5D6YA

Crystal structure of double tudor domain of human lysine demethylase kdm4a complexed with histone h3k23me3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
SITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 4A
publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 20
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6yA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6yA02
2M16A 2QQRA 3MO8A 5KE2A 2L3RA 3OY9A 4BD3A 2XK0A 4CRIA 4ZTJA 4PLIA 2RI3A 2R5MA 1WJSA 2B8AA 2R57A 5D6YA 2MWOA 4N4HA 4A4EA 5C0MA 4E7JA 1H3ZA 3DLMA 4IKFA 3CEYA 2YRVA 2RHUA 3PMTA 2GF7A 2LDMA 2DAQA 4C5IA 2JTFA 3ASKA 5J39A 1KHCA 2NLUA 3OYMA 2BIVA 5FROA 3MP1A 3SD4A 4IUPA 3H8ZA 3ME9A 2R5AA 3O8VA 4NS5A 4UC4A 1WJRA 4GY5A 2RJDA 3LH0A 5KCHA 2WACA 5IAYA 5D6XA 3PFSA 1WJQA 3Q1JA 4A4FA 2BKDN 2RHYA 4C5HA 2K3YA 3MEUA 3EAEA 4L59A 5FRMA 5M9OA 3P8DA 2X35A 1MHNA 4C5EA 1OI1A 3OYCA 3LLRA 4B9WA 2LCCA 3H6ZA 2MWPA 5J26A 4E7LA 1OZ3A 2M0OA 3C4SA 3L2QA 3OYAA 3QJ6A 3OYDA 4FU6A 4N4GA 4BACA 3OA6A 3PNWC 3S3OA 2EQMA 2E6NA 3QBYA 3LGLA 2IG0A 3FEOA 2X4XA 3FC3A 2PQWA 4N4IA 2EQUA 3FDRA 4IUTA 4IUVA 5KE3A 3S3MA 2RHXA 1RI0A 2O4XB 4OVAA 4BE0A 2FHDA 2F5KA 3MP8A 3FLGA 2LTOA 2RHZA 4BE1A 3L2WA 4II1A 3OS2A 4QQ6A 2LVMA 5KCOA 4A4GA 3P8HA 2QQSA 3M9QA 2L8DA 3OS1A 4PLLA 4QQGA 2RJEA 5C6SA 5KH6A 1N27A 3OYFA 4E7KA 2G3RA 2XDPA 2JZ2A 3QKJA 4QQDA 3OYLA 4QW2A 3F70A 4BDYA 2EQKA 1SSFA 3OS0A 5IN1A 3OYBA 3UWNA 2EKOA 3DB3A 3KUFA 2HQXA 3OMGA 4IUUA 4HCZA 4IUQA 2RJFA 4ZTFA 3ZEHA 4IURA 2HQEA 3LYIA 3S3NA 3LGFA 3QIIA 4E7IA 4Q5WA 1OYXA 2GFAA 2E5QA 5CIUA 3OYKA 3OYEA 2X4YA 4C5GA 3META 2RHIA 3OYNA 2RI5A 4BDZA 2GFUA 3E9FA 4B9XA 3LX7A 2O4XA 4RG2A 4PL6A 1G5VA 4X34A 2CKKA 5FRNA 1WGSA 2X4WA 3MEAA 3UT1A 2BUDA 4EDUA 3L2RA 4BE2A 2EFIA 3OYJA 3L2UA 2L89A 3PMIA 2D9TA 2DIGA 2RO0A 1OZ2A 1XNIA 3L42A 3NTIA 2LRQA 3BDLA 3NTHA 4QVZA 5D6WA 3DB4A 4A4HA 3OMCA 3OB9A 3GOXA 3OYGA 3MEWA 3OQ5A 3OYIA 2RI2A 4FL6A 3L2VA 3OYHA 4Z02A 2P0KA 2EQJA 2RJCA 2R58A 3MEVA 2VYTA 3MP6A 4E7HA 3S6WA 3NTKA 3E9GA 2DIQA 2M1HA 2K3XA 4LD6A
chains in the Genus database with same CATH superfamily
1MMAA 2JN0A 3FJ5A 3OY9A 3V7CA 3X28B 4CRIA 3THKA 1K9MC 1YJNA 3JCMQ 1SG5A 3PMTA 1ZA2B 1YHQA 3BFMA 2L3SA 4RV0A 3CMEA 2FEIA 3CCSQ 4IUPA 3VS3A 2F2WA 5GMKl 3HHTB 5I2MA 2HNIA 1KG1A 1JEGA 1R0BG 3QHSA 5GAN7 1YWPA 3Q1JA 1ARKA 5A0DA 2K3YA 2PNIA 4J9BA 5M9OA 3P8DA 2X35A 3JCMb 3G71Q 1RI9A 2X51A 4F7UG 5LJ5g 2QI2A 4XAXB 2M0OA 3IQLA 4JRIA 3L2QA 1JU5C 2J7IA 4R56A 2GBQA 2HBWA 2PWYA 3QBYA 1IB8A 1VQMA 1NEBA 2K6DA 2RHXA 2DVJA 2XKOC 4PJJA 3FPUA 5C1BA 4J8OA 4AG2C 4N0AA 2AT1B 2ZAEA 1FMKA 3HRUA 2G3RA 5KYUB 1ZC1A 4C0DC 1RL2A 4D8KA 3OMGA 4DBRA 4M77G 4JZ4A 1ZBJA 1K8AU 2QA4Q 2OTJT 4XK8E 2RMOA 1Q82R 1WA7A 1QW1A 4X9DA 3G6EA 3CBOA 2PVGB 1XOVA 3RERA 1WGSA 2CP3A 3JRZA 3UT1A 2BUDA 1TXQA 3L2UA 1RAAB 4ANJA 1QCNA 4QVCA 2W10A 1U3OA 1PNJA 1B34A 4KGXB 3CPWS 4JS4A 4RCCA 2CP6A 3CCET 1N9RA 3RR6A 1Q81C 3JCMc 1Q86C 4LE9A 4J9FA 3QZ5B 2QEXA 2CREA 1GCQC 2M16A 2MPXC 2QQRA 3MO8A 5FU7C 3TSWA 3JB9I 2XK0A 2F2XA 1M3CA 3EFOA 2LCSA 1VQKQ 1S3SA 1M90U 2ZPEB 1T3LA 2LW6A 2JTFA 5KYXA 2DZCA 1IO6A 4JDSA 3SD4A 1VIEA 3KFVA 3CCUT 2Q1DX 4JJDA 8AT1B 4E7SA 3JB9J 2KT1A 4L59A 2YUQA 2Q19X 2BZ8A 2L2PA 2GCXA 1YITQ 3VS4A 3REAB 4C92E 3H0FA 3VUBA 4FU6A 3V8LA 4C92C 4EMKC 1TU0B 4FT2A 2PUKB 5GAMf 1KD1C 5IXBA 4JJCA 2CDTA 2RQUA 3OS5A 3CD6A 2VC8A 4Y92A 3BW1A 1VQ8T 2HKQB 1UGVA 1MNDA 1OU8A 2J06A 4KODA 2MM2A 2YT6A 4J9CA 4DOVA 1YJNQ 4BDYA 1ZLMA 1YJWT 1BI0A 2AHJB 4C0DB 1H92A 1WXTA 1X01A 4PFOA 3G4SA 4M75E 2RJFA 3CMEQ 1F1BB 2VWFA 1YBYA 3AT1B 3ZL7C 1JXOA 4M75C 2MMPA 1W2BA 2GQIA 1IHVA 3FPTA 4DQ2A 1FMWA 2X4WA 3MEAA 2PVOB 1K1ZA 1OOTA 1YP5A 2SEMA 3OYJA 5CCBA 1WHLA 3KBGA 2KDSA 3CCMT 3BDLA 3C12A 1AZGB 3M59A 2LMJA 2JW4A 2I2LA 1BI1A 2QGGA 3QO3A 5GAOp 2CYZB 1J3TA 1VQMQ 1KC8C 3M54A 1PSEA 2I0NA 4QQ6A 5GAOm 1RAGB 1PRLC 1LVKA 4KO8A 4KT0E 5FU7B 5EQJB 2RPNA 2B8AA 5GANg 1PRMC 3I5RA 3P8BB 4DBHA 4HCBA 1MV0B 1AOJA 2Z0WA 4OMOA 2X4JA 2R5AA 2YUPA 3O8VA 4UC4A 4RCBA 2EJFA 5CAIA 3PE0A 4RTZA 3EHQA 3V8KA 3SWNC 3JCMh 2LX9A 2XIDA 3G6EQ 1Q95G 2MWPA 2D1XA 3RDVA 3QJ6A 1I1JA 3CC2T 3JB9G 3UATA 2DJQA 2D0NA 1NG2A 3OBYA 3M55A 3QXEB 4MDXA 2EBPA 5GAOr 1XJWB 2FZKB 4C92B 4EMKB 5I2SA 3PVLA 2FHDA 3QWXX 1X69A 1PWTA 1M1FA 4ARIA 1JRIA 4RKUE 1OPLA 2VXFA 5CCXA 3HTRA 2QEXQ 4PLLA 1SRLA 1H3HA 2A37A 1N27A 5J3BA 4OMNA 4RG8A 1KQSP 3OS0A 2ED0A 2ENMA 1OEBA 1K73C 1QCFA 3OSSC 1E6HA 2KROA 3ZBDA 4HCZA 2HQEA 1VQLA 1ZA1B 4E7IA 1ZQ1A 4JUVA 4ZNXA 1G3TA 2K9GA 3OYEA 4CC4B 3OYKA 1D3BB 1NPPA 2YLCA 4M75B 5I21A 3CC4A 1M3BA 3N5BB 2JV2A 1VIFA 4RTXA 4X34A 5FRNA 3L2RA 2YUOA 2FVUA 3JV3A 4PJMA 4JJNK 3CCST 3NTIA 1UHCA 2YDLA 4M78A 4A4HA 1VQ6A 4FSXA 3G7ZA 1ACMB 1AWWA 2BE9B 2ZGWA 2VYTA 2VUBA 4XQ3A 4KDLA 3G71T 1TSFA 3CD6Q 5LJ3d 3J81E 1RAHB 1R7RA 3RIRA 2CP0A 4PLIA 2ED1A 5LJ5e 2MWOA 3QYGB 2GNCA 1ZX6A 2PTKA 5IHNA 2E41A 1HJDA 2EPDA 1G8XA 2FZGB 2DL5A 3NGPA 1WHJA 2C0OA 2K2MA 4FW2A 1U1TA 3G4SQ 3ZJUA 4X1VA 2XDBA 1TOVA 3A5ZB 3SWNB 2EKHA 4J9EA 1TG0A 1Q82U 1X75C 5HK0A 1UG1A 2EJGA 2RH2A 2QDLA 3VJPA 2DERA 2KRSA 1FX7A 2DD4A 1TTHB 4F7UE 1AZEA 3VS6A 2E12A 2QA4T 4N4IA 3EGXB 3OW2P 3H0IA 2ROTA 4D8DA 7AT1B 3REBB 4KUIA 4K11A 4PFPA 3SHWA 4KRTA 2LQNA 1VQ9Q 3A1PA 1HK9A 2L8DA 1EIFA 3E2UA 4M7DA 1CSKA 1S72A 2VV5A 3EFRA 4KGZB 1UJ0A 4DA4A 4F16A 4MZMA 3DB3A 3KUFA 1PG5B 3S3NA 4FW1A 4LDUA 2X4YA 2FYKA 1W70A 1Y71A 3META 3H0HA 1PKTA 4M77E 3J7AF 1X6BA 2O4XA 2YXYA 4AFUC 1MV3A 2QAZA 4M77C 4HKEA 2Y90A 1WQ7A 1NLOC 3HFNA 4L5GA 5CKHA 3MEWA 1ZHIA 3OYIA 2CT3A 3L2VA 4NOYA 2EQJA 2E3HA 2EQIA 2GGRA 2V8KA 3JCMf 1YITT 4A63B 2RQRA 3RESA 3CCRT 3PTAA 1VQPA 4FYVB 3LWHA 2VB6A 1KQSS 3VS2A 3L2ZA 3M5AA 2KRNA 4C5IA 1VQ4A 1SEMA 2EJ9A 3UA7A 1UGRB 1WX6A 4PJOF 1D0YA 1VQLQ 2H3JA 2LJ0A 1XQHA 3EG9A 4LNPA 3RMQA 5GLFA 4M4ZA 5ECAA 1TH7A 1YJNT 1GRIA 1YHQT 2KK4A 3C4SA 5FWCA 3CMET 2KSSA 1M3AA 5GANj 1KFZA 5CO7A 4ELYC 1VQ6Q 8ATCB 4ZN3A 2E3IA 2JUFA 4F7UB 4PKCC 4J83A 2LVMA 1BB9A 2JT4A 4RTTA 4ESRA 2FRYA 3OYFA 2KXDA 3UF4A 3QYHB 4OMQA 3URGA 4FIBA 1K8AC 1VQMT 4PJOD 2KNBB 4IUUA 2GFAA 1RUWA 4XTWA 2HMAA 5FTJA 4BY6C 4LDXA 5GAOl 4E2FB 2A08A 2GFUA 4B9XA 4BE2A 5GANh 1VQKA 3A8LB 3PGGA 3VYHB 4M77B 2DYIA 5HK3A 2LRQA 3NTHA 2RK2A 3M0RA 5IHIA 1YCYA 1YI2A 4LD9K 1UGPB 9ATCB 3RMSA 4FCYA 1BIAA 2E65A 4OMFB 2EVRA 1K0XA 3NTKA 1M5Q1 4DOWA 4PK4A 3G6ET 3EGDA 4JS5A 5GJWB 1M90C 3R6OA 2RI3A 1WNLA 1NYGA 1ZSZC 1S72Q 2NUZA 4PFZA 4PJOA 2HKNA 3H8ZA 1LJOA 1M2OA 3QG1A 4IIOA 3A8OB 2XG8D 5IAYA 5GAN8 4BI8B 4HCCA 2QEXT 4J6YA 4C5HA 2DO3A 1D0ZA 3MEUA 3DLLA 1WYXA 2IIMA 4XTVA 5CVIA 2DXTA 2V8JA 1C6VX 2E4HA 3VS7A 1JBMA 3OYAA 2NWMA 3JCMX 3OA6A 1YWOA 4M78G 1QWEA 3PT9A 2RF0A 2ZCFB 1MMGA 3QQ7A 3GNFB 3CCJA 1Y0MA 4LUDA 1QVGA 3FLGA 3CQTA 3L2WA 2LCLA 3JAME 4A53A 3VU3C 2LJ1A 1VQPQ 4J9HA 3AHUA 3VRZA 1EFNA 3I35A 1KJWA 2JMAA 2EW3A 3RKYA 1KK7A 4JPBW 4OMPA 2EGCA 1VQ4Q 5DLOA 2O01E 3CD6T 1ZUKA 4Q5WA 2E5QA 1CZ5A 3EG2A 4RTVA 3QPHA 2RI5A 4BY6B 3UPUA 1QVFA 1E7OA 1ABQA 1C1AA 2EFIA 1WHMA 1YIJA 2HL5C 1X6OA 2DEUA 1GBQA 2V26A 2XMFA 3G4ST 3LWIA 2X9HA 3DKMA 4Z89A 3HRSA 2KT8A 3BDUA 3MKDA 4LDWA 1VQ7A 4GLMA 1W2BP 1E32A 5ERGB 1OU9A 2LNHB 2MI6A 5GAN4 3SFMA 1LOJA 2EYYA 4M7DG 1DJ7B 5B6CA 3DLMA 1ZSZB 1BKBA 3J80E 4XU0A 1U06A 2GQVA 2B25A 3JB9H 3I56A 4N0AC 1Q7YR 4JLIA 3LH0A 1VQ9T 1BYMA 2O2OA 2RHYA 3GIBA 2CP5A 3EH2A 3EGUA 4A4KA 2D6FA 1W1FA 4LN2A 3M0QA 2COZA 2NUTA 2OAUA 3FB9A 2KEAA 4WCIA 2DX1A 4HCKA 2PJHB 4HVVA 4FT4A 2JTMA 2C0IA 3MCAB 1RADB 3G1JA 1BIBA 4ORZA 1YI2Q 3BQBA 1G83A 2AKKA 2QXFA 5DYGA 2LTOA 1QP2A 4QT7A 3P8HA 1I07A 1IZ6A 5GANf 5C6SA 4AG1C 1Z9ZA 3M57A 1IRXA 1ZBXA 5IN1A 2HBPA 1RLQC 2WSFE 1Y57A 2K3BA 4ZTFA 3ZEHA 3A98A 4C8QF 1K9AA 3M56A 2GTJA 1M8MA 1LNXA 1GFDA 1I8FA 2RA2A 1WHHA 4EDUA 5DM7R 3INZA 2L89A 3PMIA 2E10A 2NUPA 2QYZA 5D6WA 1VQLT 1M2VA 3OMCA 2KBTA 4Z02A 3A8HB 1P92A 1XTDA 1SHFA 2K4YA 2ROLA 4DBQA 3CCJQ 3CC7Q 3S6WA 3CC4T 1X2KA 4LD6A 5CKDA 1WPYA 2KGTA 4HVUA 5GMKi 1JXMA 2DA9A 4ZTJA 1WJSA 5KYYA 1FMVA 4KH0B 2RHUA 2RQWA 1JB0E 1VQ6T 3LH5A 2DAQA 1KHCA 2NLUA 3M0PA 2VKNA 2X3XD 4C8QD 2DMOA 2G6FX 1WLPB 1Q82C 3TREA 5CQYA 4FYXB 5D6XA 1AWJA 3PFSA 1H8KA 3FPRA 1VQ9A 4LXCA 5FU6C 1UHFA 3ZGZA 2Y4YA 3CMAA 2V1QA 1TUDA 4OF1A 1OULA 1YIJQ 5IH2A 2ZPIB 2FPDA 3JSCA 4IIMA 1VQ5Q 3CCQA 2DTHA 4JJBA 3TCJA 5A2QE 4HT9A 2Y4XA 4XU2A 2M51A 2DL3A 3MP8A 1FWZA 1AWXA 1VQ7Q 1W2BS 1QCOA 4JRQA 3VYGA 4JRKA 1B34B 1N6AA 1VYUA 2J6FA 1UB4A 3UA6A 1I5LA 2COWA 4QW2A 5FW9A 2HL3A 4F14A 1JJ2A 4O5VA 4PJOG 2DK3A 3GF5A 4QVDA 2YVLA 1O75A 4C8QA 1D1AA 1HXDA 1JQQA 3QIIA 3I56Q 2P0QA 3EFOB 1CKBA 5GMKe 4M7AF 2A36A 5C18A 2EYWA 2K57A 3M4GA 1T3SA 2OJ2A 3HRTA 5HY6A 4AQ7A 5KYXB 1S72T 2CH4A 2DE0X 2ZPBB 3RNJA 1Q86U 1PSFA 3CCVA 2CT4A 3QWZA 2DIGA 2KQWA 1N8RU 3H41A 3NHNA 3T9NA 5LJ5j 1HSQA 3OYHA 2HAXA 4DEXA 4AFZC 5CK9A 4M77F 2QTVA 2YSQA 1UFFA 3GPLA 1V29B 2QQ9A 5KE2A 1NJIR 1CZ4A 1LCKA 2DD5A 4ME7A 1G3WA 5D6YA 1H3ZA 2KRMA 4CC7A 4CC2A 2C0TA 3JCMP 3OYMA 2D8HA 1MNEA 3MP1A 1SF9A 2VASA 1WJRA 4M7AD 2DYBA 5DLQE 4AS1A 1VQPT 2EYXA 3LGAA 3CXCA 2E5KA 5LJ5h 2QGFB 5FU6B 2QTXA 4WTOB 5A0LA 2KYMA 1VQ4T 5FLXE 2NYSA 2E6NA 2DJZA 2FB7A 2X4XA 4M77D 4M78E 1TWBA 2RK1A 1WLFA 2A28A 1Y07A 2LC4A 2KYBA 1QCSA 2PZ1A 2JM9A 1MGQA 4M78C 3M0TA 3QUIA 1RACB 5LJ3e 2E64A 2IPOB 2XDPA 4NL3A 4KULA 3EG0A 3MPUB 2EQKA 1SSFA 3UWNA 4ZGJB 3HSBA 2O9SA 3U23A 4GLKA 1Q7YU 4M7AA 2DXUA 2LJ3A 1AD5A 4XTZA 3V7SA 3OSVA 3E9FA 4FSSA 5DY9A 2J05A 2O9VA 3CMAQ 2RO0A 1NLPC 2L5QA 3HU2A 4XTUA 2F1LA 3OB9A 1AHJB 4E7ZA 3CCQQ 2IVWA 1KIKA 2P0KA 2R58A 2YWWA 5AT1B 5CD1A 2EAYA 3GP8A 2XU8A 1GBRA 3EG1A 2VXEA 1I81A 4OGEA 1VQKT 2HCKA 2QDYB 4E7JA 3SEMA 4N4HA 2XD0A 2DL7A 2BZXA 5GAN2 1B7TA 2GF7A 1YI2T 3ASKA 4M7DE 3TQ7P 3QZ9B 1O54A 1T0JA 3CF2A 2A7YA 4GY5A 1G3SA 4M7DC 2L3PA 4PJNA 4EPCA 3MJXA 5FRMA 2HSPA 1K0SA 4JLGA 4B9WA 2K79A 2V8IA 1WXBA 2P0PA 3I9QA 3HP9A 5D7UA 2YUNA 3CCVQ 3PNWC 2DBMA 2M9UA 2IG0A 2LNVA 3FIFA 1QVPA 2F2VA 3LW5E 1R77A 2W0ZA 4BE0A 1NM7A 2BTTA 2V1RA 3E19A 2MAMA 1CKAA 1R0CB 2KI7A 5EPPA 3WXMB 2COYA 4J5YA 4M78B 2F69A 3QWYA 5I11A 2JZ2A 1K76A 4YTLA 2KR3A 3X24B 1M4ZA 2EGEA 3CCJT 4R0KA 2H3EB 1VQNA 3E1SA 5CIUA 4ATOA 2AZSA 3VS1A 4J7FA 1YN8A 1UE9A 4JZ3A 1QVGP 2CSQA 2DVEA 3OYNA 2FZCB 2DXCA 3H9NA 1OZ2A 3SDZA 1BK2A 2HD0A 4BI4A 3M53A 1M30A 1SHGA 2CP7A 5KYUA 5HCKA 4CC3A 2ABLA 2EIFA 3MB5A 2DM1A 4R55A 3KXTA 1YIJT 4J9GA 2B86A 5LJ5f 1QVFP 1VQ5T 3CEYA 2FPFA 5J39A 4FYYB 2BIVA 1QQJA 4X9CA 2LZ6B 5GAMd 4C8QG 4HA8A 3OW2S 1B3QA 3BE3A 1VQ7T 3D7SB 4ZGEB 2DRKA 5FTKA 2WACA 4M7DB 4KUDK 4J9DA 1U5SA 2OTLQ 2BKDN 1NZ9A 3HKSA 2L3QA 2LQ8A 2K5LA 3A8GB 1TUGB 3ER0A 1VOMA 1TS9A 1ZSGA 4Y28E 4Z88A 4LDVA 1PCXA 1OPKA 2E6ZA 3OYDA 4RMOA 1ZUUA 1N5ZA 3I56T 1RAEB 1N9SA 1NPRA 3I5SA 3FC3A 2PQWA 3M0UA 2FPEA 5GAMe 2O4XB 4TVRA 3QDRB 3CCLA 2OI3A 3VV0A 6AT1B 3HL8A 1OV3A 4II1A 5CKFA 3V8JA 2EGAA 1QLYA 2MM0A 2K2VA 1NJIU 4ARCA 1Q86R 1V76A 4HXJA 2ZZDA 3QKJA 3QDFA 2ZPFB 1N8RR 1VQOA 1Y7XA 2CP2A 1Y96A 2MOXA 2ZPHB 4J9IA 3CC7A 2LT4A 4PJOE 1K4US 4CQNA 4AFQC 2RQVA 1PD0A 4RG2A 4PJOC 4C92F 4MDWA 1BU1A 1I9GA 3NPFA 1FXXA 2CUDA 1YJ9A 3DB4A 3EG9B 4PNOA 2RI2A 4MMKA 2RJCA 1AWOA 3A8MB 3SB2A 1G2BA 5EC7A 2QQAA 4RTWA 1KD1R 2YUJA 5FTLA 2CZ0B 2HSEB 1VYVA 5LJ3g 1OQKA 4ZN1A 2DBKA 3I55A 3CPWA 3TU4K 1VQ5A 4M75F 4LDYA 4NS5A 3TSZA 2CS7A 4DEYA 4M7AG 2DL4A 1VQNQ 1QVGS 1WJQA 1FYNA 4FM4B 4C92D 2M0YA 2DL8A 5HKCA 2LCCA 1KHIA 1B07A 1D1BA 4BACA 4N4GA 3R6NA 2Q1CX 1GCQA 1O9SA 1SPKA 2J6KA 4VUBA 2DFUA 5CCAA 3S3MA 4IUVA 5KE3A 4BUGA 2K5FA 1S1NA 3EFSA 1M8VA 2F5KA 2EYZA 4KLNA 1D09B 4O6JA 1SKUB 2MK5A 3QJYA 2ZPGB 2JVVA 5GAOq 1KC8R 3CMAT 2DTIA 4AFSC 3OS1A 1QVFS 4E7KA 5I22A 1QDNA 1D1CA 4M75D 3CCQT 2MYSA 2PUOB 1PD1A 3EGDB 1UECA 4IURA 1NEGA 1I0CA 2QG9B 4C92A 4EMKA 2FRWA 3EG3A 2E70A 3JCMW 1M1KU 4MZTA 1VUBA 1N8RC 2C06A 4PJOB 1UGSB 1MMNA 1MMDA 4KH1B 3FRNA 1VYTA 1M1GA 1SRMA 1WHGA 5AYFA 2KXCA 1JJ2P 2Q18X 4FL6A 3GLXA 4D6WA 2YHTA 1BBZA 1PKSA 4E7HA 3CPFA 5KYNA 3CCLQ 3E9GA 1RAIB 2M1HA 4JRPA 2QQBA 1ABOA 3CCVT 1Y96B 3QC8A 3CCRQ 1D3BA 4M75A 1KSWA 2LDMA 3EHRA 1K9MU 2JS0A 1VQOQ 3UDCA 2RN8A 5GJVB 2QASA 1K73R 5KCHA 4OGCA 4HVWA 1U8RA 2XDDA 2DRMA 2BZYA 1D0XA 4GBQA 3H6ZA 1OZ3A 2DXBA 2X3WD 1YHQQ 1YJ9Q 4EMGA 4XU3A 3FEOA 3L1AA 2XI9A 1C0MA 4A4GA 2OTJA 1JO8A 2QQSA 4RTYA 3CXCP 3FJPA 3GBQA 2RJEA 4C0FA 5GMKj 5L8RE 1PC0A 2A3LA 3SWNA 2RNAA 1I5OB 2D0QB 2RQTA 1YNZA 2JXBA 1Q7YC 4OMLA 3I55Q 5CQXA 1EX4A 4M78F 1HYOA 3LYIA 3LGFA 3CCEA 4RUGA 3JCMd 5FTNA 2J6OA 2RHIA 1OX9A 2XHCA 1GL5A 3EGXA 4PL6A 1W6XA 2CKKA 2QK0A 4QKUA 1UDLA 2E1HA 3JCMV 4C0ZA 4F7UF 2D8JA 1BCMA 3GOXA 3M4YA 3EH1A 4E47A 2OTLT 4Z8AA 5GAMg 3CCUA 2NUTB 3MP6A 1KQ2A 5GMKh 3LHDA 3JCMe 5IHKA 1WQWA 3PIOA 3VS5A 1RABB 1Q81U 2R5MA 2R57A 1IXDA 1T0HA 4IKFA 4FYWB 5LL6S 4M78D 2O31A 4XU1A 4ZGDB 3M0SA 2HEQA 3V7RA 3ME9A 1AT1B 1HD3A 2RJDA 3ZJVA 4C8QE 1QKWA 3OBWA 2AK5A 2FL7A 3C0CA 2JTEA 2AKLA 4C5EA 2DZ9A 1VQ8A 4C8QC 2CZ6B 2LQWA 1R8OB 3MHXA 5J26A 2L0AA 1MUZA 4M7DF 1QWFA 1TUCA 2VVKA 4XTXA 5LJ3j 2JMCA 1JJ2S 3WVDB 5KYWA 1WFWA 1YJWA 2JNGA 4IUTA 1NBEB 5GMKm 3M58A 3NFCA 2CZ1B 5A0GA 3TEEA 4J7IA 4BE1A 1YCSB 5GAN5 2ATCB 5GAN3 1KD1U 2RM4A 3M9QA 2EWNA 2NUPB 5LJ5d 3VKIA 3PIPA 1M2VB 4OMMA 4PJLA 2GTOA 3VS0A 4J6XA 3OYBA 2EKOA 2A0FB 3CCMA 3ZJTA 1W4SA 4AMCA 1IGUA 2DKGA 2M02A 4MZPA 2ECZA 2HZYA 2KVQG 5KYYB 1H641 3HU1A 3QQ8A 5LJ3h 1G5VA 4M7DD 4F7UA 4V2SA 2YLBA 2VGMA 1XNIA 4QVZA 2WSEE 1WXUA 3CBPA 5CKEA 3ULRB 1VQNT 1ZUYA 3MEVA 3RKXA 3BY7A 2OTLA 4KBMB 2RD1A 3CXCS 1KC8U 2OTJQ 2L3RA 4BD3A 1GXIE 5C0MA 4A4EA 1IGQA 2DEQA 2HDAA 3GNGA 3CC2A 1X6GA 2CUBA 2H8HA 5GAN6 4M77A 1K8AR 2WSCE 1QKXA 1QP3A 3CCEQ 1BI3A 1UTIA 4C92G 2DILA 2CSIA 4M7AE 1OI1A 2LT1A 3OYCA 4C0GA 1KQSA 4E7LA 4C8QB 4E6RA 4M7AC 4Y91A 1OX8A 2LP5A 2SRCA 3S3OA 4AT1B 2O88A 2EQMA 4DBFA 3LGLA 5CKBA 3RUXA 2EQUA 3FDRA 1RI0A 1UJYA 4OVAA 4J6WA 1EZZB 2BE7D 3CCUQ 2RHZA 2FG0A 3ZFJA 3OS2A 1NJIC 1WI7A 1M1KR 4QQGA 5KH6A 4F04B 5FWBA 3WVEB 2MCNA 4M75G 1M90R 1UEBA 3F70A 1A0NB 3CCSA 5IT9E 2PVDB 3X20B 1GFCA 2HQXA 5EG2A 3CCLT 4OP0A 3HFOA 1OYXA 2P4RA 1K73U 2DLPA 4OB3B 2YRDA 1KQ1A 1UGQB 2OAWA 1VA7A 3G71A 4BDZA 1V1CA 5KYWB 2JOYA 1AVZC 1YFNA 3RKWA 3OYYA 1VQ8Q 1RLPC 1VQOT 1IREB 2XICA 2MF2A 3L42A 1QMCA 2KE9A 1SSHA 4B6MA 1K9MR 3OYGA 3CC7T 1WDXA 3JB9F 3CBMA 4OB0B 1YJWQ 3TVTA 2FO0A 2EYQA 2RB6A 4L6V5 1BI2A 1LPLA 4F17A 2MIOA 2LQKA 1NYFA 2K3XA 3CC4Q 5IXFA 2PU9B 3VRYA 1M27C 1YJ9T 1UUEA 1I4K1 2YRVA 4KGVB 2K5IA 3HPWA 5FROA 3VUZA 3OW2A 3CCMQ 1X27A 2QA4A 1CR5A 2DPPB 1PHTA 5CR2A 2JM8A 2HQHA 4A4FA 1X2QA 3EAEA 4OB1B 5GAMj 4CI0C 1MHNA 1M9SA 3LLRA 5GANd 2ESWA 4EIKA 4HT8A 2CZ7B 4RTUA 3I55T 4EMHA 4M7AB 3JB9D 1G3YA 1X43A 1WIEA 2KAFA 4XTYA 1PM3A 2DTOA 4BB7A 3CPWP 1ZSZA 4WF2A 1GCPA 4P5NA 3HU3A 3JCMg 5KCOA 1WHKA 2CGHA 2DETA 3NMZC 3QSUA 5LJ3f 5FTMA 2AIRB 5GANe 2F5TX 4A54A 4QQDA 3OYLA 2P84A 2P4TA 3O5ZA 4MMLA 2K7AA 3PVQA 4IUQA 3C94A 3CC2Q 2Q1AX 5GAMh 1Z9QA 2DF6A 2DNUA 5GAOn 2JJ9A 1RAFB 1NE8A 1BCOA 1M1KC 4C5GA 4NL2A 2CH4W 5L23A 1YITA 1U1SA 3LX7A 2VGNA 4ELZC 4LUEA 4KDIA 2AZVA 3CCRA 1Q81R 2D9TA 2KY9A 3C95A 4OB2B 3RBBB 1E6GA 3X26B 3OQ5A 1AEYA 1IHWA 3TIWA 2KMTA 2OX7A 3JCMJ 2YRCA 3X25B 2LX7A 1WZOA 2DIQA 5DYIA 4BI3A 2JS2A
chains in the Genus database with same CATH topology
3CCRT 3PTAA 2JN0A 2QQ9A 1VQPA 5KE2A 2QQBA 3V7CA 3OY9A 3X28B 3CCVT 1Y96B 4CRIA 1CZ4A 2DD5A 4ME7A 3LWHA 1G3WA 1KQSS 1K9MC 3L2ZA 1D3BA 5D6YA 1H3ZA 3QC8A 1YJNA 4M75A 3M5AA 3JCMQ 3PMTA 4C5IA 2LDMA 1YHQA 3JCMP 3BFMA 4RV0A 3OYMA 3CMEA 1VQ4A 1K9MU 3MP1A 2EJ9A 3UDCA 4IUPA 5GMKl 3HHTB 1WJRA 2HNIA 5I2MA 1KG1A 1UGRB 4PJOF 4M7AD 5KCHA 5DLQE 3QHSA 2H3JA 4OGCA 5GAN7 4AS1A 1XQHA 3Q1JA 1U8RA 3RMQA 5A0DA 1VQPT 2K3YA 3LGAA 2XDDA 3CXCA 5M9OA 3P8DA 2X35A 5GLFA 3JCMb 1TH7A 1YJNT 3H6ZA 4F7UG 5FU6B 5LJ5g 5LJ5h 2QI2A 2QTXA 1YHQT 4XAXB 1OZ3A 2KK4A 2M0OA 3C4SA 4JRIA 3L2QA 5A0LA 4R56A 2DXBA 3CMET 1VQ4T 2KSSA 5FLXE 4EMGA 4XU3A 2E6NA 2DJZA 2FB7A 3FEOA 3L1AA 2X4XA 2XI9A 3QBYA 5GANj 2PWYA 5CO7A 4ELYC 1VQMA 4M77D 2RHXA 2XKOC 4M78E 4ZN3A 2RK1A 1WLFA 1Y07A 2LC4A 4F7UB 2JUFA 1QCSA 3FPUA 4PKCC 4J83A 5C1BA 2LVMA 4A4GA 4J8OA 2OTJA 2QQSA 1MGQA 4M78C 3QUIA 3FJPA 5LJ3e 4N0AA 2E64A 2RJEA 3HRUA 4C0FA 5GMKj 3OYFA 5L8RE 2G3RA 4LD9K 2A3LA 2XDPA 3SWNA 4NL3A 2D0QB 4KULA 1ZC1A 3QYHB 2EQKA 1SSFA 4C0DC 3URGA 1Q7YC 1RL2A 3UWNA 4ZGJB 4FIBA 1K8AC 1VQMT 3HSBA 4PJOD 4GLKA 3OMGA 4IUUA 5CQXA 4M78F 3LYIA 3LGFA 4M77G 3CCEA 1Q7YU 2GFAA 4M7AA 2DXUA 1K8AU 4XTWA 3JCMd 5FTNA 2OTJT 5FTJA 4XTZA 4XK8E 3V7SA 4BY6C 3OSVA 4LDXA 2RHIA 5GAOl 2XHCA 1QW1A 4X9DA 2GFUA 3E9FA 4B9XA 3G6EA 3CBOA 2PVGB 4PL6A 1XOVA 2CKKA 3RERA 1WGSA 3JRZA 3UT1A 5DY9A 2BUDA 5GANh 4BE2A 1VQKA 3L2UA 3A8LB 3PGGA 3VYHB 2E1HA 2RO0A 3JCMV 4M77B 4QVCA 5HK3A 4C0ZA 4F7UF 2LRQA 3NTHA 4JRPA 2RK2A 1B34A 2L5QA 3CPWS 3HU2A 4XTUA 4JS4A 1YCYA 3OB9A 3M4YA 4RCCA 1AHJB 3GOXA 1YI2A 3CCET 1UGPB 4E47A 2OTLT 2IVWA 3RMSA 2P0KA 5GAMg 1BIAA 2R58A 2E65A 3CCUA 1N9RA 4OMFB 3MP6A 1KQ2A 5CD1A 5GMKh 3LHDA 1Q81C 3NTKA 2EAYA 3GP8A 3JCMe 1M5Q1 4BI3A 4DOWA 3JCMc 3G6ET 4JS5A 2XU8A 1WQWA 1Q86C 3PIOA 2VXEA 1I81A 3QZ5B 4OGEA 2QEXA 2M16A 2QQRA 3MO8A 1VQKT 5FU7C 1M90C 3JB9I 1Q81U 2XK0A 2QDYB 3R6OA 2RI3A 2R5MA 1WNLA 2R57A 4E7JA 4N4HA 2XD0A 1S3SA 4IKFA 5LL6S 5GAN2 2ZPEB 2GF7A 4M78D 1YI2T 1M90U 2JTFA 3ASKA 4XU1A 4ZGDB 4M7DE 2LW6A 2DZCA 3QZ9B 4JDSA 4PJOA 3SD4A 1O54A 3V7RA 1VIEA 3H8ZA 3ME9A 3CCUT 2Q1DX 3CF2A 2A7YA 1LJOA 3QG1A 4GY5A 1G3SA 2RJDA 4M7DC 3A8OB 2XG8D 5IAYA 5GAN8 3ZJVA 4BI8B 4HCCA 4C8QE 2QEXT 4J6YA 3JB9J 3OBWA 2DO3A 4C5HA 4EPCA 3MEUA 4L59A 3DLLA 2FL7A 5FRMA 4C5EA 2Q19X 4XTVA 4JLGA 2GCXA 5CVIA 2DZ9A 2V8IA 4B9WA 1VQ8A 4C8QC 2CZ6B 1R8OB 2P0PA 4C92E 3MHXA 2DXTA 2V8JA 5J26A 3HP9A 4M7DF 1JBMA 3VUBA 3OYAA 4FU6A 4XTXA 3V8LA 3PNWC 5LJ3j 3JCMX 3OA6A 4M78G 4C92C 3PT9A 1JJ2S 3WVDB 2M9UA 4EMKC 2IG0A 2ZCFB 2LNVA 4FT2A 2PUKB 1YJWA 3QQ7A 3FIFA 1QVPA 2JNGA 3GNFB 3LW5E 4IUTA 5GAMf 3M58A 5GMKm 3CCJA 1KD1C 3NFCA 2CZ1B 4BE0A 3JB9H 5A0GA 1QVGA 3OS5A 3FLGA 3CD6A 3TEEA 4J7IA 4BE1A 3L2WA 5GAN5 2LCLA 2VC8A 3E19A 5GAN3 2MAMA 3JAME 3BW1A 4A53A 1KD1U 1VQ8T 5EPPA 2RM4A 3WXMB 3M9QA 2EWNA 4J5YA 3VU3C 5LJ5d 4M78B 3VKIA 3PIPA 2F69A 3AHUA 4KODA 2MM2A 2JZ2A 4DOVA 4YTLA 4J6XA 3X24B 1M4ZA 4BDYA 3OYBA 1YJWT 1BI0A 2AHJB 3RKYA 4C0DB 2EKOA 1X01A 3CCMA 3CCJT 3ZJTA 3G4SA 4M75E 2RJFA 1W4SA 5DLOA 1VQNA 2DKGA 2O01E 3CD6T 3E1SA 4Q5WA 1YBYA 2E5QA 1CZ5A 5CIUA 4MZPA 4ATOA 2KVQG 4J7FA 4M75C 2MMPA 1H641 1W2BA 3QPHA 2DVEA 2RI5A 3OYNA 4BY6B 2DXCA 3UPUA 3HU1A 3FPTA 3QQ8A 5LJ3h 1G5VA 4DQ2A 4M7DD 1QVFA 2X4WA 3MEAA 2PVOB 4F7UA 4V2SA 2EFIA 3OYJA 2YLBA 1YIJA 5CCBA 1X6OA 2VGMA 1OZ2A 1XNIA 2KDSA 3KBGA 3CCMT 3BDLA 4QVZA 2WSEE 3C12A 3G4ST 3SDZA 3LWIA 3M59A 2HD0A 3CBPA 3DKMA 5CKEA 1VQNT 4BI4A 2I2LA 3HRSA 3M53A 1BI1A 3QO3A 3BDUA 5GAOp 2CYZB 3MEVA 1KC8C 3RKXA 4LDWA 1VQ7A 3BY7A 2OTLA 4KBMB 3M54A 2RD1A 1PSEA 4QQ6A 5GAOm 3CXCS 1KC8U 2EIFA 1E32A 5ERGB 2MI6A 5GAN4 3MB5A 2L3RA 3SFMA 4R55A 4BD3A 3KXTA 1YIJT 4KO8A 1GXIE 1LOJA 4KT0E 5FU7B 1DJ7B 5LJ5f 4M7DG 5EQJB 2B8AA 5GANg 4AQ7A 5C0MA 4A4EA 5B6CA 2DEQA 1VQ5T 3DLMA 1BKBA 3CEYA 3P8BB 3J80E 4HCBA 5J39A 4XU0A 2BIVA 3GNGA 3CC2A 4X9CA 2GQVA 2B25A 5GAMd 4C8QG 4HA8A 3OW2S 2X4JA 2R5AA 3O8VA 5GAN6 4UC4A 4RCBA 4ZGEB 2EJFA 5CAIA 4N0AC 3I56A 1VQ7T 4M77A 4JLIA 3LH0A 3V8KA 1VQ9T 2WACA 2WSCE 1BYMA 5FTKA 1QP3A 3SWNC 4M7DB 3JCMh 2LX9A 4KUDK 1BI3A 2BKDN 2RHYA 3GIBA 1NZ9A 3HKSA 4C92G 2XIDA 2LQ8A 2K5LA 3A8GB 4A4KA 4M7AE 2D6FA 1OI1A 2LT1A 3OYCA 3ER0A 4C0GA 2OAUA 4Y28E 3FB9A 1KQSA 2MWPA 4E7LA 4C8QB 4LDVA 4M7AC 2E6ZA 4Y91A 3QJ6A 3OYDA 3CC2T 3JB9G 2YVLA 4RMOA 3S3OA 3OBYA 4MDXA 3M55A 3QXEB 2PJHB 4FT4A 2EQMA 3I56T 5GAOr 1N9SA 1NPRA 3LGLA 2JTMA 3FC3A 3MCAB 5CKBA 2PQWA 4C92B 3RUXA 4EMKB 5I2SA 1BIBA 2EQUA 3FDRA 3BQBA 1RI0A 2O4XB 5GAMe 4OVAA 4TVRA 3QDRB 4J6WA 2FHDA 3CCLA 2QXFA 3VV0A 5DYGA 3HL8A 2LTOA 2RHZA 4II1A 1M1FA 5CKFA 3V8JA 3ZFJA 3OS2A 1QP2A 1JRIA 1NJIC 3P8HA 4ARIA 4RKUE 2VXFA 5CCXA 1IZ6A 2MM0A 4PLLA 2K2VA 4QQGA 5GANf 5C6SA 5KH6A 1NJIU 1N27A 3M57A 4ARCA 5J3BA 3WVEB 4RG8A 2ZZDA 3QKJA 4M75G 1ZBXA 1UEBA 3F70A 3OS0A 2ZPFB 5IN1A 2HBPA 1VQOA 3CCSA 5IT9E 2PVDB 1Y7XA 2WSFE 3X20B 3OSSC 1K73C 3ZBDA 2HQXA 1Y96A 4HCZA 5EG2A 4ZTFA 3ZEHA 4OP0A 3CCLT 2HQEA 1VQLA 3HFOA 2ZPHB 4E7IA 3CC7A 1OYXA 1ZQ1A 2LT4A 4JUVA 1K73U 4OB3B 1G3TA 3OYKA 4C8QF 3OYEA 4PJOE 1KQ1A 1UGQB 4CQNA 1D3BB 3M56A 1NPPA 2YLCA 3G71A 4M75B 5I21A 4BDZA 3CC4A 1LNXA 1I8FA 3N5BB 4PJOC 4RG2A 2JV2A 1VIFA 2RA2A 2JOYA 4X34A 3RKWA 5FRNA 4C92F 3L2RA 3OYYA 4MDWA 4EDUA 5DM7R 3INZA 2L89A 3PMIA 1I9GA 2FVUA 1FXXA 4JJNK 1VQOT 3CCST 1IREB 1YJ9A 2XICA 2MF2A 2E10A 3L42A 3NTIA 5D6WA 4M78A 3DB4A 4A4HA 1VQLT 3OMCA 4PNOA 1VQ6A 3OYGA 4FSXA 3CC7T 3G7ZA 3CBMA 3JB9F 2RI2A 4MMKA 4OB0B 4Z02A 2RJCA 3A8MB 2ZGWA 3A8HB 2VYTA 1P92A 1XTDA 2EYQA 2K4YA 2RB6A 2VUBA 4XQ3A 3SB2A 4L6V5 3S6WA 1BI2A 3G71T 3CC4T 2QQAA 5FTLA 2YUJA 5LJ3d 3J81E 2LQKA 2K3XA 4LD6A 2CZ0B 5CKDA 1R7RA 3RIRA 1WPYA 2PU9B 5GMKi 5LJ3g 4ZTJA 4PLIA 4KDLA 1WJSA 1YJ9T 5LJ5e 2MWOA 3QYGB 1I4K1 4ZN1A 2YRVA 2RHUA 1JB0E 2K5IA 1VQ6T 2DAQA 3HPWA 2E41A 1KHCA 2NLUA 3I55A 3CPWA 3TU4K 1VQ5A 5FROA 3VUZA 4M75F 3OW2A 4C8QD 4LDYA 4NS5A 1U1TA 1Q82C 2QA4A 1CR5A 2CS7A 3ZJUA 3TREA 5CQYA 2DPPB 5CR2A 2XDBA 4M7AG 1QVGS 5D6XA 3PFSA 1WJQA 3A5ZB 4A4FA 3FPRA 3SWNB 4FM4B 4C92D 1VQ9A 1Q82U 3EAEA 4OB1B 5GAMj 1X75C 4CI0C 5HK0A 1MHNA 2EJGA 1M9SA 2RH2A 5FU6C 3LLRA 5GANd 5HKCA 2LCCA 2Y4YA 1KHIA 3ZGZA 3CMAA 3VJPA 4OF1A 4HT8A 2CZ7B 3I55T 1FX7A 4M7AB 4EMHA 2DD4A 4N4GA 4BACA 3JB9D 1G3YA 4F7UE 2Q1CX 2ZPIB 3JSCA 2KAFA 4XTYA 1O9SA 2DTOA 2E12A 3CCQA 2DTHA 2QA4T 3TCJA 4VUBA 4BB7A 5CCAA 4N4IA 5A2QE 4IUVA 5KE3A 4BUGA 3S3MA 2K5FA 2Y4XA 4XU2A 3EFSA 4WF2A 4HT9A 1M8VA 2F5KA 4KLNA 4O6JA 4KUIA 3MP8A 3QJYA 1FWZA 4P5NA 3HU3A 3JCMg 2ZPGB 1W2BS 5KCOA 2JVVA 5GAOq 2CGHA 1HK9A 4JRQA 3VYGA 3CMAT 4JRKA 1B34B 2DTIA 5LJ3f 2L8DA 3QSUA 3OS1A 5FTMA 1N6AA 1QVFS 1EIFA 4M7DA 4E7KA 1UB4A 5GANe 1S72A 2F5TX 1I5LA 4A54A 1QDNA 4M75D 4QQDA 3OYLA 4QW2A 2P4TA 2VV5A 3EFRA 3CCQT 4MMLA 1JJ2A 4DA4A 4O5VA 4MZMA 2DK3A 3DB3A 3GF5A 2PUOB 3KUFA 4IUQA 4PJOG 4QVDA 3C94A 1O75A 4C8QA 5GAMh 2Q1AX 4IURA 3S3NA 1HXDA 3QIIA 5GAOn 1NE8A 2P0QA 1M1KC 4LDUA 2X4YA 2FYKA 4C5GA 4NL2A 1Y71A 3META 5GMKe 4M7AF 4C92A 5C18A 2K57A 4M77E 3M4GA 4EMKA 3HRTA 1YITA 5HY6A 3J7AF 1U1SA 3LX7A 2E70A 2O4XA 2VGNA 3JCMW 1M1KU 1S72T 1VUBA 4MZTA 4ELZC 2ZPBB 1N8RC 1UGSB 2C06A 3CCRA 1Q86U 4PJOB 4KDIA 1PSFA 4M77C 2D9TA 3CCVA 3FRNA 2Y90A 4HKEA 3QWZA 2DIGA 2KQWA 1WQ7A 2KY9A 1N8RU 3HFNA 3C95A 4L5GA 4OB2B 1M1GA 5CKHA 3T9NA 3X26B 5LJ5j 5AYFA 3MEWA 1ZHIA 3OQ5A 3OYIA 2Q18X 4FL6A 3L2VA 3OYHA 2HAXA 2KMTA 3GLXA 4D6WA 4NOYA 2EQJA 2YHTA 3JCMJ 3TIWA 3X25B 4E7HA 2V8KA 3CPFA 3JCMf 4M77F 5CK9A 1YITT 3GPLA 3E9GA 2DIQA 5DYIA 2M1HA 3RESA 1V29B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M16 A;  2QQR A;  3MO8 A;  5KE2 A;  2L3R A;  3OY9 A;  4BD3 A;  2XK0 A;  4CRI A;  4ZTJ A;  4PLI A;  2RI3 A;  2R5M A;  1WJS A;  2B8A A;  2R57 A;  5D6Y A;  2MWO A;  4N4H A;  4A4E A;  5C0M A;  4E7J A;  1H3Z A;  3DLM A;  4IKF A;  3CEY A;  2YRV A;  2RHU A;  3PMT A;  2GF7 A;  2LDM A;  2DAQ A;  4C5I A;  2JTF A;  3ASK A;  5J39 A;  1KHC A;  2NLU A;  3OYM A;  2BIV A;  5FRO A;  3MP1 A;  3SD4 A;  4IUP A;  3H8Z A;  3ME9 A;  2R5A A;  3O8V A;  4NS5 A;  4UC4 A;  1WJR A;  4GY5 A;  2RJD A;  3LH0 A;  5KCH A;  2WAC A;  5IAY A;  5D6X A;  3PFS A;  1WJQ A;  3Q1J A;  4A4F A;  2BKD N;  2RHY A;  4C5H A;  2K3Y A;  3MEU A;  3EAE A;  4L59 A;  5FRM A;  5M9O A;  3P8D A;  2X35 A;  1MHN A;  4C5E A;  1OI1 A;  3OYC A;  3LLR A;  4B9W A;  2LCC A;  3H6Z A;  2MWP A;  5J26 A;  4E7L A;  1OZ3 A;  2M0O A;  3C4S A;  3L2Q A;  3OYA A;  3QJ6 A;  3OYD A;  4FU6 A;  4N4G A;  4BAC A;  3OA6 A;  3PNW C;  3S3O A;  2EQM A;  2E6N A;  3QBY A;  3LGL A;  2IG0 A;  3FEO A;  2X4X A;  3FC3 A;  2PQW A;  4N4I A;  2EQU A;  3FDR A;  4IUT A;  4IUV A;  5KE3 A;  3S3M A;  2RHX A;  1RI0 A;  2O4X B;  4OVA A;  4BE0 A;  2FHD A;  2F5K A;  3MP8 A;  3FLG A;  2LTO A;  2RHZ A;  4BE1 A;  3L2W A;  4II1 A;  3OS2 A;  4QQ6 A;  2LVM A;  5KCO A;  4A4G A;  3P8H A;  2QQS A;  3M9Q A;  2L8D A;  3OS1 A;  4PLL A;  4QQG A;  2RJE A;  5C6S A;  5KH6 A;  1N27 A;  3OYF A;  4E7K A;  2G3R A;  2XDP A;  2JZ2 A;  3QKJ A;  4QQD A;  3OYL A;  4QW2 A;  3F70 A;  4BDY A;  2EQK A;  1SSF A;  3OS0 A;  5IN1 A;  3OYB A;  3UWN A;  2EKO A;  3DB3 A;  3KUF A;  2HQX A;  3OMG A;  4IUU A;  4HCZ A;  4IUQ A;  2RJF A;  4ZTF A;  3ZEH A;  4IUR A;  2HQE A;  3LYI A;  3S3N A;  3LGF A;  3QII A;  4E7I A;  4Q5W A;  1OYX A;  2GFA A;  2E5Q A;  5CIU A;  3OYK A;  3OYE A;  2X4Y A;  4C5G A;  3MET A;  2RHI A;  3OYN A;  2RI5 A;  4BDZ A;  2GFU A;  3E9F A;  4B9X A;  3LX7 A;  2O4X A;  4RG2 A;  4PL6 A;  1G5V A;  4X34 A;  2CKK A;  5FRN A;  1WGS A;  2X4W A;  3MEA A;  3UT1 A;  2BUD A;  4EDU A;  3L2R A;  4BE2 A;  2EFI A;  3OYJ A;  3L2U A;  2L89 A;  3PMI A;  2D9T A;  2DIG A;  2RO0 A;  1OZ2 A;  1XNI A;  3L42 A;  3NTI A;  2LRQ A;  3BDL A;  3NTH A;  4QVZ A;  5D6W A;  3DB4 A;  4A4H A;  3OMC A;  3OB9 A;  3GOX A;  3OYG A;  3MEW A;  3OQ5 A;  3OYI A;  2RI2 A;  4FL6 A;  3L2V A;  3OYH A;  4Z02 A;  2P0K A;  2EQJ A;  2RJC A;  2R58 A;  3MEV A;  2VYT A;  3MP6 A;  4E7H A;  3S6W A;  3NTK A;  3E9G A;  2DIQ A;  2M1H A;  2K3X A;  4LD6 A; 
#chains in the Genus database with same CATH topology
 1MMA A;  2JN0 A;  3FJ5 A;  3OY9 A;  3V7C A;  3X28 B;  4CRI A;  3THK A;  1K9M C;  1YJN A;  3JCM Q;  1SG5 A;  3PMT A;  1ZA2 B;  1YHQ A;  3BFM A;  2L3S A;  4RV0 A;  3CME A;  2FEI A;  3CCS Q;  4IUP A;  3VS3 A;  2F2W A;  5GMK l;  3HHT B;  5I2M A;  2HNI A;  1KG1 A;  1JEG A;  1R0B G;  3QHS A;  5GAN 7;  1YWP A;  3Q1J A;  1ARK A;  5A0D A;  2K3Y A;  2PNI A;  4J9B A;  5M9O A;  3P8D A;  2X35 A;  3JCM b;  3G71 Q;  1RI9 A;  2X51 A;  4F7U G;  5LJ5 g;  2QI2 A;  4XAX B;  2M0O A;  3IQL A;  4JRI A;  3L2Q A;  1JU5 C;  2J7I A;  4R56 A;  2GBQ A;  2HBW A;  2PWY A;  3QBY A;  1IB8 A;  1VQM A;  1NEB A;  2K6D A;  2RHX A;  2DVJ A;  2XKO C;  4PJJ A;  3FPU A;  5C1B A;  4J8O A;  4AG2 C;  4N0A A;  2AT1 B;  2ZAE A;  1FMK A;  3HRU A;  2G3R A;  5KYU B;  1ZC1 A;  4C0D C;  1RL2 A;  4D8K A;  3OMG A;  4DBR A;  4M77 G;  4JZ4 A;  1ZBJ A;  1K8A U;  2QA4 Q;  2OTJ T;  4XK8 E;  2RMO A;  1Q82 R;  1WA7 A;  1QW1 A;  4X9D A;  3G6E A;  3CBO A;  2PVG B;  1XOV A;  3RER A;  1WGS A;  2CP3 A;  3JRZ A;  3UT1 A;  2BUD A;  1TXQ A;  3L2U A;  1RAA B;  4ANJ A;  1QCN A;  4QVC A;  2W10 A;  1U3O A;  1PNJ A;  1B34 A;  4KGX B;  3CPW S;  4JS4 A;  4RCC A;  2CP6 A;  3CCE T;  1N9R A;  3RR6 A;  1Q81 C;  3JCM c;  1Q86 C;  4LE9 A;  4J9F A;  3QZ5 B;  2QEX A;  2CRE A;  1GCQ C;  2M16 A;  2MPX C;  2QQR A;  3MO8 A;  5FU7 C;  3TSW A;  3JB9 I;  2XK0 A;  2F2X A;  1M3C A;  3EFO A;  2LCS A;  1VQK Q;  1S3S A;  1M90 U;  2ZPE B;  1T3L A;  2LW6 A;  2JTF A;  5KYX A;  2DZC A;  1IO6 A;  4JDS A;  3SD4 A;  1VIE A;  3KFV A;  3CCU T;  2Q1D X;  4JJD A;  8AT1 B;  4E7S A;  3JB9 J;  2KT1 A;  4L59 A;  2YUQ A;  2Q19 X;  2BZ8 A;  2L2P A;  2GCX A;  1YIT Q;  3VS4 A;  3REA B;  4C92 E;  3H0F A;  3VUB A;  4FU6 A;  3V8L A;  4C92 C;  4EMK C;  1TU0 B;  4FT2 A;  2PUK B;  5GAM f;  1KD1 C;  5IXB A;  4JJC A;  2CDT A;  2RQU A;  3OS5 A;  3CD6 A;  2VC8 A;  4Y92 A;  3BW1 A;  1VQ8 T;  2HKQ B;  1UGV A;  1MND A;  1OU8 A;  2J06 A;  4KOD A;  2MM2 A;  2YT6 A;  4J9C A;  4DOV A;  1YJN Q;  4BDY A;  1ZLM A;  1YJW T;  1BI0 A;  2AHJ B;  4C0D B;  1H92 A;  1WXT A;  1X01 A;  4PFO A;  3G4S A;  4M75 E;  2RJF A;  3CME Q;  1F1B B;  2VWF A;  1YBY A;  3AT1 B;  3ZL7 C;  1JXO A;  4M75 C;  2MMP A;  1W2B A;  2GQI A;  1IHV A;  3FPT A;  4DQ2 A;  1FMW A;  2X4W A;  3MEA A;  2PVO B;  1K1Z A;  1OOT A;  1YP5 A;  2SEM A;  3OYJ A;  5CCB A;  1WHL A;  3KBG A;  2KDS A;  3CCM T;  3BDL A;  3C12 A;  1AZG B;  3M59 A;  2LMJ A;  2JW4 A;  2I2L A;  1BI1 A;  2QGG A;  3QO3 A;  5GAO p;  2CYZ B;  1J3T A;  1VQM Q;  1KC8 C;  3M54 A;  1PSE A;  2I0N A;  4QQ6 A;  5GAO m;  1RAG B;  1PRL C;  1LVK A;  4KO8 A;  4KT0 E;  5FU7 B;  5EQJ B;  2RPN A;  2B8A A;  5GAN g;  1PRM C;  3I5R A;  3P8B B;  4DBH A;  4HCB A;  1MV0 B;  1AOJ A;  2Z0W A;  4OMO A;  2X4J A;  2R5A A;  2YUP A;  3O8V A;  4UC4 A;  4RCB A;  2EJF A;  5CAI A;  3PE0 A;  4RTZ A;  3EHQ A;  3V8K A;  3SWN C;  3JCM h;  2LX9 A;  2XID A;  3G6E Q;  1Q95 G;  2MWP A;  2D1X A;  3RDV A;  3QJ6 A;  1I1J A;  3CC2 T;  3JB9 G;  3UAT A;  2DJQ A;  2D0N A;  1NG2 A;  3OBY A;  3M55 A;  3QXE B;  4MDX A;  2EBP A;  5GAO r;  1XJW B;  2FZK B;  4C92 B;  4EMK B;  5I2S A;  3PVL A;  2FHD A;  3QWX X;  1X69 A;  1PWT A;  1M1F A;  4ARI A;  1JRI A;  4RKU E;  1OPL A;  2VXF A;  5CCX A;  3HTR A;  2QEX Q;  4PLL A;  1SRL A;  1H3H A;  2A37 A;  1N27 A;  5J3B A;  4OMN A;  4RG8 A;  1KQS P;  3OS0 A;  2ED0 A;  2ENM A;  1OEB A;  1K73 C;  1QCF A;  3OSS C;  1E6H A;  2KRO A;  3ZBD A;  4HCZ A;  2HQE A;  1VQL A;  1ZA1 B;  4E7I A;  1ZQ1 A;  4JUV A;  4ZNX A;  1G3T A;  2K9G A;  3OYE A;  4CC4 B;  3OYK A;  1D3B B;  1NPP A;  2YLC A;  4M75 B;  5I21 A;  3CC4 A;  1M3B A;  3N5B B;  2JV2 A;  1VIF A;  4RTX A;  4X34 A;  5FRN A;  3L2R A;  2YUO A;  2FVU A;  3JV3 A;  4PJM A;  4JJN K;  3CCS T;  3NTI A;  1UHC A;  2YDL A;  4M78 A;  4A4H A;  1VQ6 A;  4FSX A;  3G7Z A;  1ACM B;  1AWW A;  2BE9 B;  2ZGW A;  2VYT A;  2VUB A;  4XQ3 A;  4KDL A;  3G71 T;  1TSF A;  3CD6 Q;  5LJ3 d;  3J81 E;  1RAH B;  1R7R A;  3RIR A;  2CP0 A;  4PLI A;  2ED1 A;  5LJ5 e;  2MWO A;  3QYG B;  2GNC A;  1ZX6 A;  2PTK A;  5IHN A;  2E41 A;  1HJD A;  2EPD A;  1G8X A;  2FZG B;  2DL5 A;  3NGP A;  1WHJ A;  2C0O A;  2K2M A;  4FW2 A;  1U1T A;  3G4S Q;  3ZJU A;  4X1V A;  2XDB A;  1TOV A;  3A5Z B;  3SWN B;  2EKH A;  4J9E A;  1TG0 A;  1Q82 U;  1X75 C;  5HK0 A;  1UG1 A;  2EJG A;  2RH2 A;  2QDL A;  3VJP A;  2DER A;  2KRS A;  1FX7 A;  2DD4 A;  1TTH B;  4F7U E;  1AZE A;  3VS6 A;  2E12 A;  2QA4 T;  4N4I A;  3EGX B;  3OW2 P;  3H0I A;  2ROT A;  4D8D A;  7AT1 B;  3REB B;  4KUI A;  4K11 A;  4PFP A;  3SHW A;  4KRT A;  2LQN A;  1VQ9 Q;  3A1P A;  1HK9 A;  2L8D A;  1EIF A;  3E2U A;  4M7D A;  1CSK A;  1S72 A;  2VV5 A;  3EFR A;  4KGZ B;  1UJ0 A;  4DA4 A;  4F16 A;  4MZM A;  3DB3 A;  3KUF A;  1PG5 B;  3S3N A;  4FW1 A;  4LDU A;  2X4Y A;  2FYK A;  1W70 A;  1Y71 A;  3MET A;  3H0H A;  1PKT A;  4M77 E;  3J7A F;  1X6B A;  2O4X A;  2YXY A;  4AFU C;  1MV3 A;  2QAZ A;  4M77 C;  4HKE A;  2Y90 A;  1WQ7 A;  1NLO C;  3HFN A;  4L5G A;  5CKH A;  3MEW A;  1ZHI A;  3OYI A;  2CT3 A;  3L2V A;  4NOY A;  2EQJ A;  2E3H A;  2EQI A;  2GGR A;  2V8K A;  3JCM f;  1YIT T;  4A63 B;  2RQR A;  3RES A;  3CCR T;  3PTA A;  1VQP A;  4FYV B;  3LWH A;  2VB6 A;  1KQS S;  3VS2 A;  3L2Z A;  3M5A A;  2KRN A;  4C5I A;  1VQ4 A;  1SEM A;  2EJ9 A;  3UA7 A;  1UGR B;  1WX6 A;  4PJO F;  1D0Y A;  1VQL Q;  2H3J A;  2LJ0 A;  1XQH A;  3EG9 A;  4LNP A;  3RMQ A;  5GLF A;  4M4Z A;  5ECA A;  1TH7 A;  1YJN T;  1GRI A;  1YHQ T;  2KK4 A;  3C4S A;  5FWC A;  3CME T;  2KSS A;  1M3A A;  5GAN j;  1KFZ A;  5CO7 A;  4ELY C;  1VQ6 Q;  8ATC B;  4ZN3 A;  2E3I A;  2JUF A;  4F7U B;  4PKC C;  4J83 A;  2LVM A;  1BB9 A;  2JT4 A;  4RTT A;  4ESR A;  2FRY A;  3OYF A;  2KXD A;  3UF4 A;  3QYH B;  4OMQ A;  3URG A;  4FIB A;  1K8A C;  1VQM T;  4PJO D;  2KNB B;  4IUU A;  2GFA A;  1RUW A;  4XTW A;  2HMA A;  5FTJ A;  4BY6 C;  4LDX A;  5GAO l;  4E2F B;  2A08 A;  2GFU A;  4B9X A;  4BE2 A;  5GAN h;  1VQK A;  3A8L B;  3PGG A;  3VYH B;  4M77 B;  2DYI A;  5HK3 A;  2LRQ A;  3NTH A;  2RK2 A;  3M0R A;  5IHI A;  1YCY A;  1YI2 A;  4LD9 K;  1UGP B;  9ATC B;  3RMS A;  4FCY A;  1BIA A;  2E65 A;  4OMF B;  2EVR A;  1K0X A;  3NTK A;  1M5Q 1;  4DOW A;  4PK4 A;  3G6E T;  3EGD A;  4JS5 A;  5GJW B;  1M90 C;  3R6O A;  2RI3 A;  1WNL A;  1NYG A;  1ZSZ C;  1S72 Q;  2NUZ A;  4PFZ A;  4PJO A;  2HKN A;  3H8Z A;  1LJO A;  1M2O A;  3QG1 A;  4IIO A;  3A8O B;  2XG8 D;  5IAY A;  5GAN 8;  4BI8 B;  4HCC A;  2QEX T;  4J6Y A;  4C5H A;  2DO3 A;  1D0Z A;  3MEU A;  3DLL A;  1WYX A;  2IIM A;  4XTV A;  5CVI A;  2DXT A;  2V8J A;  1C6V X;  2E4H A;  3VS7 A;  1JBM A;  3OYA A;  2NWM A;  3JCM X;  3OA6 A;  1YWO A;  4M78 G;  1QWE A;  3PT9 A;  2RF0 A;  2ZCF B;  1MMG A;  3QQ7 A;  3GNF B;  3CCJ A;  1Y0M A;  4LUD A;  1QVG A;  3FLG A;  3CQT A;  3L2W A;  2LCL A;  3JAM E;  4A53 A;  3VU3 C;  2LJ1 A;  1VQP Q;  4J9H A;  3AHU A;  3VRZ A;  1EFN A;  3I35 A;  1KJW A;  2JMA A;  2EW3 A;  3RKY A;  1KK7 A;  4JPB W;  4OMP A;  2EGC A;  1VQ4 Q;  5DLO A;  2O01 E;  3CD6 T;  1ZUK A;  4Q5W A;  2E5Q A;  1CZ5 A;  3EG2 A;  4RTV A;  3QPH A;  2RI5 A;  4BY6 B;  3UPU A;  1QVF A;  1E7O A;  1ABQ A;  1C1A A;  2EFI A;  1WHM A;  1YIJ A;  2HL5 C;  1X6O A;  2DEU A;  1GBQ A;  2V26 A;  2XMF A;  3G4S T;  3LWI A;  2X9H A;  3DKM A;  4Z89 A;  3HRS A;  2KT8 A;  3BDU A;  3MKD A;  4LDW A;  1VQ7 A;  4GLM A;  1W2B P;  1E32 A;  5ERG B;  1OU9 A;  2LNH B;  2MI6 A;  5GAN 4;  3SFM A;  1LOJ A;  2EYY A;  4M7D G;  1DJ7 B;  5B6C A;  3DLM A;  1ZSZ B;  1BKB A;  3J80 E;  4XU0 A;  1U06 A;  2GQV A;  2B25 A;  3JB9 H;  3I56 A;  4N0A C;  1Q7Y R;  4JLI A;  3LH0 A;  1VQ9 T;  1BYM A;  2O2O A;  2RHY A;  3GIB A;  2CP5 A;  3EH2 A;  3EGU A;  4A4K A;  2D6F A;  1W1F A;  4LN2 A;  3M0Q A;  2COZ A;  2NUT A;  2OAU A;  3FB9 A;  2KEA A;  4WCI A;  2DX1 A;  4HCK A;  2PJH B;  4HVV A;  4FT4 A;  2JTM A;  2C0I A;  3MCA B;  1RAD B;  3G1J A;  1BIB A;  4ORZ A;  1YI2 Q;  3BQB A;  1G83 A;  2AKK A;  2QXF A;  5DYG A;  2LTO A;  1QP2 A;  4QT7 A;  3P8H A;  1I07 A;  1IZ6 A;  5GAN f;  5C6S A;  4AG1 C;  1Z9Z A;  3M57 A;  1IRX A;  1ZBX A;  5IN1 A;  2HBP A;  1RLQ C;  2WSF E;  1Y57 A;  2K3B A;  4ZTF A;  3ZEH A;  3A98 A;  4C8Q F;  1K9A A;  3M56 A;  2GTJ A;  1M8M A;  1LNX A;  1GFD A;  1I8F A;  2RA2 A;  1WHH A;  4EDU A;  5DM7 R;  3INZ A;  2L89 A;  3PMI A;  2E10 A;  2NUP A;  2QYZ A;  5D6W A;  1VQL T;  1M2V A;  3OMC A;  2KBT A;  4Z02 A;  3A8H B;  1P92 A;  1XTD A;  1SHF A;  2K4Y A;  2ROL A;  4DBQ A;  3CCJ Q;  3CC7 Q;  3S6W A;  3CC4 T;  1X2K A;  4LD6 A;  5CKD A;  1WPY A;  2KGT A;  4HVU A;  5GMK i;  1JXM A;  2DA9 A;  4ZTJ A;  1WJS A;  5KYY A;  1FMV A;  4KH0 B;  2RHU A;  2RQW A;  1JB0 E;  1VQ6 T;  3LH5 A;  2DAQ A;  1KHC A;  2NLU A;  3M0P A;  2VKN A;  2X3X D;  4C8Q D;  2DMO A;  2G6F X;  1WLP B;  1Q82 C;  3TRE A;  5CQY A;  4FYX B;  5D6X A;  1AWJ A;  3PFS A;  1H8K A;  3FPR A;  1VQ9 A;  4LXC A;  5FU6 C;  1UHF A;  3ZGZ A;  2Y4Y A;  3CMA A;  2V1Q A;  1TUD A;  4OF1 A;  1OUL A;  1YIJ Q;  5IH2 A;  2ZPI B;  2FPD A;  3JSC A;  4IIM A;  1VQ5 Q;  3CCQ A;  2DTH A;  4JJB A;  3TCJ A;  5A2Q E;  4HT9 A;  2Y4X A;  4XU2 A;  2M51 A;  2DL3 A;  3MP8 A;  1FWZ A;  1AWX A;  1VQ7 Q;  1W2B S;  1QCO A;  4JRQ A;  3VYG A;  4JRK A;  1B34 B;  1N6A A;  1VYU A;  2J6F A;  1UB4 A;  3UA6 A;  1I5L A;  2COW A;  4QW2 A;  5FW9 A;  2HL3 A;  4F14 A;  1JJ2 A;  4O5V A;  4PJO G;  2DK3 A;  3GF5 A;  4QVD A;  2YVL A;  1O75 A;  4C8Q A;  1D1A A;  1HXD A;  1JQQ A;  3QII A;  3I56 Q;  2P0Q A;  3EFO B;  1CKB A;  5GMK e;  4M7A F;  2A36 A;  5C18 A;  2EYW A;  2K57 A;  3M4G A;  1T3S A;  2OJ2 A;  3HRT A;  5HY6 A;  4AQ7 A;  5KYX B;  1S72 T;  2CH4 A;  2DE0 X;  2ZPB B;  3RNJ A;  1Q86 U;  1PSF A;  3CCV A;  2CT4 A;  3QWZ A;  2DIG A;  2KQW A;  1N8R U;  3H41 A;  3NHN A;  3T9N A;  5LJ5 j;  1HSQ A;  3OYH A;  2HAX A;  4DEX A;  4AFZ C;  5CK9 A;  4M77 F;  2QTV A;  2YSQ A;  1UFF A;  3GPL A;  1V29 B;  2QQ9 A;  5KE2 A;  1NJI R;  1CZ4 A;  1LCK A;  2DD5 A;  4ME7 A;  1G3W A;  5D6Y A;  1H3Z A;  2KRM A;  4CC7 A;  4CC2 A;  2C0T A;  3JCM P;  3OYM A;  2D8H A;  1MNE A;  3MP1 A;  1SF9 A;  2VAS A;  1WJR A;  4M7A D;  2DYB A;  5DLQ E;  4AS1 A;  1VQP T;  2EYX A;  3LGA A;  3CXC A;  2E5K A;  5LJ5 h;  2QGF B;  5FU6 B;  2QTX A;  4WTO B;  5A0L A;  2KYM A;  1VQ4 T;  5FLX E;  2NYS A;  2E6N A;  2DJZ A;  2FB7 A;  2X4X A;  4M77 D;  4M78 E;  1TWB A;  2RK1 A;  1WLF A;  2A28 A;  1Y07 A;  2LC4 A;  2KYB A;  1QCS A;  2PZ1 A;  2JM9 A;  1MGQ A;  4M78 C;  3M0T A;  3QUI A;  1RAC B;  5LJ3 e;  2E64 A;  2IPO B;  2XDP A;  4NL3 A;  4KUL A;  3EG0 A;  3MPU B;  2EQK A;  1SSF A;  3UWN A;  4ZGJ B;  3HSB A;  2O9S A;  3U23 A;  4GLK A;  1Q7Y U;  4M7A A;  2DXU A;  2LJ3 A;  1AD5 A;  4XTZ A;  3V7S A;  3OSV A;  3E9F A;  4FSS A;  5DY9 A;  2J05 A;  2O9V A;  3CMA Q;  2RO0 A;  1NLP C;  2L5Q A;  3HU2 A;  4XTU A;  2F1L A;  3OB9 A;  1AHJ B;  4E7Z A;  3CCQ Q;  2IVW A;  1KIK A;  2P0K A;  2R58 A;  2YWW A;  5AT1 B;  5CD1 A;  2EAY A;  3GP8 A;  2XU8 A;  1GBR A;  3EG1 A;  2VXE A;  1I81 A;  4OGE A;  1VQK T;  2HCK A;  2QDY B;  4E7J A;  3SEM A;  4N4H A;  2XD0 A;  2DL7 A;  2BZX A;  5GAN 2;  1B7T A;  2GF7 A;  1YI2 T;  3ASK A;  4M7D E;  3TQ7 P;  3QZ9 B;  1O54 A;  1T0J A;  3CF2 A;  2A7Y A;  4GY5 A;  1G3S A;  4M7D C;  2L3P A;  4PJN A;  4EPC A;  3MJX A;  5FRM A;  2HSP A;  1K0S A;  4JLG A;  4B9W A;  2K79 A;  2V8I A;  1WXB A;  2P0P A;  3I9Q A;  3HP9 A;  5D7U A;  2YUN A;  3CCV Q;  3PNW C;  2DBM A;  2M9U A;  2IG0 A;  2LNV A;  3FIF A;  1QVP A;  2F2V A;  3LW5 E;  1R77 A;  2W0Z A;  4BE0 A;  1NM7 A;  2BTT A;  2V1R A;  3E19 A;  2MAM A;  1CKA A;  1R0C B;  2KI7 A;  5EPP A;  3WXM B;  2COY A;  4J5Y A;  4M78 B;  2F69 A;  3QWY A;  5I11 A;  2JZ2 A;  1K76 A;  4YTL A;  2KR3 A;  3X24 B;  1M4Z A;  2EGE A;  3CCJ T;  4R0K A;  2H3E B;  1VQN A;  3E1S A;  5CIU A;  4ATO A;  2AZS A;  3VS1 A;  4J7F A;  1YN8 A;  1UE9 A;  4JZ3 A;  1QVG P;  2CSQ A;  2DVE A;  3OYN A;  2FZC B;  2DXC A;  3H9N A;  1OZ2 A;  3SDZ A;  1BK2 A;  2HD0 A;  4BI4 A;  3M53 A;  1M30 A;  1SHG A;  2CP7 A;  5KYU A;  5HCK A;  4CC3 A;  2ABL A;  2EIF A;  3MB5 A;  2DM1 A;  4R55 A;  3KXT A;  1YIJ T;  4J9G A;  2B86 A;  5LJ5 f;  1QVF P;  1VQ5 T;  3CEY A;  2FPF A;  5J39 A;  4FYY B;  2BIV A;  1QQJ A;  4X9C A;  2LZ6 B;  5GAM d;  4C8Q G;  4HA8 A;  3OW2 S;  1B3Q A;  3BE3 A;  1VQ7 T;  3D7S B;  4ZGE B;  2DRK A;  5FTK A;  2WAC A;  4M7D B;  4KUD K;  4J9D A;  1U5S A;  2OTL Q;  2BKD N;  1NZ9 A;  3HKS A;  2L3Q A;  2LQ8 A;  2K5L A;  3A8G B;  1TUG B;  3ER0 A;  1VOM A;  1TS9 A;  1ZSG A;  4Y28 E;  4Z88 A;  4LDV A;  1PCX A;  1OPK A;  2E6Z A;  3OYD A;  4RMO A;  1ZUU A;  1N5Z A;  3I56 T;  1RAE B;  1N9S A;  1NPR A;  3I5S A;  3FC3 A;  2PQW A;  3M0U A;  2FPE A;  5GAM e;  2O4X B;  4TVR A;  3QDR B;  3CCL A;  2OI3 A;  3VV0 A;  6AT1 B;  3HL8 A;  1OV3 A;  4II1 A;  5CKF A;  3V8J A;  2EGA A;  1QLY A;  2MM0 A;  2K2V A;  1NJI U;  4ARC A;  1Q86 R;  1V76 A;  4HXJ A;  2ZZD A;  3QKJ A;  3QDF A;  2ZPF B;  1N8R R;  1VQO A;  1Y7X A;  2CP2 A;  1Y96 A;  2MOX A;  2ZPH B;  4J9I A;  3CC7 A;  2LT4 A;  4PJO E;  1K4U S;  4CQN A;  4AFQ C;  2RQV A;  1PD0 A;  4RG2 A;  4PJO C;  4C92 F;  4MDW A;  1BU1 A;  1I9G A;  3NPF A;  1FXX A;  2CUD A;  1YJ9 A;  3DB4 A;  3EG9 B;  4PNO A;  2RI2 A;  4MMK A;  2RJC A;  1AWO A;  3A8M B;  3SB2 A;  1G2B A;  5EC7 A;  2QQA A;  4RTW A;  1KD1 R;  2YUJ A;  5FTL A;  2CZ0 B;  2HSE B;  1VYV A;  5LJ3 g;  1OQK A;  4ZN1 A;  2DBK A;  3I55 A;  3CPW A;  3TU4 K;  1VQ5 A;  4M75 F;  4LDY A;  4NS5 A;  3TSZ A;  2CS7 A;  4DEY A;  4M7A G;  2DL4 A;  1VQN Q;  1QVG S;  1WJQ A;  1FYN A;  4FM4 B;  4C92 D;  2M0Y A;  2DL8 A;  5HKC A;  2LCC A;  1KHI A;  1B07 A;  1D1B A;  4BAC A;  4N4G A;  3R6N A;  2Q1C X;  1GCQ A;  1O9S A;  1SPK A;  2J6K A;  4VUB A;  2DFU A;  5CCA A;  3S3M A;  4IUV A;  5KE3 A;  4BUG A;  2K5F A;  1S1N A;  3EFS A;  1M8V A;  2F5K A;  2EYZ A;  4KLN A;  1D09 B;  4O6J A;  1SKU B;  2MK5 A;  3QJY A;  2ZPG B;  2JVV A;  5GAO q;  1KC8 R;  3CMA T;  2DTI A;  4AFS C;  3OS1 A;  1QVF S;  4E7K A;  5I22 A;  1QDN A;  1D1C A;  4M75 D;  3CCQ T;  2MYS A;  2PUO B;  1PD1 A;  3EGD B;  1UEC A;  4IUR A;  1NEG A;  1I0C A;  2QG9 B;  4C92 A;  4EMK A;  2FRW A;  3EG3 A;  2E70 A;  3JCM W;  1M1K U;  4MZT A;  1VUB A;  1N8R C;  2C06 A;  4PJO B;  1UGS B;  1MMN A;  1MMD A;  4KH1 B;  3FRN A;  1VYT A;  1M1G A;  1SRM A;  1WHG A;  5AYF A;  2KXC A;  1JJ2 P;  2Q18 X;  4FL6 A;  3GLX A;  4D6W A;  2YHT A;  1BBZ A;  1PKS A;  4E7H A;  3CPF A;  5KYN A;  3CCL Q;  3E9G A;  1RAI B;  2M1H A;  4JRP A;  2QQB A;  1ABO A;  3CCV T;  1Y96 B;  3QC8 A;  3CCR Q;  1D3B A;  4M75 A;  1KSW A;  2LDM A;  3EHR A;  1K9M U;  2JS0 A;  1VQO Q;  3UDC A;  2RN8 A;  5GJV B;  2QAS A;  1K73 R;  5KCH A;  4OGC A;  4HVW A;  1U8R A;  2XDD A;  2DRM A;  2BZY A;  1D0X A;  4GBQ A;  3H6Z A;  1OZ3 A;  2DXB A;  2X3W D;  1YHQ Q;  1YJ9 Q;  4EMG A;  4XU3 A;  3FEO A;  3L1A A;  2XI9 A;  1C0M A;  4A4G A;  2OTJ A;  1JO8 A;  2QQS A;  4RTY A;  3CXC P;  3FJP A;  3GBQ A;  2RJE A;  4C0F A;  5GMK j;  5L8R E;  1PC0 A;  2A3L A;  3SWN A;  2RNA A;  1I5O B;  2D0Q B;  2RQT A;  1YNZ A;  2JXB A;  1Q7Y C;  4OML A;  3I55 Q;  5CQX A;  1EX4 A;  4M78 F;  1HYO A;  3LYI A;  3LGF A;  3CCE A;  4RUG A;  3JCM d;  5FTN A;  2J6O A;  2RHI A;  1OX9 A;  2XHC A;  1GL5 A;  3EGX A;  4PL6 A;  1W6X A;  2CKK A;  2QK0 A;  4QKU A;  1UDL A;  2E1H A;  3JCM V;  4C0Z A;  4F7U F;  2D8J A;  1BCM A;  3GOX A;  3M4Y A;  3EH1 A;  4E47 A;  2OTL T;  4Z8A A;  5GAM g;  3CCU A;  2NUT B;  3MP6 A;  1KQ2 A;  5GMK h;  3LHD A;  3JCM e;  5IHK A;  1WQW A;  3PIO A;  3VS5 A;  1RAB B;  1Q81 U;  2R5M A;  2R57 A;  1IXD A;  1T0H A;  4IKF A;  4FYW B;  5LL6 S;  4M78 D;  2O31 A;  4XU1 A;  4ZGD B;  3M0S A;  2HEQ A;  3V7R A;  3ME9 A;  1AT1 B;  1HD3 A;  2RJD A;  3ZJV A;  4C8Q E;  1QKW A;  3OBW A;  2AK5 A;  2FL7 A;  3C0C A;  2JTE A;  2AKL A;  4C5E A;  2DZ9 A;  1VQ8 A;  4C8Q C;  2CZ6 B;  2LQW A;  1R8O B;  3MHX A;  5J26 A;  2L0A A;  1MUZ A;  4M7D F;  1QWF A;  1TUC A;  2VVK A;  4XTX A;  5LJ3 j;  2JMC A;  1JJ2 S;  3WVD B;  5KYW A;  1WFW A;  1YJW A;  2JNG A;  4IUT A;  1NBE B;  5GMK m;  3M58 A;  3NFC A;  2CZ1 B;  5A0G A;  3TEE A;  4J7I A;  4BE1 A;  1YCS B;  5GAN 5;  2ATC B;  5GAN 3;  1KD1 U;  2RM4 A;  3M9Q A;  2EWN A;  2NUP B;  5LJ5 d;  3VKI A;  3PIP A;  1M2V B;  4OMM A;  4PJL A;  2GTO A;  3VS0 A;  4J6X A;  3OYB A;  2EKO A;  2A0F B;  3CCM A;  3ZJT A;  1W4S A;  4AMC A;  1IGU A;  2DKG A;  2M02 A;  4MZP A;  2ECZ A;  2HZY A;  2KVQ G;  5KYY B;  1H64 1;  3HU1 A;  3QQ8 A;  5LJ3 h;  1G5V A;  4M7D D;  4F7U A;  4V2S A;  2YLB A;  2VGM A;  1XNI A;  4QVZ A;  2WSE E;  1WXU A;  3CBP A;  5CKE A;  3ULR B;  1VQN T;  1ZUY A;  3MEV A;  3RKX A;  3BY7 A;  2OTL A;  4KBM B;  2RD1 A;  3CXC S;  1KC8 U;  2OTJ Q;  2L3R A;  4BD3 A;  1GXI E;  5C0M A;  4A4E A;  1IGQ A;  2DEQ A;  2HDA A;  3GNG A;  3CC2 A;  1X6G A;  2CUB A;  2H8H A;  5GAN 6;  4M77 A;  1K8A R;  2WSC E;  1QKX A;  1QP3 A;  3CCE Q;  1BI3 A;  1UTI A;  4C92 G;  2DIL A;  2CSI A;  4M7A E;  1OI1 A;  2LT1 A;  3OYC A;  4C0G A;  1KQS A;  4E7L A;  4C8Q B;  4E6R A;  4M7A C;  4Y91 A;  1OX8 A;  2LP5 A;  2SRC A;  3S3O A;  4AT1 B;  2O88 A;  2EQM A;  4DBF A;  3LGL A;  5CKB A;  3RUX A;  2EQU A;  3FDR A;  1RI0 A;  1UJY A;  4OVA A;  4J6W A;  1EZZ B;  2BE7 D;  3CCU Q;  2RHZ A;  2FG0 A;  3ZFJ A;  3OS2 A;  1NJI C;  1WI7 A;  1M1K R;  4QQG A;  5KH6 A;  4F04 B;  5FWB A;  3WVE B;  2MCN A;  4M75 G;  1M90 R;  1UEB A;  3F70 A;  1A0N B;  3CCS A;  5IT9 E;  2PVD B;  3X20 B;  1GFC A;  2HQX A;  5EG2 A;  3CCL T;  4OP0 A;  3HFO A;  1OYX A;  2P4R A;  1K73 U;  2DLP A;  4OB3 B;  2YRD A;  1KQ1 A;  1UGQ B;  2OAW A;  1VA7 A;  3G71 A;  4BDZ A;  1V1C A;  5KYW B;  2JOY A;  1AVZ C;  1YFN A;  3RKW A;  3OYY A;  1VQ8 Q;  1RLP C;  1VQO T;  1IRE B;  2XIC A;  2MF2 A;  3L42 A;  1QMC A;  2KE9 A;  1SSH A;  4B6M A;  1K9M R;  3OYG A;  3CC7 T;  1WDX A;  3JB9 F;  3CBM A;  4OB0 B;  1YJW Q;  3TVT A;  2FO0 A;  2EYQ A;  2RB6 A;  4L6V 5;  1BI2 A;  1LPL A;  4F17 A;  2MIO A;  2LQK A;  1NYF A;  2K3X A;  3CC4 Q;  5IXF A;  2PU9 B;  3VRY A;  1M27 C;  1YJ9 T;  1UUE A;  1I4K 1;  2YRV A;  4KGV B;  2K5I A;  3HPW A;  5FRO A;  3VUZ A;  3OW2 A;  3CCM Q;  1X27 A;  2QA4 A;  1CR5 A;  2DPP B;  1PHT A;  5CR2 A;  2JM8 A;  2HQH A;  4A4F A;  1X2Q A;  3EAE A;  4OB1 B;  5GAM j;  4CI0 C;  1MHN A;  1M9S A;  3LLR A;  5GAN d;  2ESW A;  4EIK A;  4HT8 A;  2CZ7 B;  4RTU A;  3I55 T;  4EMH A;  4M7A B;  3JB9 D;  1G3Y A;  1X43 A;  1WIE A;  2KAF A;  4XTY A;  1PM3 A;  2DTO A;  4BB7 A;  3CPW P;  1ZSZ A;  4WF2 A;  1GCP A;  4P5N A;  3HU3 A;  3JCM g;  5KCO A;  1WHK A;  2CGH A;  2DET A;  3NMZ C;  3QSU A;  5LJ3 f;  5FTM A;  2AIR B;  5GAN e;  2F5T X;  4A54 A;  4QQD A;  3OYL A;  2P84 A;  2P4T A;  3O5Z A;  4MML A;  2K7A A;  3PVQ A;  4IUQ A;  3C94 A;  3CC2 Q;  2Q1A X;  5GAM h;  1Z9Q A;  2DF6 A;  2DNU A;  5GAO n;  2JJ9 A;  1RAF B;  1NE8 A;  1BCO A;  1M1K C;  4C5G A;  4NL2 A;  2CH4 W;  5L23 A;  1YIT A;  1U1S A;  3LX7 A;  2VGN A;  4ELZ C;  4LUE A;  4KDI A;  2AZV A;  3CCR A;  1Q81 R;  2D9T A;  2KY9 A;  3C95 A;  4OB2 B;  3RBB B;  1E6G A;  3X26 B;  3OQ5 A;  1AEY A;  1IHW A;  3TIW A;  2KMT A;  2OX7 A;  3JCM J;  2YRC A;  3X25 B;  2LX7 A;  1WZO A;  2DIQ A;  5DYI A;  4BI3 A;  2JS2 A; 
#chains in the Genus database with same CATH homology
 3CCR T;  3PTA A;  2JN0 A;  2QQ9 A;  1VQP A;  5KE2 A;  2QQB A;  3V7C A;  3OY9 A;  3X28 B;  3CCV T;  1Y96 B;  4CRI A;  1CZ4 A;  2DD5 A;  4ME7 A;  3LWH A;  1G3W A;  1KQS S;  1K9M C;  3L2Z A;  1D3B A;  5D6Y A;  1H3Z A;  3QC8 A;  1YJN A;  4M75 A;  3M5A A;  3JCM Q;  3PMT A;  4C5I A;  2LDM A;  1YHQ A;  3JCM P;  3BFM A;  4RV0 A;  3OYM A;  3CME A;  1VQ4 A;  1K9M U;  3MP1 A;  2EJ9 A;  3UDC A;  4IUP A;  5GMK l;  3HHT B;  1WJR A;  2HNI A;  5I2M A;  1KG1 A;  1UGR B;  4PJO F;  4M7A D;  5KCH A;  5DLQ E;  3QHS A;  2H3J A;  4OGC A;  5GAN 7;  4AS1 A;  1XQH A;  3Q1J A;  1U8R A;  3RMQ A;  5A0D A;  1VQP T;  2K3Y A;  3LGA A;  2XDD A;  3CXC A;  5M9O A;  3P8D A;  2X35 A;  5GLF A;  3JCM b;  1TH7 A;  1YJN T;  3H6Z A;  4F7U G;  5FU6 B;  5LJ5 g;  5LJ5 h;  2QI2 A;  2QTX A;  1YHQ T;  4XAX B;  1OZ3 A;  2KK4 A;  2M0O A;  3C4S A;  4JRI A;  3L2Q A;  5A0L A;  4R56 A;  2DXB A;  3CME T;  1VQ4 T;  2KSS A;  5FLX E;  4EMG A;  4XU3 A;  2E6N A;  2DJZ A;  2FB7 A;  3FEO A;  3L1A A;  2X4X A;  2XI9 A;  3QBY A;  5GAN j;  2PWY A;  5CO7 A;  4ELY C;  1VQM A;  4M77 D;  2RHX A;  2XKO C;  4M78 E;  4ZN3 A;  2RK1 A;  1WLF A;  1Y07 A;  2LC4 A;  4F7U B;  2JUF A;  1QCS A;  3FPU A;  4PKC C;  4J83 A;  5C1B A;  2LVM A;  4A4G A;  4J8O A;  2OTJ A;  2QQS A;  1MGQ A;  4M78 C;  3QUI A;  3FJP A;  5LJ3 e;  4N0A A;  2E64 A;  2RJE A;  3HRU A;  4C0F A;  5GMK j;  3OYF A;  5L8R E;  2G3R A;  4LD9 K;  2A3L A;  2XDP A;  3SWN A;  4NL3 A;  2D0Q B;  4KUL A;  1ZC1 A;  3QYH B;  2EQK A;  1SSF A;  4C0D C;  3URG A;  1Q7Y C;  1RL2 A;  3UWN A;  4ZGJ B;  4FIB A;  1K8A C;  1VQM T;  3HSB A;  4PJO D;  4GLK A;  3OMG A;  4IUU A;  5CQX A;  4M78 F;  3LYI A;  3LGF A;  4M77 G;  3CCE A;  1Q7Y U;  2GFA A;  4M7A A;  2DXU A;  1K8A U;  4XTW A;  3JCM d;  5FTN A;  2OTJ T;  5FTJ A;  4XTZ A;  4XK8 E;  3V7S A;  4BY6 C;  3OSV A;  4LDX A;  2RHI A;  5GAO l;  2XHC A;  1QW1 A;  4X9D A;  2GFU A;  3E9F A;  4B9X A;  3G6E A;  3CBO A;  2PVG B;  4PL6 A;  1XOV A;  2CKK A;  3RER A;  1WGS A;  3JRZ A;  3UT1 A;  5DY9 A;  2BUD A;  5GAN h;  4BE2 A;  1VQK A;  3L2U A;  3A8L B;  3PGG A;  3VYH B;  2E1H A;  2RO0 A;  3JCM V;  4M77 B;  4QVC A;  5HK3 A;  4C0Z A;  4F7U F;  2LRQ A;  3NTH A;  4JRP A;  2RK2 A;  1B34 A;  2L5Q A;  3CPW S;  3HU2 A;  4XTU A;  4JS4 A;  1YCY A;  3OB9 A;  3M4Y A;  4RCC A;  1AHJ B;  3GOX A;  1YI2 A;  3CCE T;  1UGP B;  4E47 A;  2OTL T;  2IVW A;  3RMS A;  2P0K A;  5GAM g;  1BIA A;  2R58 A;  2E65 A;  3CCU A;  1N9R A;  4OMF B;  3MP6 A;  1KQ2 A;  5CD1 A;  5GMK h;  3LHD A;  1Q81 C;  3NTK A;  2EAY A;  3GP8 A;  3JCM e;  1M5Q 1;  4BI3 A;  4DOW A;  3JCM c;  3G6E T;  4JS5 A;  2XU8 A;  1WQW A;  1Q86 C;  3PIO A;  2VXE A;  1I81 A;  3QZ5 B;  4OGE A;  2QEX A;  2M16 A;  2QQR A;  3MO8 A;  1VQK T;  5FU7 C;  1M90 C;  3JB9 I;  1Q81 U;  2XK0 A;  2QDY B;  3R6O A;  2RI3 A;  2R5M A;  1WNL A;  2R57 A;  4E7J A;  4N4H A;  2XD0 A;  1S3S A;  4IKF A;  5LL6 S;  5GAN 2;  2ZPE B;  2GF7 A;  4M78 D;  1YI2 T;  1M90 U;  2JTF A;  3ASK A;  4XU1 A;  4ZGD B;  4M7D E;  2LW6 A;  2DZC A;  3QZ9 B;  4JDS A;  4PJO A;  3SD4 A;  1O54 A;  3V7R A;  1VIE A;  3H8Z A;  3ME9 A;  3CCU T;  2Q1D X;  3CF2 A;  2A7Y A;  1LJO A;  3QG1 A;  4GY5 A;  1G3S A;  2RJD A;  4M7D C;  3A8O B;  2XG8 D;  5IAY A;  5GAN 8;  3ZJV A;  4BI8 B;  4HCC A;  4C8Q E;  2QEX T;  4J6Y A;  3JB9 J;  3OBW A;  2DO3 A;  4C5H A;  4EPC A;  3MEU A;  4L59 A;  3DLL A;  2FL7 A;  5FRM A;  4C5E A;  2Q19 X;  4XTV A;  4JLG A;  2GCX A;  5CVI A;  2DZ9 A;  2V8I A;  4B9W A;  1VQ8 A;  4C8Q C;  2CZ6 B;  1R8O B;  2P0P A;  4C92 E;  3MHX A;  2DXT A;  2V8J A;  5J26 A;  3HP9 A;  4M7D F;  1JBM A;  3VUB A;  3OYA A;  4FU6 A;  4XTX A;  3V8L A;  3PNW C;  5LJ3 j;  3JCM X;  3OA6 A;  4M78 G;  4C92 C;  3PT9 A;  1JJ2 S;  3WVD B;  2M9U A;  4EMK C;  2IG0 A;  2ZCF B;  2LNV A;  4FT2 A;  2PUK B;  1YJW A;  3QQ7 A;  3FIF A;  1QVP A;  2JNG A;  3GNF B;  3LW5 E;  4IUT A;  5GAM f;  3M58 A;  5GMK m;  3CCJ A;  1KD1 C;  3NFC A;  2CZ1 B;  4BE0 A;  3JB9 H;  5A0G A;  1QVG A;  3OS5 A;  3FLG A;  3CD6 A;  3TEE A;  4J7I A;  4BE1 A;  3L2W A;  5GAN 5;  2LCL A;  2VC8 A;  3E19 A;  5GAN 3;  2MAM A;  3JAM E;  3BW1 A;  4A53 A;  1KD1 U;  1VQ8 T;  5EPP A;  2RM4 A;  3WXM B;  3M9Q A;  2EWN A;  4J5Y A;  3VU3 C;  5LJ5 d;  4M78 B;  3VKI A;  3PIP A;  2F69 A;  3AHU A;  4KOD A;  2MM2 A;  2JZ2 A;  4DOV A;  4YTL A;  4J6X A;  3X24 B;  1M4Z A;  4BDY A;  3OYB A;  1YJW T;  1BI0 A;  2AHJ B;  3RKY A;  4C0D B;  2EKO A;  1X01 A;  3CCM A;  3CCJ T;  3ZJT A;  3G4S A;  4M75 E;  2RJF A;  1W4S A;  5DLO A;  1VQN A;  2DKG A;  2O01 E;  3CD6 T;  3E1S A;  4Q5W A;  1YBY A;  2E5Q A;  1CZ5 A;  5CIU A;  4MZP A;  4ATO A;  2KVQ G;  4J7F A;  4M75 C;  2MMP A;  1H64 1;  1W2B A;  3QPH A;  2DVE A;  2RI5 A;  3OYN A;  4BY6 B;  2DXC A;  3UPU A;  3HU1 A;  3FPT A;  3QQ8 A;  5LJ3 h;  1G5V A;  4DQ2 A;  4M7D D;  1QVF A;  2X4W A;  3MEA A;  2PVO B;  4F7U A;  4V2S A;  2EFI A;  3OYJ A;  2YLB A;  1YIJ A;  5CCB A;  1X6O A;  2VGM A;  1OZ2 A;  1XNI A;  2KDS A;  3KBG A;  3CCM T;  3BDL A;  4QVZ A;  2WSE E;  3C12 A;  3G4S T;  3SDZ A;  3LWI A;  3M59 A;  2HD0 A;  3CBP A;  3DKM A;  5CKE A;  1VQN T;  4BI4 A;  2I2L A;  3HRS A;  3M53 A;  1BI1 A;  3QO3 A;  3BDU A;  5GAO p;  2CYZ B;  3MEV A;  1KC8 C;  3RKX A;  4LDW A;  1VQ7 A;  3BY7 A;  2OTL A;  4KBM B;  3M54 A;  2RD1 A;  1PSE A;  4QQ6 A;  5GAO m;  3CXC S;  1KC8 U;  2EIF A;  1E32 A;  5ERG B;  2MI6 A;  5GAN 4;  3MB5 A;  2L3R A;  3SFM A;  4R55 A;  4BD3 A;  3KXT A;  1YIJ T;  4KO8 A;  1GXI E;  1LOJ A;  4KT0 E;  5FU7 B;  1DJ7 B;  5LJ5 f;  4M7D G;  5EQJ B;  2B8A A;  5GAN g;  4AQ7 A;  5C0M A;  4A4E A;  5B6C A;  2DEQ A;  1VQ5 T;  3DLM A;  1BKB A;  3CEY A;  3P8B B;  3J80 E;  4HCB A;  5J39 A;  4XU0 A;  2BIV A;  3GNG A;  3CC2 A;  4X9C A;  2GQV A;  2B25 A;  5GAM d;  4C8Q G;  4HA8 A;  3OW2 S;  2X4J A;  2R5A A;  3O8V A;  5GAN 6;  4UC4 A;  4RCB A;  4ZGE B;  2EJF A;  5CAI A;  4N0A C;  3I56 A;  1VQ7 T;  4M77 A;  4JLI A;  3LH0 A;  3V8K A;  1VQ9 T;  2WAC A;  2WSC E;  1BYM A;  5FTK A;  1QP3 A;  3SWN C;  4M7D B;  3JCM h;  2LX9 A;  4KUD K;  1BI3 A;  2BKD N;  2RHY A;  3GIB A;  1NZ9 A;  3HKS A;  4C92 G;  2XID A;  2LQ8 A;  2K5L A;  3A8G B;  4A4K A;  4M7A E;  2D6F A;  1OI1 A;  2LT1 A;  3OYC A;  3ER0 A;  4C0G A;  2OAU A;  4Y28 E;  3FB9 A;  1KQS A;  2MWP A;  4E7L A;  4C8Q B;  4LDV A;  4M7A C;  2E6Z A;  4Y91 A;  3QJ6 A;  3OYD A;  3CC2 T;  3JB9 G;  2YVL A;  4RMO A;  3S3O A;  3OBY A;  4MDX A;  3M55 A;  3QXE B;  2PJH B;  4FT4 A;  2EQM A;  3I56 T;  5GAO r;  1N9S A;  1NPR A;  3LGL A;  2JTM A;  3FC3 A;  3MCA B;  5CKB A;  2PQW A;  4C92 B;  3RUX A;  4EMK B;  5I2S A;  1BIB A;  2EQU A;  3FDR A;  3BQB A;  1RI0 A;  2O4X B;  5GAM e;  4OVA A;  4TVR A;  3QDR B;  4J6W A;  2FHD A;  3CCL A;  2QXF A;  3VV0 A;  5DYG A;  3HL8 A;  2LTO A;  2RHZ A;  4II1 A;  1M1F A;  5CKF A;  3V8J A;  3ZFJ A;  3OS2 A;  1QP2 A;  1JRI A;  1NJI C;  3P8H A;  4ARI A;  4RKU E;  2VXF A;  5CCX A;  1IZ6 A;  2MM0 A;  4PLL A;  2K2V A;  4QQG A;  5GAN f;  5C6S A;  5KH6 A;  1NJI U;  1N27 A;  3M57 A;  4ARC A;  5J3B A;  3WVE B;  4RG8 A;  2ZZD A;  3QKJ A;  4M75 G;  1ZBX A;  1UEB A;  3F70 A;  3OS0 A;  2ZPF B;  5IN1 A;  2HBP A;  1VQO A;  3CCS A;  5IT9 E;  2PVD B;  1Y7X A;  2WSF E;  3X20 B;  3OSS C;  1K73 C;  3ZBD A;  2HQX A;  1Y96 A;  4HCZ A;  5EG2 A;  4ZTF A;  3ZEH A;  4OP0 A;  3CCL T;  2HQE A;  1VQL A;  3HFO A;  2ZPH B;  4E7I A;  3CC7 A;  1OYX A;  1ZQ1 A;  2LT4 A;  4JUV A;  1K73 U;  4OB3 B;  1G3T A;  3OYK A;  4C8Q F;  3OYE A;  4PJO E;  1KQ1 A;  1UGQ B;  4CQN A;  1D3B B;  3M56 A;  1NPP A;  2YLC A;  3G71 A;  4M75 B;  5I21 A;  4BDZ A;  3CC4 A;  1LNX A;  1I8F A;  3N5B B;  4PJO C;  4RG2 A;  2JV2 A;  1VIF A;  2RA2 A;  2JOY A;  4X34 A;  3RKW A;  5FRN A;  4C92 F;  3L2R A;  3OYY A;  4MDW A;  4EDU A;  5DM7 R;  3INZ A;  2L89 A;  3PMI A;  1I9G A;  2FVU A;  1FXX A;  4JJN K;  1VQO T;  3CCS T;  1IRE B;  1YJ9 A;  2XIC A;  2MF2 A;  2E10 A;  3L42 A;  3NTI A;  5D6W A;  4M78 A;  3DB4 A;  4A4H A;  1VQL T;  3OMC A;  4PNO A;  1VQ6 A;  3OYG A;  4FSX A;  3CC7 T;  3G7Z A;  3CBM A;  3JB9 F;  2RI2 A;  4MMK A;  4OB0 B;  4Z02 A;  2RJC A;  3A8M B;  2ZGW A;  3A8H B;  2VYT A;  1P92 A;  1XTD A;  2EYQ A;  2K4Y A;  2RB6 A;  2VUB A;  4XQ3 A;  3SB2 A;  4L6V 5;  3S6W A;  1BI2 A;  3G71 T;  3CC4 T;  2QQA A;  5FTL A;  2YUJ A;  5LJ3 d;  3J81 E;  2LQK A;  2K3X A;  4LD6 A;  2CZ0 B;  5CKD A;  1R7R A;  3RIR A;  1WPY A;  2PU9 B;  5GMK i;  5LJ3 g;  4ZTJ A;  4PLI A;  4KDL A;  1WJS A;  1YJ9 T;  5LJ5 e;  2MWO A;  3QYG B;  1I4K 1;  4ZN1 A;  2YRV A;  2RHU A;  1JB0 E;  2K5I A;  1VQ6 T;  2DAQ A;  3HPW A;  2E41 A;  1KHC A;  2NLU A;  3I55 A;  3CPW A;  3TU4 K;  1VQ5 A;  5FRO A;  3VUZ A;  4M75 F;  3OW2 A;  4C8Q D;  4LDY A;  4NS5 A;  1U1T A;  1Q82 C;  2QA4 A;  1CR5 A;  2CS7 A;  3ZJU A;  3TRE A;  5CQY A;  2DPP B;  5CR2 A;  2XDB A;  4M7A G;  1QVG S;  5D6X A;  3PFS A;  1WJQ A;  3A5Z B;  4A4F A;  3FPR A;  3SWN B;  4FM4 B;  4C92 D;  1VQ9 A;  1Q82 U;  3EAE A;  4OB1 B;  5GAM j;  1X75 C;  4CI0 C;  5HK0 A;  1MHN A;  2EJG A;  1M9S A;  2RH2 A;  5FU6 C;  3LLR A;  5GAN d;  5HKC A;  2LCC A;  2Y4Y A;  1KHI A;  3ZGZ A;  3CMA A;  3VJP A;  4OF1 A;  4HT8 A;  2CZ7 B;  3I55 T;  1FX7 A;  4M7A B;  4EMH A;  2DD4 A;  4N4G A;  4BAC A;  3JB9 D;  1G3Y A;  4F7U E;  2Q1C X;  2ZPI B;  3JSC A;  2KAF A;  4XTY A;  1O9S A;  2DTO A;  2E12 A;  3CCQ A;  2DTH A;  2QA4 T;  3TCJ A;  4VUB A;  4BB7 A;  5CCA A;  4N4I A;  5A2Q E;  4IUV A;  5KE3 A;  4BUG A;  3S3M A;  2K5F A;  2Y4X A;  4XU2 A;  3EFS A;  4WF2 A;  4HT9 A;  1M8V A;  2F5K A;  4KLN A;  4O6J A;  4KUI A;  3MP8 A;  3QJY A;  1FWZ A;  4P5N A;  3HU3 A;  3JCM g;  2ZPG B;  1W2B S;  5KCO A;  2JVV A;  5GAO q;  2CGH A;  1HK9 A;  4JRQ A;  3VYG A;  3CMA T;  4JRK A;  1B34 B;  2DTI A;  5LJ3 f;  2L8D A;  3QSU A;  3OS1 A;  5FTM A;  1N6A A;  1QVF S;  1EIF A;  4M7D A;  4E7K A;  1UB4 A;  5GAN e;  1S72 A;  2F5T X;  1I5L A;  4A54 A;  1QDN A;  4M75 D;  4QQD A;  3OYL A;  4QW2 A;  2P4T A;  2VV5 A;  3EFR A;  3CCQ T;  4MML A;  1JJ2 A;  4DA4 A;  4O5V A;  4MZM A;  2DK3 A;  3DB3 A;  3GF5 A;  2PUO B;  3KUF A;  4IUQ A;  4PJO G;  4QVD A;  3C94 A;  1O75 A;  4C8Q A;  5GAM h;  2Q1A X;  4IUR A;  3S3N A;  1HXD A;  3QII A;  5GAO n;  1NE8 A;  2P0Q A;  1M1K C;  4LDU A;  2X4Y A;  2FYK A;  4C5G A;  4NL2 A;  1Y71 A;  3MET A;  5GMK e;  4M7A F;  4C92 A;  5C18 A;  2K57 A;  4M77 E;  3M4G A;  4EMK A;  3HRT A;  1YIT A;  5HY6 A;  3J7A F;  1U1S A;  3LX7 A;  2E70 A;  2O4X A;  2VGN A;  3JCM W;  1M1K U;  1S72 T;  1VUB A;  4MZT A;  4ELZ C;  2ZPB B;  1N8R C;  1UGS B;  2C06 A;  3CCR A;  1Q86 U;  4PJO B;  4KDI A;  1PSF A;  4M77 C;  2D9T A;  3CCV A;  3FRN A;  2Y90 A;  4HKE A;  3QWZ A;  2DIG A;  2KQW A;  1WQ7 A;  2KY9 A;  1N8R U;  3HFN A;  3C95 A;  4L5G A;  4OB2 B;  1M1G A;  5CKH A;  3T9N A;  3X26 B;  5LJ5 j;  5AYF A;  3MEW A;  1ZHI A;  3OQ5 A;  3OYI A;  2Q18 X;  4FL6 A;  3L2V A;  3OYH A;  2HAX A;  2KMT A;  3GLX A;  4D6W A;  4NOY A;  2EQJ A;  2YHT A;  3JCM J;  3TIW A;  3X25 B;  4E7H A;  2V8K A;  3CPF A;  3JCM f;  4M77 F;  5CK9 A;  1YIT T;  3GPL A;  3E9G A;  2DIQ A;  5DYI A;  2M1H A;  3RES A;  1V29 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...