O4LD 5SX4H 2OX5A 3BXNB 1AQKH 3WFDH 5IMLA 1SJEA 1AGDA 3W0WE 1AGEA 1JF5A 1WZ1L 2LFGA 1GHFH 1CDCA 3N1FC 4G8EB 3C2AL 5TJWK 5KVFH 4UV7L 5IK3B 4PGZA 3RU8L 1JHLH 1N3NB 5DD6B 1U41A 1FVCB 4LP5A 4PJ9A 4QRPA 1S8DB 2NY1C 4G8GA 4PJHE 2N1KA 3HC4H 2BFVH 3CDGA 1SBBA 1FNFA 1YDPB 4POYA 5I17A 3MV7D 3KPOA 2DWDA 3FFCD 1EO5A 1I9JH 3HG1E 4NN6B 4DOHE 5DUML 2LTQB 4ZFOA 1T4KB 3PGFL 5DQ9A 2EDYA 2PN5A 2IPTL 2VQ1B 1P7QD 3UDWC 3NZHH 4L1DA 1IT9L 1QG3A 3WUZA 2NX5E 1F45A 2EH7H 4PB9L 5K9OB 5EUOF 1KLGB 1ZWIA 1NJ9A 3VU2A 1A7RL 4MWFA 1E0OB 3C2SA 2OP4L 3QIWB 5DS8B 3NACH 4C55A 5GHWH 1CL7L 1GPOL 4QOKE 1FVEA 1G9MC 3SEPA 3ZT7A 5DMKA 4ACPA 4PJ8C 1OAUH 4YHML 4NJAL 1PLGH 4WTZA 1OOAA 4JFQA 4MX7B 1K4CB 3DBXA 1QSFB 2CJUL 2B8OT 3OXRA 3QXAA 3WIFA 4M7KH 2AJXL 3T09A 4JE4B 4Z5RB 5IGXL 1BQHB 4GXUM 1UKSA 1ZVYA 1FG2B 2JLLA 4OLEA 2I60L 1FIEA 3MLXL 1CFTB 5F1IA 1BQLH 2DQUL 5L8JB 1YEFL 3BUYA 3HUJB 3W82A 1IQWH 3ZSSA 2VH5L 2VLKD 1CGSL 2PXYB 5AD0B 3RKDC 3M8OL 3MRGB 4YZFF 3QO1A 5H2BA 2NY4B 4K7PX 2AKRB 3MLYL 3LH2L 3M1BA 1W0VB 1FL3A 3O8XD 2EIZA 4M6NH 1YECH 1DQLL 2HFFA 1FL5B 1KCVL 3ARBC 4IRJA 2FZ3A 3RP1A 4X4ZA 4K3GA 4G5ZL 1FPTH 3S37H 5EH1A 5LWYL 5IF0B 3DVFA 2BX5A 1MRFL 4FFVD 3LDBB 2Z8SA 4OBSA 4M43L 5TQ0H 1I1AB 2ZCHL 2ZUQB 3QNXA 2Z9TA 5EO0A 3FO2B 2VIRA 3FB7B 5JIIA 1INQA 3TESA 3BZ4A 1PYWA 2HVJB 4QRQA 2P43B 4CMMB 4OLUL 1A4KA 5KANI 3DVGA 3LS4L 4J6RH 5DJAB 2D7PA 1OCWH 2FLRT 1F4YH 2EEBA 5B22A 2EZ0C 2VUYA 4JM2A 2FJFB 3S36L 1E6JL 3FB6A 3KJ4C 4ZYKA 5IFHH 3HPJB 3G6JB 1IC5H 2VDOH 5GJTH 2ITDB 4APQB 2FWOA 7CGTA 1LP9A 2H6PB 5I1DB 4WWID 2W59A 3QDME 5I1KH 3H9HB 4E9LA 4DZ8B 1I75A 4OCMC 3WUWB 5E6IA 5IEKB 2R56L 1DQML 5F70A 1A7OH 1HIML 1N59B 2I07B 5I1JL 3KYNA 3G08A 1OTTD 2F53A 1N7MH 3QCTL 4LVOC 2QQKL 5FO7B 4MHHG 5B39G 4LOUD 2IPUK 3HE6D 3EYOA 4JQIL 4GW5B 4ZOCA 4HUWA 2FJGB 3NIGF 1NDGA 5I76B 4HAGA 1OF2B 4WW1A 3O3EB 5A16B 2EO9A 2OXHA 2C1PB 1H8NA 2IQ9L 4ODWB 3IFPB 4XNXL 1XGYH 1U58B 5DJ0B 3ARGB 4G3YH 4NSKB 1I1CA 3O45A 1B0RB 3KS0J 4Q9CA 2FR4B 2A77L 3P0YH 4Y5XC 3F6LA 4PJEB 4ZAKD 4N8PA 2CGRL 4X9BA 4QRUA 2DTSA 4L3CB 4N0UA 1F6AA 3HZVB 3EDEA 4H25A 3O2WH 2OZ4A 2Z91A 3CPLA 1OP3K 1R5VB 5J06A 2GW5A 4UDTB 4DKFH 4YAQA 3U4EB 3PWVB 4HK0B 4HEME 4LLUB 2GK2A 1Y6NR 1U91B 2FL5B 4JPWH 1U8IA 4K07A 2VLRB 4PJFE 2NY6C 5DHXB 5H94B 2OL3A 2WBJD 3UTSD 5AEAA 5J11B 1LWRA 3TBTB 1JGEB 1A2YB 3SDYH 4FQ2L 4PD4J 2AXFA 4MD4A 3IDJB 4OZFH 3SE4A 1NGYA 3FT2A 4FZEL 1RAMA 3JWDC 4ALAL 4JAMA 1KJMB 1GGBH 4KTDL 1L6XA 4XI5C 2H9GA 4LSQH 1Y6MR 1DQDL 4MAYD 5KS9A 4YUEH 5GS1C 5TE6L 5B3JE 3K4ZA 1UB6A 4M61B 1KXQE 4RGOH 1Z5LA 4DKAA 4D0DA 4N5ED 3P73A 5CCKL 2ESVE 3UTPE 5I1IL 1S78D 1RU9L 3PV6B 4KKLD 2O93L 1YQ2A 1JFQL 2ZUTA 1J1OL 4U0RC 4YEFA 4HGWA 3HFMH 4L8SA 4PY7B 1R3LA 3DX6A 2ICCA 4OT1H 3VD3A 1SQ2N 2A38A 5MI0B 2BMKB 3I75A 1ZLVK 1UQSB 5TF1L 4JRYD 1CBVL 3KS0H 2I24N 4O9HL 3DO7A 3BEVA 3CFDB 2VDKL 2EYRA 3GK8H 3QQ4A 4LAQL 1NAMH 2A6DB 1JNNH 3LEYL 2GJZB 2NY7L 4PRPA 4HZLA 4QNPF 1AKJB 3EYVA 1DBKH 4JY5H 2HWZL 4DTGL 2C3HA 1L9MA 4DGVL 3OHXB 3B2UD 5JIPA 5D7JB 4M4PA 1FYTD 3VE0B 2V5SA 4PJXF 5EUOE 1PY9A 5JMOC 4NKDB 3TYFA 2AV1B 2DJ4A 4KI1A 3HE7C 5DUMH 4PRID 1NLBL 4PRNB 5T1LA 4LLQA 1ORSB 3PV7A 1BFVH 1S9WA 3QNYA 3ARFB 1H8SA 1VESA 4HIIB 4M9OA 2D0FA 5F7KC 5IESL 4YBHA 1T0NA 3KLHD 4LVOB 5CD5D 4MAUH 1EO8L 3KPMB 2BVEA 1A7RH 2OP4H 3MLPA 2D9CA 4S2SB 4GW1A 1A6WH 4ZUVA 1CL7H 1H0DA 2W65B 3CZJA 1AC6A 4ZD3H 5JW3L 4L4TE 2XTLA 2XQYK 1D5BA 5FF6A 2NW2B 5F9DC 5LXGL 4NP4H 3V0VB 3A67H 3L5WA 5JIHA 1Q8MA 2AJXH 3H7BB 2UZIL 3K2UL 4U6YA 3IJYB 2AP2A 2I60H 2R8SL 1RJYA 1AHWB 1QPPA 3MJ9A 4FQLH 3O8XC 2ARJB 5DEGA 3ULVF 3K8KA 5DQJA 3MLXH 1DQQB 2DQUH 2OMNA 2ERJC 2CLZA 5LCVH 5LG1A 2JIXD 5CAYB 4H26A 4LK4A 5KAQF 1V3MA 4QEGA 5D1ZA 4DGIH 3ALXA 1F90L 4HS8H 1TJGH 4PJGA 3RHWK 3O4LE 2AEPL 2XICA 3GB7A 3K8LA 2VSCA 1NQBA 3HC3H 2IFGA 3QJFB 4N68A 4RISH 3QUMH 4LARH 2JE8A 3MRIA 4YHYC 3MLZH 1WF5A 5E8PB 4YHLL 1BZ9B 5IV2A 1XGQA 4RSVA 5LWYH 1FGNL 1VFUA 2DKMA 3ARVA 3BDXA 3BISA 1CGUA 4NQUA 5ITFA 5GZND 1W72H 2ZCHH 4N8VG 4QKXB 3FRPG 4G80A 4TOYH 3B9VA 4K3DL 3TO4B 2DLTA 1MNUL 3DUSA 4Y8DC 5FCUH 3MV7E 2VXVL 2V5YA 3FFCE 2GY7B 5ALCL 1XR9A 4NO5A 4I77H 3H42L 4OLUH 2BY2A 1T2QL 3VDBA 1CFVL 3LS4H 4RNRA 3CLEL 3P4OA 2APTA 1HH6B 1VEOA 1LK3L 3GSXA 3U6RA 3PDOB 5C2UB 3S36H 1OTTC 3EFDL 2QQLL 3DURB 1CR9L 1D5IH 1UXWA 1AP2A 1FNAA 4ZUWB 1KN2L 4CU6A 3OJDB 3ARPA 3UJTL 5DVKA 1MJJB 3NIGE 2XI9A 3ARRA 2J5LC 5L88H 2Q76B 5H37G 4ZXBB 1AJ7H 1DQMH 1U8NB 3CXHJ 1U36A 3QXDB 4X7EC 3BUTA 5I1JH 4PG2A 5D7LA 3O11A 3KVQA 4PJIB 3T0WA 5GGTL 1MY7A 2DWEB 5IHZA 1DQJA 5E2WH 4P2QA 2IFFH 3U4AA 4ONOA 1QFWM 5C0DB 5JHDD 2B1HL 5CJQL 5ILTL 1XF3A 4ZAKC 1IAII 3BPCA 3HRZA 3SDCA 4NO3B 3U48A 2VLKE 4P5MA 2GCYB 5E8DH 1KG0B 2IQ9H 3QJHA 2Q3ZA 3QUXA 3ECBA 4XNXH 4PRDA 3QWRA 1UM6H 2YBRB 2ICEB 5C0BA 3TN0D 3WXWH 4ZQKA 3GSNL 5I1EL 2HRLA 4CRPA 1J5OL 5EORL 3V5KA 4PRHA 1CICC 1DUZA 1ETZA 2BY3A 4UNUA 2P8LA 2FO1A 3GFUA 2WBJC 3WJJC 2QQNH 1FE8L 4MXVE 4KQ4H 2VE6B 1XGTA 1YNLL 4U6XB 5EU6D 4ZTPL 5J1TC 3RWCB 3NTCL 4FABH 1C5BL 4L3ED 3PWPA 2Z31B 4ZUTB 5B8CA 5I74B 5I71B 5FHBH 5EBMA 3MR9B 4JCMA 3WNLA 1A3LH 4I2XB 2YMXL 5D9SB 5FFLA 1I7RA 4MJ5B 2BVUA 4MAYC 5I18H 5LGJB 3ZKND 4HT1L 4P4KB 2EDLA 5FGCE 3I3EA 1J8HD 4FQIL 3BQUB 4FZEH 2A2QT 1TQCC 1S78C 4X7TB 4KKLC 1K2DB 5EU4A 3TZVA 1GXEA 2DYPD 3KPRB 4F57H 3D3VB 2Z35B 4PG9A 4P3DB 3QIBA 2C5DC 3E8UL 1JE6A 3FQUB 4HIJA 4Y1AD 5I1GL 1M7IB 3FAWA 1YNKH 4HJGA 3MREA 4X9IA 1D6EA 1REIA 4KUCD 3RWJA 3IB4A 3JWOC 4RZCA 5FIEA 1AH1A 5I1IH 1C5DA 3REVB 3DWTA 1JFQH 4QNPE 3F5WB 1J1OH 2VXQL 5FYKD 3EJYD 3VA6A 3FMGL 3QEUA 3L3IA 1DBBL 5GSVB 5TF1H 4F9PA 3MFGB 3QRGL 3B2UC 4L4VD 5JMRA 2GTZA 3OKEB 2R1YA 3FQTB 1OP3H 2VDKH 2NLJB 4FQPA 4R2GB 2PYEB 4KVCL 2VDLL 3BPNB 4LF3A 3I9GL 1AY1H 3HNTL 1QFUL 3IVKA 4PJXE 3LEYH 3T65A 3SN6N 2NY7H 1LNUA 5EBWA 1JRHL 3T0AA 2EDTA 5HXMA 2E7MA 4EI5D 1UWGH 3MJ6A 1IGTB 3W9DB 4D2NA 4Z7UF 2X1PA 3PJSB 4WENB 4YDVA 4H20H 2ZOLA 3BGFB 5GSRA 3BO8B 3LSOA 2YUVA 5IQ9B 5CD5C 1E27B 2X5PA 4KROD 4PUBH 1LE5A 5E1AA 5EU7C 3SDDB 3V52H 1FZMA 2E7LA 2GFBB 2L4OA 5C2BL 3B4NA 5BV7B 1NLBH 3UTSE 4LSDA 4UIMB 4YHNA 5E94A 4OM1H 3DRQB 5D8JL 3ZZ1A 5I8OH 2CO7B 2AJSH 4PLKD 1CU4H 5IESH 1R3JB 5L7XH 2BY0A 4GFTB 1MHPH 1NEZB 1S7UA 4MNHB 1NGXA 3OV6A 1CVRA 1EZVY 4IRSD 4WFEE 1NFKA 3U7WL 4WI3A 3NCMA 4U1LB 1MH5A 1RUPL 3TVMB 5GZOD 3FQXA 4U1MB 2CIIA 1ND0A 1ZLVH 2VTFA 5CINH 1RUAL 5JW3H 2W38A 1E4KA 5J7CC 1QR4A 4HX1B 4NM8L 5LXGH 4JZJA 1KT2A 3HI1A 1L7IH 1AD0B 1K4DB 2ZCLL 1I1YB 4JRXB 4Y19D 4LBEB 1UXSA 3UTTA 5BS0B 4GXUN 2B5IB 1CICB 3ALPA 4K7PL 3MJ8B 4WFHD 5F72S 3HZMB 1IGFL 4K71B 4OZFA 3D39A 2EYTA 4JRYE 1OL0A 2BJML 4KUCF 5GZNC 4K9EL 4NDMB 4HG4J 2VLJD 1I7UB 4OUUA 1FZJB 1YNTB 4I0PB 3MA7A 4M6AA 4R4FL 3UJIL 3ZMRA 3PWNB 4YHLH 3VGHA 5E1HB 3E6HA 4GG8A 3UO1L 4FQCH 1GOGA 4EVNA 5DD1H 2P5ED 4NNYA 5HHOB 5DGRA 2FYYB 4I3RH 3I02B 4WI8A 1FYTE 5F7DB 4LSVL 4CL7A 4K3DH 4X6EB 4NZJA 5GIRA 4Y4HA 2QSTA 4U1SB 5D1QD 5D7SL 3OXSB 4BSJA 5ALCH 5DD5L 1NLDH 4PRIE 3TJHD 1OAYL 3H42H 1T2QH 1CFVH 1NAMA 3MRFB 2VKWA 5I19L 4R4ND 1LEIA 3VXMD 1NMCB 3W5MA 3EFDH 2QQLH 1CR9H 2JELL 5DJDA 3HS0A 1XCQB 1KN2H 5EU7E 4OD2A 5ANMA 4I9WD 1H9VA 3ARDB 1JNHB 4G42A 5MENA 3VRLF 4Z95L 4HBQA 2J88H 1LO5B 5EBLB 2J8OA 1V3KA 4OFKA 2OI9B 3IETB 2JB6B 2FB4L 2VUOA 1BM3L 3MRDB 4LDOB 3D48R 4WHCA 2LV4A 3W11D 3FQRA 3MRRB 3OPZH 4FQJL 3MV9A 5I8CB 3BVNA 1JPGB 1LEKB 5EDXA 5IB5A 4JM4H 3RDTB 2FIKA 2V6HA 5CBAB 1PKOA 2B1HH 5ILTH 4YC2C 2I9TA 1I3GH 3C6LA 5ISZD 3FT3B 4MCZA 1TPXC 4LFHD 3MSPA 3WFEH 5IG7B 3BN3B 1QNZL 1XH3A 2ZP0T 4L29A 4KFZC 3MO1B 1EEYB 5E2VH 2C1OA 1JGUL 1CQYA 4BFIA 1EO7A 4HKBA 3LS5L 5K9KA 1J5OH 5EORH 1GGIH 5ICYB 1S9KC 1WSST 1E4WH 1MCJA 1ZTXL 4G6MH 4D0BA 1I3RB 1FE8H 5F1SA 3T0VA 4Y5VA 3ARGD 4NN7C 4X8XA 3ZKNC 1HHIB 4GG6A 5HYSG 1MHEB 3SGDI 2HJFB 2PO6A 3STLB 3QI9B 1FC2D 2X09A 2B1AH 4M8QA 4KRPB 3BRGC 4MD0B 4G6JH 4M7JL 1U2CA 3SDXB 4OSUH 1BX2A 3KXFB 2H26B 5C0NC 2AJZB 4UZGA 2X1OA 2YEZA 2J7LA 4BUGA 5E7BA 3QUMA 5C08B 5FGBC 2BNQB 2YZ1A 43C9A 1C8PA 2VLRD 4DCQA 2F15A 4MVBD 1VACB 4A6YH 3ILQD 1ZOXA 4C56D 5TDPB 4F7TB 1W72A 4JG1H 4XMKL 1CD1A 5HGBB 3JUZA 5GGSB 5CEZD 2YR3A 4MDIA 5E9DB 1F6LL 3T08A 4R7NB 2NXZB 1JHKL 5FKAA 2PUQT 5F96H 2DQHH 1UM5L 2DB8A 5I1GH 1WBXA 3ZTNL 4UINH 5C0FA 4R26H 4NO2B 3VFRA 2G60H 5JOFA 5E0QA 4RGNB 2AEQL 2C7UB 5JHDE 4O2CA 3MUY1 4K3HA 43CAB 1XIWB 3WD5L 2VXQH 1FN4A 4HCRL 5HGAA 1V7NL 4EI5C 4LSUH 1DBBH 1HINH 2VXSL 3GMMA 3MOBH 2QLVB 1TIUA 2W9EL 2XA8H 3QRGH 4UUJB 4Z7UE 4IMLA 1VKXB 3G6JF 1OAKL 4EOWH 4MDJA 4KVCH 4X7FC 2ZCKH 3CUPA 4BQBA 1G9ML 4HUMB