5D6PA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a ligand
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Azaindole Ureas as a Novel Class of Bacterial Gyrase B Inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 61
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5d6pA00
4GGLA 4R3MA 3U67A 4EGHA 2WERA 3LNUA 3LPSA 2YK9A 4P7AA 4L8ZA 1I58A 3FV5A 4O0BA 1TC0A 4EEHA 4KTNA 2BU5A 4NH9A 3A0ZA 3HEKA 2YEAA 1TH8A 2YGFA 3OMUA 1UYGA 2WI2A 1PVGA 4O09A 3O0IA 2BYIA 2YE4A 2O1VA 4KSHA 1YC1A 4MPCA 4XCLA 3Q5LA 2YEDA 2AKPA 2BREA 2CCSA 2HG1A 2XX5A 4MPEA 2IORA 2BZ5A 1GKXA 4LWHA 2QFOA 1AH8A 4CE3A 3ZM7A 1Y4SA 3T0ZA 1Y8PA 2IOPA 3B25A 5CTWA 4BQJA 5M4PA 5BODA 4GFNA 4HXZA 2HCHA 4R1FA 4U7OA 4BAEA 1UYEA 2Q8GA 4I3HA 4CWOA 4FMTA 3TZ0A 3T1KA 3A0TA 2XHXA 1UYFA 3VHCA 5CTXA 2BU6A 2YGAA 5IDJA 4YKUA 2GFDA 1KIJA 4EMVA 1UY8A 4YKWA 2BT0A 2WI6A 2C2AA 2FWZA 3VADA 4E00A 4EFTA 4NH7A 2IWUA 2UWDA 5CTYA 2YGEA 1TILA 3A0XA 3GIEA 2YJWA 5CF0A 3B28A 3O2FA 4XITA 4XIPA 3TZ5A 4U7NA 3EHJA 3HZ1A 4O04A 3BM9A 1ZXMA 4XTJA 3D2RA 4BIZA 3QDDA 1R62A 3HZ5A 3R91A 5M4KA 1AJ6A 4LWEA 2ESAA 4HY6A 2VCJA 4WUCA 1TBWA 2GQPA 3FT5A 3Q5KA 3A0RA 3GIFA 5D7CA 4PL9A 1YC3A 2Q2EB 2BTZA 2XJXA 1QYEA 1UYDA 1I5AA 3EHFA 2IWXA 4KSGA 2YEJA 2YJXA 4AS9A 1AMWA 1YT0A 4EGKA 1YS3A 3RLRA 1EA6A 2H55A 3B27A 2YECA 1BGQA 4LP0A 4I5SA 2XX4A 1THNA 3QTFA 4PRVA 5M4NA 5BOCA 4CWPA 5CPHA 3WQ9A 5D7RA 4O07A 2BRCA 3H80A 2YI0A 1NHIA 4GQTA 2YE8A 3TZ4A 2XJGA 3B26A 4R3AA 4XIQA 4B7PA 4QPJA 2QG0A 4ASBA 2YE9A 4DZYA 4HZ5A 4AWPA 4XCJA 2ZBKB 3OWDA 2HKJA 3IEDA 2YI5A 4V26A 3RKZA 4HY1A 3JZ3A 4BQGA 4XE2A 1I59A 4Q20A 4CWFA 4HYMA 3DGEA 1YESA 3H4LA 5C93A 1ZWHA 1H7SA 2CGFA 4LWFA 4LWGA 4XDMA 3CRLA 1NHJA 3PEHA 3EKRA 2PNRA 1US7A 4YKZA 4K4OA 4URLA 2XDKA 1UY6A 4KP4A 4EGIA 2WEPA 1ID0A 1KZNA 5L3JA 2YK2A 4FPPA 5F5RA 3INWA 3T2SA 4GEEA 3Q5JA 2Q8HA 1B62A 2CCTA 4EM7A 2FXSA 3U2DA 3RLQA 1U2OA 5F3KA 2H8MA 2Q8IA 2YEEA 3ZKDA 4XKOA 4L94A 1YC4A 3K97A 3OPDA 4V25A 1B3QA 3ZKBA 4JAVA 4B6CA 2XABA 5FNFA 4MOTA 2BU7A 2ZDXA 4MP2A 3C0EA 4P8OA 2XD6A 2XDXA 2YEGA 2YKIA 3G75A 3WHAA 4H7QA 5D7DA 1ZW9A 3OWBA 4FCPA 3VHAA 1QZRA 1YT2A 3KE6A 4XKAA 3OW6A 5M4MA 1Y8OA 3B24A 4ASAA 5IN9A 4EFUA 3G7EA 4L90A 2VW5A 4W7TA 2YE7A 2YEFA 1YERA 2YI7A 1UY9A 1A4HA 3MNRP 1Z5AA 3EHHA 2XCMA 3D36A 3VHDA 2QF6A 2E0AA 4LPBA 4PRXA 3R4PA 1YT1A 2YKJA 2CH4A 2YEIA 3T10A 2YEBA 4X9LA 1YSZA 3T0HA 2CG9A 1YETA 4ZKIA 4L91A 4WUDA 5FNDA 3ZXOA 1TIDA 1UYMA 2K5BA 4XD8A 5D6PA 4O05A 4CWTA 4UROA 2XDSA 4HYPA 3G7BA 1B63A 3HYYA 2XX2A 4YKRA 4CWQA 3EHGA 4CE2A 2VWCA 1ZXNA 5M4EA 2FWYA 1AH6A 1UYIA 4H85A 4MBCA 3HHUA 4FCQA 1S16A 1Y8NA 4XKKA 3C11A 5J71A 1I5CA 2FYPA 4KFGA 3CGZA 4GT8A 2YE6A 2O1UA 5FWKA 2JKIA 2XHTA 4NH8A 3K98A 1MU5A 2YKEA 2EXLA 4AWOA 4ASGA 3K60A 5IDMA 1NHHA 3R92A 1AM1A 4YKTA 3GIGB 5GGZA 2WI1A 4MPNA 4YKQA 4AWQA 4CWRA 2CCUA 3A0WA 2ZKJA 4PU9A 1TC6A 3PEJA 2YEHA 1BXDA 2YKBA 1Y4UA 1UYHA 1I5DA 3HYZA 4KQVA 4WUBA 4CE1A 4JQLA 2WI4A 4L93A 4E02A 1EI1A 3CRKA 1BKNA 3CWVA 4JAUA 3K99A 2XHRA 4YKYA 3CGYA 3R4OA 3TUHA 3A0YA 3GIGA 1S14A 1GKZA 2WI3A 2YKCA 4BIUA 4QPKA 1QY8A 4CWSA 2BU8A 2JJCA 4FCRA 1UYCA 4HZ0A 4LWIA 3ZXQA 2IWSA 4URMA 4DUHA 1U0ZA 2XDUA 3INXA 4XC0A 1H7UA 4YKXA 1L0OA 4U93A 3U2KA 2VCIA 1OSFA 1UYLA 2XK2A 2QG2A 1GJVA 4MB9A 2XJJA 5D6QA 1MX0A 3NMQA 5CTUA 5M4HA 3TTZA 3TZ2A 3R4NA 4MP7A 1YSRA 2O1WA 4BXIA 5FNCA 2YI6A 4URNA 2BSMA 3O6OA 3FT8A 2YE2A 1I5BA 2YE5A 3EKOA 3SL2A 2WEQA 2XDLA 3BMYA 1BYQA 2BU2A 4HXWA 1Z5CA 1Z59A 4XIRA 4CWNA 4GCZA 4H81A 4ASFA 2BYHA 5J6AA 2Q8FA 2YE3A 2WI7A 1JM6A 4ZVIA 1Z5BA 2ZDYA 3R4MA 3D0BA 4JASA 1UY7A 1UYKA 3RLPA 4E01A 2IOQA 2WI5A
chains in the Genus database with same CATH superfamily
4GGLA 4R3MA 3U67A 4EGHA 2WERA 3LNUA 3LPSA 2YK9A 4P7AA 4L8ZA 1I58A 3FV5A 4O0BA 1TC0A 4EEHA 4KTNA 5JENA 2BU5A 4NH9A 3A0ZA 3HEKA 2YEAA 1TH8A 2YGFA 3OMUA 1UYGA 2WI2A 1PVGA 4O09A 3O0IA 2BYIA 2YE4A 2O1VA 4KSHA 1YC1A 4MPCA 4XCLA 3Q5LA 2YEDA 2AKPA 2BREA 2CCSA 2HG1A 2XX5A 4MPEA 2IORA 2BZ5A 1GKXA 4LWHA 2QFOA 1AH8A 4CE3A 3ZM7A 1Y4SA 3T0ZA 1Y8PA 2IOPA 3B25A 5CTWA 4BQJA 5M4PA 5BODA 4GFNA 4HXZA 2HCHA 4R1FA 4U7OA 4BAEA 1UYEA 2Q8GA 4I3HA 4CWOA 4FMTA 3TZ0A 3T1KA 1IXMA 3A0TA 2XHXA 1UYFA 3VHCA 5CTXA 2BU6A 2YGAA 5IDJA 4YKUA 2GFDA 1KIJA 4EMVA 1UY8A 4YKWA 2BT0A 2WI6A 2C2AA 2FWZA 3VADA 4E00A 4EFTA 4NH7A 2IWUA 2UWDA 5CTYA 2YGEA 1TILA 3A0XA 3GIEA 2YJWA 5CF0A 3B28A 3O2FA 4XITA 4XIPA 3TZ5A 4U7NA 3EHJA 3HZ1A 4O04A 3BM9A 1ZXMA 4XTJA 3D2RA 4BIZA 3QDDA 1R62A 3HZ5A 3R91A 5M4KA 1AJ6A 4LWEA 2ESAA 4HY6A 2VCJA 4WUCA 1TBWA 2GQPA 3FT5A 3Q5KA 3A0RA 3GIFA 5D7CA 3LMMA 4PL9A 1YC3A 2Q2EB 2BTZA 2XJXA 1QYEA 1UYDA 1I5AA 3EHFA 2HHIA 2IWXA 4KSGA 2YEJA 2YJXA 4AS9A 1AMWA 1YT0A 4EGKA 1YS3A 3RLRA 1EA6A 2H55A 3B27A 2YECA 1BGQA 4LP0A 4I5SA 2XX4A 1THNA 3QTFA 4PRVA 5M4NA 5BOCA 4CWPA 5CPHA 3WQ9A 5D7RA 4O07A 2BRCA 3H80A 2YI0A 1NHIA 4GQTA 2YE8A 3TZ4A 2XJGA 3B26A 4R3AA 4XIQA 2C1GA 4B7PA 4QPJA 2QG0A 4ASBA 2YE9A 4DZYA 4HZ5A 4AWPA 4XCJA 2ZBKB 3OWDA 2HKJA 3IEDA 2YI5A 4V26A 3RKZA 4HY1A 3JZ3A 4BQGA 4XE2A 1I59A 4Q20A 4CWFA 4HYMA 3DGEA 1YESA 3H4LA 5C93A 1ZWHA 1H7SA 2CGFA 4LWFA 4LWGA 4XDMA 3CRLA 1NHJA 3PEHA 3EKRA 2PNRA 1US7A 4YKZA 4K4OA 4URLA 2C1IA 2XDKA 1UY6A 4KP4A 4E72A 4EGIA 2WEPA 1ID0A 1KZNA 5L3JA 2YK2A 4FPPA 5F5RA 3INWA 3T2SA 4GEEA 3CYGA 3Q5JA 2Q8HA 1B62A 2CCTA 4EM7A 2FXSA 3U2DA 3RLQA 1U2OA 5F3KA 2H8MA 2Q8IA 2YEEA 3ZKDA 4XKOA 4L94A 1YC4A 3K97A 3OPDA 4V25A 1B3QA 3ZKBA 4JAVA 4B6CA 2XABA 5FNFA 4MOTA 2BU7A 2ZDXA 3S5TA 4MP2A 3C0EA 4P8OA 2XD6A 2XDXA 2YEGA 2YKIA 3G75A 3WHAA 4H7QA 5D7DA 1ZW9A 3OWBA 4FCPA 3VHAA 1QZRA 1YT2A 3KE6A 4XKAA 3OW6A 5M4MA 1Y8OA 3B24A 4ASAA 5IN9A 4EFUA 3G7EA 4L90A 2VW5A 4W7TA 2YE7A 2YEFA 1YERA 2YI7A 1UY9A 1A4HA 3MNRP 1Z5AA 3EHHA 2XCMA 3D36A 3VHDA 2QF6A 2E0AA 4LPBA 4PRXA 3R4PA 1YT1A 2YKJA 2CH4A 2YEIA 3T10A 2YEBA 4X9LA 1YSZA 3T0HA 2CG9A 1YETA 4ZKIA 4L91A 4WUDA 5FNDA 3ZXOA 1TIDA 1UYMA 2K5BA 4XD8A 5D6PA 4O05A 4CWTA 4UROA 2XDSA 4HYPA 3G7BA 1B63A 3HYYA 2XX2A 4YKRA 4CWQA 3EHGA 4CE2A 2VWCA 1ZXNA 5M4EA 2FWYA 1AH6A 1UYIA 4H85A 4MBCA 3HHUA 4FCQA 1S16A 1Y8NA 4XKKA 3C11A 5J71A 1I5CA 2FYPA 4KFGA 3CGZA 4GT8A 2YE6A 2O1UA 5FWKA 2JKIA 2XHTA 4NH8A 3K98A 1MU5A 2YKEA 2EXLA 4AWOA 4ASGA 3K60A 5IDMA 1NHHA 3R92A 1AM1A 4YKTA 3GIGB 5GGZA 2WI1A 4MPNA 4YKQA 4AWQA 4CWRA 2CCUA 3A0WA 1F51A 2ZKJA 4PU9A 1TC6A 3PEJA 2YEHA 1BXDA 2YKBA 1Y4UA 1UYHA 1I5DA 3HYZA 4KQVA 4WUBA 4CE1A 4JQLA 2WI4A 4L93A 4E02A 1EI1A 3CRKA 1BKNA 3CWVA 4JAUA 3K99A 2XHRA 4YKYA 3CGYA 3R4OA 3TUHA 3A0YA 3GIGA 1S14A 1GKZA 2WI3A 2YKCA 4BIUA 4QPKA 1QY8A 4CWSA 2BU8A 2JJCA 4FCRA 1UYCA 4HZ0A 4LWIA 3ZXQA 2IWSA 4URMA 4DUHA 1U0ZA 2XDUA 3INXA 4XC0A 1H7UA 4YKXA 1L0OA 4U93A 3U2KA 2VCIA 1OSFA 1UYLA 2XK2A 2QG2A 1GJVA 4MB9A 2XJJA 5D6QA 1MX0A 3NMQA 5CTUA 5M4HA 3TTZA 3TZ2A 3R4NA 4MP7A 1YSRA 2O1WA 4BXIA 5FNCA 2YI6A 2FTKA 4URNA 2BSMA 3O6OA 3FT8A 2YE2A 1I5BA 2YE5A 3EKOA 3SL2A 2WEQA 2XDLA 3BMYA 1BYQA 2BU2A 4HXWA 1Z5CA 1Z59A 4XIRA 4CWNA 4GCZA 4H81A 4ASFA 2BYHA 5J6AA 2Q8FA 2YE3A 2WI7A 1JM6A 4ZVIA 1Z5BA 2ZDYA 3R4MA 3D0BA 4JASA 1UY7A 1UYKA 3RLPA 4E01A 2IOQA 2WI5A
chains in the Genus database with same CATH topology
4GGLA 4R3MA 3U67A 4EGHA 2WERA 3LNUA 3LPSA 2YK9A 4P7AA 4L8ZA 1I58A 3FV5A 4O0BA 1TC0A 4EEHA 4KTNA 2BU5A 4NH9A 3A0ZA 3HEKA 2YEAA 1TH8A 2YGFA 3OMUA 1UYGA 2WI2A 1PVGA 4O09A 3O0IA 2BYIA 2YE4A 2O1VA 4KSHA 1YC1A 4MPCA 4XCLA 3Q5LA 2YEDA 2AKPA 2BREA 2CCSA 2HG1A 2XX5A 4MPEA 2IORA 2BZ5A 1GKXA 4LWHA 2QFOA 1AH8A 4CE3A 3ZM7A 1Y4SA 3T0ZA 1Y8PA 2IOPA 3B25A 5CTWA 4BQJA 5M4PA 5BODA 4GFNA 4HXZA 2HCHA 4R1FA 4U7OA 4BAEA 1UYEA 2Q8GA 4I3HA 4CWOA 4FMTA 3TZ0A 3T1KA 3A0TA 2XHXA 1UYFA 3VHCA 5CTXA 2BU6A 2YGAA 5IDJA 4YKUA 2GFDA 1KIJA 4EMVA 1UY8A 4YKWA 2BT0A 2WI6A 2C2AA 2FWZA 3VADA 4E00A 4EFTA 4NH7A 2IWUA 2UWDA 5CTYA 2YGEA 1TILA 3A0XA 3GIEA 2YJWA 5CF0A 3B28A 3O2FA 4XITA 4XIPA 3TZ5A 4U7NA 3EHJA 3HZ1A 4O04A 3BM9A 1ZXMA 4XTJA 3D2RA 4BIZA 3QDDA 1R62A 3HZ5A 3R91A 5M4KA 1AJ6A 4LWEA 2ESAA 4HY6A 2VCJA 4WUCA 1TBWA 2GQPA 3FT5A 3Q5KA 3A0RA 3GIFA 5D7CA 4PL9A 1YC3A 2Q2EB 2BTZA 2XJXA 1QYEA 1UYDA 1I5AA 3EHFA 2IWXA 4KSGA 2YEJA 2YJXA 4AS9A 1AMWA 1YT0A 4EGKA 1YS3A 3RLRA 1EA6A 2H55A 3B27A 2YECA 1BGQA 4LP0A 4I5SA 2XX4A 1THNA 3QTFA 4PRVA 5M4NA 5BOCA 4CWPA 5CPHA 3WQ9A 5D7RA 4O07A 2BRCA 3H80A 2YI0A 1NHIA 4GQTA 2YE8A 3TZ4A 2XJGA 3B26A 4R3AA 4XIQA 4B7PA 4QPJA 2QG0A 4ASBA 2YE9A 4DZYA 4HZ5A 4AWPA 4XCJA 2ZBKB 3OWDA 2HKJA 3IEDA 2YI5A 4V26A 3RKZA 4HY1A 3JZ3A 4BQGA 4XE2A 1I59A 4Q20A 4CWFA 4HYMA 3DGEA 1YESA 3H4LA 5C93A 1ZWHA 1H7SA 2CGFA 4LWFA 4LWGA 4XDMA 3CRLA 1NHJA 3PEHA 3EKRA 2PNRA 1US7A 4YKZA 4K4OA 4URLA 2XDKA 1UY6A 4KP4A 4EGIA 2WEPA 1ID0A 1KZNA 5L3JA 2YK2A 4FPPA 5F5RA 3INWA 3T2SA 4GEEA 3Q5JA 2Q8HA 1B62A 2CCTA 4EM7A 2FXSA 3U2DA 3RLQA 1U2OA 5F3KA 2H8MA 2Q8IA 2YEEA 3ZKDA 4XKOA 4L94A 1YC4A 3K97A 3OPDA 4V25A 1B3QA 3ZKBA 4JAVA 4B6CA 2XABA 5FNFA 4MOTA 2BU7A 2ZDXA 4MP2A 3C0EA 4P8OA 2XD6A 2XDXA 2YEGA 2YKIA 3G75A 3WHAA 4H7QA 5D7DA 1ZW9A 3OWBA 4FCPA 3VHAA 1QZRA 1YT2A 3KE6A 4XKAA 3OW6A 5M4MA 1Y8OA 3B24A 4ASAA 5IN9A 4EFUA 3G7EA 4L90A 2VW5A 4W7TA 2YE7A 2YEFA 1YERA 2YI7A 1UY9A 1A4HA 3MNRP 1Z5AA 3EHHA 2XCMA 3D36A 3VHDA 2QF6A 2E0AA 4LPBA 4PRXA 3R4PA 1YT1A 2YKJA 2CH4A 2YEIA 3T10A 2YEBA 4X9LA 1YSZA 3T0HA 2CG9A 1YETA 4ZKIA 4L91A 4WUDA 5FNDA 3ZXOA 1TIDA 1UYMA 2K5BA 4XD8A 5D6PA 4O05A 4CWTA 4UROA 2XDSA 4HYPA 3G7BA 1B63A 3HYYA 2XX2A 4YKRA 4CWQA 3EHGA 4CE2A 2VWCA 1ZXNA 5M4EA 2FWYA 1AH6A 1UYIA 4H85A 4MBCA 3HHUA 4FCQA 1S16A 1Y8NA 4XKKA 3C11A 5J71A 1I5CA 2FYPA 4KFGA 3CGZA 4GT8A 2YE6A 2O1UA 5FWKA 2JKIA 2XHTA 4NH8A 3K98A 1MU5A 2YKEA 2EXLA 4AWOA 4ASGA 3K60A 5IDMA 1NHHA 3R92A 1AM1A 4YKTA 3GIGB 5GGZA 2WI1A 4MPNA 4YKQA 4AWQA 4CWRA 2CCUA 3A0WA 2ZKJA 4PU9A 1TC6A 3PEJA 2YEHA 1BXDA 2YKBA 1Y4UA 1UYHA 1I5DA 3HYZA 4KQVA 4WUBA 4CE1A 4JQLA 2WI4A 4L93A 4E02A 1EI1A 3CRKA 1BKNA 3CWVA 4JAUA 3K99A 2XHRA 4YKYA 3CGYA 3R4OA 3TUHA 3A0YA 3GIGA 1S14A 1GKZA 2WI3A 2YKCA 4BIUA 4QPKA 1QY8A 4CWSA 2BU8A 2JJCA 4FCRA 1UYCA 4HZ0A 4LWIA 3ZXQA 2IWSA 4URMA 4DUHA 1U0ZA 2XDUA 3INXA 4XC0A 1H7UA 4YKXA 1L0OA 4U93A 3U2KA 2VCIA 1OSFA 1UYLA 2XK2A 2QG2A 1GJVA 4MB9A 2XJJA 5D6QA 1MX0A 3NMQA 5CTUA 5M4HA 3TTZA 3TZ2A 3R4NA 4MP7A 1YSRA 2O1WA 4BXIA 5FNCA 2YI6A 4URNA 2BSMA 3O6OA 3FT8A 2YE2A 1I5BA 2YE5A 3EKOA 3SL2A 2WEQA 2XDLA 3BMYA 1BYQA 2BU2A 4HXWA 1Z5CA 1Z59A 4XIRA 4CWNA 4GCZA 4H81A 4ASFA 2BYHA 5J6AA 2Q8FA 2YE3A 2WI7A 1JM6A 4ZVIA 1Z5BA 2ZDYA 3R4MA 3D0BA 4JASA 1UY7A 1UYKA 3RLPA 4E01A 2IOQA 2WI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGL A;  4R3M A;  3U67 A;  4EGH A;  2WER A;  3LNU A;  3LPS A;  2YK9 A;  4P7A A;  4L8Z A;  1I58 A;  3FV5 A;  4O0B A;  1TC0 A;  4EEH A;  4KTN A;  2BU5 A;  4NH9 A;  3A0Z A;  3HEK A;  2YEA A;  1TH8 A;  2YGF A;  3OMU A;  1UYG A;  2WI2 A;  1PVG A;  4O09 A;  3O0I A;  2BYI A;  2YE4 A;  2O1V A;  4KSH A;  1YC1 A;  4MPC A;  4XCL A;  3Q5L A;  2YED A;  2AKP A;  2BRE A;  2CCS A;  2HG1 A;  2XX5 A;  4MPE A;  2IOR A;  2BZ5 A;  1GKX A;  4LWH A;  2QFO A;  1AH8 A;  4CE3 A;  3ZM7 A;  1Y4S A;  3T0Z A;  1Y8P A;  2IOP A;  3B25 A;  5CTW A;  4BQJ A;  5M4P A;  5BOD A;  4GFN A;  4HXZ A;  2HCH A;  4R1F A;  4U7O A;  4BAE A;  1UYE A;  2Q8G A;  4I3H A;  4CWO A;  4FMT A;  3TZ0 A;  3T1K A;  3A0T A;  2XHX A;  1UYF A;  3VHC A;  5CTX A;  2BU6 A;  2YGA A;  5IDJ A;  4YKU A;  2GFD A;  1KIJ A;  4EMV A;  1UY8 A;  4YKW A;  2BT0 A;  2WI6 A;  2C2A A;  2FWZ A;  3VAD A;  4E00 A;  4EFT A;  4NH7 A;  2IWU A;  2UWD A;  5CTY A;  2YGE A;  1TIL A;  3A0X A;  3GIE A;  2YJW A;  5CF0 A;  3B28 A;  3O2F A;  4XIT A;  4XIP A;  3TZ5 A;  4U7N A;  3EHJ A;  3HZ1 A;  4O04 A;  3BM9 A;  1ZXM A;  4XTJ A;  3D2R A;  4BIZ A;  3QDD A;  1R62 A;  3HZ5 A;  3R91 A;  5M4K A;  1AJ6 A;  4LWE A;  2ESA A;  4HY6 A;  2VCJ A;  4WUC A;  1TBW A;  2GQP A;  3FT5 A;  3Q5K A;  3A0R A;  3GIF A;  5D7C A;  4PL9 A;  1YC3 A;  2Q2E B;  2BTZ A;  2XJX A;  1QYE A;  1UYD A;  1I5A A;  3EHF A;  2IWX A;  4KSG A;  2YEJ A;  2YJX A;  4AS9 A;  1AMW A;  1YT0 A;  4EGK A;  1YS3 A;  3RLR A;  1EA6 A;  2H55 A;  3B27 A;  2YEC A;  1BGQ A;  4LP0 A;  4I5S A;  2XX4 A;  1THN A;  3QTF A;  4PRV A;  5M4N A;  5BOC A;  4CWP A;  5CPH A;  3WQ9 A;  5D7R A;  4O07 A;  2BRC A;  3H80 A;  2YI0 A;  1NHI A;  4GQT A;  2YE8 A;  3TZ4 A;  2XJG A;  3B26 A;  4R3A A;  4XIQ A;  4B7P A;  4QPJ A;  2QG0 A;  4ASB A;  2YE9 A;  4DZY A;  4HZ5 A;  4AWP A;  4XCJ A;  2ZBK B;  3OWD A;  2HKJ A;  3IED A;  2YI5 A;  4V26 A;  3RKZ A;  4HY1 A;  3JZ3 A;  4BQG A;  4XE2 A;  1I59 A;  4Q20 A;  4CWF A;  4HYM A;  3DGE A;  1YES A;  3H4L A;  5C93 A;  1ZWH A;  1H7S A;  2CGF A;  4LWF A;  4LWG A;  4XDM A;  3CRL A;  1NHJ A;  3PEH A;  3EKR A;  2PNR A;  1US7 A;  4YKZ A;  4K4O A;  4URL A;  2XDK A;  1UY6 A;  4KP4 A;  4EGI A;  2WEP A;  1ID0 A;  1KZN A;  5L3J A;  2YK2 A;  4FPP A;  5F5R A;  3INW A;  3T2S A;  4GEE A;  3Q5J A;  2Q8H A;  1B62 A;  2CCT A;  4EM7 A;  2FXS A;  3U2D A;  3RLQ A;  1U2O A;  5F3K A;  2H8M A;  2Q8I A;  2YEE A;  3ZKD A;  4XKO A;  4L94 A;  1YC4 A;  3K97 A;  3OPD A;  4V25 A;  1B3Q A;  3ZKB A;  4JAV A;  4B6C A;  2XAB A;  5FNF A;  4MOT A;  2BU7 A;  2ZDX A;  4MP2 A;  3C0E A;  4P8O A;  2XD6 A;  2XDX A;  2YEG A;  2YKI A;  3G75 A;  3WHA A;  4H7Q A;  5D7D A;  1ZW9 A;  3OWB A;  4FCP A;  3VHA A;  1QZR A;  1YT2 A;  3KE6 A;  4XKA A;  3OW6 A;  5M4M A;  1Y8O A;  3B24 A;  4ASA A;  5IN9 A;  4EFU A;  3G7E A;  4L90 A;  2VW5 A;  4W7T A;  2YE7 A;  2YEF A;  1YER A;  2YI7 A;  1UY9 A;  1A4H A;  3MNR P;  1Z5A A;  3EHH A;  2XCM A;  3D36 A;  3VHD A;  2QF6 A;  2E0A A;  4LPB A;  4PRX A;  3R4P A;  1YT1 A;  2YKJ A;  2CH4 A;  2YEI A;  3T10 A;  2YEB A;  4X9L A;  1YSZ A;  3T0H A;  2CG9 A;  1YET A;  4ZKI A;  4L91 A;  4WUD A;  5FND A;  3ZXO A;  1TID A;  1UYM A;  2K5B A;  4XD8 A;  5D6P A;  4O05 A;  4CWT A;  4URO A;  2XDS A;  4HYP A;  3G7B A;  1B63 A;  3HYY A;  2XX2 A;  4YKR A;  4CWQ A;  3EHG A;  4CE2 A;  2VWC A;  1ZXN A;  5M4E A;  2FWY A;  1AH6 A;  1UYI A;  4H85 A;  4MBC A;  3HHU A;  4FCQ A;  1S16 A;  1Y8N A;  4XKK A;  3C11 A;  5J71 A;  1I5C A;  2FYP A;  4KFG A;  3CGZ A;  4GT8 A;  2YE6 A;  2O1U A;  5FWK A;  2JKI A;  2XHT A;  4NH8 A;  3K98 A;  1MU5 A;  2YKE A;  2EXL A;  4AWO A;  4ASG A;  3K60 A;  5IDM A;  1NHH A;  3R92 A;  1AM1 A;  4YKT A;  3GIG B;  5GGZ A;  2WI1 A;  4MPN A;  4YKQ A;  4AWQ A;  4CWR A;  2CCU A;  3A0W A;  2ZKJ A;  4PU9 A;  1TC6 A;  3PEJ A;  2YEH A;  1BXD A;  2YKB A;  1Y4U A;  1UYH A;  1I5D A;  3HYZ A;  4KQV A;  4WUB A;  4CE1 A;  4JQL A;  2WI4 A;  4L93 A;  4E02 A;  1EI1 A;  3CRK A;  1BKN A;  3CWV A;  4JAU A;  3K99 A;  2XHR A;  4YKY A;  3CGY A;  3R4O A;  3TUH A;  3A0Y A;  3GIG A;  1S14 A;  1GKZ A;  2WI3 A;  2YKC A;  4BIU A;  4QPK A;  1QY8 A;  4CWS A;  2BU8 A;  2JJC A;  4FCR A;  1UYC A;  4HZ0 A;  4LWI A;  3ZXQ A;  2IWS A;  4URM A;  4DUH A;  1U0Z A;  2XDU A;  3INX A;  4XC0 A;  1H7U A;  4YKX A;  1L0O A;  4U93 A;  3U2K A;  2VCI A;  1OSF A;  1UYL A;  2XK2 A;  2QG2 A;  1GJV A;  4MB9 A;  2XJJ A;  5D6Q A;  1MX0 A;  3NMQ A;  5CTU A;  5M4H A;  3TTZ A;  3TZ2 A;  3R4N A;  4MP7 A;  1YSR A;  2O1W A;  4BXI A;  5FNC A;  2YI6 A;  4URN A;  2BSM A;  3O6O A;  3FT8 A;  2YE2 A;  1I5B A;  2YE5 A;  3EKO A;  3SL2 A;  2WEQ A;  2XDL A;  3BMY A;  1BYQ A;  2BU2 A;  4HXW A;  1Z5C A;  1Z59 A;  4XIR A;  4CWN A;  4GCZ A;  4H81 A;  4ASF A;  2BYH A;  5J6A A;  2Q8F A;  2YE3 A;  2WI7 A;  1JM6 A;  4ZVI A;  1Z5B A;  2ZDY A;  3R4M A;  3D0B A;  4JAS A;  1UY7 A;  1UYK A;  3RLP A;  4E01 A;  2IOQ A;  2WI5 A; 
#chains in the Genus database with same CATH topology
 4GGL A;  4R3M A;  3U67 A;  4EGH A;  2WER A;  3LNU A;  3LPS A;  2YK9 A;  4P7A A;  4L8Z A;  1I58 A;  3FV5 A;  4O0B A;  1TC0 A;  4EEH A;  4KTN A;  5JEN A;  2BU5 A;  4NH9 A;  3A0Z A;  3HEK A;  2YEA A;  1TH8 A;  2YGF A;  3OMU A;  1UYG A;  2WI2 A;  1PVG A;  4O09 A;  3O0I A;  2BYI A;  2YE4 A;  2O1V A;  4KSH A;  1YC1 A;  4MPC A;  4XCL A;  3Q5L A;  2YED A;  2AKP A;  2BRE A;  2CCS A;  2HG1 A;  2XX5 A;  4MPE A;  2IOR A;  2BZ5 A;  1GKX A;  4LWH A;  2QFO A;  1AH8 A;  4CE3 A;  3ZM7 A;  1Y4S A;  3T0Z A;  1Y8P A;  2IOP A;  3B25 A;  5CTW A;  4BQJ A;  5M4P A;  5BOD A;  4GFN A;  4HXZ A;  2HCH A;  4R1F A;  4U7O A;  4BAE A;  1UYE A;  2Q8G A;  4I3H A;  4CWO A;  4FMT A;  3TZ0 A;  3T1K A;  1IXM A;  3A0T A;  2XHX A;  1UYF A;  3VHC A;  5CTX A;  2BU6 A;  2YGA A;  5IDJ A;  4YKU A;  2GFD A;  1KIJ A;  4EMV A;  1UY8 A;  4YKW A;  2BT0 A;  2WI6 A;  2C2A A;  2FWZ A;  3VAD A;  4E00 A;  4EFT A;  4NH7 A;  2IWU A;  2UWD A;  5CTY A;  2YGE A;  1TIL A;  3A0X A;  3GIE A;  2YJW A;  5CF0 A;  3B28 A;  3O2F A;  4XIT A;  4XIP A;  3TZ5 A;  4U7N A;  3EHJ A;  3HZ1 A;  4O04 A;  3BM9 A;  1ZXM A;  4XTJ A;  3D2R A;  4BIZ A;  3QDD A;  1R62 A;  3HZ5 A;  3R91 A;  5M4K A;  1AJ6 A;  4LWE A;  2ESA A;  4HY6 A;  2VCJ A;  4WUC A;  1TBW A;  2GQP A;  3FT5 A;  3Q5K A;  3A0R A;  3GIF A;  5D7C A;  3LMM A;  4PL9 A;  1YC3 A;  2Q2E B;  2BTZ A;  2XJX A;  1QYE A;  1UYD A;  1I5A A;  3EHF A;  2HHI A;  2IWX A;  4KSG A;  2YEJ A;  2YJX A;  4AS9 A;  1AMW A;  1YT0 A;  4EGK A;  1YS3 A;  3RLR A;  1EA6 A;  2H55 A;  3B27 A;  2YEC A;  1BGQ A;  4LP0 A;  4I5S A;  2XX4 A;  1THN A;  3QTF A;  4PRV A;  5M4N A;  5BOC A;  4CWP A;  5CPH A;  3WQ9 A;  5D7R A;  4O07 A;  2BRC A;  3H80 A;  2YI0 A;  1NHI A;  4GQT A;  2YE8 A;  3TZ4 A;  2XJG A;  3B26 A;  4R3A A;  4XIQ A;  2C1G A;  4B7P A;  4QPJ A;  2QG0 A;  4ASB A;  2YE9 A;  4DZY A;  4HZ5 A;  4AWP A;  4XCJ A;  2ZBK B;  3OWD A;  2HKJ A;  3IED A;  2YI5 A;  4V26 A;  3RKZ A;  4HY1 A;  3JZ3 A;  4BQG A;  4XE2 A;  1I59 A;  4Q20 A;  4CWF A;  4HYM A;  3DGE A;  1YES A;  3H4L A;  5C93 A;  1ZWH A;  1H7S A;  2CGF A;  4LWF A;  4LWG A;  4XDM A;  3CRL A;  1NHJ A;  3PEH A;  3EKR A;  2PNR A;  1US7 A;  4YKZ A;  4K4O A;  4URL A;  2C1I A;  2XDK A;  1UY6 A;  4KP4 A;  4E72 A;  4EGI A;  2WEP A;  1ID0 A;  1KZN A;  5L3J A;  2YK2 A;  4FPP A;  5F5R A;  3INW A;  3T2S A;  4GEE A;  3CYG A;  3Q5J A;  2Q8H A;  1B62 A;  2CCT A;  4EM7 A;  2FXS A;  3U2D A;  3RLQ A;  1U2O A;  5F3K A;  2H8M A;  2Q8I A;  2YEE A;  3ZKD A;  4XKO A;  4L94 A;  1YC4 A;  3K97 A;  3OPD A;  4V25 A;  1B3Q A;  3ZKB A;  4JAV A;  4B6C A;  2XAB A;  5FNF A;  4MOT A;  2BU7 A;  2ZDX A;  3S5T A;  4MP2 A;  3C0E A;  4P8O A;  2XD6 A;  2XDX A;  2YEG A;  2YKI A;  3G75 A;  3WHA A;  4H7Q A;  5D7D A;  1ZW9 A;  3OWB A;  4FCP A;  3VHA A;  1QZR A;  1YT2 A;  3KE6 A;  4XKA A;  3OW6 A;  5M4M A;  1Y8O A;  3B24 A;  4ASA A;  5IN9 A;  4EFU A;  3G7E A;  4L90 A;  2VW5 A;  4W7T A;  2YE7 A;  2YEF A;  1YER A;  2YI7 A;  1UY9 A;  1A4H A;  3MNR P;  1Z5A A;  3EHH A;  2XCM A;  3D36 A;  3VHD A;  2QF6 A;  2E0A A;  4LPB A;  4PRX A;  3R4P A;  1YT1 A;  2YKJ A;  2CH4 A;  2YEI A;  3T10 A;  2YEB A;  4X9L A;  1YSZ A;  3T0H A;  2CG9 A;  1YET A;  4ZKI A;  4L91 A;  4WUD A;  5FND A;  3ZXO A;  1TID A;  1UYM A;  2K5B A;  4XD8 A;  5D6P A;  4O05 A;  4CWT A;  4URO A;  2XDS A;  4HYP A;  3G7B A;  1B63 A;  3HYY A;  2XX2 A;  4YKR A;  4CWQ A;  3EHG A;  4CE2 A;  2VWC A;  1ZXN A;  5M4E A;  2FWY A;  1AH6 A;  1UYI A;  4H85 A;  4MBC A;  3HHU A;  4FCQ A;  1S16 A;  1Y8N A;  4XKK A;  3C11 A;  5J71 A;  1I5C A;  2FYP A;  4KFG A;  3CGZ A;  4GT8 A;  2YE6 A;  2O1U A;  5FWK A;  2JKI A;  2XHT A;  4NH8 A;  3K98 A;  1MU5 A;  2YKE A;  2EXL A;  4AWO A;  4ASG A;  3K60 A;  5IDM A;  1NHH A;  3R92 A;  1AM1 A;  4YKT A;  3GIG B;  5GGZ A;  2WI1 A;  4MPN A;  4YKQ A;  4AWQ A;  4CWR A;  2CCU A;  3A0W A;  1F51 A;  2ZKJ A;  4PU9 A;  1TC6 A;  3PEJ A;  2YEH A;  1BXD A;  2YKB A;  1Y4U A;  1UYH A;  1I5D A;  3HYZ A;  4KQV A;  4WUB A;  4CE1 A;  4JQL A;  2WI4 A;  4L93 A;  4E02 A;  1EI1 A;  3CRK A;  1BKN A;  3CWV A;  4JAU A;  3K99 A;  2XHR A;  4YKY A;  3CGY A;  3R4O A;  3TUH A;  3A0Y A;  3GIG A;  1S14 A;  1GKZ A;  2WI3 A;  2YKC A;  4BIU A;  4QPK A;  1QY8 A;  4CWS A;  2BU8 A;  2JJC A;  4FCR A;  1UYC A;  4HZ0 A;  4LWI A;  3ZXQ A;  2IWS A;  4URM A;  4DUH A;  1U0Z A;  2XDU A;  3INX A;  4XC0 A;  1H7U A;  4YKX A;  1L0O A;  4U93 A;  3U2K A;  2VCI A;  1OSF A;  1UYL A;  2XK2 A;  2QG2 A;  1GJV A;  4MB9 A;  2XJJ A;  5D6Q A;  1MX0 A;  3NMQ A;  5CTU A;  5M4H A;  3TTZ A;  3TZ2 A;  3R4N A;  4MP7 A;  1YSR A;  2O1W A;  4BXI A;  5FNC A;  2YI6 A;  2FTK A;  4URN A;  2BSM A;  3O6O A;  3FT8 A;  2YE2 A;  1I5B A;  2YE5 A;  3EKO A;  3SL2 A;  2WEQ A;  2XDL A;  3BMY A;  1BYQ A;  2BU2 A;  4HXW A;  1Z5C A;  1Z59 A;  4XIR A;  4CWN A;  4GCZ A;  4H81 A;  4ASF A;  2BYH A;  5J6A A;  2Q8F A;  2YE3 A;  2WI7 A;  1JM6 A;  4ZVI A;  1Z5B A;  2ZDY A;  3R4M A;  3D0B A;  4JAS A;  1UY7 A;  1UYK A;  3RLP A;  4E01 A;  2IOQ A;  2WI5 A; 
#chains in the Genus database with same CATH homology
 4GGL A;  4R3M A;  3U67 A;  4EGH A;  2WER A;  3LNU A;  3LPS A;  2YK9 A;  4P7A A;  4L8Z A;  1I58 A;  3FV5 A;  4O0B A;  1TC0 A;  4EEH A;  4KTN A;  2BU5 A;  4NH9 A;  3A0Z A;  3HEK A;  2YEA A;  1TH8 A;  2YGF A;  3OMU A;  1UYG A;  2WI2 A;  1PVG A;  4O09 A;  3O0I A;  2BYI A;  2YE4 A;  2O1V A;  4KSH A;  1YC1 A;  4MPC A;  4XCL A;  3Q5L A;  2YED A;  2AKP A;  2BRE A;  2CCS A;  2HG1 A;  2XX5 A;  4MPE A;  2IOR A;  2BZ5 A;  1GKX A;  4LWH A;  2QFO A;  1AH8 A;  4CE3 A;  3ZM7 A;  1Y4S A;  3T0Z A;  1Y8P A;  2IOP A;  3B25 A;  5CTW A;  4BQJ A;  5M4P A;  5BOD A;  4GFN A;  4HXZ A;  2HCH A;  4R1F A;  4U7O A;  4BAE A;  1UYE A;  2Q8G A;  4I3H A;  4CWO A;  4FMT A;  3TZ0 A;  3T1K A;  3A0T A;  2XHX A;  1UYF A;  3VHC A;  5CTX A;  2BU6 A;  2YGA A;  5IDJ A;  4YKU A;  2GFD A;  1KIJ A;  4EMV A;  1UY8 A;  4YKW A;  2BT0 A;  2WI6 A;  2C2A A;  2FWZ A;  3VAD A;  4E00 A;  4EFT A;  4NH7 A;  2IWU A;  2UWD A;  5CTY A;  2YGE A;  1TIL A;  3A0X A;  3GIE A;  2YJW A;  5CF0 A;  3B28 A;  3O2F A;  4XIT A;  4XIP A;  3TZ5 A;  4U7N A;  3EHJ A;  3HZ1 A;  4O04 A;  3BM9 A;  1ZXM A;  4XTJ A;  3D2R A;  4BIZ A;  3QDD A;  1R62 A;  3HZ5 A;  3R91 A;  5M4K A;  1AJ6 A;  4LWE A;  2ESA A;  4HY6 A;  2VCJ A;  4WUC A;  1TBW A;  2GQP A;  3FT5 A;  3Q5K A;  3A0R A;  3GIF A;  5D7C A;  4PL9 A;  1YC3 A;  2Q2E B;  2BTZ A;  2XJX A;  1QYE A;  1UYD A;  1I5A A;  3EHF A;  2IWX A;  4KSG A;  2YEJ A;  2YJX A;  4AS9 A;  1AMW A;  1YT0 A;  4EGK A;  1YS3 A;  3RLR A;  1EA6 A;  2H55 A;  3B27 A;  2YEC A;  1BGQ A;  4LP0 A;  4I5S A;  2XX4 A;  1THN A;  3QTF A;  4PRV A;  5M4N A;  5BOC A;  4CWP A;  5CPH A;  3WQ9 A;  5D7R A;  4O07 A;  2BRC A;  3H80 A;  2YI0 A;  1NHI A;  4GQT A;  2YE8 A;  3TZ4 A;  2XJG A;  3B26 A;  4R3A A;  4XIQ A;  4B7P A;  4QPJ A;  2QG0 A;  4ASB A;  2YE9 A;  4DZY A;  4HZ5 A;  4AWP A;  4XCJ A;  2ZBK B;  3OWD A;  2HKJ A;  3IED A;  2YI5 A;  4V26 A;  3RKZ A;  4HY1 A;  3JZ3 A;  4BQG A;  4XE2 A;  1I59 A;  4Q20 A;  4CWF A;  4HYM A;  3DGE A;  1YES A;  3H4L A;  5C93 A;  1ZWH A;  1H7S A;  2CGF A;  4LWF A;  4LWG A;  4XDM A;  3CRL A;  1NHJ A;  3PEH A;  3EKR A;  2PNR A;  1US7 A;  4YKZ A;  4K4O A;  4URL A;  2XDK A;  1UY6 A;  4KP4 A;  4EGI A;  2WEP A;  1ID0 A;  1KZN A;  5L3J A;  2YK2 A;  4FPP A;  5F5R A;  3INW A;  3T2S A;  4GEE A;  3Q5J A;  2Q8H A;  1B62 A;  2CCT A;  4EM7 A;  2FXS A;  3U2D A;  3RLQ A;  1U2O A;  5F3K A;  2H8M A;  2Q8I A;  2YEE A;  3ZKD A;  4XKO A;  4L94 A;  1YC4 A;  3K97 A;  3OPD A;  4V25 A;  1B3Q A;  3ZKB A;  4JAV A;  4B6C A;  2XAB A;  5FNF A;  4MOT A;  2BU7 A;  2ZDX A;  4MP2 A;  3C0E A;  4P8O A;  2XD6 A;  2XDX A;  2YEG A;  2YKI A;  3G75 A;  3WHA A;  4H7Q A;  5D7D A;  1ZW9 A;  3OWB A;  4FCP A;  3VHA A;  1QZR A;  1YT2 A;  3KE6 A;  4XKA A;  3OW6 A;  5M4M A;  1Y8O A;  3B24 A;  4ASA A;  5IN9 A;  4EFU A;  3G7E A;  4L90 A;  2VW5 A;  4W7T A;  2YE7 A;  2YEF A;  1YER A;  2YI7 A;  1UY9 A;  1A4H A;  3MNR P;  1Z5A A;  3EHH A;  2XCM A;  3D36 A;  3VHD A;  2QF6 A;  2E0A A;  4LPB A;  4PRX A;  3R4P A;  1YT1 A;  2YKJ A;  2CH4 A;  2YEI A;  3T10 A;  2YEB A;  4X9L A;  1YSZ A;  3T0H A;  2CG9 A;  1YET A;  4ZKI A;  4L91 A;  4WUD A;  5FND A;  3ZXO A;  1TID A;  1UYM A;  2K5B A;  4XD8 A;  5D6P A;  4O05 A;  4CWT A;  4URO A;  2XDS A;  4HYP A;  3G7B A;  1B63 A;  3HYY A;  2XX2 A;  4YKR A;  4CWQ A;  3EHG A;  4CE2 A;  2VWC A;  1ZXN A;  5M4E A;  2FWY A;  1AH6 A;  1UYI A;  4H85 A;  4MBC A;  3HHU A;  4FCQ A;  1S16 A;  1Y8N A;  4XKK A;  3C11 A;  5J71 A;  1I5C A;  2FYP A;  4KFG A;  3CGZ A;  4GT8 A;  2YE6 A;  2O1U A;  5FWK A;  2JKI A;  2XHT A;  4NH8 A;  3K98 A;  1MU5 A;  2YKE A;  2EXL A;  4AWO A;  4ASG A;  3K60 A;  5IDM A;  1NHH A;  3R92 A;  1AM1 A;  4YKT A;  3GIG B;  5GGZ A;  2WI1 A;  4MPN A;  4YKQ A;  4AWQ A;  4CWR A;  2CCU A;  3A0W A;  2ZKJ A;  4PU9 A;  1TC6 A;  3PEJ A;  2YEH A;  1BXD A;  2YKB A;  1Y4U A;  1UYH A;  1I5D A;  3HYZ A;  4KQV A;  4WUB A;  4CE1 A;  4JQL A;  2WI4 A;  4L93 A;  4E02 A;  1EI1 A;  3CRK A;  1BKN A;  3CWV A;  4JAU A;  3K99 A;  2XHR A;  4YKY A;  3CGY A;  3R4O A;  3TUH A;  3A0Y A;  3GIG A;  1S14 A;  1GKZ A;  2WI3 A;  2YKC A;  4BIU A;  4QPK A;  1QY8 A;  4CWS A;  2BU8 A;  2JJC A;  4FCR A;  1UYC A;  4HZ0 A;  4LWI A;  3ZXQ A;  2IWS A;  4URM A;  4DUH A;  1U0Z A;  2XDU A;  3INX A;  4XC0 A;  1H7U A;  4YKX A;  1L0O A;  4U93 A;  3U2K A;  2VCI A;  1OSF A;  1UYL A;  2XK2 A;  2QG2 A;  1GJV A;  4MB9 A;  2XJJ A;  5D6Q A;  1MX0 A;  3NMQ A;  5CTU A;  5M4H A;  3TTZ A;  3TZ2 A;  3R4N A;  4MP7 A;  1YSR A;  2O1W A;  4BXI A;  5FNC A;  2YI6 A;  4URN A;  2BSM A;  3O6O A;  3FT8 A;  2YE2 A;  1I5B A;  2YE5 A;  3EKO A;  3SL2 A;  2WEQ A;  2XDL A;  3BMY A;  1BYQ A;  2BU2 A;  4HXW A;  1Z5C A;  1Z59 A;  4XIR A;  4CWN A;  4GCZ A;  4H81 A;  4ASF A;  2BYH A;  5J6A A;  2Q8F A;  2YE3 A;  2WI7 A;  1JM6 A;  4ZVI A;  1Z5B A;  2ZDY A;  3R4M A;  3D0B A;  4JAS A;  1UY7 A;  1UYK A;  3RLP A;  4E01 A;  2IOQ A;  2WI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...