5D6DA

Crystal structure of gasdalie igg1 fc in complex with fcgriiia
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
209
structure length
209
Chain Sequence
AGPDVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPLPEEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Structural characterization of GASDALIE Fc bound to the activating Fc receptor Fc gamma RIIIa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d6dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d6dA01
2CRYA 4AL8L 3NZHH 3LEVL 1DBKH 1DVFB 4I2XA 4NZRH 1JGVL 3ULVF 2ZSVB 4HGWA 1SBBA 5BW7C 1P7QB 5BZWA 3H9SD 1RHHA 1ULVA 5J13C 5D71H 2GJJA 3DVNB 3DTXA 3DWTA 2EICA 1ZLVH 3VXSA 3BH8A 2MJWA 2B7DT 5D7JA 3B3IA 3IXAA 2A1WL 3OPZH 3AXLB 2H1PL 4QF1A 1ZK9A 4TVSa 4X6DA 3QDJA 5HHOE 4PB0L 1MCRA 3OKLB 1T1YB 3IDYC 5AUMB 3MUZ1 5HHVL 5GJSL 4WEBL 4U6VL 1TCRB 3T2QA 2DI9A 1Q9OB 4NQEE 3MRDA 4U6XB 3RP1A 4LCWE 4PP1D 5C6TL 3AMLA 1DQDL 3ILPB 4HEPG 2XOTA 1A7OL 5F7EH 1AGDB 2APWA 1W8OA 1G6RB 3GSWB 4K55A 2ADJA 3DOSA 5J7CC 3ZL4L 3D39E 4ELMA 1BD2E 1BM3H 5ICYA 4PV9B 3BP6B 1U8LB 2VH5L 4GQPH 3D3VD 2B0SL 2BVOA 3AS0A 2XWTB 3PHQB 4OUUA 2QL1A 2QQNL 1DBMH 1CYGA 4POZC 4P4RB 2GJ6E 1HQ4A 3O3DA 1ZTXL 3SKOB 4NGHL 1R5IB 5C09E 5LGHH 2DB8A 2GSIA 3E1F1 4DN3L 4L5FL 2YRPA 4UDTB 3PGCA 3I6GB 2HWZH 3BPLB 3LS5H 1X4ZA 3GMMB 3BUTA 2CIIA 4WHTB 3SCMD 4YJZL 3ULVD 1U36A 3QHFH 4WGWB 2PYED 2VDLL 3ECBA 5CZVH 1UT9A 5C08B 3QIUB 1A3LL 1NEZB 3MFFA 4JRXD 3KPLA 2A9NH 1NSNH 4PJDE 4XT1C 4XX1G 5DUPL 1A3QA 2Z4QB 1MCEA 4X5WB 4LU5H 3O6KL 3TWCH 2CD0A 3OXRB 2ESVD 2DTML 2EKSA 4Y4FC 3FONB 4CADB 4TOYH 3DV4B 3TNMB 1CQKA 4NCC1 1QSED 1U6AL 5ITFB 3SE4C 1KBGH 3MNWB 4GQ9H 5EUOB 4G6ML 4X9FA 4HF5H 1BAFH 1S7SB 5IROA 4MCYA 1S5HB 3QAZC 4M1CC 3QEQE 3UEZA 3JZ7A 4ACPA 3IETB 3MV8B 1OAXH 5I1CL 3WFEL 3C5ZA 3WLWC 1PJ9A 5K9KB 2BSSA 4HMDA 2IQAA 3MGOA 3GMOA 3C2AH 4X7DC 4X6CA 4LLWB 3QWOA 4AG4L 1OAYL 2MSPA 5L2JA 1QTYT 5I71C 3HUJB 2VLRE 4X7TB 5K9JH 3ZO0A 3KS0J 4WW2B 5F70A 4OGZA 1HHGA 4R90L 1NLDL 4OCNC 2B1HH 1BJ1J 1C5DA 2D7OA 4H20L 1U93B 2KDGA 1YMHB 2CDEA 3S88H 5ICZA 5EULV 1MLBA 4OCRL 4JDZA 5GGVL 3UZVB 1XGPB 3U46B 5HYJD 1NMBH 3P0VL 4JZJC 2IEPA 5HI3D 2Y6SC 1YJDH 4OLVH 5KVEH 4HIXH 2FATH 2NCMA 4X4YA 1XT5A 3HPLA 5EOCL 1UA6L 5AYUH 1G7HA 1FG2A 4ZXBB 3OKOA 1CFSA 5DHYA 1WAAA 3GNML 4N5UA 4XC1L 3U36A 5HHPB 2MPAH 3BP5B 4P2QB 1T2JA 3KAAA 4OZGF 5CZXD 3QFJD 1DQTA 3GSNB 3NFNA 5C3LD 4KQ3H 2PR4H 3HR5B 4TVPD 4Y19E 1A0QH 1MFAL 1J7VR 4Z8FH 4PJ8D 2W0FA 3TBTA 5BO1H 2VL5A 3W9DA 3KPPA 3T1FA 2UWEF 5A3IC 3SKUD 5FYLE 4PS4H 1LEKB 3C09C 3Q1SH 5L8LB 3QUYA 1GZPB 1IM9B 1JWSA 4HIHA 3SDAC 3RWHA 3TZVB 3P4OB 4CUCA 3QHZL 2PXYB 1C12B 2VABB 3K81A 4YX2L 2ZUVA 3FT3A 3GHBL 4M6AA 4U4BA 1FBIH 3SOBH 4PJIE 4BFBD 2AJZA 2DF3A 3RPKA 3I6LE 2YD1A 3MA9L 2I9LB 2R56L 1PY4A 4N0FA 3V0VA 3G6JE 4HCRA 2D7QA 3OAZH 1HINH 1U2HA 5IB1B 1P2CB 2R0KH 5CJQH 5IB2A 4FQCH 1T21A 1VGEH 5LKNA 1CT8A 2C5DC 5EORH 2F54E 1T6VN 3O4OB 1KLUB 5I30H 1VFUA 3OKYA 4UV4L 3QIWC 1ZT4B 4ZMAT 5KTEH 1N6UA 1KJ3L 4PY8J 4OD3H 2X1PA 3FN0H 4IS6B 3HA0A 1MFBL 1KTDA 2M2DA 4JREB 1U3HB 5BS0E 4RGNB 3ZE1F 2ZSWB 3WS6C 1PZ5A 1X9QA 3F58H 1G7QB 1TVBA 5DD1L 5GS2D 4BFIB 1JF1B 5CILH 3BWUC 1A9EB 3OHXA 3WYRA 5ESQA 4G6AD 2BJML 1JNHA 1NFDB 2A83A 2NPLX 3M1BA 4HXBL 2ICCA 3VA6A 4WGVB 4PRDA 2D3VA 3BZFA 4WFFD 3TBYA 4KVNH 5CEZD 3U4EA 1QFOA 2XIDA 5JO5A 1F4XL 1HK6A 4JDVB 5I1JL 5HI5C 1HZHL 4X7FC 5BRZE 5ISZD 4RMRA 2YWZA 3BKJH 3BZ4A 3T8XB 4P2OC 3SDXF 1QHPA 5TE7L 3RDTD 3L3IA 4AL8H 2FO4A 2VDKH 3LH2L 4L3ED 1WT5C 4AMKL 1JGVH 4CMHB 4P23B 4LEXL 3WS3A 3LPWA 2IBZX 3V0WL 2DL2A 4UBDD 4LCCA 3HE6D 4OD1L 3V7MA 1ZVSB 2ID5A 3C5JB 4XTRD 4P0DA 3AC0A 4PG2A 5ESVB 1B90A 3NA9L 2A1WH 5D72L 1CCZA 1RZ7L 3PGDA 1ZLVK 2BMKA 4PB0H 4Y2DB 3DPBA 15C8H 3DVIA 5CP3H 3C6LD 3UTTE 1T5WB 3MLSH 3TPKA 3LEXB 5HHVH 3A6CH 5GJSH 4WEBH 4U6VH 4PRAA 4HMEA 1AGFB 4YHOL 1IJ9A 1DQDH 1QFPA 4HJJL 2R4SH 4Y5VB 4JEGB 5I1KL 5E0QA 3NZ8B 3E6FA 3AU1A 3EYQD 3MGTA 4XH2B 4ZFFA 3ZKMC 4NSKB 1UB5B 4OM1L 1Y0LB 5DJAB 3EJYC 3CZJA 4BA8A 4UQ2A 3ZL4H 3QNYA 3KPNB 5IHZB 4XPAL 1W72A 1HH6A 2J8UA 2VH5H 1DQJB 3MRJA 2WMPA 4XMKL 2B0SH 4XXDB 3QEUA 4HHAB 4J7RA 4G8IB 1FAIH 3EO9L 3DMMD 5A43C 1VEPA 4PRHE 4HGKC 2X1OA 3OKNB 2QQNH 4GG8A 3UTSE 3MOAL 2FECI 3W9EA 4RGOL 1ZTXH 1ADQL 4ZTPL 4NGHH 5HDQH 3B2UC 5E8EB 1UM4L 3QO1B 1FNEA 2A2QT 4DN3H 4L5FH 4POYA 3IFLL 1YY9C 4J4PC 3QWQB 3B9KA 5I6XB 1NCDL 1A4JA 3D85B 2MTPA 1KB9K 1OGAD 1RURH 4F9PC 1NCUA 3GMLA 4KK8D 2A74B 4ENEC 4MAYC 2VDLH 3H8NA 3RGHA 5E08L 2M8XA 4M00A 1A3LH 3P4NB 4BSWA 1IL1A 1U8PB 1T80A 2OQJA 5DUPH 1BVKA 4Z7WF 3BRGC 4L8SC 3WMSA 4M3JA 3O6KH 4H88L 4KRLB 2WP3T 5ACZB 1AGBB 2DTMH 1INEL 1YEGL 4IOIB 2FEDC 4KKAD 5EZJB 4BH7A 1A6VH 5C07B 3ARZA 4KJYB 1U6AH 1DUZB 2G5BA 4XMLH 1NGYA 2GYSA 4F7CA 4YWGL 4G6MH 3UMTA 3FQNA 4HKXB 1CTNA 3NAAL 4PRIB 5I1CH 3GRWH 4X8JB 4OZIE 5EU6D 4APQB 4PGEA 2YPLA 2HP4A 4MJ5B 43CAA 4LEOA 1KIRA 1PQZB 2R23B 4AG4H 3CDGB 5FB8B 1GOFA 3VDAA 5FKPB 3V5DA 1EH9A 1F6FB 2C1PB 2HT3D 4R90H 1NLDH 1NC2B 3D69B 1JPTL 4H20H 3QZWA 5KSAA 4H5SB 3PGFL 4OCRH 5GGVH 4Z77A 5FGRA 4X6DF 1R5WB 5SWSE 3OR7B 1YDPB 5IOPA 5IVNA 2WWMC 4ZUWA 5FYKH 4LLYB 1OLLA 2NY0C 2XYCA 1PKQA 3NTCL 2APXA 4OBRA 1OF2B 4RCAA 2C3HA 4TPRL 3TP4A 1UA6H 5T1LB 3MV9A 5GHWL 4XCYB 2R2CA 5ABDE 5KOVC 3TFKC 1CD0A 5F3HA 3WJLC 3GNMH 3L6FA 3PWLA 4BK4A 4EUPA 1OAKL 4HUUA 2DAVA 4P9ML 3ZKXB 5F9JA 4LCUB 2P5WD 2A6IB 5D2NB 3G6AB 1S9WA 3LHPL 4ELMF 4LMQE 1R3HA 2BNUA 1E4KC 1A9BA 3H2WA 1BZ7B 4DUVA 1IAII 4XCEB 4OB5L 4MQTB 2A6DB 4KHXH 4K3DL 1JHLL 3U0PB 1A3RL 3T0WA 3UDWC 2A73B 1S7RB 5GSRA 1XGQB 2DM4A 3GSQA 3QHZH 4RFOL 5IESL 3QDMA 4EQ2A 2P42B 5D70L 1IGIL 2OTUB 4YX2H 1T1WA 4YK4B 3GHBH 2H26B 5HVHB 4MXQD 1IMHC 3Q0HA 5BVPL 3OF6A 1MQKL 5HPOA 3HB3C 4TSAL 5T1DH 2WBWB 1MEXL 1U8JB 3CXHJ 5D7IB 4QRPB 3WIFB 3HMXH 1CXKA 1KLGB 2R56H 2A0LD 2Q7YA 4PY7A 5EG6C 3GGWB 5B39A 3VXSD 3N1PC 4QRRE 1N2RB 5D7JD 3RVVC 3UPCA 3I3BA 4DOHE 5BJTA 3BO8A 3KLAA 3SPVB 1PVHA 4J3OC 5JLZA 3ZDYF 1G9ML 1LWRA 5CWSB 2ORBL 3WUWA 1QSFD 4XPGH 2HT4C 5AWNH 3UC0H 1T0MA 1FZKB 5E94A 1KJ3H 2VXTL 4C56A 5I16A 1MFBH 3MUGB 4CVZA 1AD0A 4YFLF 5KSUB 3WHE1 4X6CF 1IGJB 3HRZA 4Y1AE 4J3SA 5DD1H 1Z9OA 3SDDD 3LN4A 4PLKD 3GI8H 3SE9L 2BJMH 3O3BB 3MLTA 2NLJA 2IPTL 3VFUB 1MHEA 5HJ3A 5C86A 1QSVA 3FQRB 4G43A 3GEWB 2WAHA 5GGSB 4HD9A 2X4NB 3CXHK 1DN0A 4KV5F 1F4XH 4CW1B 3RQ3A 4GBXD 1R5VA 32C2A 1Q9LA 3S97C 5FAAA 4GMTL 3LRHA 3UYPA 4FNLL 3KYKL 1P5UA 4ODSL 4Z7UB 1VEOA 3ZTJG 3EDJA 5H2BA 3B43A 1J8HE 3O9WD 5TE7H 2IANE 1EGJA 3HC0B 3VXQB 2OK0H 4AMKH 4G8FB 4NQDE 4LEXH 5KZCB 1ED3A 3KXFD 2K1MA 3VD4A 4AM0A 3CMOL 1NAMA 3OKDA 4OD1H 3TVMD 4PJXA 3F7YB 2BVYA 4WFHD 1BFVL 2NZ9C 5IW6B 3DX6A 4HUXB 4KDVA 1ROWA 1DEEA 5D72H 1RZ7H 1FNLA 2AK4D 1DBJL 4P4KA 2ITDA 4QRTA 4YFDB 2O5XL 4HWBA 4OQTA 2G75A 5GRXG 1A6UL 4YHZH 5DMYA 4GFTB 3GMRA 4BQ8A 25C8L 4QHLB 3TYFA 4F80A 4Z5RA 4CN4A 4UINL 4TN9A 5D2LA 2Y1VA 3FFCA 4U1KA 1HH9B 3RNQB 4HJJH 4RGMB 5AZEL 5I1KH 1J18A 3QRFM 5CSGA 4NO3A 3IFPA 1FFPB 5CEXB 1B4JL 5FUOH 2XNAB 2GTZB 3HLAB 3GB7A 5BV7C 4OM1H 1CDHA 2OZ4A 5HGHB 1HHIA 5H35B 3ROLA 3GHEL 2UVEA 4JVWA 1HI6A 3Q48A 5CP7A 3BP7A 2N7BA 2XRAL 3PDDA 5JMRA 1MHCA 1LD9A 4XPAH 1D5IL 3CH1A 3IFOB 3UPAA 3K7UA 4XMKH 2VDNH 3EOAB 1Q9WA 3B9EA 3QUXB 1DQQB 1CE6A 2Q76A 1NGWA 4JFFA 2ZPKH 4K7FA 4CBPA 4PRPE 2FIKB 1GGCL 2DOCA 3MOAH 4PJGE 4ZNEA 4JFYB 4RGOH 4QXTB 1MJUL 2V7HA 1ADQH 2AP2A 4ZTPH 5T3ZE 5DEGA 3WUZA 1MHHA 1UM4H 1UJ3B 3QWRD 4Z7VA 1F11A 1FJ1A 4NQCA 2Q6WA 1TJHH 4X5LA 5KS9A 1NCDH 3CVHL 4LLDA 1R24B 1V3LA 4PJFF 4ZO8A 3G5VA 5D93B 5JNYB 2D2OA 2CO7B 4PTTA 4IRSA 5DLML 1D9KD 4PGDA 3GSOB 4Y4HB 2XQBL 5C1MB 2C3XA 3PWPA 4M8QA 2B5IC 3I6KB 4WRLA 1F3JA 3FT2B 1C8PA 2YWYA 1OOAA 1LP9E 4H88H 2GY5A 3UBXG 4E42A 4PJCA 5EU5A 1INEH 1YEGH 3KLHC 3ZMRA 1VPOL 1HKLH 3F6LA 3MMEA 1JPGB 3IRPX 3SJVB 2CUIA 3K3QA 4NKDB 2YSSA 3ZYIA 3W81A 3MRQB 4CKVX 1XCQB 4YWGH 3QUYD 1HSBA 3MCG1 1ORSA 4NQXB 2I5YL 5EOCJ 3F7RA 5HVWA 4XWOD 3BQUA 1FNHA 4L8DB 4ZTOL 3B6SB 3ROOB 4N0RA 5F1NA 4FA8A 4JY5L 5IEKB 2YK1H 1VFBA 2AXJA 1OSZB 2IPKB 3U4AA 4UT6L 1G7LA 2DM2A 5HHMD 2RFXB 5HDBF 3C08L 5FK9B 4FQQB 2G9HB 1AO7A 5D1ZB 1PG7H 1UB6A 1JPTH 2WBKA 1DCLA 1L6ZA 3PGFH 5EO0A 4FFYL 3MYJA 3P40A 3KYOA 3P0GB 4QY8A 5E1AB 1FORL 1AXSB 3HC4L 1Q94A 3IB4A 1T5XA 4F2MB 4GJTB 4KRNA 4U1LB 3L3DA 1RI8A 1S7UB 3ZDXF 4P57A 1S9XA 3NTCH 2DQHL 1CFQA 2Z91A 4JFXB 2BNRD 1FRGH 5EU7E 2FZ3A 4U7MA 5KSBB 3IAQA 1AD9B 4RDQG 1U8NA 3MBEB 3RGVC 2LVCA 3LKNB 4I3GA 1WZMA 4GKZB 5CJOL 4RFNC 4GRLC 4JY4B 5F9AC 4FQHA 4GKOA 1EK3A 1YEDA 5E2JA 5FO9B 4M48L 3ZSSA 2X7LA 4P9MH 1UYWL 4G42A 1KTRL 3TIEA 5F1IB 1I8KB 1JK8B 4KK6C 1KCLA 4YEFA 1AHWC 1ONQB 1YECL 3LHPH 4I2XE 1OW0A 1K5NB 1YMMB 2WLZA 4FFZH 3Q5TA 4OD2B 2GITB 4EEEA 1PEWA 4QOKA 2J8UF 4YDVB 4KMTL 1S7WB 1ZLSL 4GT7A 2BSED 4OB5H 2NW2A 4K3DH 1JHLH 2QQKH 2UVFA 1ZT7B 2V9RA 4YXHL 1R3KB 1EERB 3BKCL 4PBWD 4RA0C 2I07A 1F4AA 1VKXB 3FO1B 3LN9A 4PD4K 2NY1D 5IESH 4QRUB 4YDIH 3LEYL 1EHLL 1WIPA 1CG9B 2JIXD 5D70H 2MKLC 5HHQB 3VRJB 1KN4L 5C0AB 3PDOB 4LMQI 3OWEA 5H94B 2WUBH 3RWFA 2ICEA 5CJ5A 5BVPH 4UIMB 1Q72L 3DX8B 1CDBA 3FRUA 2QEJA 3T0EB 6FABL 1MQKH 4MA7L 4TSAH 4XAKE 2PNDA 1MEXH 1OB1A 1CE1L 1ZHLA 1KULA 2AQ2A 2IMMA 4HV8B 1HDMB 4PUBL 3DROB 4GSDL 1AKJA 4KK9C 1M71B 4UU9B 4M6OL 1VFMA 1CN4A 2D0FA 2JK5B 4G9FB 4KDWA 3SY0B 2IADB 5LQBL 1KTLA 2H6PB 1B0WA 3P3YA 1P4LB 2EIEA 1BOGA 1A6TA 4ZOAA 3HI6L 5ESAB 3LKQA 3VWKB 1G9MH 1H5BC 2DYPA 4DKAA 2ORBH 4TSCH 4YXLL 1YEIL 3QH3A 5FYJE 2NY3D 1M6OB 5IVXA 4JFQA 1S7VB 1OAUH 3B9VA 2VXTH 5FYLL 1VGKB 3O41A 2EDBA 5SWQB 2DQIL 4P2YA 5T3XL 4I4WA 1U41A 3LKSB 3GKWL 5TQ2H 4FQLH 1QPXA 1ZHKB 2OSLA 3UBXB 2HAZA 3RWGA 5D7LE 1UWEL 2E6QA 2FD6L 4BSVA 3P9MB 3PDGA 1JPST 1YPZF 3L7FB 5EU7C 4KC3B 2D31B 4EZMA 3FB6A 2OTWB 4NUJB 2P7TB 5KSVB 1EEYA 4MAUL 2ARWA 1V7MH 1S9KC 2VDPL 5ID0B 1NDMB 3DO7B 3QNXB 1FVEA 5J89A 4FNLH 1UWXH 5SWZA 3I84A 2FH6A 1GJIA 3DRTB 3P11L 5C0RL 1VSCA 4O00A 2VIRA 3CFBA 3K4DA 3B9KD 3DV6B 3O4LB 3N06B 1CIDA 4I18B 4M7LT 5GS0L 3UTQB 5MEOB 4TNWK 2XWJA 2VO5A 3CMOH 3VFWB 4JGJA 3MRFB 4UAOC 2H2SD 2BSRB 2XACC 2XXMB 5CSBA 1N8ZA 2IMNA 2VQUA 1EDQA 1EJ6A 1SJHB 2P24A 1DBJH 3CSGA 1OL0A 3KGRA 5JQ6L 3KPRA 4E41B 3FOLB 4P5TB 3QNZB 4Y89A 4OSUH 4EI6A 25C8H 3T77B 3EHBD 4KROD 4CMMB 4M62H 1HYSC 3N85H 1ZXQA 2CLRB 3R06B 4NO2B 4WUUE 4JANA 1WCBB 4D0BA 3LMJH 1U8QA 3BKYH 5H37G 1OP5H 3MLUL 3N9GL 3VXMD 3BHBA 4TTDD 2NQCA 2VDRL 1BLNB 3INUL 5F7NC 1NCBL 4NP4H 1UGNA 2EYRB 1HHJA 2XRAH 3VD3A 2FB4L 3EFDL 1F2QA 1D5IH 3R4DA 4L4TD 1BJMA 3BXNB 1BGXL 4L4VD 2C7UA 2VLKD 5L8JB 2B39A 4F33B 3ARVA 3Q6GH 2HTKC 3O3EB 4HBQA 1T22B 4G8GD 4ZFGL 3VGGA 3BESR 1GGCH 3NCFB 4O02L 5CKGA 4NBXB 2DQTL 2P46B 4JFHE 1MH5A 1MJUH 2MCPL 1XF3A 1R6VA 3GMNA 2YC1B 3QB7C 3VJ6B 3JTTB 1U42A 4NN5C 4M6ML 1MFCL 2VITA 4YHNA 2AJUL 3CVHH 2YPKA 3S35L 2W60B 3QCTL 1QD0A 5FM4A 4KKCD 1MF2L 4MSWB 3ARED 3J7HA 1KJ2A 4G6KL 2BY3A 5DLMH 3T1WA 5FUCE 4HUKB 2ZJSL 1K4CA 2FRGP 2XTJE 2GCYB 3E2HC 5T5NF 1PGRB 4DCQA 1OWRM 4NUGL 4WI4A 4D9LH 2JJTA 4E5XA 5JHLL 1C7TA 2XXCB 4UIKL 4WI5A 4ODHL 1NMCC 1SYVA 2DJ4A 4IRJA 5KVDL 3GDBA 2DD8L 1CLCA 5E2WL 2AJ3A 3PHOA 3TNNB 5I75C 5HXMA 4EKXA 1VPOH 1J0YA 2J4WL 2X10A 4U0QB 5IROC 5D5ME 4LLVB 1DSFL 2CLVA 1JUFB 4JFZH 2I5YH 3QI9A 1AIFA 5HHNA 4EI5B 1FYHB 4ZTOH 4JY5H 4XVJL 5GS1A 3QDMD 5B3NA 2ZUTA 3WDHA 3DIFA 3QFDA 4L9LA 1EHAA 3C08H 1IAOA 1HILB 4GW5A 4UTAL 4YEEA 3HG1A 1A6ZB 2KH2B 4GG6B 2ZG3A 4M9OA 5JHDE 4Q6IB 5E9DD 1IKFL 4WHYH 4R96B 1CXEA 4FFYH 2RCSL 3RPIB 1JHTA 3G9AB 4RA3A 4N0CC 3DBXB 4NC1E 3EYOA 4WWKA 1FORH 5DHXB 3HC4H 1KJVB 3PWUA 4QRQB 3N1QC 4D9RD 2R1WB 4QHKJ 3UTPD 1D5ZB 2WIMA 1H0DB 2DQHH 2EDXA 1EEQA 2W38A 4EN3A 3U6RA 4QXGL 4MJ6A 2VXQH 1W8NA 3V7AE 1YEHH 1JGDA 4HMCA 1BBDL 5F3BB 3ARBB 1XIWA 4YZFF 3QDGE 1JYNA 4U1GC 5CJOH 2F53A 3HAEG 2PTUA 3DX7A 4LLUB 1DZBA 2XN9B 4M48H 5EUKA 4X6FB 1H15A 2VTFA 1RK1A 4X6EA 1RUKL 5EC1A 3GIZL 4I0CC 1YECH 2PYFB 1AR2A 1FYTD 2NR6D 2VLJA 4KMTH 1ZLSH 1I3GL 3G08A 3GSXB 5IEHA 1U2CA 1Q1JL 4XBGA 4LCYA 3RUGB 3BKCH 1P7QD 3LD8B 3UAJC 5IG7B 2LU7A 5DC0A 5FUCC 3CVHB 2XTJC 1YUHB 1FZOA 3LEYH 2J5LB 3EO1B 4HUWB 2XKNB 4Z7VF 5EOQL 3O6MH 2PW1A 2E6JA 3IDGA 1KN4H 1ITCA 3DRQB 1DBBL 4HKBB 3ZHKA 1MQ8A 1GCFA 3SGEH 5J11B 4I77L 4MWFA 1K8IB 6FABH 4MA7H 4OF0A 3T2PA 5C0DB 2R9HC 3GRWA 5C0BA 1CE1H 3ZLQC 4YQXL 1NUNB 1F4WL 4FFWD 4GSDH 1CK0L 2BCKB 3U79A 1SJEB 1ZOXA 2YA0A 2MHAB 4M6OH 4CGTA 4QHKI 3MTRA 4MVBC 4Q6YA 4IMLA 2DI8A 1JTTA 5DK0B 5KAQF 4AK1A 5LQBH 2GTWA 4PJCF 1VCAA 3BMWA 3G5XB 4JGUA 1MCKA 3HI6H 3RTQC 1ZWIB 2ADGA 5EU4B 5GRWA 4IM8A 4M03A 3SE3C 1YEIH 1LEIB 5L2KA 5FGSA 1S3KL 1UZ6F 5EN2B 3PL6A 2V5MA 5FYLH 5DD6B 3IAPA 1INQB 3D9AL 5B3JE 4TUKL 1XF4A 4YDJB 3WNLA 1E28B 5BCAA 2DQIH 5L8KB 4NC1C 4CN6A 3R0NA 5DJZA 2YXMA 1YEFH 3GKWH 3QQ9D 2IAMA 4WO4A 1D5XA 1T89A 3ZTNL 4ZYKA 2X9XA 1UWEH 3NMEA 1VERA 2FD6H 5DJYA 1MELA 3HMWH 2NY4C 3DYOA 4N5EC 1A1OB 4PB9L 3P4LA 3REVA 1A2YA 1P5VA 1EV2E 1X6LA 4V2CB 4PJDB 3R1GL 4ODTH 1NCNA 4MAUH 1WEJH 5DSCA 3EBAA 4YXKL 1FL5A 2VDPH 4FQXD 1M7XA 4KXZI 4JFFD 4M93B 5TDOA 3DXAA 3U0TA 4ONHA 3NIFF 4G80A 3NABH 5GIRA 5C08D 3MJ8B 3UYRL 2RQ8A 5D1XA 4LF3A 4PJAB 3BP4B 4OFDA 1QR1B 1D3CA 2KUTA 5JPMA 2D7PA 3P11H 5C0RH 5DD5H 3VWJA 1KB5B 1RZKC 1MRCL 2JJVA 1UWXK 2Q3ZA 2VMFA 4XPTL 3OG4B 3QXAB 4OI9A 2R0LL 3TBWB 4S1RL 2VXUH 4HIJB 4L8BA 1DANT 4PG2C 1U8IA 2DL9A 4MS8C 4IRSD 4P46A 5C0NC 1WZ1H 2P1YA 5D4QA 4J3XA 4AJ0A 1MSPA 2EDTA 3PWPD 4X7CC 2JTDA 3L5WA 4NWUL 1YEJL 4WI7A 5JQ6H 4U1JA 3HMXA 2BXZA 4F9LA 5M94B 1SVZA 2RGSA 4FTVA 4QTHA 3VA2C 1BFTA 3SDCA 1RU9L 2WANA 1OTUC 5IB4A 4D8PA 1T03L 3QQNA 2R0WL 3BQUD 4HSQA 4KTEL 4R97B 2VUOA 3MLUH 3U2SB 2NY6C 4L3CA 2VDRH 3C60D 1I1AD 4YC2B 2JCCB 3INUH 1OP5K 1NCBH 3WKML 2BVPA 3U9PH 3MV9E 3VGEA 3Q2CA 5DURB 5LBSH 3OGCB 2FB4H 4NYLB 4LQFH 4NO5A 4YAQB 4O2FB 4LPWA 3HZVB 4YO0A 3MRIA 3OJDB 1JI1A 3MV7B 3SQBA 2P8LB 1IT9L 4JFEA 5HGDB 3ARGA 4ZFGH 5HGAA 4O02H 3GJEB 2DQTH 1ZSDA 2OCFD 2PO6A 4OLEA 2MCPH 2YA1A 4MX7B 1GPOH 3KR3H 1CU4L 4GS7B 3MRGB 4K2UL 4PJEE 1NFDF 3OKMA 1BJ8A 1MFCH 4HJGA 2AJUH 5MENA 3VXUB 3S35H 2GHWB 3I3EA 3QRGL 3QCTH 5DMIL 3S34H 4DJMA 4LARH 2R2BA 5DJ2B 3QHTC 3RY6A 1RULL 2F74B 2PCPB 3PQYE 5C71A 3V52L 3NACH 4Y5XA 1X5YA 5IBTL 2ZJSH 2ZCHH 3SGKA 4JAMA 4QCIB 3O8XA 5FGBA 3HZKA 4NUGH 2L7UA 4LASL 5INDB 5IR1B 5JHLH 1MCOH 4UIKH 4ODHH 5DUBB 1PYWA 5KVDH 5I76B 2FR4B 5E2WH 4PJ7A 4JPVH 1LQSR 5C0CB 5HGBB 3SDYL 5IWLC 5IM7B 3CX5J 3LKPB 4WDIA 1IGTB 1ETZA 2CIKB 2H2PC 1PSKL 4YPJA 1DSFH 2WUCH 4GW4B 1F02I 3ARQA 4G6FB 1R3LA 2EE3A 4NKMB 3X13B 5E4EB 1FFNB 4O4YL 5JW3L 3N1GC 2AV7A 1Q0XH 4Y16B 4PR5A 4XVJH 1D6EA 5DRWB 5C0EB 2YZ8A 3VE0A 4KK5C 4MQ7B 3S3JA 2MQ0A 1ZGLA 5KG9B 2DIJA 5FECA 4XNMA 5E2VL 2UV3A 1LE9A 1A1NA 2JB6B 4LVHC 4C83A 4OV5B 4LCIL 5KSAC 4MCZA 4UTAH 1I3VA 2F19H 1O7SA 1JGLH 3TN0A 4OF7A 3PWNA 1IKFH 1UCBL 3RWIA 5C0IB 3VFVB 3CGTA 3VXOA 2BVQA 5CBAA 1WWCA 4GMSL 1F42A 2E7HA 2AXHA 3O3UN 4ONGL 2VZTA 5JZ7C 1NBVH 1OD9A 2YEZA 4NRZA 4PTUB 3RWCA 4OZ4A 2DYPD 5DJDB 4QXGH 3P9LA 1J88A 4K3EH 1T7XA 4RRPG 3EFFA 1BBDH 3CSPA 4NNPH 3PWVA 3M17B 4OCSL 2J8OA 3L95B 4ZAKA 5C9KA 4Z78B 5DJ6A 2DQFB 1SMAA 4QWWC 4KI5F 3IT8D 2P8MA 3NOIA 4W4OA 1SVCP 1RUKH 2R69L 4JKWA 3B5TA 1UZ8B 3ZT6A 2BOBB 2OJZL 5GSVB 1DP0A 1MI5D 1ZT1A 2KZWA 3C2SA 3VG0H 1B0GB 2GFBA 4WFGE 4X83A 5FM5M 3CH8A 4KJWD 4PJXE 1Q1JH 3UPRA 2NX5A 2LU4A 3FTGA 4FG6C 2ADIB 4U1HB 3QEHA 1HNGA 4E0RA 5DRZB 4JJ5A 1RZGB 4R4FL 3CFDB 3HRPA 3FL7A 1AQDB 2J8HA 2D9QB 3D3VB 3EW3B 4YHPB 2WSKA 2FJFA 5EOQH 5SWZD 2BFVL 1DFBH 5K33A 1DBBH 5F9WC 1I3UA 5FHAL 4YHML 5F93C 4FQIH 5D2LE 4MA1C 5F7FA 3FFCE 2EC8A 2GJZA 1CR9H 5EU3B 5IHUH 3A6BL 3KLSA 5DR5L 3WV0A 2VDOL 3AGVA 3WFZA 2DMBA 2OS7A 1F4WH 3IKKA 3T0XA 1L0YA 4QEGA 4YHIA 5JOFB 5JIPA 3HS0A 1CK0H 2NY0B 1BFOA 4LP5A 5J12B 4B53A 4PREB 4R0LB 3SCMB 3QUKB 5IMMB 4JHWL 1GZQA 1T4KB 2PYEB 1DBAL 1K9TA 1XAUA 3F12B 1IEHA 4OAWA 4K07A 4JRXB 5DC9B 3KYAA 1XF2A 1TPXC 1A4KA 1GOGA 4PRNB 4PRHB 5IMKB 1BREA 1S3KH 2ESVB 4GRWE 4AEHL 4ZNEE 2H41A 1QSEB 3ETBF 4JY6A 1HQRA 2Z31A 3D9AH 1M7DB 2J2ZA 4TUKH 2P8PB 3ARDA 4WI2A 1U95A 4Q2ZA 5EOTB 4DQOL 4NQCE 4KI5D 4NRXA 2QKIB 1T20B 4QHUA 5KS9E 3DUUB 4Q9RL 2CPCA 2ZCKL 3ZTNH 3EDKA 4N9GA 4DUXA 2VB5A 3K74B 4RIRA 5SV3A 3VXRD 1ES0B 4MNQB 3JV0A 3RZCA 3B2VH 3TO2B 3WHXA 2JE8A 2XQYG 2V2XA 1MY7A 3R1GH 5A16B 3KYNA 1KENL 3QXUA 4YXKH 4PJHA 1E6OL 5HD8C 3CDYA 5I66B 3MRCA 2DIAA 2ZG1A 3C6SA 3MUJA 1AJ7L 1WBXA 1Q9KB 1H8OA 5B8CA 1EFXD 2FBOJ 3LQAC 5IW1A 3L7EB 4JG1L 5EBLA 4F7TB 3H0TA 5J9PB 1MRCH 2YRLA 4P5MA 4X4XA 1TFHA 5HYJB 2VUYA 2N4IA 3MCLL 4NFBA 5C07D 1EO8L 2R0LH 3MJ6A 4S1RH 3JV4A 1W0WA 5CEZE 4QGTA 2VKXA 3Q3GA 4NBYB 5IJVB 4J23A 4P3WA 4DVBA 2IFGA 1T1XA 2CDFB 5CEYB 4KU1A 2WINA 4H26B 4XBPA 1ACZA 4P2RD 2NNAA 3K8KA 3ZYZA 3ARYA 4P4KC 5ISZE 4GAFB 5DJCA 3D0VA 5DWUL 4OFPA 4K71B 4NWUH 4WI8A 1YEJH 3SKNB 1YC7A 2P5EA 4RNRB 3EZ8A 1N5YL 1NL0H 1AO7E 1EIBA 4U1NB 5DXWA 2DM3A 3QFJB 5CUSH 5DJ0A 1RU9H 3V95A 3VH8G 3P73A 1SEBB 3JV6A 1CD8A 1V3JA 3I9GL 4PJ8B 3U7AA 1T03H 5CLTA 1N4XL 4V1DE 1DVFA 2R0WH 3MOQA 3BE1H 5JUEL 3C9NB 3ZDZF 3NCEB 3CFEB 3RI5K 3S3PA 4UQ3A 3WKMH 3MRBB 2OL3H 4WU7B 3I50H 1FL6B 1Y6NR 1CLOL 2PETA 1Z9SA 5CCKL 4D9QD 1UKTA 1IC5L 1SY6A 5F88B 1MWAB 4HWEL 4JGMA 3Q6FB 2DDQL 2FNBA 1E4XI 4AIZB 4HG4K 3VRIB 5T1LD 3MRLA 3MLYH 3IRZA 3TEUA 1AGCB 1IFHL 4KTYA 1QO3A 4U6XA 4EOWL 3L5IA 5BZDB 4XVUD 4PJBE 3ILPA 4KJQC 1OTSD 3A6OA 1DUYB 4QOKE 5DO2C 3JUYA 2R1XB 3HHRB 3U30B 1AGDA 4M02A 1WISA 3HN3A 2QR0A 1E6JL 3GIVB 4K2UH 4X99A 1CFTB 3WDJA 3C8KB 3S8WA 1W0VB 1G6RA 1MLCB 1IGML 5IHLB 5B4MD 4HT1H 3QRGH 5DMIH 1KG0A 4XP9L 4NT6A 1QRNA 1MCIA 1XIWD 5LCVL 1RULH 5TDPA 5IF0B 5IBTH 4JPKL 1TCMA 2J6EA 3O11B 3GMQB 3QPXL 2H32H 2ATPB 4LASH 5K9QI 5AD0B 3NH7L 3SDXE 1YY8A 4JHZA 5C92A 1J0ZA 3SDYH 4P4RA 2VLJD 5KW9L 1D6VL 4OZGB 3ZT5A 1QVOB 2Q20A 1PSKH 1R5IA 3UX9B 3BMVA 4GKSB 5HBBA 4OFVA 4QRPD 4R4NC 2SEBB 1F3DJ 1WQVT 3GMMA 4EDWL 5JW3H 4CU7A 2MFNA 5A1AA 2OYPA 4XAWL 4WNQB 4LKCB 1JPFA 5EDXA 2UWEB 4OTXL 4LHUA 1FV1B 3CC5A 5DQDH 2DRUA 3QIUA 3KPSA 3KYMB 5E2VH 3EDDA 3O2DH 1LO2L 5T3ZH 5IVXE 4HS6A 4MZ2A 1D7FA 3FQUB 4HK3N 4LCIH 2M1KA 2UUDK 3T4AB 1QA9B 2W9DL 1ND0B 1UCBH 4NC0B 4L3EB 1LILA 3MQIA 2QLVB 1D5MA 4OGYH 3MNWA 1AFVL 5EUOA 1Q0YL 4Y4FA 4GMSH 1S7SA 3HE6B 4ONGH 4WU5A 4ODUA 1WGOA 4S1SL 4GAGL 3FQWA 1KACB 2ATKB 5GISL 3LDBB 3LN5B 2C4FU 4UTBH 2YMXH 2DLTA 3KJ4C 5D1QC 5L2KD 2OMBA 2B5IB 43C9B 5FYKD 3C6LB 3QULA 3PL6D 3ZYOA 3SQOH 3HUJA 5AZ2L 2MOVA 4C4KO 2DQUL 4NN7B 4HCRL 4WW2A 1DQMH 3LKRB 5HHOA 1CICA 2DQCL 4LSDA 1OW0C 2EDOA 3V4PL 4ZUUB 4WO4D 2R69H 1N64L 4Y0GA 4ZODA 1QLRA 4NZTL 1N3NB 3HZMB 3VGBA 3CFKA 4NQEA 3IKCB 3NCBB 5KOMC 2OJZH 4LCWA 3T0VA 5LXGL 3U46A 1J0HA 3VH8B 4LSTL 1CZ8L 4L8CB 1NLBL 5JA8B 2IH3B 3LCYA 1KIPB 4OZHA 3VI4F 3VMPA 4JZJA 1G9NC 2V7NB 5D6DA 2E27L 3BRDA 3ULUE 4WV1B 5HI4D 2EIZB 4X0KB 2P5WE 4RISL 2BFVH 5CFHA 1BD2A 3BUYA 4Z7WE 3DMMB 4P2QA 3QCUL 3BH9B 5FHAH 1A1MB 3TO4A 5L88H 1ZGLP 1YZZA 1F58L 4J8RB 1XZ0B 5ID1B 1IEAA 2X4PA 5BVJB 4U6HA 1PW3A 4LGSB 3A6BH 5DR5H 5JDSB 2VDOH 4F3FB 1WV7T 4MNGB 4Z7QF 1MJ8L 3FMGL 4ODXA 5EZIL 3V5HB 4LKXA 1XGTA 2X40A 1XH3A 1OGAB 1Y6KR 5C09A 1LEKA 2Z93A 4YHLL 1EUTA 4JHWH 1AGEA 5IIEA 1DBAH 2VJXA 4Y5YC 3RGVB 5BOPA 3P4OA 4FTVD 2I27N 2PXYA 3EOYG 4GRLB 4Y4KD 4CRPA 4WI6A 2Y5EA 4P3DA 4JO4H 3SDCD 1RZKL 3SDAA 1N6QL 3BSZL 4Q9BA 1UH3A 1MNUH 1U58B 4B50A 4AEHH 3CSBA 3QUXD 4AENB 2WBJC 3S5LG 2AERT 4OT1L 1RUPL 1ZLWK 4DQOH 5F8QC 2FDBP 1PLGL 5HYFA 1QBLL 2V5YA 4Q9RH 5KN5B 2LVEA 2CK2A 3OX8B 2HLAB 5IB1A 4XNZB 1P2CA 5KSBF 1KFAL 4R2GD 2YN3A 1QSFE 1WWBX 3NCMA 4JN2B 4KTDL 5FIEA 5JPNB 3NN8A 2VZOA 3RY4A 4JFED 3K4AA 3PIQB 1E6OH 4C55A 2ENYA 1KLUA 4GOSA 2MCG1 4NFCA 2PO6D 1ZT4A 2Y25A 3C8DA 3VFMA 1A6WL 2W65B 1AJ7H 2VLRA 3BIKA 3FZUD 5JR1H 4U7KA 3CPLA 3QIWA 2XKUA 4TULH 3OBAA 1U3HA 5J6HB 1N26A 1W72L 4ONOA 4BFIA 1N0XL 3GMPB 3MCLH 3N0PB 3T2NH 3MRHB 3T08A 3OKKB 1M1SA 3Q5OA 3WS6A 3WXVH 3IF1B 5CJ8A 1KOAA 2ZOKB 4WTZA 3ULUC 3O8XD 2EXWC 3L1OL 5DWUH 4KXZH 4ZPTB 4MXVF 3D2UD 1OT1A 4MJID 1WVZA 2DJUA 4HK0B 4JM2F 5KVGH 1N5YH 5A2JH 2ZUSA 3PE9A 1B0RA 4OQ1A 4M61B 2I60L 3KXFE 4OIIL 5TH2A 3ARRA 3I9GH 3EYFB 4L29B 2P49B 3BAEL 1N4XH 3RAJL 4HC1A 4P2OA 1F8TL 1P6FA 5C0JB 3U7WL 5JUEH 4F8QA 4Y19A 4ALAL 4XBEL 3KWWA 1GHFH 1QBAA 1T0NB 1NANH 1EMTL 5CCKH 3VXTB 1IC5H 1UVQB 2F53E 3H3PL 4Y2DA 2PTVA 2YBRB 2DDQH 1K4DB 3M8OL 3TH4T 4LAJH 3NFPA 1JWUB 3TN0D 3FB7A 5J1AA 5IB3A 3LEXA 1KYOJ 2ZUQB 5DQ9A 1SEQH 1IFHH 4EOWH 1A7NH 3I2CL 5GGTH 2AJVL 4HGWB 1WWWX 2F8VA 3MUY1 1L6XA 1AGFA 1VB9A 3VG9C 1I7ZA 1BBJA 4PBXA 3NZ8A 3DTXB 4KPHL 4PJIA 3VXSB 4AY0A 1G7MA 1NFKA 3BH8B 5D7JB 4NSKA 3B3IB 3BN9C 4QF1B 1GGBH 4YIQB 1IGMH 4HXAL 4X6DB 3QDJB 3IDXL 4KGLA 4XP9H 4CVXA 4O51A 2D7NA 4UNTA 3ARUA 1FO0A 4ZAKD 4BK5A 4KHTL 2JJTC 1E4XL 4L3AA 4JPKH 4IIQB 1DQJA 1CIUA 3QPXH 1YYLH 4IRJC 1D5BA 2GAZB 1RUML 1IC4L 1A7PL 4DKFL 3ILQD 1JGUL 3NH7H 4NCC2 4DGVL 2F54A 2EDJA 2MKWA 4JN1L 5C0BE 3V4UH 3ARTA 4L4JA 3BZEB 4JM2D 3ZKND 1CD9B 2HVKA 3QIBA 3SDDB 1FNGA 3QI9C 1B4RA 4LK4A 2ADJB 2ZNWA 1NJ9A 1NCCL 3RRQA 2IGFL 4ELMB 4IDJL 3UCRA 1FFRA 4EDWH 5GS1C 3D85A 5CIPB 3FO9A 3S5LB 2A74A 2BVOB 4OTXH 4J4PA 4HUVA 5GJTL 1S9YA 5ALCL 3OJ2C 4KDTC 1YNKL 4GBXB 4L9LC 2YOCA 4HQQL 5E2TH 3P4NA 4JHAL 1LO2H 4LHQB 1HQ4B 3O3DB 1FL3A 1JIBA 2Y9RT 1FFOB 3MYZA 1AGBA 2FCBA 2GSIB 4I0PD 1FZJB 3B9AA 3S4SA 3O9WB 4PJ9A 5JXAH 5BRZA 2W9DH 3PGCB 4LL9A 1MRFL 2BY2A 4WWKC 4L8SA 3TVMC 1QLFA 3ZE2E 1L9MA 1MCBA 1Q0YH 4NDMA 1J9CT 4EN3C 4HKXA 3ECBB 3EO0B 4S1SH 1FZMA 4GAGH 3STLA 3OKEA 5E70A 3MFFB 3ZT7A 5GISH 1CGUA 2AK4B 4MJ5A 4BQBA 4C59B 5FM8A 5I8KL 3CDGA 5TE6H 4PV8B 1YYML 1NMCB 5AZ2H 1NGXA 3JVGA 3MLWL 5I75B 1IRAY 3T4YA 3P30H 3EJZD 2DQCH 4KJPC 1MAML 3D69A 4I1NB 3DSFH 2HG5A 3O45A 2FL5A 4MCYB 5KBNC 2QHLA 4EXPX 2BK8A 4N90E 4FXLA 4NZTH 3VW3L 1DL7L 3C5ZB 5LXGH 1R5WA 2BSSB 4ODVL 5DMGC 1BZ9A 1P1ZA 3MGOB 3GMOB 1JF5A 1I9RL 4X6CB 1CZ8H 2O61A 5JXEC 4HJ0C 4JFDE 5DEFA 1NLBH 5BQ7B 5LGJB 1EVUA 5JOPE 1OF2A 4X80L 2DLGA 1HHGB 1KCRL 3C8HA 5GZOC 4JFOA 2BRRL 4QNPF 1RVFH 5ICZB 5I8EA 2FGZA 4JDZB 2AJYL 1H3PL 4P5TD 2F15A 1F58H 3TT1L 5E6IA 4BZYA 5GGQH 4P9HC 4OFYA 2D0GA 1S8DB 2I25N 4X4YB 2A6DA 3HPLB 4J3WA 3U0PA 3FFDA 2YUXA 5L6YL 1G7HB 3RX8A 5BXFA 3SO3C 1WTGT 1NMAL 5DHYB 3HE7C 2DWDA 1S7RA 3U36B 3D18A 1N59A 4NN6B 1IC1A 5I1EL 3UDWA 4ZD3H 3LQAL 3WIIL 4ETYA 1RZKH 4YHKL 2OTUA 1N6QH 2NXZC 3BSZH 1OSPH 4ZS6D 5K59E 1NAML 1GOHA 1TVHB 2W0FB 4ZDHA 1W0YT 2CKBB 2VL5B 3W9DB 3KPPB 1JP5A 4LNVA 3T1FB 5MEQA 2IAMC 3WIFA 1RUPH 4UILL 4HWUA 3QUYB 3WFDL 1T7VA 1JWSB 3GGWA 4OQTL 2UY6A 4HWBL 3NPSB 2APTA 1QBLH 3LV3A 4G8EA 3T3ME 4ISVA 4K8RC 4LOUC 4LFHD 4KZDL 4H25A 1KFAH 4OCWL 3NFSL 4D0CA 2N56A 3IDNA 3FJTA 3PXJA 3FT3B 5HHMB 3W0WE 4XPHL 3QG7L 4WW1A 3L3OB 4OZIA 2BNQD 5D1XC 2VE6A 1VFAA 4N8VG 4PJ7E 1T6WA 1P4BH 1LDPL 3VWJC 2OZ4L 5T1KD 4N0FB 1RUQL 4XNUH 5CGTA 1HCFX 3MUGA 1HCVA 2OR9L 5KSUA 4G9DA 3FO0L 3D25B 2VXSL 2XV6B 4F58L 5A2FA 2FWOB 4RAVA 5IB2B 2XT1B 1T21B 1ACYL 4DN4L 1H3XA 4P46C 4KI1A 5SWSA 2BNRB 4KRMB 1H3TA 5T1MA 3FQRA 1DDHA 3O6FA 4IRZL 2X4NA 4XNQA 3L1OH 2ZWLT 1RJLA 3MXVL 5F7LB 2YRZA 3PWJA 3RHWF 4F9LC 4JCMA 5CMAB 2I26N 4CW1A 4DKEL 5J0BA 3S37L 1I75A 1KTDB 1I8IA 1JNJA 3OXSA 1PZ5B 3BX7C 3DLQR 2I60H 4N0UE 3BGMB 4POZD 3H7BA 3BAEH 1TQBC 1JNHB 3RAJH 3M1BB 3NZHL 3KVQA 4PRDB 3BZFB 3QUZC 3TBYB 4J12A 1K85A 2H9GA 4YH6A 3U4EB 4ALAH 2K9UA 3IDIA 4XBEH 1U8HA 4LHUD 5JO5B 4LSPL 3QZWG 4ZFOB 3LPFA 5EZLA 2XZAH 2Y07L 1JHKL 1X4XA 4G5ZL 3KPSD 1LO0L 3BKML 1EMTH 2NY1B 1LK3L 3BZ4B 2JIXB 4TNVF 4UT7L 5DFVC 4EJ1C 3M8OH 2CXKA 3ARFA 3F5WA 2F58L 1J5OL 3L3IB 3CU7A 1UACL 3E6HA 2DKUA 3I2CH 3WS3B 2AJVH 5EC2A 3VXME 4Y4FD 3T04D 4Y8DC 1EXUA 1Q8MA 5ANMA 5SX5H 4LCCB 5CEXA 2GTZA 1T1ZA 3DVGA 5DGRA 5F7EL 2NX5E 2NYYC 3UJJL 1CF8L 3PGDB 4HXAH 4M1CD 1BX2B 1RIVL 2BMKB 2EDNA 5HVGB 5I9QC 1ODAA 4PJDF 3MRNA 1ZAGA 4NZJA 3WLWD 3VDBA 2FX9L 5CGMA 4KGJA 3TCLA 4KHTH 1E4XH 4PRAB 3AUVA 4I0KA 3LQZB 3F7VB 1BQHA 3EOAA 2NY3B 4H1LG 1RUMH 1IC4H 1DQQA 2EDDA 3QXDA 1A7PH 4DKFH 3E6FB 1JGUH 3AU1B 1K8DA 1WTLA 4NQED 3EUUA 4JN1H 4LCWD 4R26H 1LGVA 1QFHA 4AZ8A 4JFYA 4QXTA 3RKPA 4PG9A 4S1QL 3MO1A 4JG0H 1UJ3A 4P5KA 4HGMA 2FIRT 4UQ2B 1NCCH 1RIUH 3QNYB 2IGFH 5HYQB 4NQSA 4IDJH 4EUPH 3LAFA 2DLFL 4G6JL 1W72B 2C3VA 1QPPA 4Y1AA 2B2XH 4WI3A 2J8UB 1R24A 4FRWA 1FPTH 2Y6SD 1LO5B 4NIKB 3QEUB 3D39D 1BD2D 5GJTH 5ALCH 5MP6L 1YNKH 4HQQH 4Y4HA 2VZ1A 4JHAH 5DTFB 1X5XA 3EYVB 3MC0A 4WY7L 4I9WD 5JIHA 3FT2A 2Q7NA 2DLHA 2A9NL 1NSNL 4XPFL 4XVSH 3TJHC 1FNEB 4GRMB 4YBLB 5I8CA 3MFGB 4I3RL 1OP3H 3TYGL 1AXIB 1MRFH 4XC3L 2GJ6D 2OL3A 3B9KB 1I85A 4YGVA 4Z95H 3SJVA 4NKDA 4K94C 1A4JB 4TOYL 3WUWG 1O5DT 3EYSH 3KPTA 4LVNB 4N8VB 5GPRA 3GSVA 4ZFZA 1G9NL 4Q9QL 1AI1L 3HI1A 2HKFL 1PX3A 3IXTB 4MZ3A 5A3ID 4BSWB 3TV3L 1IL1B 3U83A 2OQJB 1DR9A 1BVKB 2IC2A 1TNMA 4LLQB 5IEKA 3SDAD 5AEAA 3C2AL 5I8KH 3U0WH 1YYMH 5E9DE 4BH7B 1P84J 3ZE0E 3MLWH 2G5BB 1FLRH 2G9HA 1NGYB 3NCJH 3IDMA 1KIQA 5D1ZA 4F7CB 1EAPB 3F62A 1QFUL 4PP2B 3FQNB 3VW3H 3S88L 1DL7H 5E1AA 2CGRL 2R2HA 1AXSA 4OKVA 3DNKA 4M43L 4MB3A 1I9RH 5L9DL 1GGUA 4PGEB 3QEQD 2H32A 1NMBL 2YPLB 43CAB 3B4NA 4LEOB 1KIRB 2PTTA 4JPWL 5CINL 1MJ7L 3V5DB 1CVRA 1CD1A 4L4TB 4HIXL 1AD9A 1YPZB 4L4VB 1P69B 1T2QH 2P5EE 2VLKB 4PJIF 5I1GL 5I73C 2HJKA 5FO8A 3WFHB 2VLRD 3GM0A 3QZWB 4G8GB 5FHBH 1XR9A 4K7PY 5J1TC 2AJYH 1LVEA 3X12A 3QIWD 1H3PH 3G6JF 5F1IA 3VFSB 1PKOA 4ZUWB 2HVJA 1ONQA 4KQ3L 4PRPA 1PKQB 3FCTB 4NJ9L 5FA4A 4YDVA 3C5SB 3O2DA 4K9EC 3OZ9L 5JTWA 5E8PA 5I15L 3CCHA 1NMAH 3AREB 3Q1SL 4A6YH 5F3HB 3K1KC 3PWLB 4EUPB 4HUUB 1JYVA 1NCWH 1VKXA 1BZQK 5I1EH 5F9JB 1FVCA 3LQAH 1GGYA 3WIIH 5HHQA 1RD6A 1S9WB 4UUJB 5C0AA 1DQLH 2HFFB 5HI5D 4W6XB 1R3HB 2Z31C 2BNUB 3HFML 4MDJA 2Z35A 1NAMH 1A9BB 3ARDC 1L0QA 2G60L 3QQ3A 4UIMA 3DX8A 4HW6A 4FXKA 4P2OD 3T0EA 1UQSB 4OZFH 1LP9A 4Y19D 3BPNC 4NFDA 4UILH 4H1LB 3WFDH 3S3SA 3SBWA 3ULUL 5E6YA 5I0ZA 5MI0C 4OQTH 4HWBH 4TUOA 1U3ZA 4YDLC 3RI5F 5GSRB 5FYLD 3RZCC 1MRDH 1QRNE 2AW2A 3GSQB 4NQVB 1WZLA 4KZDH 5DJ8A 4OCWH 3NFSH 2H6PA 3QDMB 2AEQL 5GRZA 2R0KL 2X41A 4HKJB 4Z7NE 2Q87A 1T1WB 1RAMA 1WBZA 1CXHA 3VWKA 1V3KA 5TFSH 4YZFE 3QG7H 1FNSL 3SN6N 4YUEH 2W59A 5EIQA 3VXNA 1EEZA 1S7VA 3L9RA 2OZ4H 2OP4H 3CSYA 2Q7YB 1U3YA 1NGZA 5SWQA 2OR9H 1W2KT 4HBCL 2MQCA 3FB5A 3FO0H 5C0CD 4JPIA 2VXSH 3O3AB 1OGTB 4F58H 5BJTB 4KRPC 3BO8B 3CFJA 3KLAB 5C9JA 5ICXA 1ACYH 5JLZB 4DN4H 3ZKMD 3P9MA 4EQ3A 1RK0A 4AH2B 4KKLC 3WUWB 4GRWH 3EJYD 4IRZH 1WCQA 1SJVA 1G0DA 3MXVH 2OTWA 1TPXB 2P7TA 4NUJA 5KSVA 4Q97A 2WWKO 5E94B 4KVNL 4CNIB 2D03L 2NY2B 3JV5A 3MCKA 5ID0A 4QHMA 4C56B 3BD3A 4FQPA 4MB5A 4DKEH 2F54D 5AAMA 5I16B 3DO7A 4CVZB 2ZZUT 2PW2B 1AD0B 5ENWA 2W0LA 4MMXC 2BSTA 1DVFC 1ZA6A 4ORGB 5DHVH 3BKJL 3LN4B 1HWGB 1UENA 2F8OA 2X1XR 5I1LB 1KJ2L 5EUOE 2NLJB 1KIUA 1BFSA 3O4LA 5BS0D 1MHEB 2IPUK 1Z9LA 4G43B 3B2UD 3UTQA 2YHGA 1BHGA 2VDKL 4HIIB 3MV8E 3IJYA 3CXDL 4BUGA 1YY9D 1FSKC 2E9JA 4J4PD 3VFWA 4LSPH 3ALXA 3MRFA 2Y07H 1JHKH 1R5VB 4G5ZH 32C2B 3UTOA 3VRLE 3WEXB 1LO0H 1HXYB 1HEZA 3BKMH 4MAYD 4ENED 1I9JH 1LK3H 1SJHA 3CUPB 3HUJE 1MFNA 3S7GA 4O2CA 2DQGL 4UT7H 4E41A 3FOLA 3FKUS 3QNZA 5H2BB 4IOFC 4C57C 2F58H 5BRZD 3RNKA 2APBA 1J5OH 1QFWL 15C8L 1I4FB 3IU4L 1UACH 2Y5TA 5E7FA 1E4WL 4CMMA 3MLSL 1ED3B 1HHHB 1CXFA 3A6CL 4MD4B 3W11C 2FEDD 1RJYA 4M7JH 4U3XA 4AM0B 2CQVA 1NAMB 3OKDB 3R06A 3QA3A 2R4SL 3KJ6L 1KCSL 4F7MB 5SX5K 1RV6X 1DEEB 2R1YB 1MVFA 3UJJH 1CF8H 3WNMA 1WWAX 4OZHE 4P4KB 2ITDB 2VXVL 5C3TA 1RIVH 1KPVA 1QACA 1AR1C 2D7TL 3H42L 4XZUA 3O2WL 2EYRA 1ZEAL 1K2DB 2L4OA 1EO7A 4MHHG 4PRBB 3REWA 2FX9H 2MNUA 3GMRB 3TGXA 3OQ3B 1YNTA 4Z5RB 3BXNA 4ZQKB 4YPGA 5D2LB 4P2QE 1JZ3A 4DEPB 2LV4A 4U1KB 3UTTD 4F33A 1H9VA 5HYIA 3VFNB 3NGBB 2VL4A 3RWDB 5C8JA 1FAIL 2MQ3A 4TUJA 3IYLW 1S5IH 3GB7B 4S1QH 3AY4C 4PLJC 1HHIB 2YC1A 3BPLC 4LSSH 1HI6B 5HDQL 3W2DL 5CP7B 4KH2A 3BP7B 3MLXL 3FOMA 1MHCB 1LD9B 2DLFH 4G6JH 3RIFK 4X6BA 1YN7A 3CH1B 4HZAA 2W60A 2AQ3A 4AT6A 1JMZA 2NY0D 1CLYL 3QIUC 5D7LA 1Q9WB 1BIIA 1RURL 4M3KB 4OLWL 2HMIC 4FQXB 1CE6B 3JWDC 1CXIA 5MP6H 4JFFB 4K7FB 2HN7A 2GCYA 3BPOC 4ERSL 2D7MA 2Z92A 4WY7H 3AM8C 2EYTA 1URLA 5DRXA 5D7KD 4WEMB 3TFKD 1HSAB 4XPFH 4XP5H 1MHHB 3WL9A 4PRHD 3UROR 4F57L 3ZHLA 4Z7VB 3RWEB 4I3RH 3TYGH 3UTSD 1FJ1B 4XC3H 1UWGL 2Q6WB 1PG7W 5KS9B 1A6VL 4XP1L 3QJFA 1OP3K 4PIRF 3G5VB 1G9NH 4S1DC 4XMLL 4Q9QH 1M05B 1NBYA 1AI1H 4GLRI 4PTTB 4IRSB 2X4SA 1RZJC 2HKFH 4DFIA 4EI5A 4PGDB 5KANI 3TV3H 3PWPB 4M8QB 5I1IH 5GGTA 1F3JB 2FHCA 4JO1H 4PJ5A 3GRWL 4MNQD 3VFTB 4E42B 2YUWA 4PJCB 3WNOA 4WW2C 1TIUA 2XG4A 4U3HA 1CICC 3MMEB 1RQ5A 4RQQA 5B21A 2K7QA 2WQ8A 4P9HL 1PFCA 4BUHA 4GG6A 3E8UL 3ESVF 1HSBB 1QFUH 4MA8L 4XX1E 2R8SL 1ORSB 1H8NA 1P4IL 4RGNE 3K8MA 3BQUB 3HB3D 3OMZA 3ABZA 4UT9H 1G6VK 5F1NB 2CGRH 1X4YA 3ME0A 5HDOA 4U05A 4DAGH 3H3KA 4M43H 4JVPA 1E27A 3C60B 1RZIA 1NFDE 3VGAC 5L9DH 2R1WA 1I1AB 4WUUA 1D5ZA 1G7LB 5D6DC 3RVVD 5FYKL 3MJGX 3D0LA 4JPWH 1A5FL 5ITBH 5CINH 4ZXBC 1MJ7H 3K2MC 4RMVA 3MNZB 5F3BA 3ARBA 1AO7B 2CDGA 1CVSC 5I1GH 1UB6B 3DETC 4UNUA 1SBSL 3TO4C 3VD7A 5EO0B 2B20A 3MYJB 2HT4D 4LLUA 2XN9A 3X3GL 3MJ7B 2QQLH 4QY8B 4OLYL 3ESUF 1Q94B 1T5XB 4K8RL 2VQ1A 4P57B 1S9XB 4JRYA 5GZNC 2C3GA 4NJ9H 3WXWL 5SWSD 3VFPA 1F4HA 3GSXA 1X7QB 3OZ9H 1DLHB 1U8NB 3RUGA 2LE9A 1MUJA 4KHXL 4P3CL 3TZVC 3VFGL 2V5SA 5I15H 2PXYC 3ORJA 4NOFA 2V9TA 4NZUH 3TIEB 4G42B 2NW3A 3H9YA 2XFXA 1Z5LA 5IMLB 4WWID 5F8RC 3RVWC 3DRQA 4OGAC 3QJHA 3HFMH 2EXYC 2G60H 4QOKB 3I3DA 2NW2B 5C0DA 2EE6A 2ERJB 2XA3A 3EOTL 1UG9A 4FHBD 5T1DL 1NAKL 3IDJA 3ULUH 3VGHA 3E3QE 5LWYH 3HMXL 2BCKA 2HJLA 2I07B 5ALBH 2MHAA 3PJSA 5D5MA 5DDHB 1K3ZA 2BVUA 2EO1A 4NO0A 5DVOA 1PX4A 3O0RL 2AEQH 1CDIA 3H9HA 1JF6A 2EC9T 2AK1L 2NZ9D 3OL2A 4TSBL 1N0LA 4XCNB 2ICEB 3O4OC 3RWFB 3WDIA 3FRUB 4C4KT 4O58L 2IJ0C 1FNSH 5FYKU 2XA8H 1GAFL 2VZUA 1E4JA 1ZHLB 4NHUB 3RTQA 2VNCA 4XPGL 5FO7B 5EIVA 5AWNL 4LPXA 3UC0L 4JREC 1JE6A 5GRUL 1AKJB 1U3HC 3SE3A 4RGNC 1X3DA 2RR3A 2FJHA 5E03A 4HBCH 1BQLH 2JJUA 1EVTC 3AAZB 4HLJA 2ARJQ 5JHDA 4ZUSB 1DJSA 4GKNA 1BOGB 3K46A 1KEGL 4QRRD 3S36X 2EEDA 2BX5A 3LKQB 3GI8L 1X44A 2DYPB 4JM4L 1LHZA 2HKHL 1A1OA 3PXHA 4CN1A 1QOKA 3QH3B 1GXEA 1I8MB 1G7JA 4JFQB 3IVKB 4I8DA 1F90L 2D03H 1MPAL 4XI5C 2BOCA 5I74B 5DI8A 2DICA 3O41B 1M4KA 3MV01 4DTGL 3QDGA 2ZUXA 4I4WB 1J87A 1UADC 2AXGA 2RHEA 5DD3L 1T83A 2OSLB 1CGSL 4CMHC 4P23C 3RWGB 3ALWA 4J2XA 1MCDA 1KJ2H 4BSVB 1MI5B 4RAHA 1BVLB 4Y1AD 2K3TA 5E8OB 2OK0L 1BPVA 3TBWA 2FJGA 4HIJA 3DURA 4PRIE 3S96B 3FB6B 1J0JA 3CXDH 1EEYB 5B38G 3TA3A 5TDNA 1U8MA 4Y2DC 4M5YH 3FT4A 2QADC 1I8LC 5SWZB 2DQGH 1IGYA 2AAVA 4PJGF 2EDHA 1JFQL 5IUSA 4UDUA 2QSVA 2VIRB 1QFWH 3IU4H 3MOBL 1E4WH 2HA1A 4YHZL 1TDQA 2EDWA 3T3PE 2C1OA 3BDXA 3EKCA 1KB9J 4PY8I 3KLHD 1J8HD 2IAND 1ZLUH 2XWJB 2A6KA 3HAEA 3E3QC 4NQDD 3KJ6H 1CGYA 1KCSH 1N8ZB 2NY5C 1OY3B 3HTLX 5FUOL 4OI8A 4D9QE 1G0YR 2VXVH 2JCCA 4F7PA 2D7TH 3H42H 3KPRB 4U0RB 3O2WH 5F9DC 4WTXA 3BN3B 1ZEAH 4EI6B 4S11A 3U9UB 2A6JA 3ULSB 1LP9F 1EJOL 1VACA 1BP3B 2EE2A 4J3VA 2E8ZA 1CFNB 3HZVA 3OJDA 4K94L 5J56B 2VDNL 4QXWA 4M6NL 5HGDA 4D0BB 1AQKL 5D2NE 4MQXC 2ZUWA 1U8QB 3QIBC 1IARB 4YBQC 2ZPKL 2X70A 3BHBB 4MX7A 4K7PH 1J1XH 5I6XC 3MBXH 3RWJA 1AE6L 3MRGA 1UXWA 4ZUVB 3W2DH 1FVDB 3MLXH 35C8L 4NJAL 3VXRB 3VXUA 1U91A 4W81A 2F5BL 1TJHL 3OR6A 2C7UB 2HTLC 1CLYH 3F8UB 5DJ2A 5J1SC 5IV2B 4OLWH 2F74A 1C1EL 4JRWA 4U6TA 3TBVB 3H6JA 2ZOLB 5ERWA 4ERSH 3RGVD 3HPJA 2AEPH 3DI3B 1MH5B 5IR1A 1XR8A 4DZBA 3L3HB 1XF3B 4GRLD 4PJ9C 5DYOB 5DUBA 3GMNB 5IB5B 4F57H 5I76A 3GO1H 3MRMA 3EYUH 5GRJL 1EFXB 5D7IE 5IM7A 1J12A 4DK6A 3LKPA 1UWGH 4YHNB 2VITB 1UC6A 4KK6D 3UO1L 1HKLL 5T3ZD 2YPKB 4XP1H 3TJEH 4GO6B 2ZKHL 5IWLA 1Z0NA 2CMRL 4P2RB 1GGTA 1K4CB 4APQC 4NNXA 4Y16A 4DCQB 2H3NA 4R7NA 5DRWA 1DN2A 4E5XB 2UYLA 3U48A 4UOW0 5ILTH 4MQ7A 1SYVB 3GSRA 5KG9A 2YK1L 3JVGC 2AJ3B 1XEDA 3PHOB 3AB0C 1KPUB 4LSQL 1CL7I 2JB6A 1KJMA 1NC4D 1JYXA 1HHKB 3B9DA 3BJ91 4G3YL 5HGGS 6CGTA 4P9HH 2CLVB 3E8UH 4K9EL 5E24E 4JJHA 5IHBA 3MA7B 4MA8H 2R8SH 1P4IH 1PG7L 3QI9B 1JPSL 1J05A 1AIFB 1WUNT 2DLEA 5HHNB 1LE5A 4X9HA 4AQOA 3H9SA 4JFPA 4KK9D 4Q7DA 1M7IA 5CGYC 1RJZA 3LPGA 5A2IH 3KPOB 3MLRL 5IK3A 3DIFB 4N0YL 1VEMA 2AKRA 1A5FH 3QFDB 5DJDA 1IAOB 1LNUA 2DN7A 1FRGL 4GW5B 5E1HB 3HG1B 4EDXA 4XHJC 1S78C 2Z8RA 3FQXB 4KMLB 5B38B 1SBSH 3ZKXC 5K9OA 1IM3A 1C7SA 1JHTB 2P47B 1GIGL 3LRSA 2DQFA 5FV1L 4M7LL 3X3GH 1QP1A 4Z7UE 4JE4B 5E6IC 3RVTC 3VGDA 4JQIH 3EYOB 4OLYH 2YD5A 5F6IB 3V6ZA 4K8RH 5HTSA 4FQ2H 3BFOA 2BOBA 5E2UL 3WXWH 3BEWA 4FFZL 4LVEA 1JGDB 4HS8H 3VFGH 4P3CH 5EBWB 1XIWB 2QQKL 2ADIA 4PJEA 1HYRC 2D0HA 4U1HA 4P99A 4DK3A 2F53B 1UFUA 3BDYL 3DX7B 2X4RA 4ZUTA 5EUKB 3IS0X 1H15B 3V6OE 4YK4C 3D3VA 2I9TA 1RK1B 3TM6A 1IQDA 3E0GA 5EC1B 3PQYA 4YDIL 2GEEA 4X98B 3QUMA 4U1IA 2WUBL 5ANME 3ZZ1A 2VLJB 3G08B 4U6YB 5IEHB 5EU3A 3EOTH 4XP4L 4XBGB 4Y88A 4LCYB 5ADOL 5D6CA 1NAKH 1RFDL 3LB6C 5BMFL 4FZEL 5C6PB 1AH1A 3LIZL 5F1OB 3SCMA 4N8PA 1U92B 2W91A 2ITCA 2GSGA 4JLRB 3O0RH 1V8HA 3QCVL 2BC4B 2AK1H 3QDJD 4TSBH 2PKDA 2XWBA 1I1FA 3OAZK 4JRXA 2KQMA 4MWFB 4LNRA 3T65A 4O58H 5DC4B 3K4ZA 3KPQA 1DEDA 1GAFH 4JKLA 4TSCL 1SQ2N 2ESVA 1T66C 1CWVA 2GK0A 5GRUH 1OAUL 3OJVC 2F5AL 4ODWB 4XAKD 5FGCE 4KQ4L 1HYSD 1SY6L 2GTWB 1J1OL 3OV6A 4FMFA 4XWGH 5TQ2L 1KEGH 1I3RA 4FQLL 1I1CA 2ADGB 5JW4N 3O6FC 4OFIA 3CAFA 4JM4H 2HKHH 2F8XC 1I9EA 5L2KB 4OBSA 1P7KB 3PL6B 4IEFB 3VDCA 1F90H 2NXZB 1MPAH 3F7QA 1I9IH 1NGPL 1WFTA 5INCA 5I66A 1V7ML 3FB8A 2CSPA 1XGUB 2QSTA 4DTGH 3X11A 1G6RL 2EYSA 2HTKD 5DJZB 3WN5B 5DD3H 2IAMB 4WO4B 1D5XB 3SJVE 3MUHL 1CGSH 3NIGE 1CBVL 5E5RB 4ZYKB 4A6YA 5DJYB 2EH8L 3R8BB 5HYJA 3AFLA 4RFEA 5C0GB 3FQTB 2X9WA 3IAGC 2J6EL 3REVB 1A2YB 3F6IA 5D7LD 5IJVA 2R39A 5DSCB 1WAAF 1FL5B 5TDOB 1CDCA 3U0TB 3DXAB 4ONHB 1CFBA 4G80B 4X5XB 3UJTH 4BQ9A 4HEME 5CS7A 3ARFC 5FF6A 5J6GB 3MR9B 4JKKA 3IGAA 4OZFA 2ILLA 3SKNA 2VRAA 5JPMB 4CJ1A 2VKWA 1JFQH 3V8OA 4LBEA 4U1NA 3MOBH 4OSUL 5A2LH 1IGFL 3G04B 4L8BB 4CL7A 4RSVA 5CJXA 4PJ8A 4M62L 1A8JH 1FHGA 3MODL 4JQVC 4OGXL 3LS4H 2C3WA 3BOVA 4XNXL 5CD3A 3N85L 3RL1A 1O7VA 1ZLUK 3JWDL 3LMJL 3BKYL 4Q0XL 3C5ZD 3CFEA 5DZOA 3CJJA 4U1JB 1B2WL 3MRBA 2RB8A 1WFUA 4FTVB 4QTHB 3K8LA 1FIEA 4NP4L 2W9EL 4Y4KB 2DQEH 1EJOH 2JKXA 3SKMA 1B6UA 4CU6A 4F37K 2M26A 1MWAA 3SDCB 4GUPA 4IHOB 4NKIH 4K94H 1HXMB 5IB4B 2ARJB 2AV1B 5D5MF 4M6NH 3WD5L 1F6LL 1AGCA 4OIBA 3Q6GL 5BZDA 1AQKH 4FABL 5EO1B 1YMME 4XPBL 1RZJL 1YA5A 1UJ3C 4L3CB 2Q1EA 2CXGA 1JV5A 4L1DA 4WUUD 2ICWB 2R1XA 4N0CD 1AE6H 2BVPB 2Y4SA 2X4UA 4QYOA 4BJLA 1CFTA 5DJXA 1W0VA 35C8H 4NJAH 5D93C 5IW3A 2QTEA 4R2GB 2F5BH 4NO5B 4AIOA 4YO0B 3MRIB 4Y4HC 1C1EH 1MCWM 5DHVA 5J4MA 1N5AB 1QYGL 4JFEB 4Z0XA 2WK2A 5ETUA 2VLLB 2MMXA 3ARGB 3MPCA 5C0AE 3RJQB 4W4NA 4JZNA 3U7YL 2PO6B 5DF0A 5FOBB 3OGOE 5F1KC 3WE6A 1N7MH 1JZ4A 3B5HA 4D9LL 1Z9MA 1A6AA 3T0EE 1I85C 4L9DA 5GRJH 5HYSG 4R7DA 5LAXA 2DWEA 2FECL 4JFHD 3ALPA 3UO1H 5MENB 1T04A 1TZIA 1JNNL 5E00A 3FO2A 2R2BB 1V05A 2ZKHH 4G9FE 1U8KA 2NXYC 3V6FA 3TIDA 5I9QB 4Y5XB 1I7RB 2CMRH 4JFZL 3IDUA 4JAMB 4LHJB 5GQBA 4WNQA 3O8XB 3GSNL 3UAJD 2UWEA 5LJYH 3SEPA 1EZVY 2B8OT 2GY7B 3D2UB 1PYWB 4MJIB 5F6HJ 3KYMA 3DHJA 2XTJD 5ISZA 5GGRB 4LSQH 5D1ZC 3WNPA 1ZA3B 1ETZB 1FP5A 2ZG2A 3W39A 4G3YH 5TE4L 4K9EH 5ELIA 3QXTA 3RDTA 1CXLA 3EOBB 8CGTA 4L3EA 1JPSH 3BPCB 2R9HD 2CO6B 5ADPH 2AV7B 4GLRH 4PD4J 4PR5B 3X14A 1F2XK 3P4MA 4NO0D 2FEEI 4V1DA 2WIIA 5C0FA 1T3FA 5GXBB 3NPZB 3MLRH 4B5EA 5FECB 4MVBD 4XNMB 4N0YH 4Z18A 3MBEC 2PN5A 3TBSB 1ZMYA 1LE9B 3LN5A 4JKMA 1F97A 4HDIA 3HCVA 4HAGA 4C83B 4OF6A 4MCZB 2VXQL 1YEHL 3KNBA 1KXVC 4HPOH 3TN0B 4EXKA 3PWNB 1JNLL 5E7BA 1RIHH 1RUAL 3RWIB 5IFJA 1GIGH 1NDGA 3MJ9A 3NVQA 5D1QA 3VXOB 4M7LH 2FBJH 2BVQB 5CBAB 2XPGB 1G0XA 5JHDD 2VSDA 5F7MC 3O4LE 3WIHH 2YEZB 4JKPL 4NRZB 5E2UH 1UXSA 3HNVL 3RWCB 5JW5A 4OZ4B 4PJBA 5TF0A 5JW4Q 3P9LB 3RVXC 1AXTL 4L8CA 3EFFB 3OSKA 3MRPB 2IH3A 2NY4D 4ZAKB 1KIPA 2LABA 2PF6A 4N5ED 4HWZA 3BDYH 3ILQC 5DJ6B 4E41E 5F6HI 3BYYA 2ICWJ 3QDGD 1KGCE 5L0QB 5B3JF 4Z0BL 5E8DL 3WSQL 3DMMA 4GW1A 3BH9A 3T0EC 3O6ML 3VFOB 1A1MA 3T09A 1WC7A 1ZT1B 2XI9A 4J8RA 5DS8B 4LFHG 4JM2B 5TF1L 3SBWC 1UKQA 4XP4H 3FTGB 3SDXA 5ADOH 4MNGA 3J8F7 1RFDH 4JR9L 5BMFH 4FZEH 1IAIL 3QEHB 4E0RB 4I48A 2BDNL 4JJ5B 4XRCB 4MNHA 3LIZH 4TTGA 4MS8D 3JTSB 5D7SL 2FJFB 3VWKC 4PGCA 3QCVH 4Q58C 1IILE 5C0ND 2BRQA 5I73B 5EIIA 2AJXH 4HC1L 5D9SB 5F96H 2EEBA 4AEFA 1F13A 2GJZB 4Y5YA 5MHSE 1JZ5A 3KS0H 1U58A 4I0PB 1MAJA 4YHIB 3HZYA 4YHYB 1BJ1H 4Z76A 1DE4B 1S7XA 1EO5A 2CUHA 1OTUD 2F5AH 3DX9A 2X89A 5I17A 1BFOB 2LQRA 4KQ4H 3QYCA 4CAGA 2X9YA 1SY6H 4NC2B 4ETQA 4DW2H 1J1OH 5HYSB 4OLUL 1YEFL 1DANU 2ADFL 2BHYA 2WBJA 2NY6D 4MJ4A 3OX8A 4OAWB 3WFBH 1BWMA 1XF2B 3L3JA 1A4KB 1SYSA 3AS3A 3L3KB 1JWMA 3HMWL 5EU6A 1FGVL 5IBLC 4XP6L 5I1AA 1TMCB 4YR6B 3PIQA 4ODTL 1NGPH 1PDKA 1HQRB 1MCSA 1WEJL 4KKBC 4S2SB 2WV3A 1G7IA 1X6NA 1U95B 4M4PA 3NABL 1G6RH 1R3IL 2R0ZL 4KAQL 4NRXB 4LHUG 5TQ0L 5F21B 3RX5A 4QHUB 4GXVL 3DUSB 4I18C 1CBVH 4N9GB 1FO0L 1S9VB 5B22A 4BFEA 2EH8H 2Z8WC 4RIRB 5J6HA 5DD5L 4IJ3B 4B0MM 3RZCB 2J6EH 3RIFF 3WHXB 2YKLL 2V2XB 2X5PA 4XGZA 3KYNB 3ZYJA 2VXUL 5F7KC 1S7QB 1JJUA 1L0XA 4PJHB 1MVUB 4M4RA 2ZOKA 4PJ5E 3MRCB 1CTOA 5GGVY 3C6SB 3WO4B 1FC1A 4GXUN 1WZ1L 2CUMA 3ES6B 1WBXB 2VLME 5B8CB 4LSVL 2H8PA 3MROA 5GGSY 4HFWA 5EBLB 3STZA 5J3HD 3H0TB 4P5MB 4GG6E 2P5WA 1IGFH 4HPYL 1CDYA 4PJEF 4Z7WA 1IE5A 3JV4B 3Q3GB 3EYFA 3MODH 4N68A 4OGXH 3RIAK 4DVBB 1T1XB 5FUZL 4XNXH 2H2PD 1IEBA 4GH7B 4JHBA 2WINB 2BVTA 2NNAB 4ZSOB 3JSSA 5DK2A 3JWDH 5DJCB 3D0VB 4Q0XH 3BDBA 4L1HA 3CDCA 1B2WH 5CHNA 2YPLD 2W9EH 4N8CH 3VGFA 3U9PL 5LBSL 1UVQA 4KK5D 3P73B 1K4DA 3JV6B 4LQFL 1JN6A 4Z7OE 2XN9E 4BZ2H 2VR9A 4K3JL 1XGRA 3CFIC 4WVRA 3WD5H 4NKOA 5K93A 5KSAD 2E7LA 4DWHA 5IMOA 4FABH 1YN6A 4XPBH 1RZJH 3CLFH 4J1UA 4JRYE 4DVRL 2X4OA 4NRYB 2XTLA 4UQ3B 1FSKB 1TTFA 5C6WH 1XF1A 3RUGE 1GPOL 3KR3L 3PUCA 5J13B 4YIQA 4HX1A 2EKJA 4K7PX 5JZ7D 4Q74A 3L3GA 3IJSA 3QEGL 3MV9D 5DGQA 3S34L 3MRLB 2WWKT 4LARL 4V2BA 1QYGH 2AXFA 4WFEE 2EDKA 5DMJB 1QO3B 1QSFA 2BNQB 4IIQA 3NACL 2ZCHL 2GAZA 5FXCH 3U7YH 1LK2A 3IDYB 3QSKB 5T1KB 2ICES 4XVTL 1MCOL 5GRVL 4QWWD 2QR0B 3PP4H 4WHYG 4X99B 3BZEA 1OQOA 4JPVL 5EFIA 4H0IA 3SDDA 1KG0B 4NT6B 1QRNB 1ORQA 4EI5C 1JNNH 1QLEL 1I7TA 2WUCL 5AG9A 5TDPB 1P53A 1NCAL 3HNTL 5E4IA 3AMKA 5CIPA 2D4DA 5CSZA 5FEBA 5FA3A 3S5LA 4FG6D 4I9WE 4WEUD 3GSNH 5I19H 5M95B 2FX8H 1Q0XL 2HLFC 2HRLA 3PQYD 4O5LL 4GBXA 5GGUA 5CJBA 4GAYA 1GL4B 1YY8B 4KFZC 1JTPA 4Q6IC 4OI7A 3OF6D 4J3UA 4KDTA 4YFEA 1FFOA 5TE4H 4LIQE 1FZJA 2GT9B 3RVUC 3O9WA 2F19L 1C08A 1JGLL 4PJXF 3ELAT 1RY7B 4QHNB 3KXFA 5A2KH 1FQ9C 1JPFB 3PNWA 1PBYA 3BGFC 2HFGH 3CC5B 4LHUB 3TVMA 2ZP0T 3EO0A 1VFOA 3KPSB 1BOYA 3DGGB 1NBVL 1VESA 3ARBC 3GM8A 4HS6B 3BPOB 2AK4A 4S0SD 5D2LF 5IKCA 3GJFA 1FE8L 4K3EL 1BECA 1CL7H 1EFQA 4PV8A 1NBZA 1ZKAA 4NNPL 1YNLL 3DUHA 1JNLH 1RUAH 2ENSA 4PJAE 2NY2D 1D5MB 1V5JA 3CLEL 4WTZG 5GGRY 3UBXI 4C56D 4HKZA 4Y4FB 2XZQH 4CDGC 4WU5B 4ODUB 3SE8L 4JKPH 3FQWB 1I1YA 2VC2L 3HNVH 4U1SB 2FEEL 2IH1B 2CRIA 2BHUA 4HH9B 5F1SA 2QBWA 3LD8C 3QAZB 1AXTH 3S9DB 5JORA 3THML 3V0AC 2DQJL 1EBAA 3VG0L 1OTTC 5BQ7A 2OX5A 5LGJA 3QULB 4HS3A 3T2OA 4EVNB 4NPYA 4O9HH 3U4BL 1Y18B 2J5LC 3KPMA 4R4BB 5CD5C 4GRWF 5HHOB 5JXEA 4JZOB 1CICB 5I71B 5J11C 2YD7A 4Z0BH 5HD8D 1P6AB 5E8DH 3WSQH 1QLRB 3QPQC 1OLZA 3CFKB 4NQEB 3HC3L 1DFBL 4LCWB 4MD0A 1KEML 4FQIL 3SO5A 5KS9F 5TF1H 1XF5A 1C16B 3IJHA 2V2TB 3QWRA 1CR9L 5LGKA 5IHUL 3VGAB 3NCCB 4JR9H 4OZHB 1MCPL 1IAIH 1QSZA 5D8JL 5SX4I 4JZJB 1S8DA 3JXAA 2BDNH 2AQ1A 4WFGD 3ZKQD 1KUMA 1GRWA 2JCCE 3DHMA 2AS5M 1DLFL 3JWOC 5D7SH 3CZFA 1WIOA 3D39B 3BUYB 1A7RH 1BD2B 5DQJA 2FSEB 3MX0A 1D9KA 1ZS8A 4P4KD 4RMUA 4ZPVB 3TO4B 4KUCF 3MV7E 3LVEA 4HC1H 4P59L 1EPFA 1IEAB 2X4PB 3HE7A 4U6HB 4OF5A 1EHXA 4NZDA 1P9MC 1TVHA 3FFCD 2CKBA 1FNFA 2GJ6B 4ODXB 3VCLA 4LKXB 1XGTB 1XH3B 5HPMB 5C09B 2GUOA 3BT2L 2Z93B 4YNYA 5IVZA 5LVEA 4H8WC 5T3XE 1AGEB 5IIEB 5IP4A 4OLUH 3VXUE 2ADFH 3C09B 4RBPH 1IAMA 1QFWM 4P3DB 4CU8A 1FGVH 3SDAB 4M93C 3DECA 4XP6H 5DMKA 3B2VL 3MGAA 3L3OA 2H45A 5DA4A 1IZJA 3VMOA 1G9EA 1TTGA 4FFVC 1T83C 3V5KA 1KT2B 5C0CE 1J8KA 2HT2C 1R3IH 2R0ZH 2Z9TA 4KAQH 2NY5H 3RL2B 5TQ0H 4O2EB 3K2UL 3NBNA 4GXVH 4JDTL 1FO0H 2Y7QB 5AYQA 5BV7L 3TPUA 3D25A 1LEGA 4KJQD 2FWOA 4NQCD 5DO2D 4WIQA 3G5ZA 1TVDA 3TA3C 3QEQB 4ESKA 3RKDC 5HY9B 3G5YA 2YKLH 2BXYA 3NN8B 3S4SG 3NIDE 2FHBA 2BNRA 2P4AB 3VI3E 1G1YA 2HJFB 4JFDA 4RMTA 2L7JA 3VFMB 5E5MA 5CMAA 3QG6A 4QT5A 4PJFA 2NMSA 2VLRB 1NUFA 4LSVH 3BIKB 2HFEA 4PJBF 3CPLB 3QIWB 4OCYL 1L4IA 1X5HA 2X44D 2KPNA 4HPYH 1NL0L 4F7EA 4KUCD 5CUSL 3BGMA 3D48R 4R97C 5LG1A 3VXPA 5EO9A 4DGIL 5JOEA 3H9SE 4X4MA 1HOCA 5FUZH 4N1CA 3GBML 1YC8A 1V7NL 2XICA 4CVWA 4ONFL 4YC2C 2EZ0C 3BE1L 4R4ND 3WLBA 1G7PB 1QEWB 4ZFOA 1JGEA 2E8YA 3BWAB 4OCMC 1XCTB 3QUZA 2OL3L 3I50L 1B0RB 3EJJX 2JIXA 3T0AA 5TH2B 4DGYL 4K3JH 4X9IA 1AO7D 3LEVH 3MSPA 4LPVA 1NUDA 4P2OB 3MLYL 4UB0L 4Y19B 2CRMA 4GS7C 3KWWB 4V1DD 4DVRH 5A40E 1FNAA 3MRRA 3UTZA 4QLRA 2H1PH 4U1MA 5MERA 4NCDA 4MDIA 1BX2A 3L5XL 5IVXF 4HT1L 3NFPB 1WICA 3QEGH 3FB7B 2QADB 5J1AB 5IB3B 3D3VE 5DQ9B 5D1QD 2V17L 3LQZA 2EDLA 3F7VA 3FAWA 3LSOB 1FGNL 5C6TH 1XFPA 2VAAB 2P43B 1I7ZB 3RHWK 3W0WA 4XB7A 1BBJB 3UP1A 1A7OH 4PJIB 4XVTH 1G84A 2BZDA 1G7MB 4KKNA 4QOKD 1NFIA 1A7BA 3G6JB 5E4EC 4CVXB 4O51B 1QLEH 1FO0B 5GS0C 5HYQA