5D6DC

Crystal structure of gasdalie igg1 fc in complex with fcgriiia
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
167
structure length
157
Chain Sequence
AVVFLEPQWYRVLEKDSVTLKCQGATQWFHNESLISSQASSYFIDAATVDDSGEYRCQTQLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVQITITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Structural characterization of GASDALIE Fc bound to the activating Fc receptor Fc gamma RIIIa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 20
structure length 157
sequence length 167
ec nomenclature
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d6dC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d6dC02
3I75B 1TJGL 3MUGB 3TH3T 1HN1A 2X1QA 4UT6L 3LKSB 3EYFA 4LAQH 1BQUA 1YECL 1F4WL 1W8OA 1YN7B 3QUKA 4JREB 1T04A 1Q8MA 2VOTA 5EFIA 5HI4C 4EI5A 1D5BB 3BYTA 1G6RA 1M05A 3MRGA 4U4BA 3KLSA 1IMHC 4PJAF 5CEZL 1CFQA 4Z95H 2O5YL 2OR9H 4H8WL 3PHQA 4PD4K 1F58H 3MNWB 4LHUA 5EDXA 1CDUA 3JWNC 1CFSB 3MLZH 3MBEC 1JPSL 2HTKD 4HF5L 3SKOB 1I1RA 2YN3A 5F88B 3RBSA 1OSZA 4OQTH 1H3UA 4PS4H 1AP2B 4F57H 5EOCL 2F54A 5F7NC 3VWKC 1QG3A 4XH2A 3T4AB 3U0PA 5I76A 1BFVH 1KIQB 5KAQF 3QWRD 1YMHB 3C87A 4WFFD 3RY5A 3D39B 4PGCA 2X4PA 3ZTJH 4Y5XB 1BJ8A 5I8CA 1NDGB 1YNTA 1G0XA 5GGVH 4FQ2H 3VRLF 4HHAA 4DTGL 3DUSA 5E2VH 1G6RH 3CFJA 5EBLA 3S36X 1WC7A 1TMCB 1VEOA 4MJID 2ZG2A 3EAKA 1K4DB 4KHTL 1CK0H 4OD3L 3WJJC 2A6IA 5F44A 2AXFA 1TVBB 4OCXL 3QJHB 2ATKB 2NY2D 2NY5C 2P43B 2O61B 4QOKD 1MCRA 4M6OL 1I3RB 1LDPL 5F3BB 5TE6L 4X99A 5I6XB 3MV7B 5IEKB 4G43B 1EH9A 3CX5K 2AXGB 3TPUA 1CFTB 3PGDA 4ETYA 1GOHA 4TPRL 1J1XH 4HDIA 5A2KH 2F15A 4M7KH 4XZUB 2DQUL 4W4NA 2PN5A 1RHHA 4G8FA 2FSEA 3OGOE 3G6DH 1OW0A 2A73A 4IOIA 4XMKL 3WFZA 4N0YL 5I73B 3BGFC 4QHUA 1SJHB 2C3WA 5GS0D 4Q7DA 2J8UA 3SO5A 1ZGLA 4XCCL 3WFHB 2HFFB 4Z77B 5IR1B 2WUCH 3IVKA 2VXTL 1OTTD 3M8OH 1RZGB 1DEEB 4F58H 1DBJH 5C0JB 3V5HB 5DRNB 3GK8H 3FT4A 3A6CH 4G6AC 2OBGA 4RAUA 1QHPA 1CTOA 2QL1A 1LO0L 4PRID 5CMAA 1E27A 4KK5C 4N8VG 5GISH 3WXVL 5J1AB 3OR7B 3T09A 1TTFA 3H2WA 4NO2A 4L8SC 4K23L 2JTDA 2Z91B 3LKNA 1RZJC 2D03L 1NCAL 4O2CA 3SQOL 3V0WL 1TQCC 2FBJL 2OSLA 5TF1L 5HBBA 4PLJD 3OKNB 2XWJB 5K9JH 1LK2B 3I50L 3UJIH 5ECJE 3QISA 1UJTA 3ARTA 4JG0L 5HYJD 3QEGL 4CMMA 5E9DB 3LVEA 1XR8B 2AXHA 4NNYB 3NN8A 4D9QE 4I0PC 3BPOB 2VZUA 2BSTA 1ZV5A 3WDHA 2X9YA 4GUPB 5GIRB 1R3JA 2P7TA 3EO1A 4N8VB 3GMNB 1IGFH 4U0QB 4Y4KB 3F7PC 5FYKD 3QI9A 2HT2C 5JUEH 3E8UH 2YPKB 1QQDA 4LSVH 5CKGA 5DSCA 2YBRB 4JQVC 4HEPG 4PJDE 4HPOL 5E2WH 3TNNA 4J1UA 4ONGL 4YHIB 4Q6IC 4MNQE 3IDUA 2FIKB 2ENSA 2V9TA 5TF0A 5DFVC 3FT3B 1OHQA 3CSBA 3I75A 2A1WL 3LSOB 4GSDL 1DQTA 1MCOH 3LKSA 5K9OB 2EC9U 5TFSL 2AJVH 1YN7A 1G7QB 3NIFF 3KXFD 1G7PB 3VWJC 4Z7VF 2FJFB 2Y06H 1J0ZA 3S4SG 1LE9B 2QSVA 1HCFX 2RCSL 5EU6B 2BHZA 2Y7QA 3D0VB 4OFKA 3EIFA 4RMQA 4PLOB 5SWSD 5HSFA 4GXVH 1MCFA 5JTWA 3GMLA 4Q9RL 2R9HD 4DFIA 3MV7E 2XA3A 5F88A 5B8CC 4F7EB 4DKEH 2FWOB 1U6AL 1WWBX 3QFJD 4PGEB 3AY4A 3CXHK 3X14B 2MPAH 4MNQA 4QWWD 1YMHA 1MSPA 1FO0L 5FYJE 2B1HH 4TSBH 1NDGA 2EYTA 5EC1B 2X4OA 5DMGD 4NO3A 1GJIA 1E6OH 2WLYA 3KJ4B 1EVTC 3S4SB 5CZXC 1ZANL 3IU4H 1IGML 3QULB 2ID5A 1K4DA 5LGHH 3QT2A 4L4VE 4N5ED 1T3FB 2Y5EA 1JN6B 4NBXB 5HD8C 2ATKA 1RZIB 1KELH 3BPLC 4NWTL 4QO1A 1VSCA 1S8DA 4CRPA 1YYLL 4AYFA 3E0GA 3HE6D 3ZL4L 3REWB 4LPWA 1J8HB 2NY6C 5F3BA 5E03A 5DYOB 1II4E 1OLZA 3MV7A 4G43A 4ODBD 4OV6F 2AXGA 1CFTA 1K2DB 2ZNWA 3L3OB 2WW8A 3O8XA 4Y19B 4XZUA 1NKOA 3C6LA 4L4TE 4LDEB 4J4PA 2Y5TA 4KUZH 4HXAL 4AEIL 3HI1A 4LQ1A 1SJHA 3BEVA 2CK2A 2HFFA 5FO7A 4Z77A 5IR1A 4NJ9L 4POUB 1XMWA 1RZGA 1DEEA 5C0JA 1VGKA 4CU8A 3V5HA 5DRNA 4L4VA 3HS0A 3DVNA 3OKDB 1JFQL 1FZJB 3HMXL 3EFFA 5JNYA 2BMKB 1FP5A 1JE6A 2XZAH 4FP8L 5J1AA 2VC2L 5GZND 1RIUL 4JPVH 5D1QC 1UH4A 5CBEB 1DL7L 4GW5B 1CVSC 4F7PB 5D93B 3LDBC 4C54A 3SO3C 3OKNA 1DVFD 4KJPC 5I1IL 1X5FA 4KY1H 2F58H 4FG6D 4AQ1B 1OGAD 1K6QH 4NNYA 5JW5A 3O2WL 3QXDB 3KAAA 3HR5B 3QAZB 3DBXB 4KVCL 4ZTOL 3SDCA 5DEZA 1G7JA 4ODSH 4NZRH 5EU6E 5GIRA 3KNBA 3GMNA 3MPCA 4N8VA 1FE8L 4P5TB 4Q0XL 4JHWL 4Y4KA 4NT6B 2H3NB 4DFHA 5EBMB 2R1WB 4W68A 2ZUTA 2YPKA 4MAYD 2NZ9C 2PYFB 2P5EB 1CL7H 2BJMH 1TVHB 4HIXL 5J56B 1PFCA 3IFOA 1NBVL 1SMAA 4YHIA 1FVDB 4ZAKB 1UXWA 1YMMD 2GY7B 3PWUA 4ALAH 2FIKA 3IDNB 1MVFA 2YR3A 3FT3A 2YD8A 4JO4L 4MNGB 3UTTE 3O2VH 4UOJA 1KOAA 5INCB 1DQJB 2IC2A 5CCKH 1ZE3C 4MA8L 3P3YA 4H88L 2P8MA 3WEXA 4DJMA 4YXKL 1UM5L 1G7PA 3IXTA 4LARH 4HWNA 5I1HL 3DMMB 1LE9A 4K2UH 3VRJB 1UJ3C 5EU6A 3VXSE 5CSGA 1A1OB 1JNHB 4HMCA 4CNIB 2QADD 4GG6B 5DF0A 2BVYA 4HGWB 5TDNB 3B9KA 2EDDA 3B2VH 5J8OA 2VL5A 5C3TA 2VDPL 3EGSB 4F7EA 2FWOA 2CLZB 4PGEA 1SVCP 5L8JB 2D9QB 3AB0B 3X14A 2YD7A 1Y0LA 2Y9RT 5FYLD 2V9RA 1F3JB 3H9HB 1MNUL 4GRMA 5ANME 2DLFL 3C6SB 1RUAH 5EC1A 2NZIA 3NFPB 1ZOXA 1K8DB 5ETUB 3P0YL 5HHMD 3S4SA 2D7PA 3GZKA 5FGBC 2EDJA 3QQNA 4ODWB 4G9FE 4TTDD 3QULA 1QSEE 3ZZ1A 1T3FA 43CAB 3GHBL 3BN9D 4MJIB 3F5WB 4LCCB 5F97E 2IPTL 3U1SL 5KSUB 1D5MB 1AQKL 2NY2B 3KR3H 1J8HA 3MACH 1YYMH 5F21B 5DYOA 3Q2CA 1JYXA 3JTTA 3ARRA 5KVFH 2VIRA 2ZUSA 4QOKB 3DIFB 1X9QA 4P59L 1K2DA 2ATPA 2YMXL 4Y19A 4FS0A 3MUJA 4P9HL 3ZDYF 1CDBA 1A7RH 2VXUL 3WUZA 2VAAB 3KPQA 1WUNT 2ZPKH 4G6AD 2C3HA 2HYMA 3V9FA 3U9PH 4RGNC 4U1KB 4KPHH 3ZE1E 4JM2D 3UBXB 1ERNA 1JTPA 5J4MA 4UUJA 1INDL 3OKEB 2GY5A 1KTDB 3K2MC 4BK5A 5KZCD 4G9FA 1QSEA 3R06A 1P4BH 4AJ0A 1WLHA 2BVQA 3N1MC 4K3HA 4Z7QE 5L6YL 5JR1H 2XOTA 2WQ8A 3C09B 4R8WL 3LY6A 4UOW1 4YHOL 1Z9MA 5CJQH 1EO7A 2BMKA 3RZCA 3FQNB 2RQ8A 1KXTB 3SCMC 1QFUH 4PRIB 4FZEL 3CFDB 4LSRH 2IFFH 5CBEA 3O11B 5AWNH 4GW5A 5ITBL 3H7LA 1RUPH 4I0PD 1XF3B 3WL9B 1YEGL 3OKOA 1JWMB 1QKZH 4X6DE 5MHSE 4I8DA 1XIWD 2HT2D 4OSUL 2JCCE 3TCLB 5DC0A 2W0PA 5HYJB 3QXDA 3HR5A 4YZFE 5C6TL 1KGCD 3IRPX 4POYA 2OK0H 1Z0MA 4WW1B 2EDYA 2OS7A 5IBUG 5EBMA 3TO4C 1D5XB 3IXAB 5I9QC 3EJZD 2NNAB 1G9NL 2P5EA 3OAZH 3NACL 5D70L 4DK6A 1TVHA 4JO2H 2ADJB 1RZKH 1FVDA 4Q58C 1XAUA 2YWYA 4R0LC 4ZAKA 4PJIE 1LE5A 3IDNA 4L8CB 3MLRL 4PTTB 3ZT6A 2LV4A 1TTUA 3P2TA 4MNGA 4Q2ZB 4ZFGL 5INCA 4AEHH 1FYTD 1F00I 5L88H 2CIKA 5DFTA 1IQWL 3N50A 4ZO8A 3BFOA 4OLUH 1U8LB 1OARL 3ARDD 1IZJA 1BVZA 3T0EC 1N6QL 3LD8C 3B43A 4NO0D 5IBUB 3I6LE 1OOAA 3PDGA 4M7KL 1WFTA 1QRKA 1X5IA 3KXFB 4F3FB 3MLXL 3VRJA 1WWWX 5I8KH 4XVSH 4HULB 1JNHA 5IBTH 3SE4A 1ROWA 3LS5L 5C2BH 4GG6A 4YDKH 5ILTL 2VUOA 4L8DB 5SWSB 5BS0E 3EGSA 4F58L 5ADOH 2CLZA 2VDNH 2OCFD 2FD6H 5CZXD 1QPXA 1MRCL 1ZHNB 3NPZB 1QRND 4JFHD 1F3JA 2DRUA 3EOTL 3NCMA 1A9EB 3H9HA 3QFJB 5DJZB 3MXWL 3KYAA 4XC3H 5DD3H 3OJDA 5F1IB 3NFPA 1K8DA 1B2WL 5ETUA 5E0QA 4LL9A 5SWZD 2GKIA 3Q3GA 3TGXA 4ZUTA 2GSGB 4UU9B 4ODWA 5IHLB 1VPOL 2NY6D 3CDGB 2YZ8A 3BD4A 1T6VN 2HJKB 3WNNA 4YHZH 32C2A 1FNLA 3F5WA 4LCCA 4WUKH 1FQ9C 1TCMA 4OTXL 4GXUM 2IANE 1R5VB 1D5MA 3FONB 5BQ7B 3CIQA 2X40A 1N7ML 4JQXC 5C0BE 4N0UE 4QOKA 5BS0A 3DIFA 3RY4A 5KG9B 4O9HH 5FUZH 3P9WB 1SHMA 5MEOA 1A14L 3BX7C 5F7WC 1A4JB 1AGEB 1F4YL 1SMOA 3EYQC 4LAJH 2IEPA 3K2UH 2FGWH 2VAAA 4RDQF 1QR4A 1MAML 4N9GB 5CJBA 1PY9A 1ZA3B 3WLWD 4U1KA 1U8NB 2IMMA 4G6JL 4WI3A 5E2WL 1NAKL 3FMGH 4OGZA 4K3DL 3MBXL 3TA3B 4NOBA 2UWEE 4R7DB 4MJ5B 2D0FA 5D1QD 4BZ1L 1BZQK 1AE6H 4IRJC 3BPCA 5F89A 1JMXA 3VFVB 5BMFH 3HZKB 1DLHA 3MZGB 3AM8A 5FYKE 3SBWA 3FQNA 2IANA 2P42B 3KYKL 4WI2A 1JCKA 3CFDA 1WGOA 5C0BA 3QQ4B 3BGMB 3OSKA 3O11A 4UDTB 4MMZC 5KVEH 1XF3A 3WL9A 5I1JH 4FTVE 5J13C 1A02N 3FN0L 3MLSH 1JWMA 1WF5A 1QBLL 3VXRD 3H0TB 3QDAA 4FXGB 5GS0H 3V2AR 1NCCL 5H94A 1Q9KB 3OQ3B 5E99L 1DVFB 3R1GL 4DKFH 4TSCL 2NZ9D 1AY1L 2R56L 2YHGA 1OGAB 3CD4A 4UAOB 2ARJA 2UWEA 5HVHB 1N5AB 3I9GL 4GOSA 1CIDA 4LGSB 2CK0H 1FNHA 4PRNB 4WW1A 4TSBL 5DD5H 5M94B 1D5XA 4OIBA 4PV8B 3F58L 3IXAA 3NZ8B 5MEND 1MHHB 1X4YA 1E6OL 1INQB 4HIEA 1N8ZB 4MAYB 2ADJA 1P84J 2XA8H 4XMPL 4HIHB 4A2LA 4OZIB 2D7TH 4PTTA 5IB5B 1YMMB 4Q2ZA 2DICA 2X6MA 4X6CB 1U41A 3ZSSA 4YC2C 4EBQH 4E42B 3M1BA 1DBKH 3PV7A 4XBEH 4LSUH 1U8MB 1U8LA 5F70A 4LEOB 4HC1L 3ARPA 5I1GH 2IBGA 4JPWL 4F3FA 3KXFA 2VN4A 4PREA 5HGHA 2E3VA 1X5KA 3UC0H 4GT7A 4OCRH 5FYKH 3UEZA 5HYFA 5I8OL 4AZ8A 2ITDA 5IVXB 3IAQA 4JRXE 4NQEE 5IK3B 3WBDA 5JW3H 4L8DA 5SWSA 2DMCA 1MVUA 2EXYC 3ZKXC 2Z92A 2QADB 4PV9A 1V3MA 1FHGA 3TV3L 4Z0BH 1E4WH 1Z9LA 3F7YA 5E8DL 4FABH 1ZHNA 2AAVA 4RWHA 1MAJA 3U7YL 3W82A 5E2TL 5F1IA 2VTFA 2F5AH 4DGYH 2DIJA 2ZUXA 4U6VH 4OZ4B 2GSGA 4UU9A 5D7LD 1UWGH 2HJKA 4QNPE 5HHMB 2APXA 4QXTA 3U79A 3K8LA 1L0QA 1Q9LB 5FYJL 3RWDB 4ZDHB 5FAAA 4YHLH 2XRAL 2FCBA 4LKCB 1H5BB 3FONA 2X4RB 4XNMA 1FFNB 1KTKE 4DN4L 3HE6A 5CSZA 4RGND 5KG9A 4X6BA 5DJ0A 1RJZB 1NBYA 2X4NB 1JHKH 2GSIB 1A4JA 3T0XA 3L95B 3QDGE 5IB3B 1F2XK 1P6AB 1CS6A 2CUMA 2GEEA 1XR9B 3ULUC 4N9GA 4WW2F 2MCPL 4XVUC 4KMQA 3BT2H 1AGBB 2J2ZA 5C7XL 3P77B 4ZS6D 2VLJE 3E2HC 1OGAE 2HKHH 1CE6B 4J23A 4R7DA 4JM2B 3SKMB 1CDJA 3LHPH 3QIWD 4Y5VB 4I9WD 5SX5K 5KZCB 3LZFH 3HZKA 1M71B 4FQHB 3ZT5A 5CCKL 2GK0A 3U4BL 3ZYJA 2DWEB 4NFCA 4ORGB 2IPKA 5D96B 3V4UL 2B1AL 3QQ4A 3OXSA 4UDTA 2PYED 3S3SA 3DURB 4XB8A 3RPKA 2VJXA 3WIHL 2NLJB 5EO9B 4B41A 2AJUL 4A6YB 1BAFH 1FG9C 3CVIH 1JWUB 3QDGA 4ZFOB 3H0TA 4I0PB 1GIGH 3T0VA 2E6PA 1PGRB 4FXGA 3B2VL 3J8F7 5HDBF 5JQHC 3CX2A 3L5HA 5EUKB 1Q9KA 5T3XD 1DVFA 1XIWB 2ZOLA 1UWEL 1OGAA 5IMMB 4LCUB 3DNKA 4OF6A 2A9MH 3VFGH 1WBZB 1GGBH 1N5AA 2OR7A 2C1PB 3K7UA 4PV8A 3NZ8A 4P2CG 1H3PL 1MHHA 5D9SB 3I3DA 1N8ZA 3VXME 3OZ9L 4MAYA 3V5DB 1N4XH 3X13B 3N85H 4ZO7A 4EDWH 2QKIA 4O58L 3DI3B 2R2EB 4HIHA 4OZIA 2X1OA 1YMMA 4NN6B 3T2OA 4AQOA 3RIFK 2VRAA 2G9HB 2DF3A 3MFGB 5D7KE 5SV3A 4TSAH 4PRHD 5T5NG 2NYYC 4LEOA 1FYTB 3ILPA 1JRHH 2V5RA 3ARDB 5DEFA 5HHPB 4WUUE 4NO0B 3ZHDA 3ZTNH 4ZPVA 2OLDA 5IVXA 4MB4A 5IF0B 2XN9E 3R8BB 5E6ID 2BVTA 2O5XL 4IIQC 1MCWW 2J8UF 5IK3A 3VWKA 2QQLH 4J3WA 1V3LA 1NC4D 1UM4H 1FH5H 4JJ5B 2EKJA 4AM0B 1BD2D 5AEAA 4HUXB 2OTPA 5JHDD 1CG9A 3DXAD 4DGIL 4KHXL 4AH2B 4X0KB 1IEHA 2N1KA 5AYQA 1QRNB 2R8SH 1P4LB 3VGEA 5EC2B 4LSRL 2IFFL 2XQYG 3BPLB 4KAQH 4KKLD 3RFZC 5SWZB 1ZHKB 1Q9LA 3O4LD 1QKZL 2NY6B 2A9NL 4ZDHA 5DRXB 3WSQH 5C08E 3WNKA 1B6UA 4LKCA 3EYQD 2XN9A 4TULL 2XNAB 1IFHH 1FL5A 3W9DB 4RMUA 1DLFH 5FO9B 4KGLA 4UINH 3MCKB 4PR5A 2AK4D 2ZCLH 3TVMD 1RJZA 2ZCHL 3DLQR 2GSIA 1TQBC 3QIBC 3WXWH 5E8OB 2L7JA 3L95A 2PR4L 1XR9A 3QP3A 1NFDE 4PB9H 2GTZB 4IRJD 1S7QB 3M17B 1RJLB 1UZ6E 1EFQA 4MQXC 4Y88A 3QB7C 1PEZA 2VITB 3HMWL 3ARUA 1A1MA 5B38G 3LIZH 3QFDB 3SKMA 2QHRL 4C56E 1JIBA 3ZSTA 4XI5D 5D1QB 1QA9A 4AEHL 3EO9H 5DHVB 3ARVA 3ZKND 4YDLC 5JW4N 2DWEA 4ORGA 3BOVA 1T2JA 4LU5L 3DURA 5BV7L 1EHLL 2GQHA 2NLJA 2EZ0D 1IARB 1MY7A 5I8KL 4AEFA 4PJFB 4XXCC 4S1QH 1EVUA 1IAIH 4PJBB 3BPNC 4A6YA 2CJUL 1IGCL 5C2BL 1EAJA 1J12A 4ZFOA 1GZPB 4NKDA 4I0PA 2W60A 5B38B 4XAWH 4LLQB 1FVCA 3VXRB 2WP3T 4RGOH 2HRPH 4FMKA 1FYTE 1UEYA 2NY1D 4DOHE 35C8L 3NPSB 1NAMB 1F97A 3TBYB 4LCUA 4K07A 2BVPB 4WJ5B 5C0RL 4JKMA 1WBZA 4YGVA 3VD3A 4JQVA 4HW6A 2PNDA 3UTSD 4NRXB 1RZJH 2C1PA 4PJ7B 3HLAB 3AS1A 3IB4A 1L0XA 2ICES 2QQNH 4LDOB 3FO1A 3F7VA 4Q6IA 3U2SB 1VA9A 3QDJE 1FGVH 4GBXC 5MENB 3V5DA 4X6FB 1BHGA 2J4WL 2JJWA 2LU7A 4WHCA 3TIEA 4A6YH 1FORL 1CYGA 2R2EA 3HFMH 3CMOH 1YEEL 1KLUB 3D0LA 4JFHE 2FGZA 3L6FB 2Y36L 2G9HA 4M7LT 1U8IB 3RUGB 1UJ3B 3WNOA 3DSFL 4OZFA 1FYTA 4JPKH 1XF5A 2EXYD 4GAYB 5D2LB 1IGJB 1BIIB 1GGYA 5ID1B 4NO0A 5B8CA 2BK8A 1FZOB 2X4SB 1WT5A 3V95A 4M62L 4PBWD 1NEUA 5IJVB 4OF7A 2PTVA 5LAXB 1L7IL 4JJ5A 4AM0A 5I19L 1E28B 1YN6A 3MV9D 4D9LH 5C1MB 4AH2A 3IDIB 5BMFL 4YXLL 4X0KA 1BF2A 4JY5H 2DQGL 4U0RB 3KLHC 4OZFH 1IKFL 3BYYA 2YWZA 5EC2A 2XTLA 2NTSP 5H2BB 5HVWA 5B39A 3RU8L 4WIQA 1A6PA 1ZHKA 5KVEL 3GUTB 2HRLA 3KPPB 3MZTA 5D7LB 1WK0A 2IH1B 4TVPD 4GH7B 4HKJA 4XP6H 2CR3A 4DVBB 3M07A 1EPFA 1RUKH 3WIIL 1Z5LB 3IGAA 2FR4B 3BZ4B 5F71A 2XNAA 4OZGE 4DKFL 1E6JH 3W9DA 4HH9A 4YUEH 3JV0A 4KROD 3I6KA 1C08A 3MCKA 1YJDC 4I2XB 2CDEB 1OM3L 5E8OA 4RGNB 1AKJD 3OG4B 4X5XB 3MA9H 4PJCE 5DD5L 1E4XL 1NPUA 4HS6A 4Y16D 1S7QA 3M17A 4OFDA 3QEUB 4KQ3H 4KXZH 2VITA 1WBXA 4XVTH 3WFCH 3MXVL 4ODXB 2D7TL 4JY6B 4LLWB 4LLVA 4XPGH 5D1QA 3EYSL 1KB5L 3QIWB 4K8RC 2AS5M 1J8KA 5DHVA 3W2DH 2DQTH 3KPMA 2HT4C 3H3PH 5E4IA 1C7TA 3G5VB 1UKTA 4LMQE 1T0PB 1MCQA 1HHIA 3O0RH 2H8PB 1AIFA 5IIEA 1T7ZA 3FB6B 4XPFH 3ULVL 3V8CA 4L29A 2YD6A 3B9EA 4WV1C 1S3KL 5DJ6B 2OL3A 3MJ7B 3Q6FA 2PYEB 1T4KA 4X4YA 3PIQA 1U91B 3VD5A 4K3EH 4OJFH 4M7LL 3SDAC 4QLRA 2HVKA 3VI3E 5B38A 4LLQA 1AO7D 1XGQA 4P3CH 2Q8BH 3RWCB 1UEMA 2PCPB 4ONOA 1EEYB 1AC0A 1NAMA 3TBYA 3MRBB 3P40A 4WJ5A 3SDDD 1JNLH 1HYRC 2BVPA 2J3SA 1MELA 1JGEA 3B4NA 4TNWF 2NY3C 3P4MB 4NRXA 3GSNB 4P2YA 3SDYL 5F9DC 3HLAA 2JK5B 2WWMD 3LQAH 4NC1C 1PKQB 5IFAH 4E5XA 3U2SA 5DVMA 1I8KB 1S7WB 1SEQH 4UOW0 4BFEA 5MENA 1UWGL 2LFGA 4X6FA 5E8NB 2OL3H 4RQQA 1FGNL 3QR2A 4YX2L 1NUNB 4U1NB 3SOBL 1QUNA 1FCCA 1NUFA 1DQLL 4AT6B 4YHLL 1KLUA 5E2JA 2ICWI 2MQ0A 5C0AE 3WYRA 1ZLUH 4I18B 5DXWA 1EO5A 1JPTL 1NAMH 1U8IA 4BUHA 5IWLC 1LK3H 1U2HA 1WWCA 3W0WE 4ZMAT 1UJ3A 4U1MB 2W65A 1NSNH 3T0WA 5D5MB 4I77H 1MIMH 1T7XA 5CEYB 4GAYA 5D2LA 4PRHB 1MJUH 1IGJA 3Q6GH 1BZ7B 5ID1A 4NJAL 4OLWL 1FZOA 4JFZH 5IESL 4UB0H 4X6EA 1B0WA 3B9DA 3TYGL 5KSBB 4FRWA 2OI9C 4JANA 3C8DA 5LAXA 5E6IB 1J0YA 2XZQH 1V5JA 1MAKA 4S1SL 3G6AB 4RGNE 1NC4B 1BM3L 2ZOKA 4P23C 1E28A 4PLKC 2A6DB 4BSWA 3IDIA 3PABB 4LNVA 4TUKH 1BD2B 3FQWA 4F33B 5JHDB 3DXAB 5C0AA 2DD8H 2E8YA 5J6GA 3RNKB 2VYRE 3EBAA 5H2BA 3VRIA 5GGSB 3W0WA 1YNKH 3NMEA 4Z7UE 3OAYH 2MHAB 3GUTA 3KPPA 2DQJH 2IH1A 1BAFL 1IE5A 3W5MA 5TDPA 4P46C 2EDWA 1U42A 1RIHL 4FXKA 3O4LB 2XT1B 3QUXD 4PRDB 5IQ9B 1Z5LA 4S0SD 3PGFH 3S36L 2O26U 1YEJH 4HBQA 2LVEA 1LMKA 2RHEA 5SV4A 3WNPA 3L5WB 2SEBA 2EXWC 4MJ6B 3JZ7A 3MGOB 5DUBB 4ODTH 4YBQC 3RL1B 4U1JB 1HXMB 1IGTB 4K55A 4I2XA 5FA3B 2CDEA 2EDXA 2O5ZH 4XCYA 4H8WC 3MRNA 4Z7QF 1YA5A 4X5XA 2AK4B 3TVMB 4JRWA 2BC4B 3T1FA 2Q1EA 3VGAC 4WTXA 4YR6B 3OAZK 2IBBA 1IBGH 4R3SB 3FOMB 1N4XL 4OCMC 4IRJB 5JIPA 2H6PB 1NGQH 4QYOA 2QJDA 3VFSB 1UACL 1OY3B 4EDWL 2ZUQC 4MDJB 4ODXA 1F11B 1FDLH 5CZVL 1NGZB 1C5DB 1KCVL 3VXNB 3QIWA 3SE3A 1KT2B 2AW2A 4P57B 2WSKA 2YRLA 2B2XL 5KANG 5BOPA 5J13B 1S9XB 4BH8B 3KLAB 2H8PA 2ZKHL 3FB6A 4LRNL 4XPTH 4YZFF 4R2GC 5DJ6A 1Z9OA 2R0LL 2GJ6E 1IC1A 2AK1H 3ARBD 3T0EE 3U6RB 5J12B 2DM3A 4GG6F 1LO2H 4RMSA 1SBBA 3QUYC 5IM7B 3BQUC 5D5ME 3MLTB 1MFBL 3RWCA 1UQSB 1Q94B 2ESVD 4QF1B 3QRGH 2P44B 3SDXB 2VLMD 1AFVL 3MRBA 3TO4A 1ZKAA 3V0VB 5L2JB 1JVKA 4P3DB 2NY1B 5I18H 5BZDB 3BZDA 2MKLC 2YUZA 3P4MA 4KDTA 5H37G 3UZEA 1FIEA 1JNNL 2ZJSL 4AL8L 5JPMB 43C9B 3UTSB 1VFBA 1T0MA 1I8KA 1S7WA 1MLCA 1N64L 5E8NA 3QG7L 4GW4B 5HDQL 1CGSH 4P9ML 1UM6L 3UO1H 2DLHA 1JYNA 1J11A 2OR8A 1DE4B 3BSZL 1ORQB 4N1EA 4RFNB 2OTUB 3WSQL 4TOYL 2PF6A 4XPBL 4AT6A 2J12B 5FM5M 1HKFA 3T0EA 3FB8B 3CX5J 4JGJA 5GRZA 1KLGB 1MJ8L 4I18A 3RTQC 4MLIA 1AHWC 5T3XH 1DLFL 5CEXB 3NAAL 4U1MA 4ELKB 3RJQB 4UINL 4APQB 5D5MA 1NMAH 4PRHA 3WXWL 1BZ7A 4R97C 1T1WB 5IKCB 1TPXC 1DBBL 4L8BA 3PQYD 3C5ZD 5CP7B 5DUPL 3RWGB 1ACYL 2Q20A 4L3AA 3WHE1 3CK0L 1I7ZB 3DV6A 5KSBA 2NY5L 4G3YH 1F5WA 1FIGH 1MCJA 4O5LH 3U4EA 3KLHD 3DECA 4L9DA 5KVGH 1MCCA 2DJSA 5C09E 3G6AA 2H2SD 1MIEH 4MCYA 3NZHL 4UMGA 5C71A 3PABA 3GEWB 2VUYA 4PJEE 1BD2A 4L5FH 4OI9A 1MLBB 3MV9B 5JHDA 3JV6A 2FYYA 1RZ8A 4HCRA 3TNMB 2NX5E 4KWUA 3B2UC 1V8HA 3O81A 1ZS8B 2VLKE 2I25N 5GGSA 3F7QA 4HK3J 3S35H 3TBWB 5L9DL 3GMOB 3BP5B 1UCTA 2C3XA 5EBGA 1Q0XH 4JDZA 4KKCC 1CDIA 1HILA 4PJ8C 2Y72A 5IQ9A 3GSUB 12E8L 4XAWL 1OGTA 5E56A 1R3KB 2HRPL 3L5WA 5CD5C 2VSDA 3MGOA 4P2RD 1Q1JH 5DUBA 3RL1A 1HXMA 1E4XI 1IGTA 4JDVA 5FA3A 5K9QI 1UFUA 3MROB 2UWEF 3DX8B 4MNHA 4KROB 5F7EH 3C60D 1KJ3H 4HCRH 2XZCH 2BC4A 4H1LB 1H0DA 2X9WA 4KMTH 4PJEA 2EIEA 3E2HB 3FKUS 5DK3A 1AKJB 1QLFB 3BEWB 4R3SA 3H9SE 4ZOBA 3RI5K 4Y16B 4PGJA 4K8RD 4IRJA 1W72B 3VFSA 2HT4D 5HDOA 3EUUA 4OV5B 5EZIH 3R8QA 4LIQH 4M02A 5FGCB 4M5YL 3RVUC 3VXNA 3C2AL 1IEBA 5ISZD 2NW3B 2QV2A 1OQOA 4P57A 2FATH 7FABL 3T1WA 2FEDC 3SDAD 2F5BL 1Q72L 2ICWJ 1MFAL 3BWUC 3MNZB 1XGRB 5JOEA 5I30L 1QNZH 3EOBB 3GJFA 1F8TH 5HHNA 5GZOC 3W11C 2NY0C 2EO9A 4G8GE 2NY3D 5DZOA 5IGXL 4RZCB 5IM7A 4W70A 3MLTA 4FQXD 3H9SA 1UQSA 4M43H 1JMZA 4QF1A 3BH9B 1EBAA 1AO7B 3SDXA 1KJ2L 1FFRA 2Y07H 4P3DA 1SYSB 5KTEL 1VGEH 3NFNB 5BZDA 3HUJE 4GRLC 1NCBL 3SDDB 4R26H 2BY0A 3VGDA 4PRPE 2EDTA 1QYGL 3LEYH 3MCLL 5KVMC 4GKZA 4G6FD 2CKBL 3UTSA 3GJFH 2A6JB 5I15L 4HFWB 4I3RH 1JI1A 2ICCA 3SE8H 4E0RB 1YUHA 4GW4A 1I9JH 2CO7B 4P4KD 4OLEA 4WI4A 1DE4A 1PLGH 5MEQB 1F4AA 2OTUA 3M45A 3CAFA 1GPOL 1IEAB 3B3IA 5CGYC 4YUEL 2ZSVB 1ZEAH 5CEXA 3GIZL 2FX9L 3B5HA 3LKOB 1VHPA 4JHBA 3VW3H 4LBEB 2VLLB 4TYUA 4G42A 5F9OL 3HG1D 5IKCA 1E4KA 1OCWH 1OTUD 3RWGA 3EHBC 2WMPA 3HUJA 4TVPE 5LCVH 4RCAA 4WFGE 5I1DB 1C8PA 2X05A 4PRPA 4XP1H 4Y2DC 2LVCA 2XTJD 3ULUE 3B8SA 5GS2H 2AJYL 4OAWB 5CJXC 3K1KC 4Z5RA 4RNRB 2R4RL 4OCNC 3D9AH 3MX0A 1MLBA 3FQUB 3MV9A 3OKMB 4Z7OF 1CXKA 2Q8AH 3TNMA 1GOGA 5EO1B 4ONFL 3UJTL 5H37H 5A40E 3SJVE 1GGIL 1ZS8A 4ZG1A 1I1AD 3PL6D 4XC1L 2EXWD 2APBA 3TLRA 3BP5A 4IOFC 4IJ3B 1FZKB 1VFAB 1OAQL 4YBQD 5CEZD 5K9KB 1RUQH 1F4XH 3HZMB 2BNRD 4JY4B 4JKWA 5KSAD 1D9KC 4IMLB 2CO6B 1DN0B 1U93B 3GSUA 3VGFA 1P6FA 2R23A 4P3CL 2F8XC 1R3KA 4ZUWB 1LQSR 1NJ9B 3QNYB 5HYSG 4CW1A 3BO8B 3QUXB 5SX4I 4DWHA 2OJZL 5IUSA 1LWRA 5EBWB 2GJZB 5F96L 2HLAB 3KYNB 4YDIH 3MROA 4F7MA 3IDGB 5E4EB 4WI7A 4F80A 4OGAD 1X5ZA 5FGRA 5ABDE 1AKJA 5C0NC 5LXGL 1JF6A 3LN4B 2BNUA 1QLFA 1MPAL 3TFKC 1W72A 1IM3A 1QLEH 3EDJA 4FQPA 5HHVL 5JIIA 2XG4A 5T1MB 4LCIH 2QHLA 4OZIF 2YXMA 4TVPH 5CIPA 2EDNA 5TDOA 3X3GH 3S9DB 4NWUH 3O41B 1RZFH 4OUUB 1CF8L 3LKQB 1KCRH 1P5VA 5HHQA 3ULUH 4WVRA 3K80A 1NSNL 2XPGA 2WP3O 4WNQA 2DI7A 1MIML 2CSPA 4JFFE 3QUYD 4FFYL 1YY8B 1XGRA 1T1XA 3MNZA 1RIVH 3BQUD 3EOBA 3QWQB 5DJYB 5D4QA 2HAZA 5ESAB 1KC5L 1FL6B 2EEBA 1OP5H 4KKAD 5IVXF 4UTAH 1RZ7H 1CE1H 1T1YA 4V2CB 2CIIB 2XXCB 3OKLB 1KCUL 5BRZE 3VFPA 3ARBB 5EU4A 3TBTB 1KV3A 5D6CB 2RIKA 5C0GB 3O3AB 3RPIB 4BH7B 2CGRH 5CIPH 5DK0B 3FFCD 3W5NA 5FUCC 5DO2D 2P49B 4P2OD 1IM9B 1SYSA 3NFNA 3FOLB 3EZ8A 5FYJU 4S1DD 3LS4H 5DQDH 1A6WH 4JB9L 2EC9T 3EYUH 2LQRA 4CAGA 3PV6A 4E0RA 25C8L 4H5SB 3D18A 1H3GA 1U3JA 3RTQD 2WQRA 4G8IB 1DQDH 3BESR 4Y4FC 5JZ7D 2G60H 1ZSDA 1MEXL 2BDNL 5ADPH 1OL0A 1G9MC 2HFGH 3EW3B 1QPPA 4EXKA 3WKNA 1IEAA 2E8ZA 5CS7A 3BAEH 5EIVA 3WN5B 3CVHB 5BRZA 2FX8H 3BP7B 3J7HA 4CU7A 3RVTC 1ZHBB 2CR6A 4IIQA 2NY4C 4D9RE 5DMIH 3KWWB 4F15B 4HXBL 2UYLB 4R4FL 3PWLB 3PQYB 1T5WB 2VZ3A 3C5ZB 1NGQL 4JN1L 3RX5A 3B2UD 4OCYH 3MUZ1 1QR1B 2C3VA 2FX7L 4XX1E 4JZOB 1LO4H 4HBCH 3O3BA 1KXVC 4MYWB 5GGVY 1DDHB 2BVOB 1G9NC 1KIRB 1U8HB 3HB3C 2IAMC 4M8VA 2E7LC 1HIML 3LH2L 4KKCD 5EO1A 1CBVH 4OGXL 1TZGH 2VXVL 2WNGA 2HH0L 4LSQH 2P4AB 3LMJH 3IJYA 1I1FB 4LCWD 2H9GB 4ERSH 1RMFH 4FOMA 4R4NC 3TT3L 5FB8B 1FZKA 4P2QD 1IGYA 2CMRH 1BFOB 2H41A 4LCYB 2PXYB 1AGFA 1IC5L 4WTWA 5T1DL 3SGEI 5I75B 3UP1A 1S78D 1JGLL 2MKWA 1M1SA 3V6ZB 4IMLA 1DN0A 3GI8H 1VFOA 1NKRA 1R0AL 4PRAB 2Z93B 2E7MA 2IADB 4ZUWA 1NJ9A 3QNYA 3UAJC 3BO8A 3QUXA 1B4JL 4F7TB 3QRGL 1TCRB 2ORBH 4HD9A 4C59B 2YC1A 3L5XH 3O6MH 5EBWA 4ZUSB 3U30B 4JZJB 2HLAA 3KYNA 2VISB 4P2RB 5DT1H 2XQBL 3RVVC 4HPYH 4NKQB 5D6DC 3JUZA 1BJ1H 2J88L 5AAMA 3C60B 3RVUD 2XKUA 5BVPH 2ZUWA 1MFDH 5ESQB 3O4OC 3ME0A 5EIIB 2C4XA 3UO1L 1SY6L 4ZODA 1QBBA 3LKPB 4MQTB 5T1MA 2ESVE 4Z7NF 2VLME 1WZ1H 3I02A 5HYSA 3DYOA 3O41A 1NC2A 1YEKH 4OUUA 4L9LB 4JO1L 3ET9F 1I7UB 4LPXA 3LKQA 3D48R 1PX3A 5ISZB 4OFYD 4XXCA 2VQ1A 1E0OB 1YY8A 4WI5A 5DJYA 4QHMB 2BY3A 3SDAB 5C9JB 5ESAA 4JKKA 3ORJA 5EORH 1R3HB 3AXLB 4JFDE 5DS8B 3QEHA 1FL6A 4YFDB 1J05B 5F6IB 2V7HA 4X80H 3Q0HA 2XFXB 4G3YL 4GRLD 4OM1H 3BE1H 3P9MA 1GHFL 2FB4H 5IHUH 3ZMRA 4D8PB 4ENED 4QRQA 4BH7A 5DRZB 2E9IA 2NY3B 2QLVB 4D0CB 1VDGA 1CLCA 1T7WA 5DK0A 3FT2B 4NFBA 5DLMH 1G7HB 4X9BA 2H32A 2V5YA 4FQXB 1A7PH 5D71H 5DMKB 1S5IL 4NM8H 2ESVA 2J5LB 4OD1L 5F7LB 2F9BT 1UENA 4FFWD 1KFAH 3QDMD 4GBXA 4OKDA 5AYUH 5GRXG 5T5NF 4ZD3L 1F3DH 4M7JL 5CGYD 3V4VH 3QJFA 3HNSH 4H5SA 4G6FB 4TTGA 4G8IA 3O45A 1RK0B 3Q5OA 4CBPA 5L8LB 4GAGH 1AQDB 5DR5H 4BZ2H 3VXPB 3FCTB 3VXQB 4Y5YB 3V52H 3AMLA 4P4KB 2D0GA 2V17H 4NHUB 5DVLA 3EHBD 3WN5A 3CVHA 1CIUA 4LNRB 1M4KA 3VG9B 2H32H 4LOUD 5INDB 1Q1JL 5GGUB 4LVHB 1WBYA 2M26A 3MJ9L 3FO9B 4R90H 1OWRM 2EC8A 4B0MM 1C16B 3ZE2E 2XZCL 4KMTL 1CXFA 2UYLA 5HTSA 5GHWL 3H7BB 3BUTA 3HG1B 3PWLA 5T33H 1T5WA 1V05A 2JJSC 3C5ZA 5C0CD 4N1HB 1T1ZB 3GO1H 4GO6B 3WD5L 3INUL 4U05A 5DRWA 4NHCH 2X1XR 1XGPA 1T21B 1MFCH 2XTJB 4NM4L 5I66B 3GSOB 5EZIL 1QR1A 2AGJH 2IG2L 1K5NB 2EO1A 4RFEA 5CLTA 4BSVB 1DDHA 4BQCA 2BVOA 5FO8A 3CVHH 4NDMB 4JR9H 3ALWA 3HE7D 4OCSH 2APFA 3CC5B 2VL4A 4C58B 3TCXA 5F9JB 4G8EA 2H9GA 3FFDB 3WHXA 5FB8A 1MWAL 4LLAA 1V3JA 4IDJH 1I1AB 3PL6B 3JTSB 4PJFF 2EH8L 4JFPB 5JXAL 1VACA 4LCYA 2XYCA 3MRHB 3EJJX 1BBJA 2DKUA 4MZ3A 2H2PD 4PRAA 1MCLA 2Z93A 1WTGT 2BNRB 4N0RA 5KSAB 3CXDH 5MP6H 5C0ND 4F7TA 1TCRA 3CU7A 2A0LD 4ZUSA 1DUZB 1PSKH 4CU6A 4XP5L 4ISVB 4JZJA 5L7XL 3TFKD 1MRDH 3MR9A 4P2RA 3GBNH 3WO3B 1UVQB 4QRRD 4OF8A 1J0JA 5B4MC 3THML 4HWBA 5EOTB 4GKOA 3LEYL 4HKXA 4HGMA 4WHTB 3C60A 15C8H 1RVFH 3MOAH 3W9EA 5ESQA 3RAJH 1AXTL 3TJHC 4DCQA 3SY0A 3LKPA 4MDIA 1JHLH 3VFNA 1YEFL 5AZEH 1YEDB 1ZLUK 4ZNEE 4FN0A 1I7UA 1T2QH 3DETD 2GHWB 3K4ZA 2K7QA 4WV1A 1I1YA 3VI3F 3S97C 2JELH 2B5IB 3VW3L 1P53A 5I1AB 2VZ1A 5IMKB 2MWCA 4M6NH 4HWBH 4U6TA 2R1YB 3SDAA 5D2LF 5C9JA 3H42L 1PQZB 2EDKA 1OCWL 1R3HA 2CPCA 3AXLA 3BQUB 5DS8A 1J05A 3FO0H 4IMKC 2EYRB 4CKVX 5FK9B 3RRQA 2XFXA 3PWJB 1HOCB 3KPOB 1VADB 4D94A 3BVNB 5DQJB 4K8RH 2ADIA 5DRZA 4D0CA 4M7ZB 4HFUH 4HK0B 3TWCH 4QRSB 5FDYA 1WIUA 1G7HA 3VGBA 2OQJA 4IRSC 5GRJH 1A0QL 2HVJB 2WANA 5DMKA 1N2RB 3NOIA 2D7NA 3FFCB 4NQVB 3D9AL 4Y4FD 1VCAA 3MMEB 4X4XB 1NCDH 1O0VA 4P2OB 4ZNEA 1BX2A 1PEWA 5EN2B 4EVNA 5GSVB 5HXMA 3U46B 3HNTL 4FNLL 1D6EB 4XP4H 1FZMB 1AQDA 4HJJH 4RGMC 1RUQL 3IU3B 2Z31D 3VXPA 2HFEB 3RTQB 5IWLA 1EO8L 3VXQA 4RISH 4WENB 1T66C 5M95B 3FTGA 4XGZA 5F7DA 4ELMB 2CQVA 4M6ML 4P5KA 5INDA 3CSGA 1X6LA 3HC0B 1IKNC 5GGUA 3TN0D 5DMJB 1JGUL 4GAFB 5BW7C 7CGTA 3H7BA 5D1XC 3HG1A 3BUYA 2BNRE 4XNZC 4AK1A 5IB2B 2CLVA 4E41E 4NOFA 5HGBB 3QPQC 4N0FB 4QY8B 3UZVB 3QUML 3MV11 1LP9B 3MLVH 1CU4H 4MXVE 4KRPD 1T21A 5I66A 3GSOA 1D7FA 2FLRT 1NCTA 1U8JB 2BY2A 2I60L 4LHUD 3MO1B 4QTHB 4XTRD 3B5GA 1K5NA 4NWUL 4GQPH 2N56A 1RJYB 4Y1AE 2FHBA 4NQDD 4NDMA 1Z6JT 4LSTL 1DANU 1V7MH 5F9JA 2C1OB 4NZUH 5FDWB 4HAGA 1HH6B 3Q5TA 3QWOB 4NUGL 5E1AB 3UAJD 1VKXB 4XAKE 4LCWB 1LILA 3MLPA 4J2XA 3MQIA 3JTSA 5HJ3B 4NKMB 5I1EH 3QCUH 1JTOA 3MRHA 4XWGH 3TYFB 5HYEA 3VFWB 4P2QB 3VCLB 1YPZB 4TUJA 1UCBL 2BNRA 4PUBH 5T5FH 2VZSA 3WHE0 4E41A 3KS0H 3T77B 3DARA 4MXWH 1DUZA 4ISVA 1IC7H 5BVJB 4LSSL 2X5PA 1ZAGA 2ZZUT 1UVQA 1JK8B 4HS8H 1PVHA 2NW2B 1CVRA 4S10A 1MHCB 1LO5B 1YY9C 2AXJA 1F42A 1TJGH 2HTLC 4UV4L 3TP4A 4UT6H 5FM4A 4XNXL 1YECH 1F4WH 4MQ7B 1FO0B 2FEEL 1P2CB 2XIDA 3E1F1 4ZOAA 2G60L 4BKLA 1S9YB 5DJ2B 1XCQB 3L3JB 5C6WH 5GS1C 4R6UA 2O5YH 4U1GB 1YEDA 4GMSL 4H8WH 1JUFB 3V4PH 1FG2B 4TQEL 1JPSH 4HF5H 3FAXA 1MUJB 2DLGA 4QRTA 5TJWK 3OBAA 4GMTL 1EEUA 5D5MF 5KSVA 5E8EA 5IMKA 5EOCH 2Y6SC 3HHRB 1CZ8L 1PQZA 3QUYA 5K59E 3OPZL 3BQUA 2CRYA 1WFNA 2BY1A 3PHOB 4LQFL 5IBLC 5EZLB 2HG5B 4M1CD 2EYRA 4MD4B 5IVOA 4LRIC 3PWJA 5KSBF 1GOFA 3CDFA 3KPOA 1VADA 3BVNA 5DQJA 4DTGH 2D4FA 4GRLB 4I0KA 4KHTH 4OD3H 3DVIA 1KBGH 2FZ3B 1RK1B 2YD3A 5E00B 4OCXH 5IG7B 2GK2A 2X4QB 1I9IL 3MMEA 4GXUN 4X4XA 3PWNB 1ND0A 5F7KC 4M6OH 3QDMB 1LDPH 3RY6A 5TE6H 5L0QC 4ERSL 4QGTA 1FNEB 1RMFL 3LRHA 5GSVA 5I1KL 1K3ZA 5D7IE 4GAJH 1D6EA 1FZMA 3D3VE 4TPRH 3IU3A 2HFEA 3QUZC 3RTQA 1ETZB 1BWMA 1I3VA 1AHWA 4YXHL 3VG0L 4M61B 4PY8J 1T22B 4XMKH 1UH2A 3NBNA 4N0YH 4ELMA 3IDJB 1MFNA 3LN9A 1S7UA 4XCCH 3NFSL 5IEHB 3EYOA 3HC0A 2FH6A 3L5XL 2VXTH 1BREA 4M9PA 2AABL 1FRGL 5EO0B 5DT1L 4MVBC 4QKXB 4HPYL 5JLZB 4YWGL 2V2TB 5HYIA 4PJEF 3TF7C 1BBDH 5FOBB 2YPLE 4D9QD 5IB2A 5HGBA 3WXVH 4N0FA 1HI6A 3AFLA 4QY8A 2APVA 1LP9A 1CLYL 5C0CB 4K23H 1U8JA 4N90D 3MO1A 3D3VA 1F6AB 4XMLL 4HKBA 2D03H 1NCAH 1RJYA 5HI3D 2L4OA 3SQOH 3V0WH 2FBJH 5TF1H 5HGAB 2F53E 2FO4A 3HR6A 1G7LA 2C1OA 1HYSC 5IFJB 5J3HD 3WS6A 3HE7B 3MYJA 5FDWA 4LKXB 5FV2A 5E1AA 3IDMB 4PJ8A 3SGDH 2FL5A 5D2NB 1BEYL 5HJ3A 4NKMA 1KPRA 3FB5A 3RVXC 3TYFA 5I1CL 3BDXA 3MJ8A 4UT9L 4GQ9H 5DURD 3DOSA 3VCLA 1YPZA 3FRPG 4POZC 1UZ8B 3F12A 2UV3A 3MRMB 3UTPE 1GAFH 2YPLA 3CFEB 4ZSOB 3T77A 2VABB 4HPOH 4K7PL 2FJHA 3SDXF 4ONGH 5HI5D 5LG1A 4HUUB 4BFIB 4D0BB 1J0IA 3P9LB 2DLEA 2NW2A 4ONHB 5J0BA 2X7LB 4G6ML 1MHCA 4FQIL 1XF4A 4WWKC 4JFQB 4QRRB 2A1WH 4GSDH 2EECA 3GJFK 3QXWA 4HKZB 3UPCA 3ZO0A 4KDVA 4R96B 4K71C 1EERB 5TFSH 3O8XD 1FO0A 1P2CA 1MCWM 3V4VL 2RR3A 5FHBL 1YDPA 2OTWA 3C6LD 4EI6B 2DAVA 4OUOA 4B5EA 1H8SA 1S9YA 3O6KL 5DJ2A 3NGBC 1XCQA 5FYJD 2RCSH 5K33A 3O9WD 1I8LC 3ULSA 4NN5B 1I4FB 4Q9RH 2PW1A 2ED8A 3MRPB 1OVZA 4PJXE 1U6AH 3IFPA 1N5YL 2FO1A 2B4CC 1N0XH 2LAAA 2OXHA 4OFYA 4PJHE 3T3PE 3WS3B 3TBSB 1CT8B 5LBSL 3VXTA 4G9DB 3D69B 3HZVA 3PHOA 4N5UA 2BSSA 2HG5A 2UUDH 3HUJF 3KHQA 1FO0H 1HDMA 3EDKA 1CWVA 1C12A 2EDBA 4XCNB 4R9HA 1JV5A 5E7BA 3GO1L 2Q3ZA 1LO3L 3DGGB 4Z76A 1ZANH 4GRLA 4KJQC 4HUVA 1B9ZA 4K9EC 1IGMH 3I84A 2FZ3A 4L4TD 1Q9WB 1RK1A 1JI2A 3PDOB 2MQCA 5ACLA 1EGJL 3S37L 5IG7A 1FSKB 2X4QA 4NWTH 4OI7A 4OCSL 3PWNA 5C2UB 4Z9KB 4GRWB 5CD3B 3ZL4H 3MODL 2QR0B 3SDCD 5L2KD 3HMXA 1FNEA 1S9VB 4EQ3A 2K3TA 3G6JE 3DWTA 4OZHE 1FNSL 1RU9L 5FCSH 2EE2A 5FM8A 3VH8G 4PP1D 3GSVB 4PJHA 1ETZA 5AAWA 3CZFB 2J6EL 5F1OB 3MRLB 3U0TA 1LEIB 3L3DA 2Z31B 4WW2B 3JWOL 1T22A 3GSQB 3CXDL 3RHWF 5FYLL 5D1XD 3ULVC 4LHUG 4NJ9H 2PUQT 3ULUF 5EO0A 4MA1C 1X5HA 2BHUA 3TN0B 5JLZA 3VGHA 1OAKH 1JFQH 4WFEE 3G5XB 2IJ0C 3C08L 3GSXA 5J6HB 3HMXH 3HRPA 5FOBA 3VH8B 5CJXA 3TIDA 2BOBB 2VC2H 2FH8A 3KGRA 4XCFH 3OL2A 2NXYC 1DL7H 3G6JA 3NABL 3GBLA 5C0CA 3MRGB 5C0EA 5MERB 3OMZA 1JHLL 2NXZC 5C0IB 1YJDL 5CWSA 3CDCA 2X09A 1F6AA 1PBYA 2YXFA 4KRPB 3WNMA 4M48L 3B9KD 3QHZL 3PHQB 4XNQA 4LHUB 3HAEA 1A6VL 3PWVB 1X5AA 3UBXI 5I1IH 4OM0L 5HGDA 1XEDA 4RWYL 2YUWA 1OAYL 4NQDB 2CDGB 1OSZB 3HE7A 4XHQA 3O2WH 1NMCC 1D9KA 3IDMA 4KVCH 4XH2B 4ZTOH 4HSQA 4XRCA 1OP5K 3UTTD 3OJ2C 1FE8H 4Q0XH 4JHWH 3BGAA 3LN5A 4PGCB 5I8CB 1GGCL 4IM8A 1AC6A 3W81A 1Z3GL 4O4YL 1WC7B 3CFEA 1T6WA 3DHJA 4KQ4L 2VABA 4HIXH 2A6IB 4XNUH 5GRJL 1NBVH 3VXSD 3HAEH 3N06B 4HUUA 4BFIA 4D0BA 3P9LA 1MCPL 4ONHA 2FEEI 3PG2A 5GRYA 1CGYA 2EEAA 4RIRA 2X7LA 4JO4H 1N3NA 3MSPA 5FUCE 4JFQA 4QRRA 4JHZA 4HKZA 4KK9C 3EDDA 3OTTA 4XCEA 4HAFA 4KU1A 4R96A 1J0HA 3D2UD 4MA8H 4H88H 4RBPK 4U3CA 4KK8C 2DL2A 1UM5H 1VFMA 2VXSH 4EI6A 1BQSA 5I1HH 4HDIB 1U8QA 3FRPA 1RHHB 4TRPL 3EOAA 4J3SA 2A73B 4IOIB 1KN4L 4PB0L 3JXAA 1ZGLB 4QHUB 5DZLA 1I4FA 2WK2A 4G9FD 1JP5A 1QSED 3VJ6B 1A47A 4HH8A 4UQ2A 2VDPH 3ARGC 3IVKB 3NH7L 1H8NA 5H8DA 2NR6C 5ICZB 1KNOA 3WS3A 4KVNL 3RIAF 3TBSA 1CT8A 3K3QA 4G9DA 3D69A 3DPBA 3KG5A 1MNUH 3GI9L 2QSCH 4JO3H 5EPMB 2DLFH 3TH4T 4BQ6A 2DDQL 3OHXB 1SYVA 4XCNA 1KUMA 1SQ2N 3P0YH 3DGGA 2GCYB 4XNYL 3RWFB 4S1RL 5CUSH 3LKNB 1WVZA 3D25A 1KB9J 3GBML 1Q9WA 4CJ0A 3PDOA 2IQ9L 3GHBH 1CTNA 3HN3A 2AKRA 1FFOB 1GZQB 2W38A 2ERJC 1A3LL 2C3GA 3U1SH 4DKAA 5ALCL 1AQKH 5DQ9B 4CMMB 1TJHL 4Y4FA 3QQ3B 3UTOA 4KKBD 3NN8B 1S9VA 5JO5A 4P59H 1JBJA 1T83C 1U0QA 2EE3A 2P7TB 3GSVA 4J8RA 2YMXH 3CZFA 4P9HH 3RJDA 4NQXA 5I1LA 2VXUH 4KTEL 2Z31A 3IJHA 4YFEA 1QQDB 3FQTA 5DSCB 4MHHI 5B3JF 1T03L 2HJLA 3RP1A 4J1UB 1INDH 1XCTA 2WUBL 3TN0A 2ENYA 5MHSD 5SX5H 3K8MA 4R8WH 3G5XA 1CGXA 5J6HA 5E24E 4YHOH 1RURL 1ZWIA 4HUNB 3VH8A 4JAMA 1YEIH 2BOBA 4KK6D 1DEDA 4FZEH 2AQ1A 4WI9A 3AAZB 5CBAA 2IAMA 5ITBH 5MERA 3KPSD 5E6ZA 5C0IA 4WRLA 2Y7QB 1YEGH 4XPHH 1S7TA 3K0WA 1NANI 3V4PL 2M8XA 3PWVA 3GMLB 1DJSA 3WUWG 2DKMA 2ZG3A 1TIUA 4NQDA 1A22B 3GNML 4PTUA 2CDGA 4OSUH 1ITBB 3STBA 4PJDB 1MRFL 2BVEA 1MCSA 3HI6L 4MNQB 2VH5L 5C6TH 3ZDZF 4UZGA 1SEBA 3IAPA 4OT1L 4FQQB 3DRQB 1M7DB 1PAMA 2EYTB 2FHFA 2X4OB 4NO3B 1G9NH 1ZLVK 5DURB 4NSKB 4WWKD 3I6LD 3NACH 4F8TA 5D70H 2G2RA 4U7MA 1EXUA 1KBGL 3GMQA 1CDGA 3WUWB 1JGDB 4PJ9C 3S3PA 1KF9B 3MLRH 5IFHL 1S8DB 1BFTA 5BS0D 4PLNC 4JJHA 2NTFA 4ZFGH 5F7YC 1H9VA 1IQWH 1BVLB 4GAJL 1EHAA 1OARH 2COQA 2E7HA 1GCFA 1N6QH 3TO2A 3O8XB 4X9GA 2R1XB 3C8KA 4KKNA 5B22A 3REVB 3MLXH 3C6LB 1OAUL 3LCYA 2Y5TB 2J8OA 3HI1B 4QRUB 1KIUA 3LS5H 2BOCA 3BEVB 4R4BA 5ILTH 4C57C 5LWYL 3JBG7 2VDOL 5FO7B 3O9WB 3CPLB 3VJ6A 3JV4B 4KZDL 4I4WB 3QBTB 2PO6C 5DTFA 3F62A 3OXRB 1VGKB 5ICZA 4OFIA 4L4VB 2BRRH 1MQKL 3HS0B 3FJTA 3DVNB 1MRCH 1GC1C 4X8JA 2IAND 4JM4L 3GKZA 3EOTH 4PFEA 3CFCL 4FQLL 5EPMA 3MXWH 3EFFB 5JNYB 1BBDL 5C0BD 3OHXA 3MJ6A 2HMIC 1B2WH 3EJYC 3RGVD 2GCYA 3S6CA 3RWFA 2G75A 1VPOH 2HKFL 1BQLH 3P11L 3BRDA 1FFOA 3SGKC 1GZQA 1MHPL 4L4TB 3DV4A 4OTXH 4NP4L 4Y4HC 4MSWB 5DQ9A 3QXAB 3QQ3A 1N7MH 1FFQA 2IGFL 5JW5B 5D7SL 1NBZA 3HI5L 4RFOL 3UMTA 2X2YA 3ETBF 3SDCB 1G7JB 1A14H 4U2ZA 3KNBB 3MRJA 2DQDH 2E27H 4N90E 1IC4L 3DUUB 3ECBB 2B20A 4XBPB 3ZE2F 1F4YH 1G0DA 5HHOD 4GQ9L 2HT3C 1MAMH 2YRPA 4GLRI 2OXGA 1GAFL 4G6JH 3BKYL 1O7SA 4H0IA 1NAKH 4CN6A 1ODAA 4K3DH 3MBXH 3IFOB 3IAGC 4FTVD 4CADA 3BW9B 1UXWB 4U2YA 3PWUB 1PG7X 1N6UA 1UA6H 4BZ1H 4OIIL 2NXYD 1JPFB 2VE6B 2AJXL 3QO1B 4LSPL 3SEPA 4UBDC 4WFHE 5IJKC 2P8MB 1U36A 1U9KA 3WEXB 5J1TC 2JE8A 3KYKH 3T3ME 3C5SA 5E08L 3IXTB 3AGVA 4EN3C 3AAZA 3F8UB 4U1HA 1BZ9B 4EI5C 2ICEA 4YHYB 1EEQA 5DD1L 3ILQD 5MI0C 2Y4SA 3FN0H 4HIJA 1G7IB 3NA4A 4PBXA 3RWEA 1HZHL 1QBLH 3GMMA 1S5HA 1RV6X 1FV1B 1TVDA 1CGWA 1ZLSL 2Q87A 3B9KB 2VL5B 1NCCH 4UI2A 5E5RB 5E99H 3R1GH 4TSCH 4PJDA 1N0XL 1AY1H 2R56H 2DTSA 2WLZA 1Y0LB 1FCGA 5DJXA 5J11B 4GRMB 3I9GH 4HC1A 4R7NB 5IP4A 4FQQA 2DQEH 3DRQA 1M7DA 2GFBA 3F58H 3UTTB 1EJOH 2F8OA 4IOSD 1DBAL 5EOQL 4NSKA 1M7IB 3WO4C 4J3TA 3RVWC 1ZXQA 3JWDL 3HC4L 3MNVB 3VRLE 3WUWA 2Q6WB 1JGDA 3QNZA 1T5XB 4XMPH 1IILE 3AU1B 4JRXD 4NQED 3STLB 1AGCB 1HSBB 5GJTH 3VXSB 2G5RA 1C5CL 2I27N 2R69L 2AEIT 2UZIL 3MFFA 3A6BL 3JTTB 1BOGA 3VXUE 3I3EA 1BVLA 2VIRB 2IALB 2ATPB 3PP4H 3D2UB 3GHEH 2E9JA 4HC1H 3ARGD 1S7VA 2AJ3A 2R1XA 4JPWH 3REVA 4OLZL 2NR6D 2DI9A 5I8OH 3KPQB 5ANMB 4QRUA 3HZYB 3T0AA 2EYSA 3GSNL 5MEPB 3EFDL 3O9WA 2QQKL 3CPLA 1QVOB 3JV4A 4I4WA 1KN2L 5CP3A 4UUJB 1MF2L 3OXRA 5L2KE 3TV3H 1WIPA 3I2CL 4G9FB 4IMKA 1QSEB 3R06B 5AUMA 2BVQB 5E8DH 4K3GA 1OAKL 3MOBL 3U7YH 1P7QD 5E2TH 4I48B 3ZDXF 2DM4A 4HUWB 3RZCB 3UDWC 4IRSA 4N0CC 3Q1SL 4GFTB 4XCFL 5EU5B 1Y6NR 3VXUA 3K1DA 4WDIA 3FAWA 5JHLL 3QDGD 4WHDA 3RDTC 2ED7A 2LTQC 3OKOB 5FYJH 1OTSD 1G7MB 1W0WB 4F7CB 4L4TA 2CRIA 2XRAH 5CP3H 5A2JH 1F6FB 2LU3A 2VLJD 4MSWA 3QXAA 4ODUA 4DN4H 1QFWM 4JDTL 5JDSA 3L7FA 1REIA 4JVWA 5L2KA 2YOCA 3N9GL 3DUUA 3CJJA 3ECBA 4QGYA 4XBPA 4CGTA 3GRWL 5BV7B 1A3RL 5EUOE 4ZPTB 3WIHA 1I8IB 4Z7WB 2MCPH 3ZHLA 5BW7A 5C7XH 1B6DA 3QEQE 1Z2KA 1CFNB 1CXIA 1PZ5A 4XNUL 3BW9A 4MXVF 5D1XA 2RBLA 1LE5B 5LVEA 5B3NA 3SGJC 5HI4D 1QBML 4HJ0C 2Z35A 1JPFA 2VE6A 5AZ2H 5IB4B 3WFEL 3QO1A 4GS7B 6FABL 4X6DB 3RA7L 1JYVA 1ZT1A 2CIKB 3VFMA 1FNAA 4JREC 1OLLA 3MBED 3U4BH 2HJFB 2VXSL 2JCCB 3V4UH 2B1AH 4QHKI 1BZ9A 3WIHH 5BOZG 5CKAA 4JQIL 5E94B 3NIFE 4CDGC 2AJUH 3VWKD 2E7CA 5JW4M 1G7IA 3ZKSD 4Z18A 4Z7VE 2BXYA 5EUOA 1FV1A 3VXMD 4UT7H 1QO3B 4U6XB 1EJ6A 1VEMA 5JW4Q 3GB7B 3QEQA 1UWEH 4N8CL 4EJ1C 4BZYA 3BISA 4PJIB 3VGGA 4UNVA 2QSCL 4JO3L 4M9OA 4HLZG 3CFKB 3K81A 4R7NA 4KTDL 3OJDB 4Y5XC 5D7KD 2QEJA 2Z8VC 3S5LG 3UTTA 1H3PH 3Q3GB 4UTBL 4ZUTB 1M7IA 1KPVA 5TPWL 2D9CA 3OZ9H 5CUSL 1P84K 4HWZA 3HTLX 4WUUD 3MNVA 4WWKB 32C2B 2Q6WA 4O58H 1T5XA 2XN9D 1KACB 3AU1A 3STLA 1AGCA 1HSBA 2V2XB 3VXSA 2DQIL 4KJWC 3MLUL 1VESA 1I9EA 3CLEL 5I6XC 2IALA 5BS0B 5IW6B 5GS1A 5MEOB 5F7MC 1ZA6B 3D2UA 4L3EE 2PO6D 3O6FC 5K9QG 3KYOB 4NN7B 3RKDC 4J4PC 5ANMA 3PJSB 1NMBL 3HZYA 3QQ9C 3CFBA 3LEVH 5IMLB 4ELMF 5I0ZA 2O5XH 2VO5A 5MEPA 1QVOA 4NUJB 4KK5D 4W4OC 4EUPG 4LRIA 5CINL 5F6HJ 5C08D 3GKWL 3BPCB 4DGIH 4KHXH 4UIKL 5F89B 4Z7WE 4I48A 2W92A 1DLHB 1G9ML 1OT2A 2OZ4L 4HUWA 4HK3N 3FB7B 2IANB 1YEIL 4WU7B 4U33A 5EU5A 1IAOA 5C0BB 4N0UB 1LP9F 3SKUD 2QQQA 3TT1L 3MCG1 3RGVB 2XZZA 2EDQA 4PIRF 4MX7A 4PBVC 2H1PL 4XPHL 1HINL 2A9NH 4MJ2A 1G7MA 1W0WA 4F7CA 3VFTB 1XGYL 5A2IH 3ROLB 4TULH 1KJVB 5H94B 4MD5B 1FAIL 1FNGB 1LVEA 1KB5B 4RA0C 5LQBL 2D3VA 3BPOC 5ESVB 1L7TL 4C56D 4F8QA 3BIKA 2ARJB 2ZCHH 2UWEB 3K46A 3KPSE 5DGRA 1HHGB 4MMXC 2PR4H 1QACA 2XI9A 4ZPTA 1I8IA 1H8OA 3A67L 4Z7WA 5DFVD 1YPZF 4HIEB 5HHOB 5EA0L 3X3FL 4NKOB 1CFNA 1XT5A 4HWUA 3UPRB 5GRVL 4YAQB 3HMWH 4NRZB 3O3UN 2W9DL 2QHRH 3VWJD 4EN3D 5IB4A 4FTVB 4EQ2A 1UGNA 4X6DA 5CJOH 2NXYB 2F74A 2R2HB 3M1BB 2W9EL 4PJGE 4YBLC 1LNUA 1A1NB 1HWHB 2HJFA 4HUMB 2JCCA 4LU5H 3HRZB 4HEME 4AIOA 1W0YT 5BV7H 1EHLH 4PREB 4XHJC 1Q0YL 3KLDA 5HGHB 5E94A 1FYHB 3H3KA 2YD2A 2ITDB 2CJUH 1IGCH 3KPSA 5J57B 2CLRA 3QDJD 4OB5L 5ITFB 2E9BA 5TGBA 1QO3A 1MVUB 4U6XA 2Z92B 4PV9B 3I3BA 2VKXA 3GB7A 1KTLB 3F7YB 35C8H 4WEMB 2Q7NA 2BRRL 4CMHB 4QTIL 4PJIA 2UZXB 1EHNA 5C0RH 1WQVT 2UUDK 5HD8D 3CFKA 2VSCA 5SWQA 1NUDA 1MJ7H 3G08B 3MRQB 2ZWLT 3KJ4C 4PJGA 5HYQB 3EYVB 4UQ3B 4N1CA 1JGVL 5DA0B 3CMGA 1IQDB 1BQLL 4WI6A 5J1SC 4QXTB 2J4WH 3ZE0E 3OR6A 4WWKA 1FORH 5A16B 1C1EL 3MRIB 4NGHL 5GGSY 2V2XA 1A7NL 1CLZH 1YEEH 1N59A 3H6JA 4JRXB 1NGPL 4NQEB 2Y36H 4UIMB 3S8WA 3L9RB 4XNMB 3V5KB 3UX9B 4JRYD 4G7VL 3VMOA 3ARXA 3HE6B 5CSZB 3ZYZA 5IW6A 5IW3A 5C86A 3BXNB 3CH1B 4X6BB 3DSFH 5DJ0B 1ZA6A 2AQ2A 1NBYB 1S7RB 2DQDL 2E27L 3S5LA 3KYOA 2CDFB 1ITCA 3ARGB 3PJSA 1BLNA 4M62H 5IMLA 4F9PA 1JZ2A 3ZDYE 4NUJA 3MLWL 4X7TA 4U7SA 3WFDL 3VDBA 3RWJA 4U7KA 3GM8A 1L7IH 4N0CD 1PYWB 5KW9L 3BMVA 1UA6L 3OKYA 5ACMA 5I19H 4OGYL 1AI1L 5GGRB 3ULVE 1ZT4A 3FZUC 5KN5B 4YXLH 3O6LL 3RDTD 3DO7B 5BXFA 2GK0B 5HHOE 3V8OA 3FB7A 1WEJL 2DQGH 1KYOJ 4HLZH 1IKFH 1P7QB 4WU7A 2R0KL 4KJPD 1DSFH 2IPKB 5CLWA 4N0UA 3OXSB 3DROA 3G6JF 1XH3A 3RU8H 1ZGLM 1J1OL 3RGVA 2BNQE 4PG9A 3N1PC 3QDGB 4QHKJ 5J9PB 3G9VA 3VFTA 1FBIL 4KJYB 4ZUVB 3WIIH 2BFVL 3ROLA 1KJVA 4EUPA 4MD5A 1FNGA 1KB5A 4OCLC 5TQ0L 3KYMA 2ZOLB 1T20B 2VLJB 3IDXL 5ESVA 5GGQL 1KCSL 3QAZC 4FQCL 4OLVL 1OM3H 4P5TC 1EDQA 1YEHL 1HHGA 2DQEL 4L1HA 3VI4F 1E4XH 1EJOL 4WY7L 4YH6A 2HP4A 2FNBA 5HHOA 1OP3K 4NC2B 4NKOA 1QLRA 3SKNB 3UPRA 4YAQA 5GXBB 4ZAKC 2QKIB 3MXVH 4NRZA 4S0TD 3OB8A 4OFPA 5GJTL 5KBNC 4FTVA 2BNQA 4EUPH 1F45A 2WIIB 1NLBL 3ARSA 1KB5H 3EYSH 4JEGB 4LLDB 1GH7A 2R2HA 4TNVF 4YFLI 4MLSA 5KS9E 1A1NA 4MAUL 3BKJL 3IYLW 3U83A 3PP4L 3GHEL 3HRZA 1D6VH 3ILPB 3ULVH 3DMMC 3MBEB 1HH9B 5DEFB 2DS4A 3DX7B 1S3KH 4ZPVB 4XP9L 5T1LD 3BD3A 4MD0B 5ITFA 4M7LH 3VWKB 1JNJA 3MUY1 5I71C 1HKLL 1CICC 3VXMB 3ZHKA 3UYRL 2C4FU 4YHPA 1KTLA 4FZ8L 5E1HB 3AB0C 1CG9B 4TNVK 1EBPA 5C0AD 5I16A 1I3GH 2DQCL 3SDYH 4LP5A 3G08A 3W0WD 3MRQA 1KEGL 2L0DA 2X9XA 5HYQA 4Z78A 3EYVA 5JOFB 5KS9A 4UQ3A 2UZYB 2BSED 3ALPA 5DJ8B 1IQDA 1FGNH 4NO5A 2VNCA 1C5BL 3C9NB 5AG8A 4YX2H 5A16A 1JF1A 3SOBH 3MRIA 1W8NA 3AS2A 2KPNA 4LCCC 5DD0L 4WUUB 1DQLH 1CR9L 5ENWB 3O6FD 2WWKT 4GRWF 5JA9A 2XN9B 2NY2C 1NCWL 4JRXA 4NQEA 4P5MB 1UWXH 1SJXA 4UIMA 5HY9B 4YHKL 3L9RA 1FL5B 1JPTH 3V5KA 3X12B 3RGHA 3CLFL 3C5JB 3BXNA 3CH1A 3QXUA 4PR5B 1HSAA 1KEML 4FQ1L 4TN9A 3VU2A 4EXPX 1S7RA 4PY7B 3TH2T 3BGFB 3TJEL 3FO2A 5KOMC 2WIMA 2CDFA 5I74C 4HX1B 4NJAH 3MOQA 1HEZB 1CDYA 2PO6B 3ARGA 1R24B 4OLWH 5IESH 3KDMA 3TYGH 2DMBA 2E7BA 3CZJA 4AG4L 1WV7T 3VA6A 5GS0C 3SCMD 1A1MB 2EIBA 1CGUA 1PYWA 1U8OB 5ID0A 3FHAA 3UJJH 4S1SH 2X4TB 5AZ2L 2KQMA 5GGRA 1BM3H 1NQBA 1OTTC 4DVRL 3C09C 5KN5A 3DO7A 1QA9B 2ZSWB 4L8SB 3T2NL 3AM8C 4HQQL 5C08B 3SBWC 3MGTB 1P7QA 4LASL 4PRBB 3DYPA 4QRPE 1TQCB 1WJ3A 2AEPL 2VLRE 4HZLB 2JJTC 2YK1L 4NKDB 5FGSA 5J9PA 3E6HB 1RIHH 2OP4L 4KJYA 4UT7L 4ZUVA 1T83A 1NFDB 1P4IL 2W60B 4ZS7L 1OSPL 3S36H 1FVCB 3AREC 3TO4D 1EIBA 1Y6MR 4KDWA 1BP3B 4GKNA 5DHYA 2Y23A 4Z0XB 5JMRA 3RIFF 1T20A 2VLJA 5D8JH 4KV5F 2DBJA 4YGVB 3RWHA 3U7WL 4C56B 1OB1A 3ESUF 4OZFG 3QRFM 4JN2B 3QPXH 2GW5A 3FO1B 3F7VB 1KCKA 4Q6IB 1S7SB 5IHBA 1IGIL 1U92B 4JG1L 3OV6A 5T3ZE 3P0VL 3SKNA 3TIEB 4KZEL 2GJ6D 1UACH 3QA3A 3T0ED 5CZVH 3D0LB 3BKCL 2JB6B 2WIIA 4QHNA 1KCVH 1KJ2B 2E6QA 1QFHA 4LLDA 4S2SB 3VWJB 1YQ2A 2APTA 5TE7H 2PTTB 1SBSL 3DX9B 2E9WA 3QZWG 2B2XH 5TQ2L 1MJJB 4LEXL 5MI0B 4WCYL 4OZFB 1XF5B 4DOHB 3O2DL 1CD9B 2ZKHH 4ZUUB 3MBEA 4LRNH 1HH9A 3DX7A 1DQQB 5B39G 5I2IA 4NQSB 1NBQA 5B8CB 1N0LA 2R0LH 4ZTPH 3LEVL 4MD0A 1JPGB 2DLTA 4QXGL 3V6OC 5ERWA 3H9ZA 3QDJB 1B0GA 1MFBH 3VXMA 4NCC2 2YD1A 4B7IA 1AFVH 1CDCA 1YN6B 4YE4L 1BECA 2JLLA 3KPTA 1BIHA 1JNNH 2ZJSH 4AL8H 4QWWC 1CXLA 3WJJA 1H3VA 1DQML 4IBLT 5JOFA 4JFYA 5B39B 3KPRE 2X44D 5F72S 5DJ8A 1N64H 2X42A 1B3JA 3QG7H 4X5WB 5DMGC 5HDQH 1BFSA 5FCUL 3C9NA 4P9MH 1UM6H 5DVNA 3LEXB 1R5WB 2I26N 4HKJB 3BSZH 4N5EC 4WUUA 4JPIB 5ENWA 4XPBH 3PP3K 4TOYH 1HQRB 3G04B 3IGAB 4P5MA 5HY9A 2DQHL 1MJ8H 3B9VA 4HH9B 4V1DE 3X12A 1EZVY 5BZWB 3NA9L 5C09D 3NAAH 3I6KB 1C08B 3C5JA 3HCVA 2DYPD 2F19L 4PY7A 4Q9QL 1MCBA 1ACZA 4HX1A 1DBBH 1HEZA 2PO6A 2NX5D 2VR5A 4HS6B 1R24A 5DUPH 1ACYH 3CK0H 3FZUD 5JORB 2P8PA 2VLKD 2NY5H 1UYWL 1BF8A 2Y25A 1WBXB 3TA3C 1U8OA 5DA4A 2X4TA 3QIUC 3X11B 1EV2E 1WITA 1A6UL 1JZ4A 2P48B 3NZHH 1X6NA 2CXGA 2MTPA 4LLVB 3MYZA 5CJOL 2ZSWA 1NLDH 4HS3A 4L8SA 5C08A 3KPMB 3MGTA 3RDTB 3BWAB 3DO3A 4OZGB 2LTQB 4PRBA 1SJVA 1HHIB 1IAKB 4RAVA 3LDBB 4V1DA 3SGKA 2V7NB 2A2QT 4JFEE 2ADFH 1AIFB 3SO3B 5IIEB 5L9DH 4L29B 5GZNC 4Y4HA 2OL3B 3Q6FB 3LQZA 1T4KB 4HZLA 4X4YB 3PIQB 3ELAT 4KTYA 2B7DT 2HN7B 4S11A 3E6HA 4PJCB 1XFPA 5I8EA 3H9SD 2HVKB 1NFDA 12E8H 1XGQB 3N1GC 4P3WA 1DVFC 4Z0XA 3SGEH 5IQ7L 3V0AC 4PJDF 4I0CC 5F93C 3QDHA 4FG6C 4UAOC 2VDKL 4M6AA 1JGEB 5HVHC 5CILL 1C7SA 4C56A 3P73B 3MREB 3TM6A 4JN2A 1MJ7L 2IPUK 1MI5E 2F54E 5GSRB 4E5XB 3IF1A 1S7SA 3BKMH 3MRDB 2G5BB 4LDLB 1U92A 2MQ3A 4MA7L 4MAYC 4RQQB 5GS2D 3T3MF 3HC3L 4NFDA 2CRZA 2DKSA 2KBGA 3BN3B 3QCVL 3RX7A 4HIIA 4ODHL 5IJKA 4M5YH 1CLZL 3DMMD 4G8GD 3MV8D 2JB6A 1KJ2A 1TLKA 3C2AH 4S2SA 3VWJA 1IL1A 4EN3A 1DANT 2PTTA 3N0PB 3DX9A 7FABH 1HQ4A 4BYHA 2W65B 1MJJA 1FVEA 2F5BH 3V7AE 1Q72H 1MFAH 4BK4A 2CKBA 5I30H 2VDLH 4ZUUA 2FDBP 5DUML 4YIQB 1CICD 4ODVL 1DQQA 4PP2A 5JQ6L 4PRPD 4NQSA 1FLRH 3H3BC 4X6EB 1JPGA 3KPLB 4O51A 1MI5A 1PDKA 3DUHA 4JANB 5T1LB 5IGXH 1H15A 3QDJA 2QADC 5C9KA 3GSWB 4O02L 4Q74A 4JRYE 5C0DB 3WE6B 3BDYL 2J8UE 3L3HB 2ZOKB 2MMXA 4HGKC 1KJ2H 1SM3L 1UXSB 4BSWB 2EDLA 5KTEH 3JWOC 3QZWA 3IS0X 3FQWB 1NCBH 4P48A 4LPYA 2VDQL 1W0VA 5C0AB 2V5TA 5J6GB 1QYGH 3MCLH 3OJMB 2UVFA 1DP0A 1DSFL 2CKBH 1EHXA 5ACZA 3OAUL 3VRIB 1A2YA 5F9WC 4M4PA 3W0WB 5I15H 4X5WA 1J5OL 1LEKB 1A5FL 4HWEL 4NZTH 5JOPE 2B4CL 3LEXA 1R5WA 4TTDC 5TDPB 4UV7L 4WFGD 1K4CB 4JPIA 4FMFA 4FXKB 1L0YA 2Q7YB 3G5ZB 1HQRA 3G04A 1GPOH 3BN9C 1H5BC 5IROC 1XF2A 4CVWA 3ULUD 2DQFA 4WWID 2SEBB 3O6FB 3KJ6L 5BZWA 3GIZH 2FX9H 4XVUD 1BPVA 4CVUA 1R3IL 5IVZA 1FL3A 1R3LB 2DWDB 4JRYA 4XCYB 1MFEL 2YSSB 3MRNB 4K9EL 4RMRA 5F9OH 2KDGA 3NCFB 1P69B 3T1FB 2YD5A 3SJVD 5JORA 3KVQA 2VXQL 3OB0K 4U31A 4QYOB 2HWZL 1JL8A 3N1QC 1RUML 4WEUD 4DW2L 4JM2C 2AJYH 4Z7UB 3X11A 4M3KB 3UDWA 3WKMH 4Y5VC 3SCMB 2YZ1A 4HG4J 2R4RH 3MRKB 1TJIL 2V2WB 3BP4B 4ONFH 3RDTA 3UJTH 3BWAA 5IT2L 5EU3B 3ARYA 4OZGA 4PJ5D 5F3HB 1GGIH 1AD9A 1IAKA 1D6VL 2V7NA 2VDML 5D96C 3ARED 3SE9L 4XC1H 4LVEA 1ZVSB 5DJCA 4X98B 3DVGB 1N6VA 1OAQH 4IRZL 2HN7A 4PJCA 3ROOB 4HZAA 1PJ9A 5EUOF 4NZJA 3ZT7A 4DGVL 4DQOL 5ICXA 3AUVA 4ZXBC 3NCBB 2AP2A 2OJZH 1XIWC 3MLYL 3TO4B 5I9QB 5F96H 1I3GL 3P73A 3MREA 1ZK9A 1E4JA 5GSRA 4R0LB 2I9TB 4MCZB 5LXGH 2Z8SA 3QCTL 1VFBB 1T0MB 4JFFD 1MPAH 1MLCB 3MRDA 2G5BA 4G6KL 3SGJA 4K94C 5E6YA 1X5GA 2DTMH 3D39E 3EJZC 2EDEA 2RFXB 1XGUB 2WM0A 5HHVH 3MUGA 1I85C 2B0SL 2NYYD 1F13A 4ZYKB 3S88L 4YBLB 2GJ6B 1CDHA 5BRZD 3FN3A 4NN6C 3T0EB 1OAXL 3LD8B 2XKSA 4JLRB 4K3JL 2YA1A 5CAYB 1D5BA 1CF8H 1CFBA 2GITB 1D5IL 5EH1A 4FFYH 5GRUL 3MNWA 4HT1L 4YIQA 1CFSA 4H20H 3BRGC 3AS0A 5FUOL 2ARJQ 3ARDC 4YEEA 1KC5H 4L8BB 3SKJL 3SKOA 1BGXL 1WT5C 2GAZB 1AP2A 3DV6B 3KPLA 4D2NA 1KCUH 1F90H 3BDBA 5T1LA 3DSNA 1RAMA 3U4EB 3T4AA 3GSWA 1RULL 4KGJA 1KIQA 1V7NL 3UJJL 3D39A 5C0DA 3WE6A 3IFNH 3L3HA 4Y5XA 2FHCA 4MCYB 3IFLL 1UXSA 4WEBL 5FGBA 5E2UL 3JV6B 2FYYB 1GVIA 1RZ8B 4JB9H 4Y8DC 1TVBA 3QJHA 3BH8B 4LSDA 25C8H 4D9RD 1LEKA 2O61A 4MS8C 1I3RA 4JDZB 2BDNH 1MEXH 1HILB 2Q86B 5EU7E 1K4CA 3QIBD 2Q7YA 4NIKB 5IEKA 3G5ZA 3UROR 4BQ9A 1QFWL 1OGTB 1KPUB 3U0WL 4DN3L 3D87B 3O6FA 3ZE1F 2F8VA 5D8JL 4OLYL 1GGUA 3L5IA 4JDVB 3HA0A 1R3LA 2DWDA 4MQXD 1ONQB 2DBLH 2YSSA 4MNHB 5C09B 1INEH 3W39B 2IBZY 2R0ZL 5E9DE 3TA3D 2DYPB 3WFHA 1G1YA 3QPXL 1H0DB 2P46B 3QIUD 4PJEB 1MWAB 4W4OA 1X5YA 4HXBH 4Z7WF 3I6GB 4R4FH 2R4SL 3UPAA 2D2OA 4YHML 4I3GA 2NX5B 4M1GL 4Z6AT 1B0RB 2VLKB 4JN1H 4Q9CA 3WLWC 1BJ1J 1NC2D 4Z7UA 2FX7H 1DBML 1R6VA 4FFZL 2VDRL 3SCMA 5CJ5A 4JFXB 1I8MB 2Y1VA 1I9RL 1KENL 2IQAB 3OR7A 1IEBB 1JYWA 4X6DF 3MRKA 4NQCD 1UKQA 1KXQE 4DAGL 5TE7L 2V2WA 2VMFA 1HIMH 3BP4A 3LH2H 4P4RB 2Z91A 2AEQL 3HNVL 4OGXH 5EU3A 5F3HA 2VXVH 2HH0H 3LQAC 2JCCF 5EZOL 3GJFB 3OWEA 4PD4J 1ZVSA 2XWJA 5D1ZC 1LK2A 3TT3H 5HHNB 4X98A 3DVGA 4ZTPL 3VD9A 1L4IA 1FJ1B 5E9DA 3LPWA 1SY6A 1XR8A 5T1DH 1DFBL 1IC5H 1S7XB 4XWOC 3ROOA 1JGLH 4GUPA 1R0AH 4W6YB 1ZTXL 3E6FB 3H9SB 3UCRA 1B4JH 2GIYA 3NPSC 4MB3A 4GBXD 1CFVL 1B4RA 3NIDE 4PJIF 4N68A 2XQBH 2YBRA 4DUVA 3L1OL 1AXSB 1RHFA 3NCJL 2J88H 1OAZL 4GKZB 1NGYB 4MCZA 4R0LA 2I9TA 1WZKA 4PJGF 3T2PA 1Z0NA 1YUHB 4URTB 5IHZB 3NCCB 2RFXA 1SY6H 4G5ZH 4X7SH 1XGUA 3LSOA 4JFDD 4JCMA 4H25B 4YC2B 3NTCL 4ZYKA 5K9OA 4YQXL 1F3DJ 1G7QA 2GJ6A 1J86A 2A77L 3B3IB 4JLRA 4JO1H 1H3TA 5T3ZL 4G8GB 2FJFA 2VR9A 3MV8B 2GITA 1PG7L 3D0VA 1D3CA 1J8HE 4CDHA 4LGRB 4G42B 2A74B 4M93C 3ZKXB 3VD4A 3HUJB 5I71B 1CICB 2WZPD 2JB5H 2GAZA 4PRPB 5A1AA 1YNLL 4Y19E 4QXUL 1TNNA 1GHFH 2H26B 3QHF