5D6YA

Crystal structure of double tudor domain of human lysine demethylase kdm4a complexed with histone h3k23me3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
b'SITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 4A
publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 20
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6yA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6yA02
3P8HA 1KHCA 3LLRA 1SSFA 2RJFA 3OYGA 3P8DA 3L2QA 4IUUA 3FLGA 3OYAA 4BE2A 4IUTA 3PMTA 3GOXA 2DAQA 3L2VA 4FL6A 2EQJA 2RJEA 5FRNA 2RHIA 3NTKA 3E9FA 2M0OA 5FRMA 1OZ2A 3S3NA 2M1HA 2X4WA 2RI3A 3MP8A 5KCOA 4QQ6A 2L8DA 2D9TA 2O4XB 4E7LA 4UC4A 4LD6A 3OYEA 4BE0A 3META 4B9WA 2K3YA 2X4XA 3DLMA 3E9GA 4IURA 3DB3A 5CIUA 3UT1A 2R57A 5J26A 1WJSA 4X34A 4CRIA 5D6XA 3OY9A 2GFAA 3PFSA 2PQWA 5IAYA 3MO8A 4N4IA 4A4FA 2EQMA 2L89A 1OZ3A 3O8VA 5M9OA 2EFIA 3KUFA 4QQDA 2E5QA 3OS1A 2LDMA 2LVMA 4IUVA 4BACA 2EQUA 2LRQA 2NLUA 2O4XA 5KCHA 4N4HA 3CEYA 2G3RA 1MHNA 1XNIA 3MEUA 3UWNA 3PNWC 3OYFA 2K3XA 3OMGA 2R5MA 4BE1A 4RG2A 3PMIA 5D6WA 1WGSA 2F5KA 2HQEA 2MWOA 4IKFA 4E7HA 1OI1A 2RHXA 3NTIA 1RI0A 3L2UA 2RI5A 2X35A 4FU6A 5J39A 2GFUA 2XDPA 2M16A 4NS5A 2QQRA 3OB9A 3LX7A 3S6WA 4EDUA 4A4EA 1N27A 3MEWA 2JZ2A 4HCZA 4L59A 4QQGA 2R58A 3H6ZA 3M9QA 3NTHA 4II1A 3OYCA 3L2RA 1WJRA 2P0KA 3LH0A 3OYLA 3C4SA 3OYKA 3OQ5A 3FEOA 1G5VA 3QBYA 3QKJA 2IG0A 4GY5A 2E6NA 2MWPA 3S3OA 2FHDA 5KE3A 2LCCA 2QQSA 4Z02A 3Q1JA 3OYJA 3QJ6A 2HQXA 2YRVA 4QW2A 3OYBA 2XK0A 3ASKA 3FDRA 3OYNA 4PL6A 4A4GA 2RJCA 4BDYA 5C0MA 3LYIA 3OYMA 2R5AA 4E7KA 5C6SA 4C5IA 5KE2A 4BD3A 2JTFA 4ZTFA 2VYTA 3OMCA 2BUDA 3OS2A 5KH6A 5IN1A 2LTOA 2CKKA 2BIVA 3S3MA 4ZTJA 4B9XA 2RI2A 4IUQA 1H3ZA 4PLLA 2RHZA 5D6YA 5FROA 3OS0A 3LGLA 2RHUA 2RHYA 2GF7A 2EKOA 4C5HA 3MEAA 3EAEA 3MP1A 4Q5WA 3OYIA 2X4YA 3MP6A 3MEVA 3OYDA 4E7IA 2RJDA 4E7JA 3LGFA 3SD4A 3FC3A 4C5GA 3H8ZA 3L42A 2BKDN 2DIGA 4PLIA 3OA6A 4IUPA 4QVZA 1WJQA 3QIIA 2RO0A 3L2WA 3DB4A 1OYXA 3F70A 2EQKA 2B8AA 2WACA 4N4GA 3OYHA 4BDZA 2DIQA 3BDLA 2L3RA 4OVAA 4A4HA 4C5EA 3ZEHA 3ME9A
chains in the Genus database with same CATH superfamily
3P8HA 1ACMB 3VS2A 1KHCA 1M3AA 2EPDA 1ABQA 2MF2A 2IPOB 2H8HA 2JW4A 1K9MR 3CCEQ 2RQTA 1D0YA 1SSHA 1YWOA 5KCOA 4ZGEB 1RLPC 4C0GA 1YITQ 4M7DC 3V7CA 1W1FA 2K2MA 2X9HA 4LDYA 1QVFP 4M7DE 1QVGS 5L8RE 5M9OA 4LN2A 4V2SA 4OGCA 3UA7A 1N8RR 2AK5A 2LVMA 2HEQA 4M75E 2LRQA 2NLUA 5KCHA 2CYZB 3CXCP 4DA4A 3GPLA 2XICA 9ATCB 1BK2A 4PJOB 1O9SA 1BI0A 3BFMA 1RABB 4C92B 2RA2A 1K73C 1YJ9A 1K9MU 1WQ7A 4FW1A 1KK7A 2DBKA 2LT1A 2K6DA 4RUGA 2QG9B 2IG0A 4EMKC 2DEQA 1B34B 1X69A 1M30A 2E6NA 2MWPA 4PJJA 2NUPA 4Z02A 3JCMc 1VQMT 2XHCA 3JB9J 1WHJA 3ASKA 2VWFA 3ULRB 5C0MA 5CCAA 1N9SA 2L3PA 1E6HA 3VRYA 1RADB 3EG1A 4BD3A 1N8RU 1U5SA 1BIAA 3G4SA 1YJWQ 1JEGA 3I55T 2RI2A 2CSQA 1UGPB 2LJ3A 4C5HA 3CC7Q 1G2BA 1G3TA 1IB8A 4KO8A 2X4YA 1M3CA 4MMLA 4OMQA 3OYDA 2KBTA 2EAYA 4ZN3A 3HFOA 1Y0MA 1H3HA 2Q1CX 5HCKA 2F5TX 5KYUA 4QVZA 4BY6C 3L2WA 2BZYA 3BE3A 1VQLQ 1M9SA 1H8KA 1JQQA 4FIBA 5ECAA 3GLXA 1B3QA 3HTRA 3RR6A 1BB9A 3P8DA 4OMMA 4PJNA 3EGDA 4JS4A 1BI1A 2JMCA 2DNUA 5I2SA 3LHDA 5EQJB 2M0OA 5CVIA 1WXUA 4HXJA 2CP0A 1CSKA 2KDSA 4M78D 2K2VA 4BE0A 1M3BA 2K3YA 3TQ7P 5HKCA 1T0HA 4J6YA 2MI6A 1MGQA 2FB7A 1QWEA 1YFNA 2P84A 4BUGA 2GQVA 2E5QA 3CD6T 4IIOA 2AHJB 2BE7D 2XMFA 2AZSA 2BE9B 2BTTA 2DYIA 4C8QF 2MWOA 1YBYA 1S3SA 2Q1DX 1WDXA 3L2UA 2RI5A 3BDUA 1C6VX 4JUVA 3JB9G 3OB9A 5AT1B 1GBRA 3QG1A 1N27A 3SDZA 3RDVA 3PTAA 3NMZC 3OSSC 2P0KA 1QKXA 1NPPA 1TU0B 4WCIA 4QVDA 2Q19X 4M7AD 4ATOA 4OMNA 3CC4T 3REAB 3VS0A 3R6OA 2FEIA 1QVGA 2DZCA 3G6EQ 1WPYA 2AKKA 3EGXB 2GCXA 3RKXA 1AVZC 1TUGB 3EH1A 5GAN2 2COZA 2XDBA 3OMCA 3OS2A 2J6OA 4MDXA 3LWIA 1XJWB 2EIFA 1KD1C 2AKLA 3OYIA 1X2QA 5IHIA 4OMOA 2KI7A 1RAAB 3BQBA 4LDWA 1HXDA 1X6BA 3M57A 5LJ5h 3T9NA 2KYMA 5FTMA 2QA4Q 5CR2A 4FM4B 3OSVA 2B25A 2DO3A 2DL8A 2E10A 2RF0A 1VYUA 4M7AE 2V1QA 3CQTA 1M90C 3GNGA 2QTXA 4RTXA 3SWNA 4JRQA 4GLMA 3L2QA 1PD1A 2DAQA 5GLFA 2HMAA 1IHVA 4RTYA 4HVUA 1X75C 1JU5C 1NLPC 2Q1AX 3META 1K73U 3VS3A 1TUCA 4DOWA 5D7UA 2EYQA 3EFOB 2VGNA 3CMAA 2EQIA 1MNEA 4M7DG 5GAMj 4IUVA 2W10A 1PRMC 1PCXA 1ZUKA 1K0XA 2FZKB 2K3XA 2J7IA 2R5MA 3UF4A 4A53A 4HCKA 5GAOm 1VQ8T 2QQBA 1PHTA 1YN8A 4XTXA 3CCVA 5GAMh 2JZ2A 3CCST 2D8HA 4CI0C 3FPUA 3G7ZA 1Q7YR 1HK9A 1VQOA 3C0CA 1BU1A 3Q1JA 4LUEA 5CO7A 3EG9B 4QW2A 2XKOC 4PJOA 1WFWA 4C92A 2PVOB 1UGQB 3QWZA 2D0NA 3TSZA 4M75B 1PRLC 3HFNA 1S72Q 1YHQA 1B34A 2O2OA 3M53A 2RN8A 4PJMA 5DYGA 2DYBA 5FTNA 5LJ5g 4PFPA 2CP6A 3QJYA 3MEVA 4XU3A 3VRZA 2CT4A 1QVFA 3CCRA 3VU3C 4AMCA 4X1VA 3CCJT 2J06A 2O9VA 1YJNT 1JO8A 3HRUA 4LDUA 1BI2A 3F70A 2WACA 1VQ7A 2DMOA 2H3EB 2NWMA 4A4HA 3J7AF 1WLPB 2FO0A 3ME9A 1VQ4Q 4OMFB 5I11A 1GCPA 3GIBA 1VYTA 4JDSA 1YI2Q 2HCKA 3WVDB 1X6GA 2YSQA 3CCMT 2LP5A 2VC8A 3CBOA 3SFMA 2ESWA 2C0OA 5CKHA 1GFDA 1WJSA 2GNCA 1YIJA 1AOJA 5D6XA 1LOJA 3LW5E 1QP2A 2EYXA 2GQIA 1UEBA 3PFSA 2XD0A 1OZ3A 2ROTA 4PJOC 4F04B 2LX7A 4J6XA 4C92C 3M0RA 2QK0A 1M90R 1B7TA 1CZ4A 2KRNA 2EYYA 4BY6B 4F7UE 4EMHA 5GAMg 5EPPA 5C1BA 2GFUA 2QEXQ 3VKIA 3I5SA 3MEWA 1KD1U 3L2RA 1B07A 1J3TA 4M7DF 3TEEA 2WSFE 3V8KA 3A98A 4JJBA 1UECA 2AZVA 4OP0A 1AWWA 3TCJA 1IZ6A 3FDRA 3NGPA 2KNBB 3J81E 3CCET 4TVRA 3TU4K 1R0BG 3EHRA 2ENMA 3QXEB 1M90U 1BKBA 1Z9ZA 2JXBA 2KE9A 3JCMQ 3E19A 1NLOC 4O5VA 2LQWA 1Q81R 2MK5A 2MYSA 3IQLA 3EGXA 5DLOA 1VQ6A 4JRKA 1FMKA 3LGFA 1MV3A 4R55A 2BKDN 4PK4A 3L1AA 3JCMV 4M78B 4Z89A 1OPKA 4KH0B 5A0DA 2X3WD 2ZPIB 1E6GA 3LLRA 1SSFA 2E65A 2RJFA 1RAEB 3M0PA 1OX8A 3G4SQ 4HVVA 3PGGA 1V29B 1M1KR 4Y28E 4OB3B 5CQXA 2X4WA 3OBWA 1EIFA 4KH1B 3HL8A 4F17A 2K5FA 3FPRA 5GMKe 2E64A 5GAOr 1GFCA 1WLFA 2E6ZA 3EHQA 5IAYA 1WA7A 3EFRA 3J80E 2PZ1A 3VYGA 5KYYA 2L5QA 5FWBA 1QMCA 3C12A 2OTJQ 3CC7T 3OYFA 1PD0A 4M7AB 4BE1A 1UFFA 5FTJA 1VQMA 4CQNA 4EPCA 3X20B 3EFOA 2QQAA 3JCMe 1AWOA 2WSCE 3LX7A 3REBB 3HU2A 3VS1A 2O9SA 2GTJA 1KFZA 3C4SA 2DRMA 2CZ0B 3I55A 1JB0E 2Z0WA 3GP8A 1T3LA 2QQ9A 4J9FA 2KRMA 2PUKB 2YUPA 3CCJQ 1RAGB 3I56A 1YJNQ 1ZA2B 2CUBA 4DEYA 2DF6A 1K9AA 1PSEA 4C5IA 5KH6A 3VS7A 2E3HA 1QWFA 3JRZA 3BW1A 4BI4A 3CCQA 1TS9A 4DBHA 2KEAA 2DL7A 1UUEA 3OS0A 1W2BP 1O75A 3EG9A 1AHJB 4ARCA 1WHGA 2KT8A 3AT1B 4DBQA 3X26B 2DTIA 3MP6A 1SHGA 4ORZA 2L0AA 1G83A 3JCMW 5HK3A 4WF2A 4M75A 1VQ5A 2YDLA 4FYVB 1UG1A 1QCSA 3URGA 2JJ9A 2EW3A 1E7OA 1E32A 2B8AA 3RUXA 4N4GA 2OTLT 1WI7A 3M55A 2LQ8A 1OOTA 1LNXA 1VQ9T 4HCBA 5EC7A 2JOYA 5GANf 1AD5A 2OAWA 3VYHB 5CCXA 3JV3A 4ANJA 2ZZDA 4CC4B 1QDNA 1SEMA 2RHIA 3CD6A 1R0CB 1ZSZC 2LJ1A 3S3NA 2RI3A 1M2OA 4C0DB 4LUDA 5LJ3j 3G6ET 5FLXE 1CZ5A 2R57A 4X34A 4CRIA 2DVJA 2DXTA 1HJDA 4N4IA 4FCYA 4AFUC 2D8JA 2A28A 4QQDA 3QQ8A 3QZ9B 3CCLA 4OMPA 5LJ3h 2MPXC 3VUZA 3CC4A 3JB9I 4PJOG 3PMIA 5D6WA 1WGSA 2ED0A 1N5ZA 4C92G 4C8QG 2ZCFB 1G3SA 2QA4T 1UGVA 3C95A 1I07A 4JLIA 2DZ9A 2P0QA 2O31A 1W4SA 1OU8A 2YHTA 4M75C 1KHIA 3FEOA 2QDLA 1M2VB 2LCCA 2QGGA 1WNLA 2R5AA 2CH4A 5GANd 2FZCB 4ZTJA 4DQ2A 4IIMA 4F7UB 2RHYA 3HU3A 2ZPEB 1D0XA 3MP1A 2GTOA 1FWZA 1RAHB 2A36A 1Z9QA 2F2XA 4JZ4A 3HHTB 3QSUA 4PLIA 1VQNQ 1NYFA 1RAIB 2QTVA 2ATCB 1TOVA 2RO0A 4A4KA 3X24B 1VQOQ 2CSIA 1QKWA 1WIEA 3H9NA 1D3BB 4OVAA 1UE9A 1OX9A 2LJ0A 2WSEE 2DEUA 2DBMA 1W2BS 2ZGWA 2KVQG 4JZ3A 2JS2A 4LXCA 4NL2A 3E9FA 2KXCA 2YUQA 4XQ3A 2CZ1B 4M78A 2CT3A 5FU6B 3CMET 4ME7A 2F1LA 3JCMf 4B9WA 3I35A 4IURA 1JXMA 2EJ9A 4XTYA 3A5ZB 1S1NA 4PJLA 1C0MA 2LW6A 5LJ3g 1H641 1I5LA 2E12A 1S72T 3KUFA 2DPPB 1ZA1B 1G3WA 4MZMA 1XNIA 4XU2A 1VQ7Q 2JNGA 1VQKA 3WXMB 2V8KA 2DM1A 1ZQ1A 2E41A 3V7RA 2X35A 2RMOA 1KQ2A 2KAFA 1QCOA 4L59A 1TSFA 3QWYA 3DKMA 1WJRA 1Q7YC 1PC0A 1NPRA 2CZ6B 4M7AA 2K5IA 1VQ4T 4LDVA 2DKGA 2HAXA 3U23A 2Y90A 1YIJQ 4PJOF 4XAXB 1YI2T 3NPFA 2YRVA 2RQUA 3M4YA 4C92F 1RUWA 1TG0A 4FSSA 2OTLQ 1XOVA 1D1AA 3SB2A 1VQ9Q 4XTUA 1VQPT 1QVFS 4M77D 2J6KA 2EJGA 4M78C 4DOVA 2NYSA 2O01E 1C1AA 3JCMd 3OS5A 4M78E 3JCMX 4C5GA 2AIRB 4KULA 2FPEA 3CXCS 2A3LA 1W6XA 1K8AR 2NUTA 3CCMA 4Y92A 4ARIA 4BDZA 2JS0A 4C0ZA 2LX9A 2Q18X 2DIQA 1U1TA 2HBWA 2QEXT 1I8FA 5GJVB 3INZA 4PFOA 3OYGA 3OYAA 4AG2C 2RJEA 5FRMA 1OZ2A 3RMQA 2RQWA 4M77C 1G8XA 2L8DA 3RKYA 3JCMb 1AZGB 4M77E 5CD1A 2F2WA 4M7AC 2DK3A 4DBFA 1VQ6Q 2PUOB 1M5Q1 2GFAA 3CPWP 3FJPA 1JBMA 2PVGB 4KGXB 2OJ2A 4E2FB 3VS4A 1ARKA 2ABLA 2JN0A 1KQ1A 2ZAEA 2EQUA 3CC2A 2YUNA 2FVUA 1W2BA 1YNZA 4KT0E 1NEGA 1FYNA 2W0ZA 1YJ9T 3M4GA 1NG2A 3CCEA 3S6WA 3CCUQ 5GAN6 4QQGA 5DLQE 3RMSA 4B6MA 3I9QA 5FWCA 3LH0A 4FT4A 2A7YA 1YITA 3RNJA 1ZSZB 5KE3A 1K1ZA 2QQSA 3OYBA 1VIEA 3QPHA 1VYVA 4M75G 3G4ST 1KQSP 1IHWA 5GAOn 3LYIA 4E7KA 2E5KA 3M58A 2JTFA 5GMKl 2KGTA 2QGFB 4CC3A 2LZ6B 2E1HA 3PIPA 2KXDA 1Q81C 2C06A 1M2VA 3E2UA 2EGAA 2M9UA 4J9HA 4PNOA 1SF9A 4HCCA 1QCNA 4CC2A 2YUOA 2FPDA 2OTJT 3CMEQ 2MMPA 3OA6A 1VUBA 4HT8A 5GAN5 2DL3A 1WJQA 4F7UA 1EX4A 3HRSA 5A0LA 5LJ5f 1V1CA 2EQKA 4C0DC 2FL7A 2KR3A 1TXQA 4HA8A 3I56Q 3QDRB 2X4JA 2HZYA 3QQ7A 2EGEA 1YJWA 2QASA 1M1KC 1IRXA 4IUTA 1RL2A 2E70A 5FRNA 3NTKA 4AFQC 3CCQQ 3CC7A 1D3BA 2CGHA 4LD6A 3QYHB 1BBZA 2DFUA 3DLMA 5IHKA 5CIUA 5J26A 1GRIA 1Q7YU 3CXCA 2MAMA 4J83A 2RH2A 1UB4A 4PKCC 2L2PA 4N0AA 1VQLA 4HVWA 1Q82R 4BACA 1FXXA 3QO3A 3MEUA 1MHNA 3ER0A 2L3SA 3M56A 5GAN8 2KYBA 2OX7A 4C8QD 2RHXA 5DM7R 2CS7A 2CP3A 2DTOA 3EG2A 4ZN1A 1JXOA 4NS5A 3N5BB 4J5YA 1VQPQ 4EDUA 3JCMP 1NM7A 3GNFB 3H6ZA 1D09B 3M9QA 5GAN3 3OYLA 1X43A 3G71Q 5GANe 3QBYA 3FIFA 1ZHIA 4KBMB 2QDYB 5LJ5d 2GBQA 3KBGA 5FTLA 2ROLA 4P5NA 2YWWA 1MNDA 4KUDK 1GXIE 1X27A 2BUDA 3CBPA 1TTHB 3S3MA 4IUQA 1ZC1A 2XG8D 4WTOB 2KK4A 4RTZA 3M0TA 3QHSA 1NYGA 4E7IA 2E3IA 1IGQA 4M75F 1NJIR 1CKBA 2HL3A 1K76A 4M78G 2RPNA 1JJ2P 1KQSS 2DX1A 4DEXA 4Z8AA 1K4US 2QI2A 4N0AC 3RKWA 2I2LA 5FU6C 3G6EA 1H92A 4OB2B 2JV2A 5GAOq 3A8MB 1KC8R 2LC4A 1Q86R 1RI9A 5GMKm 3GOXA 3L2VA 2EQJA 3MCAB 4OF1A 3TVTA 3VUBA 2LNHB 1WHMA 2M1HA 1YJ9Q 1AWJA 4QQ6A 1YWPA 2EGCA 4RTVA 3CMAT 3LWHA 5B6CA 3OW2P 2J6FA 2CP5A 4AFZC 3C94A 1MMDA 5DY9A 4M7AG 3M0QA 2HKQB 3OS1A 4QKUA 1A0NB 3AHUA 4J9CA 1ZUUA 1OI1A 3CPFA 5C18A 1VQNT 1Q81U 5J39A 2XDPA 2X3XD 1VQOT 3OYCA 2PU9B 5ERGB 2DERA 5GANj 4ZGJB 2VXEA 1O54A 4M77B 1NE8A 3M5AA 4D8DA 4J7FA 2NUZA 1YHQT 1ZSGA 4OB1B 4VUBA 3JB9D 1ZSZA 1QVGP 1VQKQ 1UJYA 5FROA 1M1KU 5CAIA 4YTLA 3MEAA 4PFZA 4JS5A 3UPUA 4LDXA 1IO6A 3KFVA 4RG8A 3SD4A 3CPWA 4KDIA 1OPLA 3H8ZA 3V8JA 4JJNK 4L5GA 2X51A 3HPWA 1U1SA 3ZJUA 1VQ7T 1U3OA 4J8OA 2I0NA 3DLLA 3OYHA 4RTWA 3V7SA 1YCYA 1KIKA 3ZEHA 4EMGA 3BY7A 3FLGA 4MZPA 2CZ7B 4FL6A 3JB9H 4M78F 2Y4YA 1PNJA 1NBEB 4A63B 1YIJT 1TUDA 2JT4A 1JJ2S 2X4XA 1PKTA 2C0IA 3DB3A 3ZL7C 4JRPA 1VA7A 1SKUB 2IVWA 4QVCA 1KQSA 2EQMA 1K0SA 1SPKA 4HT9A 1BCMA 1QLYA 1I0CA 4ZNXA 5IH2A 5IT9E 2RQVA 1UTIA 2MIOA 2FZGB 4AS1A 2BZ8A 3M0UA 2XDDA 4FYXB 5DYIA 1I1JA 1YI2A 2SRCA 4MDWA 1RI0A 2V8IA 5GMKj 4FT2A 1D0ZA 1RACB 2DL5A 4M77F 1U8RA 2DL4A 2FYKA 3OYEA 4ZTFA 2R58A 4II1A 4M7AF 5L23A 2HKNA 3OQ5A 1X6OA 1SRLA 4M7DD 4GY5A 3S3OA 2RQRA 1RLQC 3QJ6A 3SWNB 5GMKh 5GAN7 1CKAA 2DJQA 2PNIA 1PG5B 1SRMA 2KRSA 2K7AA 3R6NA 3M0SA 4F7UG 4XU1A 1TWBA 4XTZA 1KSWA 2LTOA 1LPLA 2EVRA 2K5LA 3CC2Q 4DBRA 4B9XA 4BI3A 1M8VA 3OYYA 1KJWA 3MJXA 4J7IA 2RHUA 1VQ6T 5A0GA 5LL6S 2P4TA 3EAEA 3M59A 1MMAA 2QEXA 1TH7A 5HY6A 3ZBDA 3JCMh 1M27C 5FTKA 4L6V5 1K8AC 3QYGB 1W70A 2ZPGB 1WZOA 3CMAQ 2EJFA 3CCUT 2V1RA 2DRKA 3QWXX 2CP7A 1AWXA 1ZUYA 2KY9A 1IGUA 2M02A 3CCVQ 1LCKA 4XTVA 5FU7B 4J6WA 4ELYC 4C8QB 2DXCA 2IIMA 3UDCA 4QT7A 1Y7XA 4KRTA 2M0YA 4EIKA 2HL5C 1Y57A 4N4HA 5J3BA 4RV0A 3OMGA 2HQHA 2MOXA 3M54A 1KG1A 1YHQQ 2ZPBB 5LJ3f 1G3YA 2LQNA 5CKDA 4FU6A 3PT9A 2M16A 5LJ5e 2QQRA 2MM0A 1VQ8A 2VV5A 4E47A 5GJWB 2HDAA 5KYWB 3CCRQ 1JJ2A 2PWYA 1MMGA 3CCSA 3I56T 4JJCA 4ELZC 1PSFA 1FMWA 2HSEB 4NL3A 1MUZA 2SEMA 4M4ZA 2KMTA 3FRNA 1AT1B 2OTJA 4LD9K 2VGMA 2YXYA 3CCQT 3A8HB 8ATCB 3ZGZA 1YCSB 2OAUA 2K3BA 4M77A 5GAOl 3RESA 3JCMg 2EKOA 2D6FA 1VQ5T 4BI8B 3MPUB 1GCQA 4E7JA 2AT1B 1NZ9A 3OW2A 4GBQA 2YUJA 1AZEA 3VV0A 4F7UF 2F2VA 4RKUE 1YP5A 5IXFA 3O5ZA 3CCJA 4E7ZA 1YJNA 3A8LB 3RBBB 5GAMe 5LJ3d 4IUUA 3FB9A 2O88A 2V8JA 2DXBA 3X25B 3G71T 1R7RA 4F16A 1ZLMA 3UATA 1WXTA 4UC4A 2K79A 1JRIA 5IXBA 2KQWA 2XU8A 4JLGA 3D7SB 1ABOA 4JRIA 4E7SA 1QW1A 3CCLT 1OEBA 3O8VA 1Q82C 2EFIA 4E6RA 3JSCA 1RAFB 3THKA 2A37A 3PNWC 3MB5A 1EZZB 2D0QB 2CUDA 2HQEA 4X9CA 2EBPA 4RCCA 1UHFA 5LJ5j 2B86A 1X01A 1I5OB 3PE0A 1I9GA 2YRCA 5KYXB 2P4RA 1GCQC 3H0FA 1K73R 1XQHA 3LGAA 3VS5A 2ECZA 3H0IA 2LMJA 1K8AU 3UA6A 6AT1B 4ZGDB 3RERA 4BB7A 5I21A 4PL6A 4A4GA 2LT4A 3EFSA 2KT1A 4J9DA 5C6SA 2E4HA 5KE2A 1WHHA 3PVLA 4R0KA 5EG2A 4CC7A 3JAME 1VOMA 1H3ZA 1QCFA 1R77A 4HKEA 3LGLA 3FPTA 4Q5WA 3KXTA 5HK0A 1NJIC 1P92A 2RJDA 1DJ7B 5KYYB 2ZPFB 2FPFA 4RMOA 2RK2A 2JTEA 3L2ZA 3QIIA 2BZXA 4KGZB 3DB4A 2MM2A 5CQYA 2D1XA 1D1BA 4C5EA 3JCMJ 4JJDA 1KC8C 1Y71A 2CDTA 1Q86C 1VQMQ 2RM4A 4J9GA 2EYZA 1I81A 1MMNA 2K57A 4NOYA 2HD0A 3RIRA 1Y07A 1WYXA 3GF5A 3MP8A 2F69A 2O4XB 1I4K1 2ZPHB 3I55Q 1WHKA 3E9GA 2DILA 5CKEA 3OY9A 1FX7A 5GAN4 1VQNA 1HSQA 2ED1A 2JTMA 5I2MA 1VQKT 2Y4XA 2LDMA 4FSXA 3ZFJA 2MCNA 3SHWA 2HSPA 3E1SA 3VS6A 4M7DB 4RG2A 4IKFA 4C8QA 2VUBA 4E7HA 3JB9F 2DTHA 1M1GA 4XK8E 4RCBA 3SWNC 1T3SA 5GAOp 4HCZA 4MMKA 4FYYB 3A8OB 1VQ5Q 3OYKA 1G5VA 2FHDA 2GGRA 1BIBA 2XK0A 4PJOD 4KUIA 3OBYA 3GBQA 2LQKA 4C92D 2RNAA 5KYWA 2LCLA 3ZJVA 2VVKA 2DJZA 2VYTA 2RK1A 2JMAA 2CKKA 1PM3A 4J9BA 4AT1B 2J05A 3H0HA 4EMKB 2RHZA 5D6YA 3CD6Q 3P8BB 1Y96B 3TSWA 3CPWS 5GAMf 5CK9A 1KD1R 3FC3A 3EGUA 3CBMA 4OGEA 1X2KA 1QP3A 2L3QA 5KYNA 1BCOA 2PTKA 1SG5A 3CCLQ 1Q82U 2L3RA 3WVEB 3ZJTA 4RTUA 5FU7C 1LJOA 3CC4Q 2OTLA 1PWTA 3VJPA 2HNIA 3HU1A 2VKNA 1OU9A 4C8QC 1ZBJA 3MHXA 4PJOE 4MZTA 3HKSA 1VQ9A 1Q95G 4C92E 4C8QE 4R56A 1N6AA 3FJ5A 5IHNA 2VXFA 4RTTA 2D9TA 1IXDA 4E7LA 3HP9A 5CKFA 3A8GB 4D6WA 2G6FX 2K9GA 3PVQA 7AT1B 1EFNA 4X9DA 3HSBA 1R8OB 3X28B 4AFSC 2CP2A 3CC2T 1SHFA 2JVVA 4OMLA 5A2QE 4J9EA 3UWNA 1WX6A 2FRYA 1QQJA 4ESRA 4AG1C 2NUPB 2DA9A 1M4ZA 1HYOA 5GAMd 1HD3A 1YITT 1GL5A 1WHLA 2DVEA 4J9IA 4A54A 2JUFA 1VIFA 1V76A 4M77G 2QA4A 5I22A 3QUIA 5CKBA 1NJIU 1UGSB 3EG3A 1MV0B 3QKJA 4KGVB 3TIWA 2FRWA 1AEYA 2DE0X 3OYJA 2RD1A 2HQXA 4BDYA 1WQWA 1N9RA 3OYMA 1CR5A 4KODA 5KYXA 3CCVT 2A08A 1KC8U 2BIVA 1Q86U 5KYUB 2M51A 2YRDA 2DXUA 2DD5A 2FG0A 2GF7A 1K9MC 3G1JA 3CCUA 4Y91A 3CF2A 1VQ8Q 4O6JA 2YLCA 3EG0A 3NFCA 4JPBW 3EH2A 2QXFA 1BYMA 3EGDB 4Z88A 4IUPA 5LJ3e 2OI3A 2P0PA 1UGRB 2RB6A 3CCSQ 1LVKA 3TREA 1OV3A 1T0JA 4KDLA 5CCBA 5GANh 2H3JA 3I5RA 1YJWT 1N8RC 4K11A 2EYWA 2C0TA 3CCRT 2YVLA 4BE2A 3PMTA 3NHNA 3SEMA 1BI3A 1ZBXA 2CREA 2HBPA 4C0FA 3UT1A 1U06A 1GBQA 3CMEA 1ZX6A 2PQWA 3MO8A 1VQLT 1QVPA 4A4FA 8AT1B 2L89A 4LE9A 2QAZA 4AQ7A 2LNVA 2XI9A 1NEBA 2KSSA 2O4XA 2LCSA 3CEYA 2G3RA 3QC8A 1S72A 3MKDA 2F5KA 4GLKA 5AYFA 4KLNA 1UJ0A 3NTIA 3QZ5B 2PVDB 3H41A 4F14A 2YLBA 2CH4W 4XTWA 2EKHA 4A4EA 2NUTB 4D8KA 3NTHA 2DD4A 3PIOA 1XTDA 1M8MA 2COWA 2DETA 3A1PA 3V8LA 4M7DA 3LH5A 3CCMQ 2YT6A 4LNPA 2DLPA 2QYZA 1VQ4A 1UHCA 3HRTA 3OYNA 2JM9A 2RJCA 1PKSA 1WXBA 2PJHB 2VB6A 2KROA 5IN1A 2JM8A 2K4YA 4PLLA 1OQKA 1FMVA 3OW2S 1OULA 1VQPA 1M1FA 4FYWB 3QDFA 3L42A 2DIGA 4FW2A 3G71A 2A0FB 4M75D 5FW9A 4EMKA 5GANg 2V26A 2EWNA 4XU0A 1D1CA 1Y96A 2XIDA 1OYXA 1UDLA 2VASA 1F1BB 5GMKi 3BDLA 1IREB 2COYA 4OB0B
chains in the Genus database with same CATH topology
3P8HA 4HA8A 2ZPIB 1KHCA 3QDRB 2X4JA 3A8LB 3LLRA 1SSFA 2E65A 2RJFA 5LJ3d 5GAMe 3QQ7A 1YJWA 2MF2A 3FB9A 4IUUA 1M1KC 4IUTA 2V8JA 2DXBA 3X25B 3G71T 1VQ4A 1RL2A 1R7RA 2E70A 1V29B 3NTKA 3PGGA 4Y28E 5FRNA 4OB3B 5CQXA 2X4WA 3CC7A 3OBWA 1EIFA 3HL8A 5KCOA 2K5FA 3FPRA 4ZGEB 1D3BA 2CGHA 5GMKe 4UC4A 4LD6A 3QYHB 4C0GA 2E64A 3DLMA 5GAOr 5CIUA 1WLFA 5J26A 1JRIA 4M7DC 3V7CA 1Q7YU 2KQWA 2XU8A 4LDYA 4JLGA 3CXCA 2E6ZA 2MAMA 4JRIA 5IAYA 1QW1A 4M7DE 3CCLT 4J83A 2RH2A 1UB4A 3EFRA 3J80E 1QVGS 5L8RE 4PKCC 3O8VA 3VYGA 5M9OA 1Q82C 2EFIA 2L5QA 4V2SA 4OGCA 3C12A 4N0AA 2LVMA 1VQLA 3JSCA 4M75E 4BACA 1FXXA 2LRQA 2NLUA 3CC7T 5KCHA 3QO3A 2CYZB 3MEUA 1MHNA 3OYFA 3PNWC 3ER0A 4M7AB 4DA4A 4BE1A 3MB5A 2D0QB 5FTJA 2HQEA 4X9CA 1VQMA 4EPCA 3M56A 3X20B 5GAN8 3GPLA 4CQNA 2QQAA 2RHXA 2XICA 4RCCA 4C8QD 3JCMe 5DM7R 2CS7A 2DTOA 4ZN1A 2WSCE 4NS5A 3N5BB 5LJ5j 1O9SA 3LX7A 1X01A 4J5YA 4EDUA 4PJOB 1BI0A 3BFMA 3HU2A 4C92B 2RA2A 3JCMP 1K73C 3GNFB 1YJ9A 3H6ZA 3M9QA 1K9MU 1I9GA 1WQ7A 5GAN3 3OYLA 2LT1A 1XQHA 3C4SA 2CZ0B 3I55A 3LGAA 1JB0E 5GANe 3GP8A 3QBYA 1K8AU 2QQ9A 2IG0A 4EMKC 2DEQA 1B34B 2E6NA 2MWPA 1ZHIA 3FIFA 4ZGDB 4Z02A 3JCMc 4KBMB 2QDYB 5LJ5d 1VQMT 3RERA 2PUKB 2XHCA 3JB9J 4BB7A 3KBGA 5I21A 3ASKA 5FTLA 3I56A 4PL6A 4A4GA 2LT4A 4P5NA 3EFSA 5C0MA 5CCAA 1N9SA 5C6SA 1PSEA 4C5IA 5KE2A 4BD3A 4KUDK 1N8RU 1GXIE 1BIAA 2BUDA 5EG2A 3CBPA 5KH6A 3G4SA 3S3MA 3JRZA 3JAME 3BW1A 4BI4A 3I55T 3CCQA 2RI2A 4IUQA 1H3ZA 2XG8D 1ZC1A 4HKEA 1UGPB 3OS0A 3LGLA 1O75A 4C5HA 1AHJB 2KK4A 3FPTA 4ARCA 1G3TA 4Q5WA 3X26B 3KXTA 4KO8A 2X4YA 2DTIA 3MP6A 3QHSA 4MMLA 5HK0A 1P92A 3OYDA 4E7IA 2RJDA 2EAYA 1NJIC 4ZN3A 1DJ7B 3JCMW 4M75F 3HFOA 5HK3A 2ZPFB 4WF2A 4M75A 2Q1CX 4RMOA 4M78G 1VQ5A 2RK2A 2F5TX 4QVZA 3L2ZA 1KQSS 3QIIA 4BY6C 1QCSA 3URGA 3L2WA 3DB4A 2MM2A 2QI2A 1E32A 2B8AA 5CQYA 4N4GA 4N0AC 3RKWA 3RUXA 2OTLT 1M9SA 2I2LA 5FU6C 3G6EA 4FIBA 3M55A 2LQ8A 3GLXA 4C5EA 4OB2B 2JV2A 3JCMJ 1LNXA 1VQ9T 1KC8C 4HCBA 1Y71A 5GAOq 1Q86C 2JOYA 2RM4A 5GANf 3A8MB 3P8DA 2LC4A 4JS4A 1I81A 1BI1A 2K57A 3VYHB 4NOYA 5GMKm 2HD0A 3GOXA 3RIRA 5CCXA 3L2VA 2ZZDA 1Y07A 5I2SA 2EQJA 3MCAB 1QDNA 2RHIA 4OF1A 3CD6A 3LHDA 5EQJB 2M0OA 3VUBA 5CVIA 3S3NA 2M1HA 3GF5A 2RI3A 3MP8A 4QQ6A 2KDSA 4M78D 2F69A 4C0DB 3L2UA 2O4XB 2K2VA 5LJ3j 1I4K1 4BE0A 2ZPHB 2K3YA 3G6ET 5HKCA 3E9GA 4J6YA 5FLXE 1CZ5A 2MI6A 2R57A 1MGQA 4X34A 4CRIA 2DXTA 3CMAT 2FB7A 5CKEA 3OY9A 1FX7A 5GAN4 3LWHA 1VQNA 5B6CA 4N4IA 4BUGA 2GQVA 3C94A 2JTMA 5I2MA 5DY9A 4QQDA 4M7AG 2E5QA 1VQKT 3QQ8A 3QZ9B 2Y4XA 2LDMA 4FSXA 3ZFJA 3OS1A 2AHJB 3CCLA 3CD6T 5LJ3h 3VUZA 3E1SA 3AHUA 4C8QF 3JB9I 3CC4A 4RG2A 4PJOG 3PMIA 5D6WA 1WGSA 4IKFA 4M7DB 2MWOA 4C8QA 2VUBA 4C92G 4E7HA 3JB9F 1OI1A 1YBYA 2DTHA 1M1GA 3CPFA 4C8QG 1S3SA 2Q1DX 5C18A 1VQNT 4XK8E 2RI5A 3BDUA 2ZCFB 4RCBA 3SWNC 2XDPA 1G3SA 4JUVA 5J39A 2QA4T 3JB9G 3OB9A 5GAOp 3QG1A 1N27A 3SDZA 3C95A 4HCZA 3PTAA 3OYCA 1VQOT 3OSSC 2P0KA 2PU9B 4JLIA 4MMKA 1NPPA 3A8OB 4QVDA 2Q19X 5ERGB 2DZ9A 2P0QA 3OYKA 1W4SA 2YHTA 4M75C 1KHIA 3FEOA 4ZGJB 5GANj 2VXEA 4M7AD 1G5VA 4ATOA 3CC4T 1O54A 4M77B 2FHDA 3R6OA 2LCCA 1QVGA 1BIBA 1NE8A 2XK0A 3M5AA 2DZCA 1WPYA 4PJOD 1WNLA 4J7FA 4KUIA 2GCXA 2R5AA 3OBYA 3RKXA 2LQKA 4C92D 2LCLA 1YHQT 3ZJVA 5GAN2 2DJZA 4OB1B 5GANd 2XDBA 2VYTA 2RK1A 3OMCA 3OS2A 4VUBA 3JB9D 2CKKA 4ZTJA 4EMKB 4DQ2A 2RHZA 5D6YA 4F7UB 3LWIA 5FROA 4MDXA 3P8BB 1M1KU 1Y96B 5CAIA 2RHYA 3HU3A 3CPWS 4YTLA 3MEAA 2EIFA 1KD1C 2ZPEB 3MP1A 3OYIA 5GAMf 4JS5A 3UPUA 5CK9A 1FWZA 4LDXA 3BQBA 4LDWA 4RG8A 3SD4A 3FC3A 3CPWA 3V8JA 3H8ZA 1HXDA 3CBMA 3HHTB 3M57A 4JJNK 4L5GA 4PLIA 4OGEA 3QSUA 5LJ5h 3T9NA 1QP3A 1U1SA 3HPWA 5FTMA 3ZJUA 1Q81U 5CR2A 1VQ7T 4J8OA 4FM4B 3DLLA 2RO0A 3OSVA 4A4KA 2B25A 3X24B 2DO3A 2E10A 3OYHA 3V7SA 1YCYA 4M7AE 1Q82U 2L3RA 3WVEB 1D3BB 4OVAA 3ZJTA 5FU7C 1LJOA 3ZEHA 1M90C 3GNGA 2QTXA 2WSEE 2OTLA 3VJPA 3SWNA 2HNIA 4EMGA 4JRQA 2ZGWA 2KVQG 1W2BS 3HU1A 4C8QC 3MHXA 4KDIA 3BY7A 3L2QA 4PJOE 3FLGA 4MZTA 3HKSA 2DAQA 4MZPA 1VQ9A 4C92E 5GLFA 2CZ7B 4FL6A 4C8QE 3JB9H 4NL2A 4M78F 3E9FA 4XQ3A 2Y4YA 4R56A 1N6AA 1X75C 2CZ1B 4M78A 2Q1AX 1YIJT 2VXFA 5FU6B 3CMET 2D9TA 4ME7A 4E7LA 3HP9A 5CKFA 3A8GB 3JCMf 3META 4B9WA 1K73U 4D6WA 2X4XA 4IURA 1JJ2S 2EJ9A 3DB3A 4XTYA 3A5ZB 4DOWA 4JRPA 2EYQA 2IVWA 4QVCA 1KQSA 4X9DA 3HSBA 2EQMA 5LJ3g 1R8OB 1H641 3X28B 1I5LA 2E12A 2LW6A 2VGNA 3CMAA 1S72T 3CC2T 3KUFA 4HT9A 4M7DG 2JVVA 2DPPB 5GAMj 4IUVA 5A2QE 1G3WA 5IT9E 4MZMA 3UWNA 1XNIA 4XU2A 2K3XA 2JNGA 1VQKA 2R5MA 3WXMB 2V8KA 4AS1A 2XDDA 5GAOm 4A53A 1VQ8T 1ZQ1A 5DYIA 1YI2A 4MDWA 2E41A 1RI0A 2V8IA 3V7RA 5GMKj 2QQBA 2X35A 4FT2A 1KQ2A 1M4ZA 2KAFA 5GAMd 4M77F 4XTXA 3CCVA 1YITT 2FYKA 1U8RA 3OYEA 2DVEA 2JZ2A 4L59A 5GAMh 4ZTFA 2R58A 4A54A 4II1A 3CCST 2JUFA 1VIFA 1WJRA 3DKMA 4M77G 2QA4A 1Q7YC 4M7AF 3QUIA 5CKBA 4CI0C 1NJIU 1NPRA 1UGSB 2CZ6B 3FPUA 4M7AA 3G7ZA 1X6OA 3OQ5A 2K5IA 1HK9A 1VQ4T 3QKJA 4LDVA 2DKGA 4GY5A 1VQOA 3S3OA 2HAXA 4M7DD 3TIWA 2Y90A 3OYJA 3Q1JA 3QJ6A 4XAXB 4PJOF 5CO7A 2RD1A 3SWNB 2HQXA 2YRVA 2XKOC 4QW2A 5GMKh 1YI2T 3M4YA 4PJOA 4C92F 4BDYA 1WQWA 4C92A 1N9RA 3OYMA 1CR5A 4KODA 3CCVT 2PVOB 1UGQB 3QWZA 4F7UG 4XU1A 1XOVA 4XTZA 3SB2A 4M75B 1KC8U 2LTOA 2BIVA 1Q86U 2K5LA 3HFNA 4XTUA 4B9XA 4BI3A 1VQPT 1YHQA 1B34A 1M8VA 3OYYA 2DXUA 3M53A 4J7IA 2DD5A 2RHUA 4M77D 2GF7A 1QVFS 5A0GA 1VQ6T 2EJGA 5LL6S 2P4TA 3EAEA 4M78C 3M59A 2QEXA 4DOVA 1K9MC 5DYGA 3CCUA 5FTNA 5LJ5g 3QJYA 2O01E 1TH7A 3MEVA 3OS5A 4XU3A 5HY6A 4Y91A 3ZBDA 4M78E 3JCMd 3JCMX 1QVFA 3CF2A 3JCMh 5FTKA 4L6V5 4O6JA 2YLCA 3NFCA 4C5GA 3QYGB 3CCRA 1K8AC 2QXFA 3VU3C 4KULA 3CXCS 1BYMA 2A3LA 2ZPGB 4IUPA 5LJ3e 3CCJT 3CCMA 2P0PA 1UGRB 2EJFA 2RB6A 1YJNT 4ARIA 3HRUA 4LDUA 1BI2A 3F70A 4BDZA 2WACA 4C0ZA 3TREA 1VQ7A 2LX9A 2Q18X 2DIQA 4KDLA 5CCBA 1U1TA 5GANh 2H3JA 4A4HA 2QEXT 1YJWT 1N8RC 3CCUT 3J7AF 3ME9A 4OMFB 3GIBA 1I8FA 4JDSA 3INZA 3OYGA 3CCRT 3OYAA 4BE2A 2YVLA 3PMTA 2KY9A 3WVDB 1BI3A 1ZBXA 2RJEA 3CCMT 5FRMA 1OZ2A 4XTVA 2VC8A 3CBOA 3RMQA 3SFMA 2HBPA 4M77C 2L8DA 3RKYA 4C0FA 3JCMb 5CKHA 5FU7B 4J6WA 4M77E 5CD1A 3UT1A 4M7AC 2DK3A 1WJSA 1YIJA 4ELYC 3CMEA 5D6XA 4C8QB 2PUOB 1LOJA 1M5Q1 2DXCA 1QP2A 3LW5E 2GFAA 3PFSA 1UEBA 2PQWA 3MO8A 3UDCA 3FJPA 1VQLT 1JBMA 1QVPA 2PVGB 4A4FA 2XD0A 2L89A 1OZ3A 5GAN7 4PJOC 1Y7XA 2JN0A 1KQ1A 4J6XA 4C92C 4AQ7A 2LNVA 2XI9A 1CZ4A 2EQUA 2KSSA 2O4XA 4N4HA 3CEYA 2G3RA 3QC8A 1S72A 4BY6B 3CC2A 5J3BA 4RV0A 3OMGA 4F7UE 2FVUA 3M54A 1W2BA 1KG1A 2F5KA 4KT0E 4GLKA 4EMHA 2ZPBB 5AYFA 5LJ3f 4KLNA 1G3YA 5CKDA 5GAMg 3NTIA 1YJ9T 5EPPA 3QZ5B 5C1BA 3M4GA 2PVDB 3PT9A 2GFUA 4FU6A 2M16A 2YLBA 5LJ5e 3CCEA 2QQRA 3S6WA 1VQ8A 2MM0A 4XTWA 3VKIA 5GAN6 2VV5A 4E47A 4A4EA 3MEWA 4QQGA 5DLQE 3NTHA 2DD4A 3RMSA 3PIOA 1XTDA 3L2RA 1KD1U 3LH0A 1JJ2A 2PWYA 4FT4A 4M7DF 2A7YA 3TEEA 2WSFE 1YITA 3V8KA 3V8LA 4M7DA 3CCSA 3I56T 4OP0A 4ELZC 5KE3A 1PSFA 2QQSA 3OYBA 4NL3A 1VIEA 3HRTA 1IZ6A 3FDRA 3QPHA 4M75G 3TCJA 2KMTA 2RJCA 3J81E 3OYNA 3FRNA 5GAOn 4TVRA 3LYIA 3G4ST 4E7KA 3CCET 3M58A 2VGMA 4LD9K 3CCQT 3A8HB 2OTJA 2PJHB 3TU4K 2JTFA 5GMKl 3QXEB 3ZGZA 1M90U 2OAUA 5IN1A 1BKBA 2K4YA 2E1HA 3PIPA 1Q81C 3JCMQ 3E19A 4M77A 4PLLA 5GAOl 2C06A 4O5VA 3RESA 3JCMg 2EKOA 3OW2S 2M9UA 4PNOA 1VQPA 5DLOA 2D6FA 1VQ5T 4HCCA 4BI8B 1VQ6A 4JRKA 4E7JA 1M1FA 3LGFA 2OTJT 1NZ9A 3L42A 4R55A 2BKDN 2DIGA 3OW2A 2MMPA 3OA6A 2YUJA 1VUBA 3G71A 4HT8A 3VV0A 4F7UF 4M75D 5GAN5 1WJQA 4EMKA 5GANg 4RKUE 4F7UA 2EWNA 3HRSA 4XU0A 3L1AA 5A0LA 1Y96A 2XIDA 5LJ5f 1OYXA 3JCMV 4M78B 2EQKA 5GMKi 3CCJA 3BDLA 4C0DC 2FL7A 1IREB 5A0DA 1YJNA 4OB0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8H A;  1KHC A;  3LLR A;  1SSF A;  2RJF A;  3OYG A;  3P8D A;  3L2Q A;  4IUU A;  3FLG A;  3OYA A;  4BE2 A;  4IUT A;  3PMT A;  3GOX A;  2DAQ A;  3L2V A;  4FL6 A;  2EQJ A;  2RJE A;  5FRN A;  2RHI A;  3NTK A;  3E9F A;  2M0O A;  5FRM A;  1OZ2 A;  3S3N A;  2M1H A;  2X4W A;  2RI3 A;  3MP8 A;  5KCO A;  4QQ6 A;  2L8D A;  2D9T A;  2O4X B;  4E7L A;  4UC4 A;  4LD6 A;  3OYE A;  4BE0 A;  3MET A;  4B9W A;  2K3Y A;  2X4X A;  3DLM A;  3E9G A;  4IUR A;  3DB3 A;  5CIU A;  3UT1 A;  2R57 A;  5J26 A;  1WJS A;  4X34 A;  4CRI A;  5D6X A;  3OY9 A;  2GFA A;  3PFS A;  2PQW A;  5IAY A;  3MO8 A;  4N4I A;  4A4F A;  2EQM A;  2L89 A;  1OZ3 A;  3O8V A;  5M9O A;  2EFI A;  3KUF A;  4QQD A;  2E5Q A;  3OS1 A;  2LDM A;  2LVM A;  4IUV A;  4BAC A;  2EQU A;  2LRQ A;  2NLU A;  2O4X A;  5KCH A;  4N4H A;  3CEY A;  2G3R A;  1MHN A;  1XNI A;  3MEU A;  3UWN A;  3PNW C;  3OYF A;  2K3X A;  3OMG A;  2R5M A;  4BE1 A;  4RG2 A;  3PMI A;  5D6W A;  1WGS A;  2F5K A;  2HQE A;  2MWO A;  4IKF A;  4E7H A;  1OI1 A;  2RHX A;  3NTI A;  1RI0 A;  3L2U A;  2RI5 A;  2X35 A;  4FU6 A;  5J39 A;  2GFU A;  2XDP A;  2M16 A;  4NS5 A;  2QQR A;  3OB9 A;  3LX7 A;  3S6W A;  4EDU A;  4A4E A;  1N27 A;  3MEW A;  2JZ2 A;  4HCZ A;  4L59 A;  4QQG A;  2R58 A;  3H6Z A;  3M9Q A;  3NTH A;  4II1 A;  3OYC A;  3L2R A;  1WJR A;  2P0K A;  3LH0 A;  3OYL A;  3C4S A;  3OYK A;  3OQ5 A;  3FEO A;  1G5V A;  3QBY A;  3QKJ A;  2IG0 A;  4GY5 A;  2E6N A;  2MWP A;  3S3O A;  2FHD A;  5KE3 A;  2LCC A;  2QQS A;  4Z02 A;  3Q1J A;  3OYJ A;  3QJ6 A;  2HQX A;  2YRV A;  4QW2 A;  3OYB A;  2XK0 A;  3ASK A;  3FDR A;  3OYN A;  4PL6 A;  4A4G A;  2RJC A;  4BDY A;  5C0M A;  3LYI A;  3OYM A;  2R5A A;  4E7K A;  5C6S A;  4C5I A;  5KE2 A;  4BD3 A;  2JTF A;  4ZTF A;  2VYT A;  3OMC A;  2BUD A;  3OS2 A;  5KH6 A;  5IN1 A;  2LTO A;  2CKK A;  2BIV A;  3S3M A;  4ZTJ A;  4B9X A;  2RI2 A;  4IUQ A;  1H3Z A;  4PLL A;  2RHZ A;  5D6Y A;  5FRO A;  3OS0 A;  3LGL A;  2RHU A;  2RHY A;  2GF7 A;  2EKO A;  4C5H A;  3MEA A;  3EAE A;  3MP1 A;  4Q5W A;  3OYI A;  2X4Y A;  3MP6 A;  3MEV A;  3OYD A;  4E7I A;  2RJD A;  4E7J A;  3LGF A;  3SD4 A;  3FC3 A;  4C5G A;  3H8Z A;  3L42 A;  2BKD N;  2DIG A;  4PLI A;  3OA6 A;  4IUP A;  4QVZ A;  1WJQ A;  3QII A;  2RO0 A;  3L2W A;  3DB4 A;  1OYX A;  3F70 A;  2EQK A;  2B8A A;  2WAC A;  4N4G A;  3OYH A;  4BDZ A;  2DIQ A;  3BDL A;  2L3R A;  4OVA A;  4A4H A;  4C5E A;  3ZEH A;  3ME9 A; 
#chains in the Genus database with same CATH topology
 3P8H A;  1ACM B;  3VS2 A;  1KHC A;  1M3A A;  2EPD A;  1ABQ A;  2MF2 A;  2IPO B;  2H8H A;  2JW4 A;  1K9M R;  3CCE Q;  2RQT A;  1D0Y A;  1SSH A;  1YWO A;  5KCO A;  4ZGE B;  1RLP C;  4C0G A;  1YIT Q;  4M7D C;  3V7C A;  1W1F A;  2K2M A;  2X9H A;  4LDY A;  1QVF P;  4M7D E;  1QVG S;  5L8R E;  5M9O A;  4LN2 A;  4V2S A;  4OGC A;  3UA7 A;  1N8R R;  2AK5 A;  2LVM A;  2HEQ A;  4M75 E;  2LRQ A;  2NLU A;  5KCH A;  2CYZ B;  3CXC P;  4DA4 A;  3GPL A;  2XIC A;  9ATC B;  1BK2 A;  4PJO B;  1O9S A;  1BI0 A;  3BFM A;  1RAB B;  4C92 B;  2RA2 A;  1K73 C;  1YJ9 A;  1K9M U;  1WQ7 A;  4FW1 A;  1KK7 A;  2DBK A;  2LT1 A;  2K6D A;  4RUG A;  2QG9 B;  2IG0 A;  4EMK C;  2DEQ A;  1B34 B;  1X69 A;  1M30 A;  2E6N A;  2MWP A;  4PJJ A;  2NUP A;  4Z02 A;  3JCM c;  1VQM T;  2XHC A;  3JB9 J;  1WHJ A;  3ASK A;  2VWF A;  3ULR B;  5C0M A;  5CCA A;  1N9S A;  2L3P A;  1E6H A;  3VRY A;  1RAD B;  3EG1 A;  4BD3 A;  1N8R U;  1U5S A;  1BIA A;  3G4S A;  1YJW Q;  1JEG A;  3I55 T;  2RI2 A;  2CSQ A;  1UGP B;  2LJ3 A;  4C5H A;  3CC7 Q;  1G2B A;  1G3T A;  1IB8 A;  4KO8 A;  2X4Y A;  1M3C A;  4MML A;  4OMQ A;  3OYD A;  2KBT A;  2EAY A;  4ZN3 A;  3HFO A;  1Y0M A;  1H3H A;  2Q1C X;  5HCK A;  2F5T X;  5KYU A;  4QVZ A;  4BY6 C;  3L2W A;  2BZY A;  3BE3 A;  1VQL Q;  1M9S A;  1H8K A;  1JQQ A;  4FIB A;  5ECA A;  3GLX A;  1B3Q A;  3HTR A;  3RR6 A;  1BB9 A;  3P8D A;  4OMM A;  4PJN A;  3EGD A;  4JS4 A;  1BI1 A;  2JMC A;  2DNU A;  5I2S A;  3LHD A;  5EQJ B;  2M0O A;  5CVI A;  1WXU A;  4HXJ A;  2CP0 A;  1CSK A;  2KDS A;  4M78 D;  2K2V A;  4BE0 A;  1M3B A;  2K3Y A;  3TQ7 P;  5HKC A;  1T0H A;  4J6Y A;  2MI6 A;  1MGQ A;  2FB7 A;  1QWE A;  1YFN A;  2P84 A;  4BUG A;  2GQV A;  2E5Q A;  3CD6 T;  4IIO A;  2AHJ B;  2BE7 D;  2XMF A;  2AZS A;  2BE9 B;  2BTT A;  2DYI A;  4C8Q F;  2MWO A;  1YBY A;  1S3S A;  2Q1D X;  1WDX A;  3L2U A;  2RI5 A;  3BDU A;  1C6V X;  4JUV A;  3JB9 G;  3OB9 A;  5AT1 B;  1GBR A;  3QG1 A;  1N27 A;  3SDZ A;  3RDV A;  3PTA A;  3NMZ C;  3OSS C;  2P0K A;  1QKX A;  1NPP A;  1TU0 B;  4WCI A;  4QVD A;  2Q19 X;  4M7A D;  4ATO A;  4OMN A;  3CC4 T;  3REA B;  3VS0 A;  3R6O A;  2FEI A;  1QVG A;  2DZC A;  3G6E Q;  1WPY A;  2AKK A;  3EGX B;  2GCX A;  3RKX A;  1AVZ C;  1TUG B;  3EH1 A;  5GAN 2;  2COZ A;  2XDB A;  3OMC A;  3OS2 A;  2J6O A;  4MDX A;  3LWI A;  1XJW B;  2EIF A;  1KD1 C;  2AKL A;  3OYI A;  1X2Q A;  5IHI A;  4OMO A;  2KI7 A;  1RAA B;  3BQB A;  4LDW A;  1HXD A;  1X6B A;  3M57 A;  5LJ5 h;  3T9N A;  2KYM A;  5FTM A;  2QA4 Q;  5CR2 A;  4FM4 B;  3OSV A;  2B25 A;  2DO3 A;  2DL8 A;  2E10 A;  2RF0 A;  1VYU A;  4M7A E;  2V1Q A;  3CQT A;  1M90 C;  3GNG A;  2QTX A;  4RTX A;  3SWN A;  4JRQ A;  4GLM A;  3L2Q A;  1PD1 A;  2DAQ A;  5GLF A;  2HMA A;  1IHV A;  4RTY A;  4HVU A;  1X75 C;  1JU5 C;  1NLP C;  2Q1A X;  3MET A;  1K73 U;  3VS3 A;  1TUC A;  4DOW A;  5D7U A;  2EYQ A;  3EFO B;  2VGN A;  3CMA A;  2EQI A;  1MNE A;  4M7D G;  5GAM j;  4IUV A;  2W10 A;  1PRM C;  1PCX A;  1ZUK A;  1K0X A;  2FZK B;  2K3X A;  2J7I A;  2R5M A;  3UF4 A;  4A53 A;  4HCK A;  5GAO m;  1VQ8 T;  2QQB A;  1PHT A;  1YN8 A;  4XTX A;  3CCV A;  5GAM h;  2JZ2 A;  3CCS T;  2D8H A;  4CI0 C;  3FPU A;  3G7Z A;  1Q7Y R;  1HK9 A;  1VQO A;  3C0C A;  1BU1 A;  3Q1J A;  4LUE A;  5CO7 A;  3EG9 B;  4QW2 A;  2XKO C;  4PJO A;  1WFW A;  4C92 A;  2PVO B;  1UGQ B;  3QWZ A;  2D0N A;  3TSZ A;  4M75 B;  1PRL C;  3HFN A;  1S72 Q;  1YHQ A;  1B34 A;  2O2O A;  3M53 A;  2RN8 A;  4PJM A;  5DYG A;  2DYB A;  5FTN A;  5LJ5 g;  4PFP A;  2CP6 A;  3QJY A;  3MEV A;  4XU3 A;  3VRZ A;  2CT4 A;  1QVF A;  3CCR A;  3VU3 C;  4AMC A;  4X1V A;  3CCJ T;  2J06 A;  2O9V A;  1YJN T;  1JO8 A;  3HRU A;  4LDU A;  1BI2 A;  3F70 A;  2WAC A;  1VQ7 A;  2DMO A;  2H3E B;  2NWM A;  4A4H A;  3J7A F;  1WLP B;  2FO0 A;  3ME9 A;  1VQ4 Q;  4OMF B;  5I11 A;  1GCP A;  3GIB A;  1VYT A;  4JDS A;  1YI2 Q;  2HCK A;  3WVD B;  1X6G A;  2YSQ A;  3CCM T;  2LP5 A;  2VC8 A;  3CBO A;  3SFM A;  2ESW A;  2C0O A;  5CKH A;  1GFD A;  1WJS A;  2GNC A;  1YIJ A;  1AOJ A;  5D6X A;  1LOJ A;  3LW5 E;  1QP2 A;  2EYX A;  2GQI A;  1UEB A;  3PFS A;  2XD0 A;  1OZ3 A;  2ROT A;  4PJO C;  4F04 B;  2LX7 A;  4J6X A;  4C92 C;  3M0R A;  2QK0 A;  1M90 R;  1B7T A;  1CZ4 A;  2KRN A;  2EYY A;  4BY6 B;  4F7U E;  4EMH A;  5GAM g;  5EPP A;  5C1B A;  2GFU A;  2QEX Q;  3VKI A;  3I5S A;  3MEW A;  1KD1 U;  3L2R A;  1B07 A;  1J3T A;  4M7D F;  3TEE A;  2WSF E;  3V8K A;  3A98 A;  4JJB A;  1UEC A;  2AZV A;  4OP0 A;  1AWW A;  3TCJ A;  1IZ6 A;  3FDR A;  3NGP A;  2KNB B;  3J81 E;  3CCE T;  4TVR A;  3TU4 K;  1R0B G;  3EHR A;  2ENM A;  3QXE B;  1M90 U;  1BKB A;  1Z9Z A;  2JXB A;  2KE9 A;  3JCM Q;  3E19 A;  1NLO C;  4O5V A;  2LQW A;  1Q81 R;  2MK5 A;  2MYS A;  3IQL A;  3EGX A;  5DLO A;  1VQ6 A;  4JRK A;  1FMK A;  3LGF A;  1MV3 A;  4R55 A;  2BKD N;  4PK4 A;  3L1A A;  3JCM V;  4M78 B;  4Z89 A;  1OPK A;  4KH0 B;  5A0D A;  2X3W D;  2ZPI B;  1E6G A;  3LLR A;  1SSF A;  2E65 A;  2RJF A;  1RAE B;  3M0P A;  1OX8 A;  3G4S Q;  4HVV A;  3PGG A;  1V29 B;  1M1K R;  4Y28 E;  4OB3 B;  5CQX A;  2X4W A;  3OBW A;  1EIF A;  4KH1 B;  3HL8 A;  4F17 A;  2K5F A;  3FPR A;  5GMK e;  2E64 A;  5GAO r;  1GFC A;  1WLF A;  2E6Z A;  3EHQ A;  5IAY A;  1WA7 A;  3EFR A;  3J80 E;  2PZ1 A;  3VYG A;  5KYY A;  2L5Q A;  5FWB A;  1QMC A;  3C12 A;  2OTJ Q;  3CC7 T;  3OYF A;  1PD0 A;  4M7A B;  4BE1 A;  1UFF A;  5FTJ A;  1VQM A;  4CQN A;  4EPC A;  3X20 B;  3EFO A;  2QQA A;  3JCM e;  1AWO A;  2WSC E;  3LX7 A;  3REB B;  3HU2 A;  3VS1 A;  2O9S A;  2GTJ A;  1KFZ A;  3C4S A;  2DRM A;  2CZ0 B;  3I55 A;  1JB0 E;  2Z0W A;  3GP8 A;  1T3L A;  2QQ9 A;  4J9F A;  2KRM A;  2PUK B;  2YUP A;  3CCJ Q;  1RAG B;  3I56 A;  1YJN Q;  1ZA2 B;  2CUB A;  4DEY A;  2DF6 A;  1K9A A;  1PSE A;  4C5I A;  5KH6 A;  3VS7 A;  2E3H A;  1QWF A;  3JRZ A;  3BW1 A;  4BI4 A;  3CCQ A;  1TS9 A;  4DBH A;  2KEA A;  2DL7 A;  1UUE A;  3OS0 A;  1W2B P;  1O75 A;  3EG9 A;  1AHJ B;  4ARC A;  1WHG A;  2KT8 A;  3AT1 B;  4DBQ A;  3X26 B;  2DTI A;  3MP6 A;  1SHG A;  4ORZ A;  2L0A A;  1G83 A;  3JCM W;  5HK3 A;  4WF2 A;  4M75 A;  1VQ5 A;  2YDL A;  4FYV B;  1UG1 A;  1QCS A;  3URG A;  2JJ9 A;  2EW3 A;  1E7O A;  1E32 A;  2B8A A;  3RUX A;  4N4G A;  2OTL T;  1WI7 A;  3M55 A;  2LQ8 A;  1OOT A;  1LNX A;  1VQ9 T;  4HCB A;  5EC7 A;  2JOY A;  5GAN f;  1AD5 A;  2OAW A;  3VYH B;  5CCX A;  3JV3 A;  4ANJ A;  2ZZD A;  4CC4 B;  1QDN A;  1SEM A;  2RHI A;  3CD6 A;  1R0C B;  1ZSZ C;  2LJ1 A;  3S3N A;  2RI3 A;  1M2O A;  4C0D B;  4LUD A;  5LJ3 j;  3G6E T;  5FLX E;  1CZ5 A;  2R57 A;  4X34 A;  4CRI A;  2DVJ A;  2DXT A;  1HJD A;  4N4I A;  4FCY A;  4AFU C;  2D8J A;  2A28 A;  4QQD A;  3QQ8 A;  3QZ9 B;  3CCL A;  4OMP A;  5LJ3 h;  2MPX C;  3VUZ A;  3CC4 A;  3JB9 I;  4PJO G;  3PMI A;  5D6W A;  1WGS A;  2ED0 A;  1N5Z A;  4C92 G;  4C8Q G;  2ZCF B;  1G3S A;  2QA4 T;  1UGV A;  3C95 A;  1I07 A;  4JLI A;  2DZ9 A;  2P0Q A;  2O31 A;  1W4S A;  1OU8 A;  2YHT A;  4M75 C;  1KHI A;  3FEO A;  2QDL A;  1M2V B;  2LCC A;  2QGG A;  1WNL A;  2R5A A;  2CH4 A;  5GAN d;  2FZC B;  4ZTJ A;  4DQ2 A;  4IIM A;  4F7U B;  2RHY A;  3HU3 A;  2ZPE B;  1D0X A;  3MP1 A;  2GTO A;  1FWZ A;  1RAH B;  2A36 A;  1Z9Q A;  2F2X A;  4JZ4 A;  3HHT B;  3QSU A;  4PLI A;  1VQN Q;  1NYF A;  1RAI B;  2QTV A;  2ATC B;  1TOV A;  2RO0 A;  4A4K A;  3X24 B;  1VQO Q;  2CSI A;  1QKW A;  1WIE A;  3H9N A;  1D3B B;  4OVA A;  1UE9 A;  1OX9 A;  2LJ0 A;  2WSE E;  2DEU A;  2DBM A;  1W2B S;  2ZGW A;  2KVQ G;  4JZ3 A;  2JS2 A;  4LXC A;  4NL2 A;  3E9F A;  2KXC A;  2YUQ A;  4XQ3 A;  2CZ1 B;  4M78 A;  2CT3 A;  5FU6 B;  3CME T;  4ME7 A;  2F1L A;  3JCM f;  4B9W A;  3I35 A;  4IUR A;  1JXM A;  2EJ9 A;  4XTY A;  3A5Z B;  1S1N A;  4PJL A;  1C0M A;  2LW6 A;  5LJ3 g;  1H64 1;  1I5L A;  2E12 A;  1S72 T;  3KUF A;  2DPP B;  1ZA1 B;  1G3W A;  4MZM A;  1XNI A;  4XU2 A;  1VQ7 Q;  2JNG A;  1VQK A;  3WXM B;  2V8K A;  2DM1 A;  1ZQ1 A;  2E41 A;  3V7R A;  2X35 A;  2RMO A;  1KQ2 A;  2KAF A;  1QCO A;  4L59 A;  1TSF A;  3QWY A;  3DKM A;  1WJR A;  1Q7Y C;  1PC0 A;  1NPR A;  2CZ6 B;  4M7A A;  2K5I A;  1VQ4 T;  4LDV A;  2DKG A;  2HAX A;  3U23 A;  2Y90 A;  1YIJ Q;  4PJO F;  4XAX B;  1YI2 T;  3NPF A;  2YRV A;  2RQU A;  3M4Y A;  4C92 F;  1RUW A;  1TG0 A;  4FSS A;  2OTL Q;  1XOV A;  1D1A A;  3SB2 A;  1VQ9 Q;  4XTU A;  1VQP T;  1QVF S;  4M77 D;  2J6K A;  2EJG A;  4M78 C;  4DOV A;  2NYS A;  2O01 E;  1C1A A;  3JCM d;  3OS5 A;  4M78 E;  3JCM X;  4C5G A;  2AIR B;  4KUL A;  2FPE A;  3CXC S;  2A3L A;  1W6X A;  1K8A R;  2NUT A;  3CCM A;  4Y92 A;  4ARI A;  4BDZ A;  2JS0 A;  4C0Z A;  2LX9 A;  2Q18 X;  2DIQ A;  1U1T A;  2HBW A;  2QEX T;  1I8F A;  5GJV B;  3INZ A;  4PFO A;  3OYG A;  3OYA A;  4AG2 C;  2RJE A;  5FRM A;  1OZ2 A;  3RMQ A;  2RQW A;  4M77 C;  1G8X A;  2L8D A;  3RKY A;  3JCM b;  1AZG B;  4M77 E;  5CD1 A;  2F2W A;  4M7A C;  2DK3 A;  4DBF A;  1VQ6 Q;  2PUO B;  1M5Q 1;  2GFA A;  3CPW P;  3FJP A;  1JBM A;  2PVG B;  4KGX B;  2OJ2 A;  4E2F B;  3VS4 A;  1ARK A;  2ABL A;  2JN0 A;  1KQ1 A;  2ZAE A;  2EQU A;  3CC2 A;  2YUN A;  2FVU A;  1W2B A;  1YNZ A;  4KT0 E;  1NEG A;  1FYN A;  2W0Z A;  1YJ9 T;  3M4G A;  1NG2 A;  3CCE A;  3S6W A;  3CCU Q;  5GAN 6;  4QQG A;  5DLQ E;  3RMS A;  4B6M A;  3I9Q A;  5FWC A;  3LH0 A;  4FT4 A;  2A7Y A;  1YIT A;  3RNJ A;  1ZSZ B;  5KE3 A;  1K1Z A;  2QQS A;  3OYB A;  1VIE A;  3QPH A;  1VYV A;  4M75 G;  3G4S T;  1KQS P;  1IHW A;  5GAO n;  3LYI A;  4E7K A;  2E5K A;  3M58 A;  2JTF A;  5GMK l;  2KGT A;  2QGF B;  4CC3 A;  2LZ6 B;  2E1H A;  3PIP A;  2KXD A;  1Q81 C;  2C06 A;  1M2V A;  3E2U A;  2EGA A;  2M9U A;  4J9H A;  4PNO A;  1SF9 A;  4HCC A;  1QCN A;  4CC2 A;  2YUO A;  2FPD A;  2OTJ T;  3CME Q;  2MMP A;  3OA6 A;  1VUB A;  4HT8 A;  5GAN 5;  2DL3 A;  1WJQ A;  4F7U A;  1EX4 A;  3HRS A;  5A0L A;  5LJ5 f;  1V1C A;  2EQK A;  4C0D C;  2FL7 A;  2KR3 A;  1TXQ A;  4HA8 A;  3I56 Q;  3QDR B;  2X4J A;  2HZY A;  3QQ7 A;  2EGE A;  1YJW A;  2QAS A;  1M1K C;  1IRX A;  4IUT A;  1RL2 A;  2E70 A;  5FRN A;  3NTK A;  4AFQ C;  3CCQ Q;  3CC7 A;  1D3B A;  2CGH A;  4LD6 A;  3QYH B;  1BBZ A;  2DFU A;  3DLM A;  5IHK A;  5CIU A;  5J26 A;  1GRI A;  1Q7Y U;  3CXC A;  2MAM A;  4J83 A;  2RH2 A;  1UB4 A;  4PKC C;  2L2P A;  4N0A A;  1VQL A;  4HVW A;  1Q82 R;  4BAC A;  1FXX A;  3QO3 A;  3MEU A;  1MHN A;  3ER0 A;  2L3S A;  3M56 A;  5GAN 8;  2KYB A;  2OX7 A;  4C8Q D;  2RHX A;  5DM7 R;  2CS7 A;  2CP3 A;  2DTO A;  3EG2 A;  4ZN1 A;  1JXO A;  4NS5 A;  3N5B B;  4J5Y A;  1VQP Q;  4EDU A;  3JCM P;  1NM7 A;  3GNF B;  3H6Z A;  1D09 B;  3M9Q A;  5GAN 3;  3OYL A;  1X43 A;  3G71 Q;  5GAN e;  3QBY A;  3FIF A;  1ZHI A;  4KBM B;  2QDY B;  5LJ5 d;  2GBQ A;  3KBG A;  5FTL A;  2ROL A;  4P5N A;  2YWW A;  1MND A;  4KUD K;  1GXI E;  1X27 A;  2BUD A;  3CBP A;  1TTH B;  3S3M A;  4IUQ A;  1ZC1 A;  2XG8 D;  4WTO B;  2KK4 A;  4RTZ A;  3M0T A;  3QHS A;  1NYG A;  4E7I A;  2E3I A;  1IGQ A;  4M75 F;  1NJI R;  1CKB A;  2HL3 A;  1K76 A;  4M78 G;  2RPN A;  1JJ2 P;  1KQS S;  2DX1 A;  4DEX A;  4Z8A A;  1K4U S;  2QI2 A;  4N0A C;  3RKW A;  2I2L A;  5FU6 C;  3G6E A;  1H92 A;  4OB2 B;  2JV2 A;  5GAO q;  3A8M B;  1KC8 R;  2LC4 A;  1Q86 R;  1RI9 A;  5GMK m;  3GOX A;  3L2V A;  2EQJ A;  3MCA B;  4OF1 A;  3TVT A;  3VUB A;  2LNH B;  1WHM A;  2M1H A;  1YJ9 Q;  1AWJ A;  4QQ6 A;  1YWP A;  2EGC A;  4RTV A;  3CMA T;  3LWH A;  5B6C A;  3OW2 P;  2J6F A;  2CP5 A;  4AFZ C;  3C94 A;  1MMD A;  5DY9 A;  4M7A G;  3M0Q A;  2HKQ B;  3OS1 A;  4QKU A;  1A0N B;  3AHU A;  4J9C A;  1ZUU A;  1OI1 A;  3CPF A;  5C18 A;  1VQN T;  1Q81 U;  5J39 A;  2XDP A;  2X3X D;  1VQO T;  3OYC A;  2PU9 B;  5ERG B;  2DER A;  5GAN j;  4ZGJ B;  2VXE A;  1O54 A;  4M77 B;  1NE8 A;  3M5A A;  4D8D A;  4J7F A;  2NUZ A;  1YHQ T;  1ZSG A;  4OB1 B;  4VUB A;  3JB9 D;  1ZSZ A;  1QVG P;  1VQK Q;  1UJY A;  5FRO A;  1M1K U;  5CAI A;  4YTL A;  3MEA A;  4PFZ A;  4JS5 A;  3UPU A;  4LDX A;  1IO6 A;  3KFV A;  4RG8 A;  3SD4 A;  3CPW A;  4KDI A;  1OPL A;  3H8Z A;  3V8J A;  4JJN K;  4L5G A;  2X51 A;  3HPW A;  1U1S A;  3ZJU A;  1VQ7 T;  1U3O A;  4J8O A;  2I0N A;  3DLL A;  3OYH A;  4RTW A;  3V7S A;  1YCY A;  1KIK A;  3ZEH A;  4EMG A;  3BY7 A;  3FLG A;  4MZP A;  2CZ7 B;  4FL6 A;  3JB9 H;  4M78 F;  2Y4Y A;  1PNJ A;  1NBE B;  4A63 B;  1YIJ T;  1TUD A;  2JT4 A;  1JJ2 S;  2X4X A;  1PKT A;  2C0I A;  3DB3 A;  3ZL7 C;  4JRP A;  1VA7 A;  1SKU B;  2IVW A;  4QVC A;  1KQS A;  2EQM A;  1K0S A;  1SPK A;  4HT9 A;  1BCM A;  1QLY A;  1I0C A;  4ZNX A;  5IH2 A;  5IT9 E;  2RQV A;  1UTI A;  2MIO A;  2FZG B;  4AS1 A;  2BZ8 A;  3M0U A;  2XDD A;  4FYX B;  5DYI A;  1I1J A;  1YI2 A;  2SRC A;  4MDW A;  1RI0 A;  2V8I A;  5GMK j;  4FT2 A;  1D0Z A;  1RAC B;  2DL5 A;  4M77 F;  1U8R A;  2DL4 A;  2FYK A;  3OYE A;  4ZTF A;  2R58 A;  4II1 A;  4M7A F;  5L23 A;  2HKN A;  3OQ5 A;  1X6O A;  1SRL A;  4M7D D;  4GY5 A;  3S3O A;  2RQR A;  1RLQ C;  3QJ6 A;  3SWN B;  5GMK h;  5GAN 7;  1CKA A;  2DJQ A;  2PNI A;  1PG5 B;  1SRM A;  2KRS A;  2K7A A;  3R6N A;  3M0S A;  4F7U G;  4XU1 A;  1TWB A;  4XTZ A;  1KSW A;  2LTO A;  1LPL A;  2EVR A;  2K5L A;  3CC2 Q;  4DBR A;  4B9X A;  4BI3 A;  1M8V A;  3OYY A;  1KJW A;  3MJX A;  4J7I A;  2RHU A;  1VQ6 T;  5A0G A;  5LL6 S;  2P4T A;  3EAE A;  3M59 A;  1MMA A;  2QEX A;  1TH7 A;  5HY6 A;  3ZBD A;  3JCM h;  1M27 C;  5FTK A;  4L6V 5;  1K8A C;  3QYG B;  1W70 A;  2ZPG B;  1WZO A;  3CMA Q;  2EJF A;  3CCU T;  2V1R A;  2DRK A;  3QWX X;  2CP7 A;  1AWX A;  1ZUY A;  2KY9 A;  1IGU A;  2M02 A;  3CCV Q;  1LCK A;  4XTV A;  5FU7 B;  4J6W A;  4ELY C;  4C8Q B;  2DXC A;  2IIM A;  3UDC A;  4QT7 A;  1Y7X A;  4KRT A;  2M0Y A;  4EIK A;  2HL5 C;  1Y57 A;  4N4H A;  5J3B A;  4RV0 A;  3OMG A;  2HQH A;  2MOX A;  3M54 A;  1KG1 A;  1YHQ Q;  2ZPB B;  5LJ3 f;  1G3Y A;  2LQN A;  5CKD A;  4FU6 A;  3PT9 A;  2M16 A;  5LJ5 e;  2QQR A;  2MM0 A;  1VQ8 A;  2VV5 A;  4E47 A;  5GJW B;  2HDA A;  5KYW B;  3CCR Q;  1JJ2 A;  2PWY A;  1MMG A;  3CCS A;  3I56 T;  4JJC A;  4ELZ C;  1PSF A;  1FMW A;  2HSE B;  4NL3 A;  1MUZ A;  2SEM A;  4M4Z A;  2KMT A;  3FRN A;  1AT1 B;  2OTJ A;  4LD9 K;  2VGM A;  2YXY A;  3CCQ T;  3A8H B;  8ATC B;  3ZGZ A;  1YCS B;  2OAU A;  2K3B A;  4M77 A;  5GAO l;  3RES A;  3JCM g;  2EKO A;  2D6F A;  1VQ5 T;  4BI8 B;  3MPU B;  1GCQ A;  4E7J A;  2AT1 B;  1NZ9 A;  3OW2 A;  4GBQ A;  2YUJ A;  1AZE A;  3VV0 A;  4F7U F;  2F2V A;  4RKU E;  1YP5 A;  5IXF A;  3O5Z A;  3CCJ A;  4E7Z A;  1YJN A;  3A8L B;  3RBB B;  5GAM e;  5LJ3 d;  4IUU A;  3FB9 A;  2O88 A;  2V8J A;  2DXB A;  3X25 B;  3G71 T;  1R7R A;  4F16 A;  1ZLM A;  3UAT A;  1WXT A;  4UC4 A;  2K79 A;  1JRI A;  5IXB A;  2KQW A;  2XU8 A;  4JLG A;  3D7S B;  1ABO A;  4JRI A;  4E7S A;  1QW1 A;  3CCL T;  1OEB A;  3O8V A;  1Q82 C;  2EFI A;  4E6R A;  3JSC A;  1RAF B;  3THK A;  2A37 A;  3PNW C;  3MB5 A;  1EZZ B;  2D0Q B;  2CUD A;  2HQE A;  4X9C A;  2EBP A;  4RCC A;  1UHF A;  5LJ5 j;  2B86 A;  1X01 A;  1I5O B;  3PE0 A;  1I9G A;  2YRC A;  5KYX B;  2P4R A;  1GCQ C;  3H0F A;  1K73 R;  1XQH A;  3LGA A;  3VS5 A;  2ECZ A;  3H0I A;  2LMJ A;  1K8A U;  3UA6 A;  6AT1 B;  4ZGD B;  3RER A;  4BB7 A;  5I21 A;  4PL6 A;  4A4G A;  2LT4 A;  3EFS A;  2KT1 A;  4J9D A;  5C6S A;  2E4H A;  5KE2 A;  1WHH A;  3PVL A;  4R0K A;  5EG2 A;  4CC7 A;  3JAM E;  1VOM A;  1H3Z A;  1QCF A;  1R77 A;  4HKE A;  3LGL A;  3FPT A;  4Q5W A;  3KXT A;  5HK0 A;  1NJI C;  1P92 A;  2RJD A;  1DJ7 B;  5KYY B;  2ZPF B;  2FPF A;  4RMO A;  2RK2 A;  2JTE A;  3L2Z A;  3QII A;  2BZX A;  4KGZ B;  3DB4 A;  2MM2 A;  5CQY A;  2D1X A;  1D1B A;  4C5E A;  3JCM J;  4JJD A;  1KC8 C;  1Y71 A;  2CDT A;  1Q86 C;  1VQM Q;  2RM4 A;  4J9G A;  2EYZ A;  1I81 A;  1MMN A;  2K57 A;  4NOY A;  2HD0 A;  3RIR A;  1Y07 A;  1WYX A;  3GF5 A;  3MP8 A;  2F69 A;  2O4X B;  1I4K 1;  2ZPH B;  3I55 Q;  1WHK A;  3E9G A;  2DIL A;  5CKE A;  3OY9 A;  1FX7 A;  5GAN 4;  1VQN A;  1HSQ A;  2ED1 A;  2JTM A;  5I2M A;  1VQK T;  2Y4X A;  2LDM A;  4FSX A;  3ZFJ A;  2MCN A;  3SHW A;  2HSP A;  3E1S A;  3VS6 A;  4M7D B;  4RG2 A;  4IKF A;  4C8Q A;  2VUB A;  4E7H A;  3JB9 F;  2DTH A;  1M1G A;  4XK8 E;  4RCB A;  3SWN C;  1T3S A;  5GAO p;  4HCZ A;  4MMK A;  4FYY B;  3A8O B;  1VQ5 Q;  3OYK A;  1G5V A;  2FHD A;  2GGR A;  1BIB A;  2XK0 A;  4PJO D;  4KUI A;  3OBY A;  3GBQ A;  2LQK A;  4C92 D;  2RNA A;  5KYW A;  2LCL A;  3ZJV A;  2VVK A;  2DJZ A;  2VYT A;  2RK1 A;  2JMA A;  2CKK A;  1PM3 A;  4J9B A;  4AT1 B;  2J05 A;  3H0H A;  4EMK B;  2RHZ A;  5D6Y A;  3CD6 Q;  3P8B B;  1Y96 B;  3TSW A;  3CPW S;  5GAM f;  5CK9 A;  1KD1 R;  3FC3 A;  3EGU A;  3CBM A;  4OGE A;  1X2K A;  1QP3 A;  2L3Q A;  5KYN A;  1BCO A;  2PTK A;  1SG5 A;  3CCL Q;  1Q82 U;  2L3R A;  3WVE B;  3ZJT A;  4RTU A;  5FU7 C;  1LJO A;  3CC4 Q;  2OTL A;  1PWT A;  3VJP A;  2HNI A;  3HU1 A;  2VKN A;  1OU9 A;  4C8Q C;  1ZBJ A;  3MHX A;  4PJO E;  4MZT A;  3HKS A;  1VQ9 A;  1Q95 G;  4C92 E;  4C8Q E;  4R56 A;  1N6A A;  3FJ5 A;  5IHN A;  2VXF A;  4RTT A;  2D9T A;  1IXD A;  4E7L A;  3HP9 A;  5CKF A;  3A8G B;  4D6W A;  2G6F X;  2K9G A;  3PVQ A;  7AT1 B;  1EFN A;  4X9D A;  3HSB A;  1R8O B;  3X28 B;  4AFS C;  2CP2 A;  3CC2 T;  1SHF A;  2JVV A;  4OML A;  5A2Q E;  4J9E A;  3UWN A;  1WX6 A;  2FRY A;  1QQJ A;  4ESR A;  4AG1 C;  2NUP B;  2DA9 A;  1M4Z A;  1HYO A;  5GAM d;  1HD3 A;  1YIT T;  1GL5 A;  1WHL A;  2DVE A;  4J9I A;  4A54 A;  2JUF A;  1VIF A;  1V76 A;  4M77 G;  2QA4 A;  5I22 A;  3QUI A;  5CKB A;  1NJI U;  1UGS B;  3EG3 A;  1MV0 B;  3QKJ A;  4KGV B;  3TIW A;  2FRW A;  1AEY A;  2DE0 X;  3OYJ A;  2RD1 A;  2HQX A;  4BDY A;  1WQW A;  1N9R A;  3OYM A;  1CR5 A;  4KOD A;  5KYX A;  3CCV T;  2A08 A;  1KC8 U;  2BIV A;  1Q86 U;  5KYU B;  2M51 A;  2YRD A;  2DXU A;  2DD5 A;  2FG0 A;  2GF7 A;  1K9M C;  3G1J A;  3CCU A;  4Y91 A;  3CF2 A;  1VQ8 Q;  4O6J A;  2YLC A;  3EG0 A;  3NFC A;  4JPB W;  3EH2 A;  2QXF A;  1BYM A;  3EGD B;  4Z88 A;  4IUP A;  5LJ3 e;  2OI3 A;  2P0P A;  1UGR B;  2RB6 A;  3CCS Q;  1LVK A;  3TRE A;  1OV3 A;  1T0J A;  4KDL A;  5CCB A;  5GAN h;  2H3J A;  3I5R A;  1YJW T;  1N8R C;  4K11 A;  2EYW A;  2C0T A;  3CCR T;  2YVL A;  4BE2 A;  3PMT A;  3NHN A;  3SEM A;  1BI3 A;  1ZBX A;  2CRE A;  2HBP A;  4C0F A;  3UT1 A;  1U06 A;  1GBQ A;  3CME A;  1ZX6 A;  2PQW A;  3MO8 A;  1VQL T;  1QVP A;  4A4F A;  8AT1 B;  2L89 A;  4LE9 A;  2QAZ A;  4AQ7 A;  2LNV A;  2XI9 A;  1NEB A;  2KSS A;  2O4X A;  2LCS A;  3CEY A;  2G3R A;  3QC8 A;  1S72 A;  3MKD A;  2F5K A;  4GLK A;  5AYF A;  4KLN A;  1UJ0 A;  3NTI A;  3QZ5 B;  2PVD B;  3H41 A;  4F14 A;  2YLB A;  2CH4 W;  4XTW A;  2EKH A;  4A4E A;  2NUT B;  4D8K A;  3NTH A;  2DD4 A;  3PIO A;  1XTD A;  1M8M A;  2COW A;  2DET A;  3A1P A;  3V8L A;  4M7D A;  3LH5 A;  3CCM Q;  2YT6 A;  4LNP A;  2DLP A;  2QYZ A;  1VQ4 A;  1UHC A;  3HRT A;  3OYN A;  2JM9 A;  2RJC A;  1PKS A;  1WXB A;  2PJH B;  2VB6 A;  2KRO A;  5IN1 A;  2JM8 A;  2K4Y A;  4PLL A;  1OQK A;  1FMV A;  3OW2 S;  1OUL A;  1VQP A;  1M1F A;  4FYW B;  3QDF A;  3L42 A;  2DIG A;  4FW2 A;  3G71 A;  2A0F B;  4M75 D;  5FW9 A;  4EMK A;  5GAN g;  2V26 A;  2EWN A;  4XU0 A;  1D1C A;  1Y96 A;  2XID A;  1OYX A;  1UDL A;  2VAS A;  1F1B B;  5GMK i;  3BDL A;  1IRE B;  2COY A;  4OB0 B; 
#chains in the Genus database with same CATH homology
 3P8H A;  4HA8 A;  2ZPI B;  1KHC A;  3QDR B;  2X4J A;  3A8L B;  3LLR A;  1SSF A;  2E65 A;  2RJF A;  5LJ3 d;  5GAM e;  3QQ7 A;  1YJW A;  2MF2 A;  3FB9 A;  4IUU A;  1M1K C;  4IUT A;  2V8J A;  2DXB A;  3X25 B;  3G71 T;  1VQ4 A;  1RL2 A;  1R7R A;  2E70 A;  1V29 B;  3NTK A;  3PGG A;  4Y28 E;  5FRN A;  4OB3 B;  5CQX A;  2X4W A;  3CC7 A;  3OBW A;  1EIF A;  3HL8 A;  5KCO A;  2K5F A;  3FPR A;  4ZGE B;  1D3B A;  2CGH A;  5GMK e;  4UC4 A;  4LD6 A;  3QYH B;  4C0G A;  2E64 A;  3DLM A;  5GAO r;  5CIU A;  1WLF A;  5J26 A;  1JRI A;  4M7D C;  3V7C A;  1Q7Y U;  2KQW A;  2XU8 A;  4LDY A;  4JLG A;  3CXC A;  2E6Z A;  2MAM A;  4JRI A;  5IAY A;  1QW1 A;  4M7D E;  3CCL T;  4J83 A;  2RH2 A;  1UB4 A;  3EFR A;  3J80 E;  1QVG S;  5L8R E;  4PKC C;  3O8V A;  3VYG A;  5M9O A;  1Q82 C;  2EFI A;  2L5Q A;  4V2S A;  4OGC A;  3C12 A;  4N0A A;  2LVM A;  1VQL A;  3JSC A;  4M75 E;  4BAC A;  1FXX A;  2LRQ A;  2NLU A;  3CC7 T;  5KCH A;  3QO3 A;  2CYZ B;  3MEU A;  1MHN A;  3OYF A;  3PNW C;  3ER0 A;  4M7A B;  4DA4 A;  4BE1 A;  3MB5 A;  2D0Q B;  5FTJ A;  2HQE A;  4X9C A;  1VQM A;  4EPC A;  3M56 A;  3X20 B;  5GAN 8;  3GPL A;  4CQN A;  2QQA A;  2RHX A;  2XIC A;  4RCC A;  4C8Q D;  3JCM e;  5DM7 R;  2CS7 A;  2DTO A;  4ZN1 A;  2WSC E;  4NS5 A;  3N5B B;  5LJ5 j;  1O9S A;  3LX7 A;  1X01 A;  4J5Y A;  4EDU A;  4PJO B;  1BI0 A;  3BFM A;  3HU2 A;  4C92 B;  2RA2 A;  3JCM P;  1K73 C;  3GNF B;  1YJ9 A;  3H6Z A;  3M9Q A;  1K9M U;  1I9G A;  1WQ7 A;  5GAN 3;  3OYL A;  2LT1 A;  1XQH A;  3C4S A;  2CZ0 B;  3I55 A;  3LGA A;  1JB0 E;  5GAN e;  3GP8 A;  3QBY A;  1K8A U;  2QQ9 A;  2IG0 A;  4EMK C;  2DEQ A;  1B34 B;  2E6N A;  2MWP A;  1ZHI A;  3FIF A;  4ZGD B;  4Z02 A;  3JCM c;  4KBM B;  2QDY B;  5LJ5 d;  1VQM T;  3RER A;  2PUK B;  2XHC A;  3JB9 J;  4BB7 A;  3KBG A;  5I21 A;  3ASK A;  5FTL A;  3I56 A;  4PL6 A;  4A4G A;  2LT4 A;  4P5N A;  3EFS A;  5C0M A;  5CCA A;  1N9S A;  5C6S A;  1PSE A;  4C5I A;  5KE2 A;  4BD3 A;  4KUD K;  1N8R U;  1GXI E;  1BIA A;  2BUD A;  5EG2 A;  3CBP A;  5KH6 A;  3G4S A;  3S3M A;  3JRZ A;  3JAM E;  3BW1 A;  4BI4 A;  3I55 T;  3CCQ A;  2RI2 A;  4IUQ A;  1H3Z A;  2XG8 D;  1ZC1 A;  4HKE A;  1UGP B;  3OS0 A;  3LGL A;  1O75 A;  4C5H A;  1AHJ B;  2KK4 A;  3FPT A;  4ARC A;  1G3T A;  4Q5W A;  3X26 B;  3KXT A;  4KO8 A;  2X4Y A;  2DTI A;  3MP6 A;  3QHS A;  4MML A;  5HK0 A;  1P92 A;  3OYD A;  4E7I A;  2RJD A;  2EAY A;  1NJI C;  4ZN3 A;  1DJ7 B;  3JCM W;  4M75 F;  3HFO A;  5HK3 A;  2ZPF B;  4WF2 A;  4M75 A;  2Q1C X;  4RMO A;  4M78 G;  1VQ5 A;  2RK2 A;  2F5T X;  4QVZ A;  3L2Z A;  1KQS S;  3QII A;  4BY6 C;  1QCS A;  3URG A;  3L2W A;  3DB4 A;  2MM2 A;  2QI2 A;  1E32 A;  2B8A A;  5CQY A;  4N4G A;  4N0A C;  3RKW A;  3RUX A;  2OTL T;  1M9S A;  2I2L A;  5FU6 C;  3G6E A;  4FIB A;  3M55 A;  2LQ8 A;  3GLX A;  4C5E A;  4OB2 B;  2JV2 A;  3JCM J;  1LNX A;  1VQ9 T;  1KC8 C;  4HCB A;  1Y71 A;  5GAO q;  1Q86 C;  2JOY A;  2RM4 A;  5GAN f;  3A8M B;  3P8D A;  2LC4 A;  4JS4 A;  1I81 A;  1BI1 A;  2K57 A;  3VYH B;  4NOY A;  5GMK m;  2HD0 A;  3GOX A;  3RIR A;  5CCX A;  3L2V A;  2ZZD A;  1Y07 A;  5I2S A;  2EQJ A;  3MCA B;  1QDN A;  2RHI A;  4OF1 A;  3CD6 A;  3LHD A;  5EQJ B;  2M0O A;  3VUB A;  5CVI A;  3S3N A;  2M1H A;  3GF5 A;  2RI3 A;  3MP8 A;  4QQ6 A;  2KDS A;  4M78 D;  2F69 A;  4C0D B;  3L2U A;  2O4X B;  2K2V A;  5LJ3 j;  1I4K 1;  4BE0 A;  2ZPH B;  2K3Y A;  3G6E T;  5HKC A;  3E9G A;  4J6Y A;  5FLX E;  1CZ5 A;  2MI6 A;  2R57 A;  1MGQ A;  4X34 A;  4CRI A;  2DXT A;  3CMA T;  2FB7 A;  5CKE A;  3OY9 A;  1FX7 A;  5GAN 4;  3LWH A;  1VQN A;  5B6C A;  4N4I A;  4BUG A;  2GQV A;  3C94 A;  2JTM A;  5I2M A;  5DY9 A;  4QQD A;  4M7A G;  2E5Q A;  1VQK T;  3QQ8 A;  3QZ9 B;  2Y4X A;  2LDM A;  4FSX A;  3ZFJ A;  3OS1 A;  2AHJ B;  3CCL A;  3CD6 T;  5LJ3 h;  3VUZ A;  3E1S A;  3AHU A;  4C8Q F;  3JB9 I;  3CC4 A;  4RG2 A;  4PJO G;  3PMI A;  5D6W A;  1WGS A;  4IKF A;  4M7D B;  2MWO A;  4C8Q A;  2VUB A;  4C92 G;  4E7H A;  3JB9 F;  1OI1 A;  1YBY A;  2DTH A;  1M1G A;  3CPF A;  4C8Q G;  1S3S A;  2Q1D X;  5C18 A;  1VQN T;  4XK8 E;  2RI5 A;  3BDU A;  2ZCF B;  4RCB A;  3SWN C;  2XDP A;  1G3S A;  4JUV A;  5J39 A;  2QA4 T;  3JB9 G;  3OB9 A;  5GAO p;  3QG1 A;  1N27 A;  3SDZ A;  3C95 A;  4HCZ A;  3PTA A;  3OYC A;  1VQO T;  3OSS C;  2P0K A;  2PU9 B;  4JLI A;  4MMK A;  1NPP A;  3A8O B;  4QVD A;  2Q19 X;  5ERG B;  2DZ9 A;  2P0Q A;  3OYK A;  1W4S A;  2YHT A;  4M75 C;  1KHI A;  3FEO A;  4ZGJ B;  5GAN j;  2VXE A;  4M7A D;  1G5V A;  4ATO A;  3CC4 T;  1O54 A;  4M77 B;  2FHD A;  3R6O A;  2LCC A;  1QVG A;  1BIB A;  1NE8 A;  2XK0 A;  3M5A A;  2DZC A;  1WPY A;  4PJO D;  1WNL A;  4J7F A;  4KUI A;  2GCX A;  2R5A A;  3OBY A;  3RKX A;  2LQK A;  4C92 D;  2LCL A;  1YHQ T;  3ZJV A;  5GAN 2;  2DJZ A;  4OB1 B;  5GAN d;  2XDB A;  2VYT A;  2RK1 A;  3OMC A;  3OS2 A;  4VUB A;  3JB9 D;  2CKK A;  4ZTJ A;  4EMK B;  4DQ2 A;  2RHZ A;  5D6Y A;  4F7U B;  3LWI A;  5FRO A;  4MDX A;  3P8B B;  1M1K U;  1Y96 B;  5CAI A;  2RHY A;  3HU3 A;  3CPW S;  4YTL A;  3MEA A;  2EIF A;  1KD1 C;  2ZPE B;  3MP1 A;  3OYI A;  5GAM f;  4JS5 A;  3UPU A;  5CK9 A;  1FWZ A;  4LDX A;  3BQB A;  4LDW A;  4RG8 A;  3SD4 A;  3FC3 A;  3CPW A;  3V8J A;  3H8Z A;  1HXD A;  3CBM A;  3HHT B;  3M57 A;  4JJN K;  4L5G A;  4PLI A;  4OGE A;  3QSU A;  5LJ5 h;  3T9N A;  1QP3 A;  1U1S A;  3HPW A;  5FTM A;  3ZJU A;  1Q81 U;  5CR2 A;  1VQ7 T;  4J8O A;  4FM4 B;  3DLL A;  2RO0 A;  3OSV A;  4A4K A;  2B25 A;  3X24 B;  2DO3 A;  2E10 A;  3OYH A;  3V7S A;  1YCY A;  4M7A E;  1Q82 U;  2L3R A;  3WVE B;  1D3B B;  4OVA A;  3ZJT A;  5FU7 C;  1LJO A;  3ZEH A;  1M90 C;  3GNG A;  2QTX A;  2WSE E;  2OTL A;  3VJP A;  3SWN A;  2HNI A;  4EMG A;  4JRQ A;  2ZGW A;  2KVQ G;  1W2B S;  3HU1 A;  4C8Q C;  3MHX A;  4KDI A;  3BY7 A;  3L2Q A;  4PJO E;  3FLG A;  4MZT A;  3HKS A;  2DAQ A;  4MZP A;  1VQ9 A;  4C92 E;  5GLF A;  2CZ7 B;  4FL6 A;  4C8Q E;  3JB9 H;  4NL2 A;  4M78 F;  3E9F A;  4XQ3 A;  2Y4Y A;  4R56 A;  1N6A A;  1X75 C;  2CZ1 B;  4M78 A;  2Q1A X;  1YIJ T;  2VXF A;  5FU6 B;  3CME T;  2D9T A;  4ME7 A;  4E7L A;  3HP9 A;  5CKF A;  3A8G B;  3JCM f;  3MET A;  4B9W A;  1K73 U;  4D6W A;  2X4X A;  4IUR A;  1JJ2 S;  2EJ9 A;  3DB3 A;  4XTY A;  3A5Z B;  4DOW A;  4JRP A;  2EYQ A;  2IVW A;  4QVC A;  1KQS A;  4X9D A;  3HSB A;  2EQM A;  5LJ3 g;  1R8O B;  1H64 1;  3X28 B;  1I5L A;  2E12 A;  2LW6 A;  2VGN A;  3CMA A;  1S72 T;  3CC2 T;  3KUF A;  4HT9 A;  4M7D G;  2JVV A;  2DPP B;  5GAM j;  4IUV A;  5A2Q E;  1G3W A;  5IT9 E;  4MZM A;  3UWN A;  1XNI A;  4XU2 A;  2K3X A;  2JNG A;  1VQK A;  2R5M A;  3WXM B;  2V8K A;  4AS1 A;  2XDD A;  5GAO m;  4A53 A;  1VQ8 T;  1ZQ1 A;  5DYI A;  1YI2 A;  4MDW A;  2E41 A;  1RI0 A;  2V8I A;  3V7R A;  5GMK j;  2QQB A;  2X35 A;  4FT2 A;  1KQ2 A;  1M4Z A;  2KAF A;  5GAM d;  4M77 F;  4XTX A;  3CCV A;  1YIT T;  2FYK A;  1U8R A;  3OYE A;  2DVE A;  2JZ2 A;  4L59 A;  5GAM h;  4ZTF A;  2R58 A;  4A54 A;  4II1 A;  3CCS T;  2JUF A;  1VIF A;  1WJR A;  3DKM A;  4M77 G;  2QA4 A;  1Q7Y C;  4M7A F;  3QUI A;  5CKB A;  4CI0 C;  1NJI U;  1NPR A;  1UGS B;  2CZ6 B;  3FPU A;  4M7A A;  3G7Z A;  1X6O A;  3OQ5 A;  2K5I A;  1HK9 A;  1VQ4 T;  3QKJ A;  4LDV A;  2DKG A;  4GY5 A;  1VQO A;  3S3O A;  2HAX A;  4M7D D;  3TIW A;  2Y90 A;  3OYJ A;  3Q1J A;  3QJ6 A;  4XAX B;  4PJO F;  5CO7 A;  2RD1 A;  3SWN B;  2HQX A;  2YRV A;  2XKO C;  4QW2 A;  5GMK h;  1YI2 T;  3M4Y A;  4PJO A;  4C92 F;  4BDY A;  1WQW A;  4C92 A;  1N9R A;  3OYM A;  1CR5 A;  4KOD A;  3CCV T;  2PVO B;  1UGQ B;  3QWZ A;  4F7U G;  4XU1 A;  1XOV A;  4XTZ A;  3SB2 A;  4M75 B;  1KC8 U;  2LTO A;  2BIV A;  1Q86 U;  2K5L A;  3HFN A;  4XTU A;  4B9X A;  4BI3 A;  1VQP T;  1YHQ A;  1B34 A;  1M8V A;  3OYY A;  2DXU A;  3M53 A;  4J7I A;  2DD5 A;  2RHU A;  4M77 D;  2GF7 A;  1QVF S;  5A0G A;  1VQ6 T;  2EJG A;  5LL6 S;  2P4T A;  3EAE A;  4M78 C;  3M59 A;  2QEX A;  4DOV A;  1K9M C;  5DYG A;  3CCU A;  5FTN A;  5LJ5 g;  3QJY A;  2O01 E;  1TH7 A;  3MEV A;  3OS5 A;  4XU3 A;  5HY6 A;  4Y91 A;  3ZBD A;  4M78 E;  3JCM d;  3JCM X;  1QVF A;  3CF2 A;  3JCM h;  5FTK A;  4L6V 5;  4O6J A;  2YLC A;  3NFC A;  4C5G A;  3QYG B;  3CCR A;  1K8A C;  2QXF A;  3VU3 C;  4KUL A;  3CXC S;  1BYM A;  2A3L A;  2ZPG B;  4IUP A;  5LJ3 e;  3CCJ T;  3CCM A;  2P0P A;  1UGR B;  2EJF A;  2RB6 A;  1YJN T;  4ARI A;  3HRU A;  4LDU A;  1BI2 A;  3F70 A;  4BDZ A;  2WAC A;  4C0Z A;  3TRE A;  1VQ7 A;  2LX9 A;  2Q18 X;  2DIQ A;  4KDL A;  5CCB A;  1U1T A;  5GAN h;  2H3J A;  4A4H A;  2QEX T;  1YJW T;  1N8R C;  3CCU T;  3J7A F;  3ME9 A;  4OMF B;  3GIB A;  1I8F A;  4JDS A;  3INZ A;  3OYG A;  3CCR T;  3OYA A;  4BE2 A;  2YVL A;  3PMT A;  2KY9 A;  3WVD B;  1BI3 A;  1ZBX A;  2RJE A;  3CCM T;  5FRM A;  1OZ2 A;  4XTV A;  2VC8 A;  3CBO A;  3RMQ A;  3SFM A;  2HBP A;  4M77 C;  2L8D A;  3RKY A;  4C0F A;  3JCM b;  5CKH A;  5FU7 B;  4J6W A;  4M77 E;  5CD1 A;  3UT1 A;  4M7A C;  2DK3 A;  1WJS A;  1YIJ A;  4ELY C;  3CME A;  5D6X A;  4C8Q B;  2PUO B;  1LOJ A;  1M5Q 1;  2DXC A;  1QP2 A;  3LW5 E;  2GFA A;  3PFS A;  1UEB A;  2PQW A;  3MO8 A;  3UDC A;  3FJP A;  1VQL T;  1JBM A;  1QVP A;  2PVG B;  4A4F A;  2XD0 A;  2L89 A;  1OZ3 A;  5GAN 7;  4PJO C;  1Y7X A;  2JN0 A;  1KQ1 A;  4J6X A;  4C92 C;  4AQ7 A;  2LNV A;  2XI9 A;  1CZ4 A;  2EQU A;  2KSS A;  2O4X A;  4N4H A;  3CEY A;  2G3R A;  3QC8 A;  1S72 A;  4BY6 B;  3CC2 A;  5J3B A;  4RV0 A;  3OMG A;  4F7U E;  2FVU A;  3M54 A;  1W2B A;  1KG1 A;  2F5K A;  4KT0 E;  4GLK A;  4EMH A;  2ZPB B;  5AYF A;  5LJ3 f;  4KLN A;  1G3Y A;  5CKD A;  5GAM g;  3NTI A;  1YJ9 T;  5EPP A;  3QZ5 B;  5C1B A;  3M4G A;  2PVD B;  3PT9 A;  2GFU A;  4FU6 A;  2M16 A;  2YLB A;  5LJ5 e;  3CCE A;  2QQR A;  3S6W A;  1VQ8 A;  2MM0 A;  4XTW A;  3VKI A;  5GAN 6;  2VV5 A;  4E47 A;  4A4E A;  3MEW A;  4QQG A;  5DLQ E;  3NTH A;  2DD4 A;  3RMS A;  3PIO A;  1XTD A;  3L2R A;  1KD1 U;  3LH0 A;  1JJ2 A;  2PWY A;  4FT4 A;  4M7D F;  2A7Y A;  3TEE A;  2WSF E;  1YIT A;  3V8K A;  3V8L A;  4M7D A;  3CCS A;  3I56 T;  4OP0 A;  4ELZ C;  5KE3 A;  1PSF A;  2QQS A;  3OYB A;  4NL3 A;  1VIE A;  3HRT A;  1IZ6 A;  3FDR A;  3QPH A;  4M75 G;  3TCJ A;  2KMT A;  2RJC A;  3J81 E;  3OYN A;  3FRN A;  5GAO n;  4TVR A;  3LYI A;  3G4S T;  4E7K A;  3CCE T;  3M58 A;  2VGM A;  4LD9 K;  3CCQ T;  3A8H B;  2OTJ A;  2PJH B;  3TU4 K;  2JTF A;  5GMK l;  3QXE B;  3ZGZ A;  1M90 U;  2OAU A;  5IN1 A;  1BKB A;  2K4Y A;  2E1H A;  3PIP A;  1Q81 C;  3JCM Q;  3E19 A;  4M77 A;  4PLL A;  5GAO l;  2C06 A;  4O5V A;  3RES A;  3JCM g;  2EKO A;  3OW2 S;  2M9U A;  4PNO A;  1VQP A;  5DLO A;  2D6F A;  1VQ5 T;  4HCC A;  4BI8 B;  1VQ6 A;  4JRK A;  4E7J A;  1M1F A;  3LGF A;  2OTJ T;  1NZ9 A;  3L42 A;  4R55 A;  2BKD N;  2DIG A;  3OW2 A;  2MMP A;  3OA6 A;  2YUJ A;  1VUB A;  3G71 A;  4HT8 A;  3VV0 A;  4F7U F;  4M75 D;  5GAN 5;  1WJQ A;  4EMK A;  5GAN g;  4RKU E;  4F7U A;  2EWN A;  3HRS A;  4XU0 A;  3L1A A;  5A0L A;  1Y96 A;  2XID A;  5LJ5 f;  1OYX A;  3JCM V;  4M78 B;  2EQK A;  5GMK i;  3CCJ A;  3BDL A;  4C0D C;  2FL7 A;  1IRE B;  5A0D A;  1YJN A;  4OB0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...