5D6YA

Crystal structure of double tudor domain of human lysine demethylase kdm4a complexed with histone h3k23me3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
SITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
total genus 20
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6yA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6yA02
5D6XA 5FROA 3L42A 4X34A 2EQUA 3L2RA 3OYAA 2LVMA 2BUDA 3LH0A 5KH6A 3NTIA 3MEAA 2RO0A 3LYIA 4RG2A 3ASKA 2EKOA 4Z02A 3PNWC 4EDUA 3L2UA 3OY9A 2F5KA 3S3NA 4BE0A 3FDRA 1WJRA 5D6WA 2EQMA 2M1HA 5KCOA 3L2QA 3E9FA 4BACA 4E7HA 2RJDA 3META 2R5AA 2RJEA 2O4XB 2P0KA 3DLMA 4PL6A 4BE1A 1N27A 2QQSA 3MP1A 4N4IA 3QIIA 1OZ3A 1OZ2A 5C0MA 5D6YA 3FLGA 2BKDN 3NTHA 3QBYA 4IUVA 1WJSA 4ZTFA 3S3MA 4IUPA 4BDZA 4CRIA 3OS0A 2LDMA 2RI2A 4OVAA 1OI1A 2PQWA 3OYMA 2EQKA 3OMGA 3ME9A 2RHZA 3SD4A 3OS2A 2D9TA 4A4HA 3L2WA 4L59A 2GF7A 4IUTA 4QQGA 4C5IA 2NLUA 2RHYA 1XNIA 4NS5A 4A4FA 2G3RA 2LCCA 2MWPA 3DB4A 3MEVA 3LGLA 3OYGA 3H8ZA 2HQEA 3H6ZA 4II1A 3CEYA 3LX7A 3UWNA 4C5HA 2B8AA 2DIGA 3OQ5A 4C5EA 1MHNA 2X4XA 3PMTA 3QKJA 4IUUA 4E7LA 4BE2A 3P8HA 2JZ2A 1OYXA 3M9QA 2VYTA 3PFSA 3OS1A 2RHIA 3O8VA 5M9OA 3OYNA 3OA6A 1H3ZA 2EFIA 3LGFA 3OB9A 2XDPA 2M16A 2R58A 3ZEHA 3P8DA 4FL6A 2L3RA 4GY5A 4PLIA 4BDYA 3OYBA 1WJQA 5J39A 3LLRA 4QQ6A 4IUQA 5CIUA 3F70A 3GOXA 5FRMA 4E7KA 2BIVA 2LTOA 2MWOA 3DB3A 5IN1A 2E5QA 2X4WA 2X35A 4QQDA 2RJFA 5KCHA 3OYHA 4IKFA 2K3YA 1WGSA 2RI3A 4HCZA 3Q1JA 3L2VA 4A4EA 3BDLA 4IURA 3OYCA 4E7IA 5KE3A 1KHCA 2DIQA 3OYLA 2L89A 5C6SA 3OYIA 3OYFA 4FU6A 2R57A 4LD6A 5J26A 1G5VA 4E7JA 2DAQA 2FHDA 5FRNA 3MP6A 3MP8A 4A4GA 3S3OA 3OYKA 4Q5WA 2E6NA 2EQJA 2JTFA 2LRQA 3NTKA 2RJCA 4C5GA 3OYJA 2GFUA 4PLLA 5IAYA 3C4SA 2M0OA 2RHXA 2X4YA 3KUFA 2O4XA 3MEWA 3QJ6A 2HQXA 4N4GA 3MEUA 4UC4A 3FC3A 3E9GA 1SSFA 2IG0A 4QW2A 2R5MA 5KE2A 1RI0A 4QVZA 4BD3A 3EAEA 3OYDA 2YRVA 4B9WA 3OYEA 4N4HA 4B9XA 2GFAA 3OMCA 2XK0A 2L8DA 3S6WA 2QQRA 4ZTJA 2K3XA 2RI5A 3MO8A 3UT1A 3PMIA 2RHUA 2WACA 2CKKA 3FEOA
chains in the Genus database with same CATH superfamily
3PIOA 2YHTA 5D6XA 2XMFA 3CCVT 2H3JA 1Z9QA 3JCMc 5EG2A 4JPBW 4HXJA 2DVJA 3M58A 3ASKA 2VXFA 1UJ0A 2EQMA 1NEBA 2XHCA 2DTHA 4D6WA 2EJ9A 2NYSA 1Q86C 3H0IA 4J6XA 1OZ2A 3VUZA 2HBWA 3INZA 1K8AR 1MV3A 4ZTFA 5LJ5d 3CBMA 3PGGA 1JEGA 2DL8A 3RNJA 1UGQB 4FW1A 1X6GA 2ECZA 4J8OA 1VQMQ 3H41A 1N5ZA 2RB6A 5LJ3d 1R8OB 2A0FB 1QCNA 2A28A 3GBQA 1HJDA 4CC2A 1VQNQ 5FTMA 3E19A 2XI9A 4MDWA 1VQLA 2GCXA 4WF2A 3M55A 4OMFB 2DRKA 2QA4Q 1JXMA 2E41A 4E7KA 3ZFJA 4KH0B 4PJLA 1JO8A 1WX6A 3CXCS 4D8DA 4FCYA 4DEYA 4M7AF 5FW9A 1NG2A 2VASA 3BDLA 4E7IA 1OX9A 4M75F 3ZGZA 1PCXA 4FYWB 1UB4A 3LHDA 3HFNA 2GQVA 4HKEA 2OAWA 2M0OA 1V76A 1VQ9T 3OYYA 2L3PA 4X9DA 2YRVA 2P0QA 4HCCA 1ZSGA 1QP3A 2F69A 1AWWA 2PJHB 4QT7A 4JZ4A 4FT2A 2FL7A 1PNJA 2F2WA 5DY9A 3G71Q 1JJ2P 5KH6A 3E1SA 4J6WA 4M78C 4RG2A 3CXCA 2P4TA 4GLMA 3UF4A 1E32A 3G4ST 1WHHA 3A8OB 4PJOA 2PVDB 3FDRA 3E2UA 2MAMA 1YJWQ 4B6MA 1YWOA 4DA4A 3OYAA 4VUBA 3CCUT 1OPLA 4N0AC 2RN8A 2EPDA 4EMGA 1VQOA 1N8RC 3ULRB 2XICA 3J81E 4C8QC 2PQWA 1VQ7A 2EQKA 5CVIA 2RHZA 3SEMA 2AKLA 5IXBA 5I11A 2DERA 1S72A 2QDYB 2HQEA 3LW5E 2XU8A 3CD6Q 2V1QA 3OQ5A 3M0QA 4IUUA 1NZ9A 1NLPC 2X9HA 3M0TA 3JSCA 3PFSA 3G71A 1MNDA 3OYNA 4ZN3A 2PUOB 4X9CA 3CCMQ 4BDYA 5GMKm 4M77B 2FPDA 1Q86R 3X25B 1C0MA 4JRKA 5KYNA 3R6OA 2DL5A 1Q82R 1OPKA 1SEMA 1QVFA 5C1BA 1OQKA 3OYFA 5I2SA 1O9SA 4M75E 4Z8AA 2OTLT 2V1RA 3OBWA 2FRWA 2JM8A 2RJCA 2DETA 2CP5A 2WSFE 2LNVA 4M78F 4HT8A 2CUBA 3RKXA 5KYXA 4ZGDB 4BD3A 3RESA 2ZCFB 1K1ZA 3TQ7P 4FM4B 4N4HA 5LJ3f 5CKDA 5FU6B 5GJVB 1WYXA 2KK4A 4C92B 3CCSA 4BUGA 2HDAA 3WVDB 4AFQC 3VUBA 5FROA 2CP2A 4X34A 3G4SA 3LH0A 1UHFA 2F5KA 1YI2T 1TWBA 4EMKA 4EIKA 1VQOT 4ARIA 2BKDN 2IIMA 2EAYA 3V7SA 4D8KA 2ZZDA 2D0QB 3THKA 1BBZA 2F2VA 5GAOr 4Y92A 1ZUKA 2QYZA 1BK2A 3QXEB 1ARKA 2K79A 3CCST 1GXIE 1PD1A 4C5EA 5GANf 2CGHA 2MM0A 5GAMh 4OMOA 4F16A 3SFMA 1CZ5A 4Y91A 4IIOA 6AT1B 1VQLQ 4DOVA 2AIRB 3OYBA 3VV0A 2WSEE 2CP0A 2B86A 1YJNA 2JW4A 2LC4A 2DILA 1ZC1A 2G6FX 3CC7A 2CP6A 4M7AG 2E3HA 5IN1A 1ZA2B 4BI8B 1N8RU 1RAGB 4JRQA 1M1GA 1BCMA 2JN0A 4EPCA 1WI7A 2RMOA 1QWFA 2R57A 2VXEA 1AD5A 1NLOC 1H3HA 1TSFA 1RI9A 2QG9B 3MB5A 2ZPFB 3JCMe 3CCUA 4UC4A 4RTUA 4M78E 2R5MA 3SDZA 3FPTA 2HL5C 3TSZA 3QZ5B 3VS1A 2P0PA 2QQRA 1RL2A 4KLNA 3CXCP 1YCSB 2E65A 1M5Q1 4PK4A 2EGAA 4CC7A 1WA7A 1ACMB 1R0BG 4HVVA 3QWXX 2VGNA 1MGQA 2OTJQ 4Z02A 3JB9G 1TOVA 2YLCA 1WPYA 1WIEA 2X4JA 4E7HA 2I2LA 1MMDA 3UA7A 1V1CA 3JCMP 3CPWP 3CC2Q 4KGXB 3VRZA 1BI2A 2FYKA 3L1AA 4PNOA 4OMLA 2DFUA 5CKEA 2EYZA 1VQ4T 3OMGA 3V7RA 3CBPA 3OS2A 4IUTA 5CQYA 2X3WD 1NJIU 1GBRA 3M4GA 2G3RA 1RAAB 2DBMA 2DRMA 2RA2A 1G3SA 3CEYA 1CKBA 2DPPB 2ZPBB 2JZ2A 2L3QA 4M7DD 3LGFA 1WXTA 2RQUA 5EQJB 4DQ2A 1JQQA 1G3YA 1UUEA 5CK9A 1K76A 3NGPA 4KGZB 1AWXA 1WHMA 2RJFA 3ER0A 2NUPB 5GAN7 4C92D 2K5IA 1QVPA 2KT1A 2CSQA 2L89A 1JU5C 5GAN6 2EVRA 2BZ8A 3CPWA 4E7JA 3MP6A 2EJGA 3G6EQ 2P84A 2JTFA 3ZJVA 1RADB 5HK0A 2DXTA 1OEBA 1MMNA 1QVGS 3I55A 3AT1B 1C1AA 2YRCA 2FEIA 4AFZC 5GANe 1SKUB 1XQHA 3CCET 2CKKA 4C92C 3FEOA 1K8AC 1KJWA 5IHKA 1QVGA 2FZCB 3L2RA 4LDYA 1Y57A 4NL3A 2BZXA 2VKNA 5FWBA 5CQXA 4JS4A 2RO0A 1K9MC 1WZOA 3A1PA 2JV2A 1OV3A 1ZUUA 2AT1B 4M75A 3X28B 4CC4B 1D1CA 1WHKA 2HSEB 4J9DA 4XTUA 1N9SA 4M75C 2QQSA 1NEGA 4QVCA 1X6OA 3CC4Q 1BIAA 2O88A 2HKNA 3OBYA 1ZBJA 1T0HA 2LX7A 1AWJA 3VS7A 3L2WA 1NJIC 2LCCA 2XD0A 1YNZA 2MWPA 3NPFA 2YUJA 5HCKA 2RQRA 3G6ET 3VS3A 2EQIA 4F04B 2KR3A 4KUDK 4C0DC 4BE2A 1OYXA 2LJ3A 5L8RE 3ZEHA 2F5TX 1HSQA 4XTVA 3CCRA 4GY5A 3LLRA 3REAB 4ELZC 1LCKA 2KYBA 2O9SA 2COZA 2DMOA 1QKXA 1YJ9Q 4QQDA 4M7DA 1VQMA 3GP8A 1I5LA 4HCZA 1SG5A 3QYHB 1KHCA 3J80E 5C6SA 4J9HA 2HEQA 2JS0A 1M3AA 3AHUA 4FU6A 5J26A 3CCRT 3RKYA 5DYGA 2M9UA 1ZSZA 2VWFA 2HSPA 4ESRA 2EQJA 3HHTB 1RAFB 4PLLA 5IAYA 1OOTA 2AK5A 4O5VA 1GCPA 3CCLQ 4XTZA 3HRSA 4MZMA 2IG0A 2NUTA 5CD1A 2CH4A 4QVZA 4NL2A 1QVFS 3M5AA 2L8DA 2KRMA 2DYBA 4M77C 3U23A 2WACA 1FWZA 1HYOA 5A0GA 4M77G 2Y4YA 1G83A 1OULA 1W2BS 3NTIA 3MEAA 4HVWA 1GCQA 2EYXA 5LJ5e 5KYYA 1YIJT 4M7AB 2BTTA 1VYTA 3NHNA 1WJRA 2DKGA 2YUQA 1U1TA 1CZ4A 1VIFA 2VC8A 3VKIA 1ZX6A 3RDVA 3JAME 3OW2S 3NTHA 4IUVA 4RTZA 1VQ8A 5IT9E 3H9NA 4M78G 1VQMT 3OS0A 1U5SA 1CR5A 1YWPA 2DL3A 1PSEA 3UDCA 3G71T 5IXFA 2DNUA 3EG3A 1X69A 4WCIA 2DX1A 2RF0A 4JUVA 1Q81U 1VQ4A 4PJOC 2DZCA 1BI3A 4L5GA 5DM7R 3OYGA 3A8MB 2XDDA 4C92G 3QO3A 2DVEA 2CUDA 1PHTA 5CKHA 3OS1A 2VYTA 2PUKB 3O8VA 2A7YA 4L6V5 1EZZB 4DOWA 4CQNA 1PKTA 3URGA 1K0XA 4P5NA 1VQOQ 3HPWA 1VUBA 1TUCA 1BCOA 4J7FA 1B34A 2MWOA 3I9QA 4JJNK 1RLPC 4FT4A 2HAXA 3PE0A 1WDXA 2LZ6B 3SB2A 3Q1JA 1NE8A 3OW2A 1LPLA 4RTVA 1E6GA 1TS9A 2ED1A 3EHQA 2FG0A 1FX7A 4A4GA 1R7RA 5GAMg 1M9SA 4E7SA 4FYVB 1EX4A 4C92F 1RAIB 2MOXA 2DL7A 2O4XA 4C0ZA 3CD6A 1U1SA 2EYWA 3CCJT 4KO8A 2JJ9A 3RIRA 1K73U 1YITT 3M0UA 2XDBA 2MYSA 3CCMA 1I07A 3VS2A 3G1JA 2CSIA 3V8LA 5GAOp 2Q18X 4LDVA 1M2OA 3PNWC 3L2UA 2F2XA 2ED0A 2YSQA 5GANg 1H92A 4Y28E 1I81A 4BACA 3CCJA 4JS5A 1YHQA 4BY6C 5EPPA 1KQSS 2E3IA 4BE1A 2CREA 2KMTA 2QA4A 3FB9A 1QCSA 1QMCA 4LUEA 4XK8E 4AS1A 3T9NA 1K73R 3EG9A 4IUPA 2L5QA 3SWNB 4N0AA 4HVUA 4PFOA 1YBYA 3CF2A 2D9TA 2E1HA 1K0SA 2RM4A 2I0NA 2LMJA 1BI1A 2MPXC 4DBRA 3TEEA 2L0AA 3OSSC 3LX7A 3UWNA 5GMKj 1KSWA 2AHJB 3VS4A 2W0ZA 2VV5A 1YN8A 3A8HB 2EFIA 4RCCA 3C12A 3CMAQ 2BZYA 5J39A 3MCAB 2J05A 1W4SA 2D6FA 1GL5A 2E5QA 1KQ1A 4ZN1A 2K3YA 2GNCA 3O5ZA 3CCMT 1M4ZA 1K9AA 3I5RA 5GMKh 4M7AD 2PNIA 1G2BA 2V8KA 1ZBXA 2RK1A 1RAEB 4ME7A 4XU0A 5FRNA 4PFPA 1Y96A 3OYKA 1OU8A 4OMMA 3I56T 2PVOB 1WHJA 1PKSA 1KD1R 1BYMA 1NM7A 5I21A 1VQPQ 1TG0A 4HCKA 2AKKA 1B34B 1RI0A 1X6BA 3EAEA 1AOJA 3TREA 2OTLA 2FZGB 3M0SA 2DYIA 3JCMf 2O2OA 1FMWA 3HRTA 3PVQA 5GANh 1Y7XA 2K4YA 3PVLA 3CMEQ 5CCBA 2QAZA 5GAN2 3HTRA 5GAMf 3GIBA 4M7DE 3QQ7A 2LJ1A 2EQUA 2CYZB 2QGGA 4M7AA 2BUDA 2K2VA 3V8KA 3WVEB 4MZPA 2ZPIB 4XTWA 3PT9A 2DZ9A 2M1HA 1WNLA 3QPHA 3EFSA 2PU9B 3DLMA 1YP5A 4J6YA 4LDXA 1SHGA 2JVVA 3HU2A 4N4IA 1GBQA 4PJOE 3FLGA 2QQ9A 2X3XD 4XU3A 1IHVA 4C8QE 3S3MA 3CMAA 2LCSA 2ZPEB 5FU6C 4OVAA 3OYMA 3ME9A 2JNGA 2DEUA 4QQGA 4RTWA 2NLUA 4NS5A 4M4ZA 3JCMh 4C8QD 1Q95G 3LGLA 1QLYA 2KGTA 4M77E 4KH1B 5FTLA 1K9MR 3QDFA 2DIGA 1UDLA 2QQBA 2OTJA 1MHNA 4HCBA 3PMTA 2EGCA 4TVRA 3JCMJ 2NWMA 3P8HA 2O9VA 3SWNC 4PJMA 1M8MA 3EFOA 2R58A 2RNAA 3M56A 2EYQA 1M1FA 4IUQA 4BI4A 5CIUA 3OW2P 5IHIA 3CCSQ 1VQKQ 4ARCA 3DB3A 4J7IA 2KVQG 4KRTA 5A0LA 1YJNT 4IKFA 5HKCA 2HZYA 4EMKC 1VQ7T 2ZGWA 1JRIA 1AVZC 3CCVA 1E7OA 3KBGA 3MP8A 4OB1B 4OGEA 2D0NA 3CBOA 2LRQA 2O01E 1AHJB 4M7DG 1SSFA 2IPOB 3M57A 4QKUA 2GTOA 2ATCB 4PKCC 3OYEA 1ZSZC 1I8FA 5GAMe 4M7DB 5D7UA 3MO8A 4J5YA 1UTIA 5DLQE 1K8AU 1VQ7Q 2LVMA 2M0YA 2ROLA 3H0HA 4EMKB 4EDUA 1VQPT 1Q82U 2AZSA 4E6RA 5D6WA 1VIEA 5GJWB 5KCOA 3D7SB 2RJDA 1IO6A 1OZ3A 5GAOn 4OMNA 5KYWA 4KULA 3CC7Q 3HU1A 3I35A 1KC8R 4C8QF 1D0YA 3G6EA 2RI2A 3WXMB 1R0CB 4KODA 5I2MA 5HY6A 4JJDA 1IXDA 2DA9A 1WFWA 1GRIA 1WLPB 2X51A 3TIWA 3V8JA 5FTNA 3H8ZA 3X20B 2XKOC 3H6ZA 1N6AA 3QWYA 5GAOq 1UGPB 3QKJA 5M9OA 2QEXA 2Z0WA 1NJIR 1EFNA 1VOMA 2QDLA 3RERA 2CZ6B 1PRLC 3CC7T 4QQ6A 5GAOl 2KXCA 2YRDA 3BY7A 5LJ5f 4HT9A 3HU3A 3HL8A 5FWCA 1N8RR 2PZ1A 5GAN4 1BU1A 2M51A 1IB8A 2RQTA 4XU2A 2KNBB 1NPRA 4LD9K 1AWOA 1YHQT 1D1AA 2E6ZA 3JCMV 4A4EA 1YJ9A 5AYFA 4FSSA 4LE9A 3CCQQ 5FU7C 2FPEA 4F17A 5LJ5g 3CMET 2F1LA 2JOYA 3QDRB 2L2PA 2YVLA 3J7AF 3RMSA 3CC4A 3EFOB 4C5GA 1S72T 2GFUA 5LJ5h 4EMHA 7AT1B 3FC3A 3E9GA 1NBEB 2GQIA 3JB9F 2LX9A 2Q19X 4ANJA 2XK0A 4FW2A 2K3XA 2RI5A 2L3SA 4LUDA 4JLIA 3G7ZA 3N5BB 1PG5B 2C06A 1VQ9A 3FIFA 1T3LA 2FVUA 2HMAA 1VQ6A 1M3BA 2LW6A 1O75A 1WHLA 2QTVA 3L2QA 4O6JA 3E9FA 4ZGJB 1U06A 4M78D 3META 1S72Q 2O4XB 1IZ6A 3QIIA 1T3SA 3QBYA 4AQ7A 3JB9I 2HD0A 1M90U 4KBMB 1JJ2S 3PIPA 1VQ8Q 5GAOm 2KXDA 4J9GA 2RPNA 3NMZC 2HNIA 5CCXA 4RCBA 5LJ3e 3MEVA 1QCOA 3RMQA 3CC4T 5C18A 4OMPA 3BW1A 1D3BB 1Q81C 4ELYC 1SPKA 1IHWA 1K9MU 1UHCA 1G8XA 4PJOG 2NUPA 2CS7A 1R77A 3RBBB 1QP2A 4K11A 3X24B 1QKWA 4XTYA 1VA7A 3L2VA 1MNEA 1WLFA 4J9IA 3OYIA 2DBKA 5GAN3 1GFCA 1YITQ 1IGQA 1MUZA 3PTAA 2MI6A 3IQLA 2LJ0A 2DXCA 1GCQC 2EKHA 2ABLA 2MMPA 3CC2A 1U3OA 3RKWA 1LVKA 4M77D 4X1VA 2CDTA 5KE2A 5DLOA 1P92A 2DM1A 2DD4A 2K5FA 1UGVA 5LJ5j 1X43A 3L42A 2LP5A 3CQTA 1SSHA 1UGSB 4PFZA 1X2KA 4M75B 5FTJA 1YITA 2H3EB 3MJXA 1Q81R 1WQWA 2WSCE 4OB3B 1NYFA 4M75G 5KYWB 1RAHB 5I22A 1M3CA 1M90R 3REBB 5D6YA 3ZJTA 2JS2A 2E64A 2E10A 1FMKA 4CRIA 4A63B 1DJ7B 1KQSA 2YDLA 1OI1A 3UATA 1Y0MA 1PD0A 1MMAA 3SD4A 1OX8A 1KG1A 4DBFA 1JJ2A 3M0RA 3KFVA 1YJWA 1IREB 3OS5A 1W70A 3DB4A 1KD1C 9ATCB 1PM3A 4LDWA 3GPLA 2A36A 5GMKe 1ZUYA 1RACB 1KFZA 2DLPA 4KUIA 2DO3A 5FU7B 1I0CA 1UGRB 1UJYA 3GLXA 3JCMg 1VQ8T 5L23A 4LXCA 3LH5A 4J9EA 1WJQA 2K2MA 1X75C 1UECA 5GMKl 1D0XA 5KYXB 2LTOA 2EJFA 3BFMA 4Z88A 1M1KR 4RTYA 1TTHB 5CKFA 2C0TA 4M7DF 2X4WA 1ABQA 5KYUB 1ZSZB 2KYMA 1UFFA 1D3BA 4DBHA 3OSVA 2QA4T 1RLQC 1M2VA 2LQWA 4HA8A 3QZ9B 2KE9A 2Q1DX 1JBMA 1AZGB 5GLFA 2B25A 1I9GA 1Y96B 3R6NA 3EHRA 3MEWA 4R55A 2JMCA 2FB7A 2X4YA 3DLLA 3QJ6A 3LWIA 1V29B 2QK0A 4B9WA 4B9XA 3EG1A 3VS5A 4F7UG 3CPWS 1W1FA 3JCMW 4M7AE 1GFDA 1K73C 3PMIA 3S3OA 5HK3A 2KEAA 3RR6A 1AEYA 3TCJA 1C6VX 5IH2A 3LYIA 4LN2A 2EKOA 2Q1CX 3FJPA 2HBPA 2M02A 1I4K1 3M59A 3UPUA 3SHWA 1H641 3HKSA 4PL6A 3BE3A 2JXBA 4M78B 2BE7D 5FTKA 5C0MA 3EFRA 1VQ6Q 1Q82C 2KBTA 2W10A 2AZVA 5CR2A 4JZ3A 2LDMA 2BE9B 2DE0X 3G4SQ 1LNXA 1TH7A 1ABOA 1F1BB 4BB7A 1ZA1B 4LDUA 3JB9D 2CP3A 3CMEA 1QDNA 2GF7A 4V2SA 2QTXA 3VS0A 4A53A 2GTJA 2OTLQ 4JLGA 1W2BA 4II1A 2DD5A 2DXUA 1WXUA 4E47A 2Y4XA 4E7LA 2D1XA 2IVWA 1B3QA 3M0PA 4RMOA 3OB9A 2M16A 2VUBA 3P8DA 4XAXB 4PLIA 5LJ3g 5ERGB 1MMGA 4DEXA 2BIVA 4J9FA 2EIFA 1S3SA 3FPUA 4FYXB 5A2QE 1BB9A 4AG2C 1FXXA 3QC8A 1G3WA 2RI3A 2KROA 3OYCA 3ZJUA 1SHFA 1AT1B 3QSUA 4JJCA 3M4YA 4A54A 4MMLA 1G5VA 2MCNA 4ZGEB 2KQWA 4E7ZA 4M7AC 4XTXA 3CCVQ 3NTKA 3KXTA 2P4RA 4RUGA 2FZKB 4CI0C 3L2ZA 3C4SA 2RHXA 1VQLT 1M8VA 2HQXA 1YIJA 2SRCA 1YHQQ 4ZNXA 1SRLA 3VRYA 2D8JA 4CC3A 2VGMA 3CCUQ 2DK3A 4KDLA 2ZPHB 3UT1A 4C0FA 1PWTA 2ESWA 1KD1U 4F14A 1Q7YR 5GAMd 3JCMQ 4C92A 2KRSA 3MPUB 2E5KA 3TVTA 4GBQA 2J06A 4JDSA 3CPFA 3I55T 2RJEA 1WJSA 4ATOA 2PVGB 2H8HA 1VYVA 3NFCA 1KHIA 4BDZA 3C0CA 5GAN5 4KGVB 3A8LB 4C5IA 2KY9A 2EWNA 4A4FA 1M90C 5CAIA 4F7UB 3M53A 1VQ5A 1YI2A 2KI7A 1VQ4Q 5IHNA 1JXOA 1YIJQ 1B07A 3VU3C 1YJWT 2E70A 1WXBA 3M9QA 4OB0B 1VQ6T 3QJYA 2XDPA 2XIDA 5GAMj 1KQ2A 2YT6A 4MMKA 3I56Q 1QQJA 4A4KA 2RD1A 3DKMA 3JB9J 1U8RA 5KCHA 2MK5A 2LNHB 1M1KU 3CCJQ 1K4US 3CCLA 1NYGA 4IURA 5KE3A 2JTMA 3CCEA 1X27A 3LGAA 3QWZA 3QG1A 2CH4W 1RABB 2DAQA 1HK9A 2DL4A 1OU9A 2DJQA 2YUNA 3M54A 4Q5WA 3I5SA 2QEXT 3CMAT 2Y90A 2EGEA 1XTDA 1J3TA 5A0DA 1CSKA 1I1JA 4N4GA 2E12A 4RV0A 1YJ9T 2SEMA 2LCLA 3C94A 3OMCA 1VQKA 3HSBA 1UEBA 1VQKT 1X01A 2OAUA 4L59A 4DBQA 3CC2T 3RUXA 4J83A 2DTOA 2COWA 3VYHB 2VB6A 4PJOB 2KAFA 4OB2B 2RK2A 1O54A 3A98A 3CCQA 1M30A 2KT8A 2JM9A 4R0KA 1PC0A 2R5AA 8ATCB 2CZ7B 1N27A 1W6XA 1UG1A 2EYYA 4M75D 2QASA 4FSXA 2K6DA 4F7UE 4A4HA 1FYNA 5KYUA 4GLKA 1XNIA 3X26B 3VYGA 1X2QA 2A37A 2J6FA 3EGDB 5CO7A 1KC8U 2NUZA 2ZPGB 1Y07A 4C5HA 2V26A 2HCKA 2X4XA 1BIBA 1M2VB 2KSSA 4IIMA 4M77F 4MDXA 4M77A 2RH2A 4PJOD 3OA6A 1H3ZA 1VQ9Q 4PJNA 4PJOF 2L3RA 3CD6T 5B6CA 2C0IA 1VQNA 1Q7YU 3QYGB 3GOXA 2PWYA 2K57A 4LNPA 4E2FB 2ENMA 2YWWA 4J9BA 2X35A 2RQVA 2DIQA 3OYLA 3FJ5A 1VYUA 4FIBA 2K5LA 1E6HA 5LL6S 5DYIA 1PSFA 3EH1A 4OGCA 1KC8C 2E6NA 2HKQB 5CCAA 4M7DC 4NOYA 1SF9A 2GBQA 3EGXA 2OTJT 3JCMd 5GMKi 4QW2A 4RTTA 4MZTA 3OYDA 2GFAA 3FPRA 1QW1A 4BY6B 4OP0A 2ZAEA 1YJNQ 4PJJA 4C0GA 2EBPA 1I5OB 3CCRQ 2QXFA 2HL3A 4OMQA 2J6KA 3FRNA 1MV0B 4BE0A 1ZLMA 4BI3A 4ORZA 1TUDA 2JMAA 1YCYA 4C8QA 3MHXA 1BI0A 3TU4K 1T0JA 2YLBA 4OF1A 2V8IA 1Q86U 1LJOA 2A08A 2COYA 3EG9B 3SWNA 2RHYA 2CT3A 2A3LA 1Z9ZA 4AMCA 2D8HA 4F7UF 3VS6A 1VQ5Q 1KIKA 3I55Q 2ROTA 2CZ1B 3GNGA 4KDIA 1KK7A 1TU0B 1EIFA 2C0OA 1D0ZA 3MKDA 1HD3A 1HXDA 4JJBA 1FMVA 4C92E 1QCFA 4J9CA 4C0DB 4JRIA 3F70A 2J7IA 3CCEQ 3EG0A 1Y71A 1QWEA 2JT4A 3EGDA 5CKBA 3QQ8A 4KT0E 4AT1B 2GGRA 1YFNA 4LD6A 1VQ5T 3C95A 1TUGB 2CT4A 3QUIA 3P8BB 2PTKA 2KDSA 3HFOA 3EGUA 2FPFA 5GAN8 5FLXE 5LJ3h 2K9GA 2O31A 3KUFA 2DTIA 4YTLA 1D1BA 1XOVA 3MEUA 2MF2A 1UE9A 2LQ8A 4Z89A 3EH2A 1D09B 3S6WA 1A0NB 4ZTJA 2NUTB 5EC7A 2YXYA 3CCQT 3VJPA 2QEXQ 4XQ3A 3HRUA 2QGFB 2DF6A 3ZL7C 2VVKA 1WHGA 2YUPA 2OI3A 3OY9A 3BQBA 3JB9H 2DXBA 3S3NA 1TXQA 2QI2A 4AFUC 2E4HA 3EGXB 2P0KA 5KYYB 1IRXA 3GF5A 3MP1A 2DEQA 3EG2A 2XG8D 1BKBA 4M78A 1M1KC 4FYYB 3TSWA 3JCMb 2K3BA 1M27C 1XJWB 2QQAA 4RTXA 3JCMX 2MIOA 2CZ0B 1G3TA 3GNFB 5GANj 3BDUA 2KRNA 1WQ7A 2EW3A 1YI2Q 2HQHA 1KQSP 1AZEA 2B8AA 3V7CA 2RQWA 1Q7YC 3ZBDA 1QVGP 1PRMC 2RHIA 2J6OA 4WTOB 2MM2A 3JV3A 2FO0A 2FRYA 4FL6A 4XU1A 4C8QB 4JRPA 1SRMA 5FRMA 1IGUA 8AT1B 2JUFA 2JTEA 4C8QG 2LQNA 3A5ZB 3JRZA 4RG8A 4RKUE 4QVDA 3UA6A 3OYHA 2LQKA 2V8JA 2K7AA 1ZHIA 1RUWA 3HP9A 1WGSA 1CKAA 2LT4A 3LWHA 1NPPA 5ECAA 4F7UA 2DJZA 3CCLT 2Q1AX 2OJ2A 5AT1B 1VQNT 1LOJA 3A8GB 3I56A 2FHDA 1ZQ1A 4AG1C 1N9RA 1QVFP 2CP7A 1JB0E 3OYJA 1B7TA 3H0FA 4AFSC 5GANd 5LJ3j 5J3BA 2LT1A 1VQPA 3QHSA 1W2BP 1H8KA 2OX7A 2YUOA 1S1NA 2RHUA 4R56A
chains in the Genus database with same CATH topology
3PIOA 2YHTA 5D6XA 5GAMd 3CCVT 1QVGA 2H3JA 3JCMQ 3L2RA 4C92A 4LDYA 2LVMA 3JCMc 5EG2A 4NL3A 4JS4A 5CQXA 3M58A 2RO0A 1K9MC 3ASKA 2VXFA 4EMKB 4EDUA 1VQPT 2JV2A 1Q82U 4M75A 5D6WA 1VIEA 2EQMA 4JDSA 3X28B 5KCOA 3QC8A 2XHCA 2DTHA 2RJDA 3CPFA 4D6WA 3I55T 2RJEA 2EJ9A 4XTUA 1N9SA 1Q86C 4J6XA 2QQSA 4M75C 1OZ3A 1OZ2A 5GAOn 3VUZA 4KULA 4QVCA 3HU1A 1X6OA 1WJSA 1BIAA 3INZA 4ATOA 4C8QF 4ZTFA 2PVGB 3OBYA 3G6EA 3NFCA 1KHIA 5LJ5d 4BDZA 2RI2A 3WXMB 4KODA 5GAN5 5I2MA 3CBMA 3PGGA 5HY6A 3A8LB 1UGQB 3L2WA 3TIWA 4C5IA 2KY9A 2EWNA 4J8OA 4A4FA 1NJIC 1M90C 5CAIA 2LCCA 3V8JA 2XD0A 4F7UB 2YUJA 2MWPA 2RB6A 3M53A 5LJ3d 1VQ5A 3H8ZA 5FTNA 1YI2A 3X20B 3G6ET 1R8OB 2XKOC 3H6ZA 1N6AA 5GAOq 1UGPB 4KUDK 3VU3C 3QKJA 4C0DC 1YJWT 4BE2A 2E70A 1OYXA 5FTMA 3E19A 3M9QA 4OB0B 2XI9A 5M9OA 1VQ6T 3QJYA 4MDWA 5L8RE 3ZEHA 2XDPA 2QEXA 1VQLA 2F5TX 4XTVA 2XIDA 5GAMj 3CCRA 2GCXA 4GY5A 4WF2A 1KQ2A 3M55A 4MMKA 3RERA 2CZ6B 3CC7T 3LLRA 4OMFB 4ELZC 4QQ6A 5GAOl 3BY7A 5LJ5f 4HT9A 3HU3A 4A4KA 2E41A 2RD1A 3DKMA 3ZFJA 4E7KA 3HL8A 3JB9J 5GAN4 3CXCS 4QQDA 5KCHA 4XU2A 1U8RA 4M7DA 4M7AF 1VQMA 3GP8A 1I5LA 4HCZA 1NPRA 1M1KU 3CCLA 4LD9K 1YHQT 3JCMV 2E6ZA 3BDLA 4IURA 4A4EA 3QYHB 5KE3A 1KHCA 3J80E 5AYFA 2JTMA 4E7IA 3CCEA 1YJ9A 5C6SA 4M75F 3LGAA 3QWZA 3ZGZA 3QG1A 5FU7C 4FU6A 3AHUA 5J26A 3CMET 5LJ5g 3CCRT 2DAQA 1HK9A 2JOYA 3QDRB 2M9UA 3RKYA 5DYGA 1UB4A 3M54A 2YVLA 4Q5WA 3LHDA 3J7AF 2QEXT 2EQJA 3HFNA 3RMSA 3CMAT 3CC4A 3HHTB 2GQVA 2Y90A 4C5GA 4PJOD 1XTDA 1S72T 2GFUA 4HKEA 4PLLA 5A0DA 5IAYA 4EMHA 5LJ5h 2M0OA 4N4GA 4O5VA 4XTZA 3FC3A 1VQ9T 3HRSA 3E9GA 2IG0A 4MZMA 5CD1A 3OYYA 2E12A 4QVZA 4RV0A 4X9DA 1YJ9T 2LX9A 3JB9F 2YRVA 2P0QA 4HCCA 3C94A 2LCLA 1QP3A 3OMCA 4NL2A 2Q19X 2F69A 1VQKA 3M5AA 1QVFS 3HSBA 2XK0A 2L8DA 1UEBA 2K3XA 2RI5A 4M77C 1X01A 1VQKT 2OAUA 2WACA 4L59A 4JLIA 1FWZA 3CC2T 3G7ZA 3RUXA 4J83A 3N5BB 5A0GA 2PJHB 2DTOA 2C06A 1VQ9A 4FT2A 4M77G 2FL7A 2Y4YA 3FIFA 5DY9A 3VYHB 2FVUA 1W2BS 5KH6A 4PJOB 2KAFA 3E1SA 2RK2A 3MEAA 3NTIA 4J6WA 4OB2B 4M78C 4RG2A 1O54A 3CXCA 2P4TA 5LJ5e 3CCQA 1VQ6A 1YIJT 2LW6A 1E32A 1O75A 3G4ST 4M7AB 3A8OB 4PJOA 2PVDB 3FDRA 1WJRA 3L2QA 2DKGA 4O6JA 3E9FA 4ZGJB 2MAMA 4M78D 3META 2R5AA 2O4XB 5DLQE 1IZ6A 2CZ7B 1N27A 1U1TA 3OYAA 4VUBA 1VIFA 2VC8A 3QIIA 3VKIA 3CCUT 3OW2S 3JAME 1CZ4A 3NTHA 3QBYA 4IUVA 1VQ8A 4N0AC 4AQ7A 3JB9I 5IT9E 4M78G 1VQMT 4EMGA 2HD0A 3OS0A 4KBMB 1VQOA 1N8RC 1M90U 2XICA 3J81E 4C8QC 2PQWA 4M75D 1VQ7A 2EQKA 1JJ2S 3PIPA 1CR5A 5GAOm 4FSXA 2RHZA 5CVIA 1PSEA 4F7UE 3UDCA 4A4HA 3G71T 5CCXA 2HNIA 4GLKA 1XNIA 3X26B 3VYGA 1S72A 4JUVA 2QDYB 4RCBA 3JCMe 5LJ3e 1Q81U 5CO7A 3MEVA 1VQ4A 1KC8U 2DZCA 1BI3A 4L5GA 3RMQA 2HQEA 5DM7R 2ZPGB 3OYGA 3CC4T 1Y07A 3A8MB 5C18A 3LW5E 2XU8A 3BW1A 4C92G 4C5HA 1D3BB 2XDDA 3QO3A 3OQ5A 2X4XA 1BIBA 1NZ9A 2DVEA 2KSSA 4IUUA 4M77F 4MDXA 5CKHA 3JSCA 4M77A 2RH2A 1Q81C 3OS1A 2VYTA 3PFSA 2PUKB 3O8VA 2A7YA 4L6V5 4ZN3A 3OYNA 2PUOB 4X9CA 4DOWA 1H3ZA 4ELYC 4CQNA 4PJOF 2L3RA 3URGA 4BDYA 4P5NA 5GMKm 3CD6T 3HPWA 5B6CA 4M77B 1K9MU 1VUBA 1VQNA 4PJOG 1Q7YU 4J7FA 3QYGB 3GOXA 2CS7A 3X25B 2PWYA 1B34A 2K57A 2MWOA 4JRKA 4JJNK 1K8AC 3R6OA 4FT4A 2X35A 1QP2A 2HAXA 3X24B 4XTYA 3SB2A 3Q1JA 1NE8A 3L2VA 3OW2A 1K8AU 1QVFA 2DIQA 3OYLA 1WLFA 5C1BA 3OYIA 4FIBA 2K5LA 5GAN3 5LL6S 3OYFA 5DYIA 5I2SA 1PSFA 1O9SA 1FX7A 4A4GA 4M75E 3PTAA 2OTLT 4OGCA 1R7RA 2MI6A 5GAMg 1KC8C 3OBWA 1M9SA 2E6NA 2DXCA 5CCAA 4M7DC 4NOYA 2RJCA 4C92F 2MMPA 2WSFE 3CC2A 2LNVA 4M78F 3RKWA 3OA6A 2OTJT 4HT8A 2O4XA 3JCMd 4M77D 5GMKi 4C0ZA 4QW2A 3RKXA 3CD6A 5KE2A 4ZGDB 4BD3A 1U1SA 3RESA 4MZTA 2ZCFB 3OYDA 5DLOA 4FM4B 4N4HA 1P92A 3CCJT 2GFAA 5LJ3f 5FU6B 5CKDA 3FPRA 2KK4A 4KO8A 4C92B 3CCSA 2DD4A 4BUGA 1QW1A 4BY6B 3RIRA 2K5FA 3WVDB 1K73U 4OP0A 1YITT 3VUBA 2XDBA 5LJ5j 4C0GA 3CCMA 5FROA 3L42A 2QXFA 4X34A 3G4SA 4DA4A 1UGSB 3LH0A 4M75B 3V8LA 5FTJA 5GAOp 1YITA 2Q18X 4LDVA 3FRNA 1WQWA 2WSCE 3PNWC 4OB3B 3L2UA 5CCBA 5GANg 2F5KA 1YI2T 4M75G 4BE0A 4PJOC 4Y28E 1I81A 4BI3A 3CCJA 4JS5A 4BACA 1YHQA 4EMKA 4BY6C 1VQOT 4ARIA 5EPPA 1KQSS 4BE1A 2KMTA 5D6YA 3ZJTA 2BKDN 1YCYA 3FB9A 4C8QA 2E64A 2QA4A 3MHXA 2EAYA 2E10A 4XK8E 1BI0A 1QCSA 3T9NA 4AS1A 3TU4K 3V7SA 3SWNB 4IUPA 2L5QA 4CRIA 2YLBA 4OF1A 1DJ7B 4N0AA 1KQSA 2V8IA 2ZZDA 1OI1A 1Q86U 1LJOA 1YBYA 3SD4A 3CF2A 2D9TA 2D0QB 3SWNA 2E1HA 5FTKA 1KG1A 1JJ2A 2RHYA 1YJWA 1IREB 3OS5A 5GAOr 2RM4A 2A3LA 1BI1A 3DB4A 1KD1C 4F7UF 3TEEA 3QXEB 4LDWA 3GPLA 3OSSC 3CCST 3LX7A 3UWNA 1GXIE 5GMKj 5GMKe 4C5EA 5GANf 2CZ1B 2AHJB 2CGHA 3GNGA 2MM0A 4KDIA 4KUIA 2DO3A 5GAMh 5FU7B 2VV5A 3SFMA 1EIFA 3A8HB 1CZ5A 1UGRB 2EFIA 4RCCA 4Y91A 3GLXA 3JCMg 1VQ8T 3C12A 4DOVA 1HXDA 3OYBA 1WJQA 3VV0A 3MCAB 2WSEE 5J39A 1YJNA 1W4SA 4C92E 1X75C 2LC4A 4C0DB 2D6FA 1ZC1A 4JRIA 3F70A 5GMKl 3CC7A 2LTOA 2EJFA 3BFMA 4M7AG 5IN1A 5CKFA 4M7DF 2E5QA 1Y71A 4R55A 2X4WA 1KQ1A 4ZN1A 4BI8B 2K3YA 3CCMT 1N8RU 1M4ZA 5GMKh 4JRQA 1M1GA 4M7AD 2JN0A 5CKBA 4KT0E 2V8KA 4EPCA 3QQ8A 1ZBXA 2RK1A 1D3BA 2R57A 4LD6A 1VQ5T 2VXEA 3OSVA 4ME7A 4XU0A 5FRNA 3C95A 2QA4T 1Y96A 3QUIA 3P8BB 3OYKA 4HA8A 3QZ9B 3I56T 2PVOB 2KDSA 2Q1DX 1JBMA 3HFOA 3MB5A 5GLFA 5GAN8 2ZPFB 1I9GA 1Y96B 5FLXE 5LJ3h 1BYMA 2B25A 3KUFA 3MEWA 2X4YA 2FB7A 5I21A 2DTIA 3QJ6A 1XOVA 4UC4A 4YTLA 3MEUA 3DLLA 3CCUA 2MF2A 3LWIA 4M78E 2R5MA 3SDZA 1V29B 1B34B 1RI0A 3FPTA 3EAEA 4B9WA 2LQ8A 3TREA 2OTLA 3QZ5B 4B9XA 2P0PA 4F7UG 3S6WA 3JCMf 2QQRA 3CPWS 3JCMW 4ZTJA 3HRTA 4M7AE 5GANh 1Y7XA 1RL2A 2K4YA 3PMIA 1K73C 3S3OA 4KLNA 3CCQT 5HK3A 5GAN2 4IKFA 5GAMf 2E65A 1M5Q1 3GIBA 4M7DE 3QQ7A 3VJPA 2EQUA 2CYZB 4M7AA 2BUDA 2K2VA 3HRUA 4XQ3A 3TCJA 3V8KA 3LYIA 2VGNA 1MGQA 3WVEB 2EKOA 2Q1CX 4MZPA 2ZPIB 4Z02A 3JB9G 3FJPA 3BQBA 2HBPA 3OY9A 4XTWA 3PT9A 3JB9H 2YLCA 1WPYA 2DZ9A 2DXBA 3S3NA 1I4K1 2QI2A 3M59A 2X4JA 2M1HA 1WNLA 3UPUA 4E7HA 2I2LA 3QPHA 3EFSA 2PU9B 1H641 3DLMA 2P0KA 3HKSA 4J6YA 4PL6A 4M78B 4LDXA 3JCMP 2JVVA 3GF5A 3MP1A 4N4IA 3EFRA 5C0MA 2DEQA 4PJOE 3HU2A 3FLGA 2QQ9A 1Q82C 2XG8D 1BKBA 4XU3A 4C8QE 5CR2A 3S3MA 1BI2A 2FYKA 3L1AA 2LDMA 4M78A 4PNOA 3CMAA 1M1KC 2ZPEB 5FU6C 3JCMb 4OVAA 5CKEA 3OYMA 1LNXA 1VQ4T 1TH7A 3OMGA 3V7RA 3CBPA 3ME9A 4BB7A 2QQAA 2JNGA 4LDUA 3OS2A 3JB9D 3CMEA 3JCMX 2GF7A 4V2SA 1QDNA 4IUTA 2QTXA 4QQGA 2CZ0B 2NLUA 1G3TA 4NS5A 5CQYA 1NJIU 3GNFB 3M4GA 2G3RA 3JCMh 4C8QD 5GANj 4A53A 3LGLA 3BDUA 4M77E 4JLGA 5FTLA 1W2BA 1WQ7A 2RA2A 1G3SA 3CEYA 2DD5A 4II1A 2DXUA 2B8AA 4E47A 3V7CA 2DIGA 2OTJA 2QQBA 2Y4XA 1MHNA 4E7LA 2DPPB 3PMTA 4HCBA 4TVRA 2ZPBB 3JCMJ 1Q7YC 3ZBDA 2IVWA 2JZ2A 3P8HA 4M7DD 2RHIA 2MM2A 3SWNC 4RMOA 3LGFA 3OB9A 2M16A 2R58A 2VUBA 3P8DA 4FL6A 4XU1A 4XAXB 4DQ2A 5EQJB 4C8QB 4PLIA 1G3YA 3M56A 5LJ3g 5ERGB 2EYQA 4JRPA 1M1FA 4IUQA 4BI4A 5CIUA 5CK9A 5FRMA 2BIVA 2JUFA 2EIFA 1S3SA 4C8QG 3A5ZB 3JRZA 3FPUA 4ARCA 3DB3A 4RG8A 4RKUE 4J7IA 4QVDA 2RJFA 5A2QE 2KVQG 2LQKA 2V8JA 5A0LA 1ZHIA 3OYHA 1YJNT 1FXXA 3ER0A 3HP9A 1WGSA 1G3WA 2LT4A 2RI3A 5HKCA 5GAN7 4EMKC 3LWHA 4C92D 3OYCA 2K5IA 1NPPA 1QVPA 4F7UA 2DJZA 1VQ7T 2ZGWA 3CCLT 2Q1AX 3ZJUA 1JRIA 2L89A 5GAN6 3QSUA 3M4YA 4A54A 4MMLA 1VQNT 1LOJA 3A8GB 3CCVA 1G5VA 3I56A 3CPWA 4ZGEB 4E7JA 2FHDA 2KQWA 3KBGA 3MP8A 3MP6A 1ZQ1A 2EJGA 4M7AC 1N9RA 4OB1B 4XTXA 4OGEA 2JTFA 3CBOA 2LRQA 3NTKA 3KXTA 3ZJVA 5HK0A 1JB0E 2DXTA 2O01E 3OYJA 4CI0C 1AHJB 3L2ZA 3C4SA 2RHXA 1VQLT 1M8VA 2HQXA 1QVGS 4M7DG 1YIJA 5GANd 5LJ3j 1SSFA 3M57A 3I55A 5J3BA 2LT1A 4PKCC 3OYEA 2VGMA 1I8FA 5GAMe 1VQPA 2DK3A 3QHSA 4M7DB 4KDLA 5GANe 2ZPHB 3MO8A 4J5YA 3UT1A 1XQHA 4C0FA 3CCET 2RHUA 3G71A 2CKKA 1KD1U 4C92C 3FEOA 4R56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D6X A;  5FRO A;  3L42 A;  4X34 A;  2EQU A;  3L2R A;  3OYA A;  2LVM A;  2BUD A;  3LH0 A;  5KH6 A;  3NTI A;  3MEA A;  2RO0 A;  3LYI A;  4RG2 A;  3ASK A;  2EKO A;  4Z02 A;  3PNW C;  4EDU A;  3L2U A;  3OY9 A;  2F5K A;  3S3N A;  4BE0 A;  3FDR A;  1WJR A;  5D6W A;  2EQM A;  2M1H A;  5KCO A;  3L2Q A;  3E9F A;  4BAC A;  4E7H A;  2RJD A;  3MET A;  2R5A A;  2RJE A;  2O4X B;  2P0K A;  3DLM A;  4PL6 A;  4BE1 A;  1N27 A;  2QQS A;  3MP1 A;  4N4I A;  3QII A;  1OZ3 A;  1OZ2 A;  5C0M A;  5D6Y A;  3FLG A;  2BKD N;  3NTH A;  3QBY A;  4IUV A;  1WJS A;  4ZTF A;  3S3M A;  4IUP A;  4BDZ A;  4CRI A;  3OS0 A;  2LDM A;  2RI2 A;  4OVA A;  1OI1 A;  2PQW A;  3OYM A;  2EQK A;  3OMG A;  3ME9 A;  2RHZ A;  3SD4 A;  3OS2 A;  2D9T A;  4A4H A;  3L2W A;  4L59 A;  2GF7 A;  4IUT A;  4QQG A;  4C5I A;  2NLU A;  2RHY A;  1XNI A;  4NS5 A;  4A4F A;  2G3R A;  2LCC A;  2MWP A;  3DB4 A;  3MEV A;  3LGL A;  3OYG A;  3H8Z A;  2HQE A;  3H6Z A;  4II1 A;  3CEY A;  3LX7 A;  3UWN A;  4C5H A;  2B8A A;  2DIG A;  3OQ5 A;  4C5E A;  1MHN A;  2X4X A;  3PMT A;  3QKJ A;  4IUU A;  4E7L A;  4BE2 A;  3P8H A;  2JZ2 A;  1OYX A;  3M9Q A;  2VYT A;  3PFS A;  3OS1 A;  2RHI A;  3O8V A;  5M9O A;  3OYN A;  3OA6 A;  1H3Z A;  2EFI A;  3LGF A;  3OB9 A;  2XDP A;  2M16 A;  2R58 A;  3ZEH A;  3P8D A;  4FL6 A;  2L3R A;  4GY5 A;  4PLI A;  4BDY A;  3OYB A;  1WJQ A;  5J39 A;  3LLR A;  4QQ6 A;  4IUQ A;  5CIU A;  3F70 A;  3GOX A;  5FRM A;  4E7K A;  2BIV A;  2LTO A;  2MWO A;  3DB3 A;  5IN1 A;  2E5Q A;  2X4W A;  2X35 A;  4QQD A;  2RJF A;  5KCH A;  3OYH A;  4IKF A;  2K3Y A;  1WGS A;  2RI3 A;  4HCZ A;  3Q1J A;  3L2V A;  4A4E A;  3BDL A;  4IUR A;  3OYC A;  4E7I A;  5KE3 A;  1KHC A;  2DIQ A;  3OYL A;  2L89 A;  5C6S A;  3OYI A;  3OYF A;  4FU6 A;  2R57 A;  4LD6 A;  5J26 A;  1G5V A;  4E7J A;  2DAQ A;  2FHD A;  5FRN A;  3MP6 A;  3MP8 A;  4A4G A;  3S3O A;  3OYK A;  4Q5W A;  2E6N A;  2EQJ A;  2JTF A;  2LRQ A;  3NTK A;  2RJC A;  4C5G A;  3OYJ A;  2GFU A;  4PLL A;  5IAY A;  3C4S A;  2M0O A;  2RHX A;  2X4Y A;  3KUF A;  2O4X A;  3MEW A;  3QJ6 A;  2HQX A;  4N4G A;  3MEU A;  4UC4 A;  3FC3 A;  3E9G A;  1SSF A;  2IG0 A;  4QW2 A;  2R5M A;  5KE2 A;  1RI0 A;  4QVZ A;  4BD3 A;  3EAE A;  3OYD A;  2YRV A;  4B9W A;  3OYE A;  4N4H A;  4B9X A;  2GFA A;  3OMC A;  2XK0 A;  2L8D A;  3S6W A;  2QQR A;  4ZTJ A;  2K3X A;  2RI5 A;  3MO8 A;  3UT1 A;  3PMI A;  2RHU A;  2WAC A;  2CKK A;  3FEO A; 
#chains in the Genus database with same CATH topology
 3PIO A;  2YHT A;  5D6X A;  2XMF A;  3CCV T;  2H3J A;  1Z9Q A;  3JCM c;  5EG2 A;  4JPB W;  4HXJ A;  2DVJ A;  3M58 A;  3ASK A;  2VXF A;  1UJ0 A;  2EQM A;  1NEB A;  2XHC A;  2DTH A;  4D6W A;  2EJ9 A;  2NYS A;  1Q86 C;  3H0I A;  4J6X A;  1OZ2 A;  3VUZ A;  2HBW A;  3INZ A;  1K8A R;  1MV3 A;  4ZTF A;  5LJ5 d;  3CBM A;  3PGG A;  1JEG A;  2DL8 A;  3RNJ A;  1UGQ B;  4FW1 A;  1X6G A;  2ECZ A;  4J8O A;  1VQM Q;  3H41 A;  1N5Z A;  2RB6 A;  5LJ3 d;  1R8O B;  2A0F B;  1QCN A;  2A28 A;  3GBQ A;  1HJD A;  4CC2 A;  1VQN Q;  5FTM A;  3E19 A;  2XI9 A;  4MDW A;  1VQL A;  2GCX A;  4WF2 A;  3M55 A;  4OMF B;  2DRK A;  2QA4 Q;  1JXM A;  2E41 A;  4E7K A;  3ZFJ A;  4KH0 B;  4PJL A;  1JO8 A;  1WX6 A;  3CXC S;  4D8D A;  4FCY A;  4DEY A;  4M7A F;  5FW9 A;  1NG2 A;  2VAS A;  3BDL A;  4E7I A;  1OX9 A;  4M75 F;  3ZGZ A;  1PCX A;  4FYW B;  1UB4 A;  3LHD A;  3HFN A;  2GQV A;  4HKE A;  2OAW A;  2M0O A;  1V76 A;  1VQ9 T;  3OYY A;  2L3P A;  4X9D A;  2YRV A;  2P0Q A;  4HCC A;  1ZSG A;  1QP3 A;  2F69 A;  1AWW A;  2PJH B;  4QT7 A;  4JZ4 A;  4FT2 A;  2FL7 A;  1PNJ A;  2F2W A;  5DY9 A;  3G71 Q;  1JJ2 P;  5KH6 A;  3E1S A;  4J6W A;  4M78 C;  4RG2 A;  3CXC A;  2P4T A;  4GLM A;  3UF4 A;  1E32 A;  3G4S T;  1WHH A;  3A8O B;  4PJO A;  2PVD B;  3FDR A;  3E2U A;  2MAM A;  1YJW Q;  4B6M A;  1YWO A;  4DA4 A;  3OYA A;  4VUB A;  3CCU T;  1OPL A;  4N0A C;  2RN8 A;  2EPD A;  4EMG A;  1VQO A;  1N8R C;  3ULR B;  2XIC A;  3J81 E;  4C8Q C;  2PQW A;  1VQ7 A;  2EQK A;  5CVI A;  2RHZ A;  3SEM A;  2AKL A;  5IXB A;  5I11 A;  2DER A;  1S72 A;  2QDY B;  2HQE A;  3LW5 E;  2XU8 A;  3CD6 Q;  2V1Q A;  3OQ5 A;  3M0Q A;  4IUU A;  1NZ9 A;  1NLP C;  2X9H A;  3M0T A;  3JSC A;  3PFS A;  3G71 A;  1MND A;  3OYN A;  4ZN3 A;  2PUO B;  4X9C A;  3CCM Q;  4BDY A;  5GMK m;  4M77 B;  2FPD A;  1Q86 R;  3X25 B;  1C0M A;  4JRK A;  5KYN A;  3R6O A;  2DL5 A;  1Q82 R;  1OPK A;  1SEM A;  1QVF A;  5C1B A;  1OQK A;  3OYF A;  5I2S A;  1O9S A;  4M75 E;  4Z8A A;  2OTL T;  2V1R A;  3OBW A;  2FRW A;  2JM8 A;  2RJC A;  2DET A;  2CP5 A;  2WSF E;  2LNV A;  4M78 F;  4HT8 A;  2CUB A;  3RKX A;  5KYX A;  4ZGD B;  4BD3 A;  3RES A;  2ZCF B;  1K1Z A;  3TQ7 P;  4FM4 B;  4N4H A;  5LJ3 f;  5CKD A;  5FU6 B;  5GJV B;  1WYX A;  2KK4 A;  4C92 B;  3CCS A;  4BUG A;  2HDA A;  3WVD B;  4AFQ C;  3VUB A;  5FRO A;  2CP2 A;  4X34 A;  3G4S A;  3LH0 A;  1UHF A;  2F5K A;  1YI2 T;  1TWB A;  4EMK A;  4EIK A;  1VQO T;  4ARI A;  2BKD N;  2IIM A;  2EAY A;  3V7S A;  4D8K A;  2ZZD A;  2D0Q B;  3THK A;  1BBZ A;  2F2V A;  5GAO r;  4Y92 A;  1ZUK A;  2QYZ A;  1BK2 A;  3QXE B;  1ARK A;  2K79 A;  3CCS T;  1GXI E;  1PD1 A;  4C5E A;  5GAN f;  2CGH A;  2MM0 A;  5GAM h;  4OMO A;  4F16 A;  3SFM A;  1CZ5 A;  4Y91 A;  4IIO A;  6AT1 B;  1VQL Q;  4DOV A;  2AIR B;  3OYB A;  3VV0 A;  2WSE E;  2CP0 A;  2B86 A;  1YJN A;  2JW4 A;  2LC4 A;  2DIL A;  1ZC1 A;  2G6F X;  3CC7 A;  2CP6 A;  4M7A G;  2E3H A;  5IN1 A;  1ZA2 B;  4BI8 B;  1N8R U;  1RAG B;  4JRQ A;  1M1G A;  1BCM A;  2JN0 A;  4EPC A;  1WI7 A;  2RMO A;  1QWF A;  2R57 A;  2VXE A;  1AD5 A;  1NLO C;  1H3H A;  1TSF A;  1RI9 A;  2QG9 B;  3MB5 A;  2ZPF B;  3JCM e;  3CCU A;  4UC4 A;  4RTU A;  4M78 E;  2R5M A;  3SDZ A;  3FPT A;  2HL5 C;  3TSZ A;  3QZ5 B;  3VS1 A;  2P0P A;  2QQR A;  1RL2 A;  4KLN A;  3CXC P;  1YCS B;  2E65 A;  1M5Q 1;  4PK4 A;  2EGA A;  4CC7 A;  1WA7 A;  1ACM B;  1R0B G;  4HVV A;  3QWX X;  2VGN A;  1MGQ A;  2OTJ Q;  4Z02 A;  3JB9 G;  1TOV A;  2YLC A;  1WPY A;  1WIE A;  2X4J A;  4E7H A;  2I2L A;  1MMD A;  3UA7 A;  1V1C A;  3JCM P;  3CPW P;  3CC2 Q;  4KGX B;  3VRZ A;  1BI2 A;  2FYK A;  3L1A A;  4PNO A;  4OML A;  2DFU A;  5CKE A;  2EYZ A;  1VQ4 T;  3OMG A;  3V7R A;  3CBP A;  3OS2 A;  4IUT A;  5CQY A;  2X3W D;  1NJI U;  1GBR A;  3M4G A;  2G3R A;  1RAA B;  2DBM A;  2DRM A;  2RA2 A;  1G3S A;  3CEY A;  1CKB A;  2DPP B;  2ZPB B;  2JZ2 A;  2L3Q A;  4M7D D;  3LGF A;  1WXT A;  2RQU A;  5EQJ B;  4DQ2 A;  1JQQ A;  1G3Y A;  1UUE A;  5CK9 A;  1K76 A;  3NGP A;  4KGZ B;  1AWX A;  1WHM A;  2RJF A;  3ER0 A;  2NUP B;  5GAN 7;  4C92 D;  2K5I A;  1QVP A;  2KT1 A;  2CSQ A;  2L89 A;  1JU5 C;  5GAN 6;  2EVR A;  2BZ8 A;  3CPW A;  4E7J A;  3MP6 A;  2EJG A;  3G6E Q;  2P84 A;  2JTF A;  3ZJV A;  1RAD B;  5HK0 A;  2DXT A;  1OEB A;  1MMN A;  1QVG S;  3I55 A;  3AT1 B;  1C1A A;  2YRC A;  2FEI A;  4AFZ C;  5GAN e;  1SKU B;  1XQH A;  3CCE T;  2CKK A;  4C92 C;  3FEO A;  1K8A C;  1KJW A;  5IHK A;  1QVG A;  2FZC B;  3L2R A;  4LDY A;  1Y57 A;  4NL3 A;  2BZX A;  2VKN A;  5FWB A;  5CQX A;  4JS4 A;  2RO0 A;  1K9M C;  1WZO A;  3A1P A;  2JV2 A;  1OV3 A;  1ZUU A;  2AT1 B;  4M75 A;  3X28 B;  4CC4 B;  1D1C A;  1WHK A;  2HSE B;  4J9D A;  4XTU A;  1N9S A;  4M75 C;  2QQS A;  1NEG A;  4QVC A;  1X6O A;  3CC4 Q;  1BIA A;  2O88 A;  2HKN A;  3OBY A;  1ZBJ A;  1T0H A;  2LX7 A;  1AWJ A;  3VS7 A;  3L2W A;  1NJI C;  2LCC A;  2XD0 A;  1YNZ A;  2MWP A;  3NPF A;  2YUJ A;  5HCK A;  2RQR A;  3G6E T;  3VS3 A;  2EQI A;  4F04 B;  2KR3 A;  4KUD K;  4C0D C;  4BE2 A;  1OYX A;  2LJ3 A;  5L8R E;  3ZEH A;  2F5T X;  1HSQ A;  4XTV A;  3CCR A;  4GY5 A;  3LLR A;  3REA B;  4ELZ C;  1LCK A;  2KYB A;  2O9S A;  2COZ A;  2DMO A;  1QKX A;  1YJ9 Q;  4QQD A;  4M7D A;  1VQM A;  3GP8 A;  1I5L A;  4HCZ A;  1SG5 A;  3QYH B;  1KHC A;  3J80 E;  5C6S A;  4J9H A;  2HEQ A;  2JS0 A;  1M3A A;  3AHU A;  4FU6 A;  5J26 A;  3CCR T;  3RKY A;  5DYG A;  2M9U A;  1ZSZ A;  2VWF A;  2HSP A;  4ESR A;  2EQJ A;  3HHT B;  1RAF B;  4PLL A;  5IAY A;  1OOT A;  2AK5 A;  4O5V A;  1GCP A;  3CCL Q;  4XTZ A;  3HRS A;  4MZM A;  2IG0 A;  2NUT A;  5CD1 A;  2CH4 A;  4QVZ A;  4NL2 A;  1QVF S;  3M5A A;  2L8D A;  2KRM A;  2DYB A;  4M77 C;  3U23 A;  2WAC A;  1FWZ A;  1HYO A;  5A0G A;  4M77 G;  2Y4Y A;  1G83 A;  1OUL A;  1W2B S;  3NTI A;  3MEA A;  4HVW A;  1GCQ A;  2EYX A;  5LJ5 e;  5KYY A;  1YIJ T;  4M7A B;  2BTT A;  1VYT A;  3NHN A;  1WJR A;  2DKG A;  2YUQ A;  1U1T A;  1CZ4 A;  1VIF A;  2VC8 A;  3VKI A;  1ZX6 A;  3RDV A;  3JAM E;  3OW2 S;  3NTH A;  4IUV A;  4RTZ A;  1VQ8 A;  5IT9 E;  3H9N A;  4M78 G;  1VQM T;  3OS0 A;  1U5S A;  1CR5 A;  1YWP A;  2DL3 A;  1PSE A;  3UDC A;  3G71 T;  5IXF A;  2DNU A;  3EG3 A;  1X69 A;  4WCI A;  2DX1 A;  2RF0 A;  4JUV A;  1Q81 U;  1VQ4 A;  4PJO C;  2DZC A;  1BI3 A;  4L5G A;  5DM7 R;  3OYG A;  3A8M B;  2XDD A;  4C92 G;  3QO3 A;  2DVE A;  2CUD A;  1PHT A;  5CKH A;  3OS1 A;  2VYT A;  2PUK B;  3O8V A;  2A7Y A;  4L6V 5;  1EZZ B;  4DOW A;  4CQN A;  1PKT A;  3URG A;  1K0X A;  4P5N A;  1VQO Q;  3HPW A;  1VUB A;  1TUC A;  1BCO A;  4J7F A;  1B34 A;  2MWO A;  3I9Q A;  4JJN K;  1RLP C;  4FT4 A;  2HAX A;  3PE0 A;  1WDX A;  2LZ6 B;  3SB2 A;  3Q1J A;  1NE8 A;  3OW2 A;  1LPL A;  4RTV A;  1E6G A;  1TS9 A;  2ED1 A;  3EHQ A;  2FG0 A;  1FX7 A;  4A4G A;  1R7R A;  5GAM g;  1M9S A;  4E7S A;  4FYV B;  1EX4 A;  4C92 F;  1RAI B;  2MOX A;  2DL7 A;  2O4X A;  4C0Z A;  3CD6 A;  1U1S A;  2EYW A;  3CCJ T;  4KO8 A;  2JJ9 A;  3RIR A;  1K73 U;  1YIT T;  3M0U A;  2XDB A;  2MYS A;  3CCM A;  1I07 A;  3VS2 A;  3G1J A;  2CSI A;  3V8L A;  5GAO p;  2Q18 X;  4LDV A;  1M2O A;  3PNW C;  3L2U A;  2F2X A;  2ED0 A;  2YSQ A;  5GAN g;  1H92 A;  4Y28 E;  1I81 A;  4BAC A;  3CCJ A;  4JS5 A;  1YHQ A;  4BY6 C;  5EPP A;  1KQS S;  2E3I A;  4BE1 A;  2CRE A;  2KMT A;  2QA4 A;  3FB9 A;  1QCS A;  1QMC A;  4LUE A;  4XK8 E;  4AS1 A;  3T9N A;  1K73 R;  3EG9 A;  4IUP A;  2L5Q A;  3SWN B;  4N0A A;  4HVU A;  4PFO A;  1YBY A;  3CF2 A;  2D9T A;  2E1H A;  1K0S A;  2RM4 A;  2I0N A;  2LMJ A;  1BI1 A;  2MPX C;  4DBR A;  3TEE A;  2L0A A;  3OSS C;  3LX7 A;  3UWN A;  5GMK j;  1KSW A;  2AHJ B;  3VS4 A;  2W0Z A;  2VV5 A;  1YN8 A;  3A8H B;  2EFI A;  4RCC A;  3C12 A;  3CMA Q;  2BZY A;  5J39 A;  3MCA B;  2J05 A;  1W4S A;  2D6F A;  1GL5 A;  2E5Q A;  1KQ1 A;  4ZN1 A;  2K3Y A;  2GNC A;  3O5Z A;  3CCM T;  1M4Z A;  1K9A A;  3I5R A;  5GMK h;  4M7A D;  2PNI A;  1G2B A;  2V8K A;  1ZBX A;  2RK1 A;  1RAE B;  4ME7 A;  4XU0 A;  5FRN A;  4PFP A;  1Y96 A;  3OYK A;  1OU8 A;  4OMM A;  3I56 T;  2PVO B;  1WHJ A;  1PKS A;  1KD1 R;  1BYM A;  1NM7 A;  5I21 A;  1VQP Q;  1TG0 A;  4HCK A;  2AKK A;  1B34 B;  1RI0 A;  1X6B A;  3EAE A;  1AOJ A;  3TRE A;  2OTL A;  2FZG B;  3M0S A;  2DYI A;  3JCM f;  2O2O A;  1FMW A;  3HRT A;  3PVQ A;  5GAN h;  1Y7X A;  2K4Y A;  3PVL A;  3CME Q;  5CCB A;  2QAZ A;  5GAN 2;  3HTR A;  5GAM f;  3GIB A;  4M7D E;  3QQ7 A;  2LJ1 A;  2EQU A;  2CYZ B;  2QGG A;  4M7A A;  2BUD A;  2K2V A;  3V8K A;  3WVE B;  4MZP A;  2ZPI B;  4XTW A;  3PT9 A;  2DZ9 A;  2M1H A;  1WNL A;  3QPH A;  3EFS A;  2PU9 B;  3DLM A;  1YP5 A;  4J6Y A;  4LDX A;  1SHG A;  2JVV A;  3HU2 A;  4N4I A;  1GBQ A;  4PJO E;  3FLG A;  2QQ9 A;  2X3X D;  4XU3 A;  1IHV A;  4C8Q E;  3S3M A;  3CMA A;  2LCS A;  2ZPE B;  5FU6 C;  4OVA A;  3OYM A;  3ME9 A;  2JNG A;  2DEU A;  4QQG A;  4RTW A;  2NLU A;  4NS5 A;  4M4Z A;  3JCM h;  4C8Q D;  1Q95 G;  3LGL A;  1QLY A;  2KGT A;  4M77 E;  4KH1 B;  5FTL A;  1K9M R;  3QDF A;  2DIG A;  1UDL A;  2QQB A;  2OTJ A;  1MHN A;  4HCB A;  3PMT A;  2EGC A;  4TVR A;  3JCM J;  2NWM A;  3P8H A;  2O9V A;  3SWN C;  4PJM A;  1M8M A;  3EFO A;  2R58 A;  2RNA A;  3M56 A;  2EYQ A;  1M1F A;  4IUQ A;  4BI4 A;  5CIU A;  3OW2 P;  5IHI A;  3CCS Q;  1VQK Q;  4ARC A;  3DB3 A;  4J7I A;  2KVQ G;  4KRT A;  5A0L A;  1YJN T;  4IKF A;  5HKC A;  2HZY A;  4EMK C;  1VQ7 T;  2ZGW A;  1JRI A;  1AVZ C;  3CCV A;  1E7O A;  3KBG A;  3MP8 A;  4OB1 B;  4OGE A;  2D0N A;  3CBO A;  2LRQ A;  2O01 E;  1AHJ B;  4M7D G;  1SSF A;  2IPO B;  3M57 A;  4QKU A;  2GTO A;  2ATC B;  4PKC C;  3OYE A;  1ZSZ C;  1I8F A;  5GAM e;  4M7D B;  5D7U A;  3MO8 A;  4J5Y A;  1UTI A;  5DLQ E;  1K8A U;  1VQ7 Q;  2LVM A;  2M0Y A;  2ROL A;  3H0H A;  4EMK B;  4EDU A;  1VQP T;  1Q82 U;  2AZS A;  4E6R A;  5D6W A;  1VIE A;  5GJW B;  5KCO A;  3D7S B;  2RJD A;  1IO6 A;  1OZ3 A;  5GAO n;  4OMN A;  5KYW A;  4KUL A;  3CC7 Q;  3HU1 A;  3I35 A;  1KC8 R;  4C8Q F;  1D0Y A;  3G6E A;  2RI2 A;  3WXM B;  1R0C B;  4KOD A;  5I2M A;  5HY6 A;  4JJD A;  1IXD A;  2DA9 A;  1WFW A;  1GRI A;  1WLP B;  2X51 A;  3TIW A;  3V8J A;  5FTN A;  3H8Z A;  3X20 B;  2XKO C;  3H6Z A;  1N6A A;  3QWY A;  5GAO q;  1UGP B;  3QKJ A;  5M9O A;  2QEX A;  2Z0W A;  1NJI R;  1EFN A;  1VOM A;  2QDL A;  3RER A;  2CZ6 B;  1PRL C;  3CC7 T;  4QQ6 A;  5GAO l;  2KXC A;  2YRD A;  3BY7 A;  5LJ5 f;  4HT9 A;  3HU3 A;  3HL8 A;  5FWC A;  1N8R R;  2PZ1 A;  5GAN 4;  1BU1 A;  2M51 A;  1IB8 A;  2RQT A;  4XU2 A;  2KNB B;  1NPR A;  4LD9 K;  1AWO A;  1YHQ T;  1D1A A;  2E6Z A;  3JCM V;  4A4E A;  1YJ9 A;  5AYF A;  4FSS A;  4LE9 A;  3CCQ Q;  5FU7 C;  2FPE A;  4F17 A;  5LJ5 g;  3CME T;  2F1L A;  2JOY A;  3QDR B;  2L2P A;  2YVL A;  3J7A F;  3RMS A;  3CC4 A;  3EFO B;  4C5G A;  1S72 T;  2GFU A;  5LJ5 h;  4EMH A;  7AT1 B;  3FC3 A;  3E9G A;  1NBE B;  2GQI A;  3JB9 F;  2LX9 A;  2Q19 X;  4ANJ A;  2XK0 A;  4FW2 A;  2K3X A;  2RI5 A;  2L3S A;  4LUD A;  4JLI A;  3G7Z A;  3N5B B;  1PG5 B;  2C06 A;  1VQ9 A;  3FIF A;  1T3L A;  2FVU A;  2HMA A;  1VQ6 A;  1M3B A;  2LW6 A;  1O75 A;  1WHL A;  2QTV A;  3L2Q A;  4O6J A;  3E9F A;  4ZGJ B;  1U06 A;  4M78 D;  3MET A;  1S72 Q;  2O4X B;  1IZ6 A;  3QII A;  1T3S A;  3QBY A;  4AQ7 A;  3JB9 I;  2HD0 A;  1M90 U;  4KBM B;  1JJ2 S;  3PIP A;  1VQ8 Q;  5GAO m;  2KXD A;  4J9G A;  2RPN A;  3NMZ C;  2HNI A;  5CCX A;  4RCB A;  5LJ3 e;  3MEV A;  1QCO A;  3RMQ A;  3CC4 T;  5C18 A;  4OMP A;  3BW1 A;  1D3B B;  1Q81 C;  4ELY C;  1SPK A;  1IHW A;  1K9M U;  1UHC A;  1G8X A;  4PJO G;  2NUP A;  2CS7 A;  1R77 A;  3RBB B;  1QP2 A;  4K11 A;  3X24 B;  1QKW A;  4XTY A;  1VA7 A;  3L2V A;  1MNE A;  1WLF A;  4J9I A;  3OYI A;  2DBK A;  5GAN 3;  1GFC A;  1YIT Q;  1IGQ A;  1MUZ A;  3PTA A;  2MI6 A;  3IQL A;  2LJ0 A;  2DXC A;  1GCQ C;  2EKH A;  2ABL A;  2MMP A;  3CC2 A;  1U3O A;  3RKW A;  1LVK A;  4M77 D;  4X1V A;  2CDT A;  5KE2 A;  5DLO A;  1P92 A;  2DM1 A;  2DD4 A;  2K5F A;  1UGV A;  5LJ5 j;  1X43 A;  3L42 A;  2LP5 A;  3CQT A;  1SSH A;  1UGS B;  4PFZ A;  1X2K A;  4M75 B;  5FTJ A;  1YIT A;  2H3E B;  3MJX A;  1Q81 R;  1WQW A;  2WSC E;  4OB3 B;  1NYF A;  4M75 G;  5KYW B;  1RAH B;  5I22 A;  1M3C A;  1M90 R;  3REB B;  5D6Y A;  3ZJT A;  2JS2 A;  2E64 A;  2E10 A;  1FMK A;  4CRI A;  4A63 B;  1DJ7 B;  1KQS A;  2YDL A;  1OI1 A;  3UAT A;  1Y0M A;  1PD0 A;  1MMA A;  3SD4 A;  1OX8 A;  1KG1 A;  4DBF A;  1JJ2 A;  3M0R A;  3KFV A;  1YJW A;  1IRE B;  3OS5 A;  1W70 A;  3DB4 A;  1KD1 C;  9ATC B;  1PM3 A;  4LDW A;  3GPL A;  2A36 A;  5GMK e;  1ZUY A;  1RAC B;  1KFZ A;  2DLP A;  4KUI A;  2DO3 A;  5FU7 B;  1I0C A;  1UGR B;  1UJY A;  3GLX A;  3JCM g;  1VQ8 T;  5L23 A;  4LXC A;  3LH5 A;  4J9E A;  1WJQ A;  2K2M A;  1X75 C;  1UEC A;  5GMK l;  1D0X A;  5KYX B;  2LTO A;  2EJF A;  3BFM A;  4Z88 A;  1M1K R;  4RTY A;  1TTH B;  5CKF A;  2C0T A;  4M7D F;  2X4W A;  1ABQ A;  5KYU B;  1ZSZ B;  2KYM A;  1UFF A;  1D3B A;  4DBH A;  3OSV A;  2QA4 T;  1RLQ C;  1M2V A;  2LQW A;  4HA8 A;  3QZ9 B;  2KE9 A;  2Q1D X;  1JBM A;  1AZG B;  5GLF A;  2B25 A;  1I9G A;  1Y96 B;  3R6N A;  3EHR A;  3MEW A;  4R55 A;  2JMC A;  2FB7 A;  2X4Y A;  3DLL A;  3QJ6 A;  3LWI A;  1V29 B;  2QK0 A;  4B9W A;  4B9X A;  3EG1 A;  3VS5 A;  4F7U G;  3CPW S;  1W1F A;  3JCM W;  4M7A E;  1GFD A;  1K73 C;  3PMI A;  3S3O A;  5HK3 A;  2KEA A;  3RR6 A;  1AEY A;  3TCJ A;  1C6V X;  5IH2 A;  3LYI A;  4LN2 A;  2EKO A;  2Q1C X;  3FJP A;  2HBP A;  2M02 A;  1I4K 1;  3M59 A;  3UPU A;  3SHW A;  1H64 1;  3HKS A;  4PL6 A;  3BE3 A;  2JXB A;  4M78 B;  2BE7 D;  5FTK A;  5C0M A;  3EFR A;  1VQ6 Q;  1Q82 C;  2KBT A;  2W10 A;  2AZV A;  5CR2 A;  4JZ3 A;  2LDM A;  2BE9 B;  2DE0 X;  3G4S Q;  1LNX A;  1TH7 A;  1ABO A;  1F1B B;  4BB7 A;  1ZA1 B;  4LDU A;  3JB9 D;  2CP3 A;  3CME A;  1QDN A;  2GF7 A;  4V2S A;  2QTX A;  3VS0 A;  4A53 A;  2GTJ A;  2OTL Q;  4JLG A;  1W2B A;  4II1 A;  2DD5 A;  2DXU A;  1WXU A;  4E47 A;  2Y4X A;  4E7L A;  2D1X A;  2IVW A;  1B3Q A;  3M0P A;  4RMO A;  3OB9 A;  2M16 A;  2VUB A;  3P8D A;  4XAX B;  4PLI A;  5LJ3 g;  5ERG B;  1MMG A;  4DEX A;  2BIV A;  4J9F A;  2EIF A;  1S3S A;  3FPU A;  4FYX B;  5A2Q E;  1BB9 A;  4AG2 C;  1FXX A;  3QC8 A;  1G3W A;  2RI3 A;  2KRO A;  3OYC A;  3ZJU A;  1SHF A;  1AT1 B;  3QSU A;  4JJC A;  3M4Y A;  4A54 A;  4MML A;  1G5V A;  2MCN A;  4ZGE B;  2KQW A;  4E7Z A;  4M7A C;  4XTX A;  3CCV Q;  3NTK A;  3KXT A;  2P4R A;  4RUG A;  2FZK B;  4CI0 C;  3L2Z A;  3C4S A;  2RHX A;  1VQL T;  1M8V A;  2HQX A;  1YIJ A;  2SRC A;  1YHQ Q;  4ZNX A;  1SRL A;  3VRY A;  2D8J A;  4CC3 A;  2VGM A;  3CCU Q;  2DK3 A;  4KDL A;  2ZPH B;  3UT1 A;  4C0F A;  1PWT A;  2ESW A;  1KD1 U;  4F14 A;  1Q7Y R;  5GAM d;  3JCM Q;  4C92 A;  2KRS A;  3MPU B;  2E5K A;  3TVT A;  4GBQ A;  2J06 A;  4JDS A;  3CPF A;  3I55 T;  2RJE A;  1WJS A;  4ATO A;  2PVG B;  2H8H A;  1VYV A;  3NFC A;  1KHI A;  4BDZ A;  3C0C A;  5GAN 5;  4KGV B;  3A8L B;  4C5I A;  2KY9 A;  2EWN A;  4A4F A;  1M90 C;  5CAI A;  4F7U B;  3M53 A;  1VQ5 A;  1YI2 A;  2KI7 A;  1VQ4 Q;  5IHN A;  1JXO A;  1YIJ Q;  1B07 A;  3VU3 C;  1YJW T;  2E70 A;  1WXB A;  3M9Q A;  4OB0 B;  1VQ6 T;  3QJY A;  2XDP A;  2XID A;  5GAM j;  1KQ2 A;  2YT6 A;  4MMK A;  3I56 Q;  1QQJ A;  4A4K A;  2RD1 A;  3DKM A;  3JB9 J;  1U8R A;  5KCH A;  2MK5 A;  2LNH B;  1M1K U;  3CCJ Q;  1K4U S;  3CCL A;  1NYG A;  4IUR A;  5KE3 A;  2JTM A;  3CCE A;  1X27 A;  3LGA A;  3QWZ A;  3QG1 A;  2CH4 W;  1RAB B;  2DAQ A;  1HK9 A;  2DL4 A;  1OU9 A;  2DJQ A;  2YUN A;  3M54 A;  4Q5W A;  3I5S A;  2QEX T;  3CMA T;  2Y90 A;  2EGE A;  1XTD A;  1J3T A;  5A0D A;  1CSK A;  1I1J A;  4N4G A;  2E12 A;  4RV0 A;  1YJ9 T;  2SEM A;  2LCL A;  3C94 A;  3OMC A;  1VQK A;  3HSB A;  1UEB A;  1VQK T;  1X01 A;  2OAU A;  4L59 A;  4DBQ A;  3CC2 T;  3RUX A;  4J83 A;  2DTO A;  2COW A;  3VYH B;  2VB6 A;  4PJO B;  2KAF A;  4OB2 B;  2RK2 A;  1O54 A;  3A98 A;  3CCQ A;  1M30 A;  2KT8 A;  2JM9 A;  4R0K A;  1PC0 A;  2R5A A;  8ATC B;  2CZ7 B;  1N27 A;  1W6X A;  1UG1 A;  2EYY A;  4M75 D;  2QAS A;  4FSX A;  2K6D A;  4F7U E;  4A4H A;  1FYN A;  5KYU A;  4GLK A;  1XNI A;  3X26 B;  3VYG A;  1X2Q A;  2A37 A;  2J6F A;  3EGD B;  5CO7 A;  1KC8 U;  2NUZ A;  2ZPG B;  1Y07 A;  4C5H A;  2V26 A;  2HCK A;  2X4X A;  1BIB A;  1M2V B;  2KSS A;  4IIM A;  4M77 F;  4MDX A;  4M77 A;  2RH2 A;  4PJO D;  3OA6 A;  1H3Z A;  1VQ9 Q;  4PJN A;  4PJO F;  2L3R A;  3CD6 T;  5B6C A;  2C0I A;  1VQN A;  1Q7Y U;  3QYG B;  3GOX A;  2PWY A;  2K57 A;  4LNP A;  4E2F B;  2ENM A;  2YWW A;  4J9B A;  2X35 A;  2RQV A;  2DIQ A;  3OYL A;  3FJ5 A;  1VYU A;  4FIB A;  2K5L A;  1E6H A;  5LL6 S;  5DYI A;  1PSF A;  3EH1 A;  4OGC A;  1KC8 C;  2E6N A;  2HKQ B;  5CCA A;  4M7D C;  4NOY A;  1SF9 A;  2GBQ A;  3EGX A;  2OTJ T;  3JCM d;  5GMK i;  4QW2 A;  4RTT A;  4MZT A;  3OYD A;  2GFA A;  3FPR A;  1QW1 A;  4BY6 B;  4OP0 A;  2ZAE A;  1YJN Q;  4PJJ A;  4C0G A;  2EBP A;  1I5O B;  3CCR Q;  2QXF A;  2HL3 A;  4OMQ A;  2J6K A;  3FRN A;  1MV0 B;  4BE0 A;  1ZLM A;  4BI3 A;  4ORZ A;  1TUD A;  2JMA A;  1YCY A;  4C8Q A;  3MHX A;  1BI0 A;  3TU4 K;  1T0J A;  2YLB A;  4OF1 A;  2V8I A;  1Q86 U;  1LJO A;  2A08 A;  2COY A;  3EG9 B;  3SWN A;  2RHY A;  2CT3 A;  2A3L A;  1Z9Z A;  4AMC A;  2D8H A;  4F7U F;  3VS6 A;  1VQ5 Q;  1KIK A;  3I55 Q;  2ROT A;  2CZ1 B;  3GNG A;  4KDI A;  1KK7 A;  1TU0 B;  1EIF A;  2C0O A;  1D0Z A;  3MKD A;  1HD3 A;  1HXD A;  4JJB A;  1FMV A;  4C92 E;  1QCF A;  4J9C A;  4C0D B;  4JRI A;  3F70 A;  2J7I A;  3CCE Q;  3EG0 A;  1Y71 A;  1QWE A;  2JT4 A;  3EGD A;  5CKB A;  3QQ8 A;  4KT0 E;  4AT1 B;  2GGR A;  1YFN A;  4LD6 A;  1VQ5 T;  3C95 A;  1TUG B;  2CT4 A;  3QUI A;  3P8B B;  2PTK A;  2KDS A;  3HFO A;  3EGU A;  2FPF A;  5GAN 8;  5FLX E;  5LJ3 h;  2K9G A;  2O31 A;  3KUF A;  2DTI A;  4YTL A;  1D1B A;  1XOV A;  3MEU A;  2MF2 A;  1UE9 A;  2LQ8 A;  4Z89 A;  3EH2 A;  1D09 B;  3S6W A;  1A0N B;  4ZTJ A;  2NUT B;  5EC7 A;  2YXY A;  3CCQ T;  3VJP A;  2QEX Q;  4XQ3 A;  3HRU A;  2QGF B;  2DF6 A;  3ZL7 C;  2VVK A;  1WHG A;  2YUP A;  2OI3 A;  3OY9 A;  3BQB A;  3JB9 H;  2DXB A;  3S3N A;  1TXQ A;  2QI2 A;  4AFU C;  2E4H A;  3EGX B;  2P0K A;  5KYY B;  1IRX A;  3GF5 A;  3MP1 A;  2DEQ A;  3EG2 A;  2XG8 D;  1BKB A;  4M78 A;  1M1K C;  4FYY B;  3TSW A;  3JCM b;  2K3B A;  1M27 C;  1XJW B;  2QQA A;  4RTX A;  3JCM X;  2MIO A;  2CZ0 B;  1G3T A;  3GNF B;  5GAN j;  3BDU A;  2KRN A;  1WQ7 A;  2EW3 A;  1YI2 Q;  2HQH A;  1KQS P;  1AZE A;  2B8A A;  3V7C A;  2RQW A;  1Q7Y C;  3ZBD A;  1QVG P;  1PRM C;  2RHI A;  2J6O A;  4WTO B;  2MM2 A;  3JV3 A;  2FO0 A;  2FRY A;  4FL6 A;  4XU1 A;  4C8Q B;  4JRP A;  1SRM A;  5FRM A;  1IGU A;  8AT1 B;  2JUF A;  2JTE A;  4C8Q G;  2LQN A;  3A5Z B;  3JRZ A;  4RG8 A;  4RKU E;  4QVD A;  3UA6 A;  3OYH A;  2LQK A;  2V8J A;  2K7A A;  1ZHI A;  1RUW A;  3HP9 A;  1WGS A;  1CKA A;  2LT4 A;  3LWH A;  1NPP A;  5ECA A;  4F7U A;  2DJZ A;  3CCL T;  2Q1A X;  2OJ2 A;  5AT1 B;  1VQN T;  1LOJ A;  3A8G B;  3I56 A;  2FHD A;  1ZQ1 A;  4AG1 C;  1N9R A;  1QVF P;  2CP7 A;  1JB0 E;  3OYJ A;  1B7T A;  3H0F A;  4AFS C;  5GAN d;  5LJ3 j;  5J3B A;  2LT1 A;  1VQP A;  3QHS A;  1W2B P;  1H8K A;  2OX7 A;  2YUO A;  1S1N A;  2RHU A;  4R56 A; 
#chains in the Genus database with same CATH homology
 3PIO A;  2YHT A;  5D6X A;  5GAM d;  3CCV T;  1QVG A;  2H3J A;  3JCM Q;  3L2R A;  4C92 A;  4LDY A;  2LVM A;  3JCM c;  5EG2 A;  4NL3 A;  4JS4 A;  5CQX A;  3M58 A;  2RO0 A;  1K9M C;  3ASK A;  2VXF A;  4EMK B;  4EDU A;  1VQP T;  2JV2 A;  1Q82 U;  4M75 A;  5D6W A;  1VIE A;  2EQM A;  4JDS A;  3X28 B;  5KCO A;  3QC8 A;  2XHC A;  2DTH A;  2RJD A;  3CPF A;  4D6W A;  3I55 T;  2RJE A;  2EJ9 A;  4XTU A;  1N9S A;  1Q86 C;  4J6X A;  2QQS A;  4M75 C;  1OZ3 A;  1OZ2 A;  5GAO n;  3VUZ A;  4KUL A;  4QVC A;  3HU1 A;  1X6O A;  1WJS A;  1BIA A;  3INZ A;  4ATO A;  4C8Q F;  4ZTF A;  2PVG B;  3OBY A;  3G6E A;  3NFC A;  1KHI A;  5LJ5 d;  4BDZ A;  2RI2 A;  3WXM B;  4KOD A;  5GAN 5;  5I2M A;  3CBM A;  3PGG A;  5HY6 A;  3A8L B;  1UGQ B;  3L2W A;  3TIW A;  4C5I A;  2KY9 A;  2EWN A;  4J8O A;  4A4F A;  1NJI C;  1M90 C;  5CAI A;  2LCC A;  3V8J A;  2XD0 A;  4F7U B;  2YUJ A;  2MWP A;  2RB6 A;  3M53 A;  5LJ3 d;  1VQ5 A;  3H8Z A;  5FTN A;  1YI2 A;  3X20 B;  3G6E T;  1R8O B;  2XKO C;  3H6Z A;  1N6A A;  5GAO q;  1UGP B;  4KUD K;  3VU3 C;  3QKJ A;  4C0D C;  1YJW T;  4BE2 A;  2E70 A;  1OYX A;  5FTM A;  3E19 A;  3M9Q A;  4OB0 B;  2XI9 A;  5M9O A;  1VQ6 T;  3QJY A;  4MDW A;  5L8R E;  3ZEH A;  2XDP A;  2QEX A;  1VQL A;  2F5T X;  4XTV A;  2XID A;  5GAM j;  3CCR A;  2GCX A;  4GY5 A;  4WF2 A;  1KQ2 A;  3M55 A;  4MMK A;  3RER A;  2CZ6 B;  3CC7 T;  3LLR A;  4OMF B;  4ELZ C;  4QQ6 A;  5GAO l;  3BY7 A;  5LJ5 f;  4HT9 A;  3HU3 A;  4A4K A;  2E41 A;  2RD1 A;  3DKM A;  3ZFJ A;  4E7K A;  3HL8 A;  3JB9 J;  5GAN 4;  3CXC S;  4QQD A;  5KCH A;  4XU2 A;  1U8R A;  4M7D A;  4M7A F;  1VQM A;  3GP8 A;  1I5L A;  4HCZ A;  1NPR A;  1M1K U;  3CCL A;  4LD9 K;  1YHQ T;  3JCM V;  2E6Z A;  3BDL A;  4IUR A;  4A4E A;  3QYH B;  5KE3 A;  1KHC A;  3J80 E;  5AYF A;  2JTM A;  4E7I A;  3CCE A;  1YJ9 A;  5C6S A;  4M75 F;  3LGA A;  3QWZ A;  3ZGZ A;  3QG1 A;  5FU7 C;  4FU6 A;  3AHU A;  5J26 A;  3CME T;  5LJ5 g;  3CCR T;  2DAQ A;  1HK9 A;  2JOY A;  3QDR B;  2M9U A;  3RKY A;  5DYG A;  1UB4 A;  3M54 A;  2YVL A;  4Q5W A;  3LHD A;  3J7A F;  2QEX T;  2EQJ A;  3HFN A;  3RMS A;  3CMA T;  3CC4 A;  3HHT B;  2GQV A;  2Y90 A;  4C5G A;  4PJO D;  1XTD A;  1S72 T;  2GFU A;  4HKE A;  4PLL A;  5A0D A;  5IAY A;  4EMH A;  5LJ5 h;  2M0O A;  4N4G A;  4O5V A;  4XTZ A;  3FC3 A;  1VQ9 T;  3HRS A;  3E9G A;  2IG0 A;  4MZM A;  5CD1 A;  3OYY A;  2E12 A;  4QVZ A;  4RV0 A;  4X9D A;  1YJ9 T;  2LX9 A;  3JB9 F;  2YRV A;  2P0Q A;  4HCC A;  3C94 A;  2LCL A;  1QP3 A;  3OMC A;  4NL2 A;  2Q19 X;  2F69 A;  1VQK A;  3M5A A;  1QVF S;  3HSB A;  2XK0 A;  2L8D A;  1UEB A;  2K3X A;  2RI5 A;  4M77 C;  1X01 A;  1VQK T;  2OAU A;  2WAC A;  4L59 A;  4JLI A;  1FWZ A;  3CC2 T;  3G7Z A;  3RUX A;  4J83 A;  3N5B B;  5A0G A;  2PJH B;  2DTO A;  2C06 A;  1VQ9 A;  4FT2 A;  4M77 G;  2FL7 A;  2Y4Y A;  3FIF A;  5DY9 A;  3VYH B;  2FVU A;  1W2B S;  5KH6 A;  4PJO B;  2KAF A;  3E1S A;  2RK2 A;  3MEA A;  3NTI A;  4J6W A;  4OB2 B;  4M78 C;  4RG2 A;  1O54 A;  3CXC A;  2P4T A;  5LJ5 e;  3CCQ A;  1VQ6 A;  1YIJ T;  2LW6 A;  1E32 A;  1O75 A;  3G4S T;  4M7A B;  3A8O B;  4PJO A;  2PVD B;  3FDR A;  1WJR A;  3L2Q A;  2DKG A;  4O6J A;  3E9F A;  4ZGJ B;  2MAM A;  4M78 D;  3MET A;  2R5A A;  2O4X B;  5DLQ E;  1IZ6 A;  2CZ7 B;  1N27 A;  1U1T A;  3OYA A;  4VUB A;  1VIF A;  2VC8 A;  3QII A;  3VKI A;  3CCU T;  3OW2 S;  3JAM E;  1CZ4 A;  3NTH A;  3QBY A;  4IUV A;  1VQ8 A;  4N0A C;  4AQ7 A;  3JB9 I;  5IT9 E;  4M78 G;  1VQM T;  4EMG A;  2HD0 A;  3OS0 A;  4KBM B;  1VQO A;  1N8R C;  1M90 U;  2XIC A;  3J81 E;  4C8Q C;  2PQW A;  4M75 D;  1VQ7 A;  2EQK A;  1JJ2 S;  3PIP A;  1CR5 A;  5GAO m;  4FSX A;  2RHZ A;  5CVI A;  1PSE A;  4F7U E;  3UDC A;  4A4H A;  3G71 T;  5CCX A;  2HNI A;  4GLK A;  1XNI A;  3X26 B;  3VYG A;  1S72 A;  4JUV A;  2QDY B;  4RCB A;  3JCM e;  5LJ3 e;  1Q81 U;  5CO7 A;  3MEV A;  1VQ4 A;  1KC8 U;  2DZC A;  1BI3 A;  4L5G A;  3RMQ A;  2HQE A;  5DM7 R;  2ZPG B;  3OYG A;  3CC4 T;  1Y07 A;  3A8M B;  5C18 A;  3LW5 E;  2XU8 A;  3BW1 A;  4C92 G;  4C5H A;  1D3B B;  2XDD A;  3QO3 A;  3OQ5 A;  2X4X A;  1BIB A;  1NZ9 A;  2DVE A;  2KSS A;  4IUU A;  4M77 F;  4MDX A;  5CKH A;  3JSC A;  4M77 A;  2RH2 A;  1Q81 C;  3OS1 A;  2VYT A;  3PFS A;  2PUK B;  3O8V A;  2A7Y A;  4L6V 5;  4ZN3 A;  3OYN A;  2PUO B;  4X9C A;  4DOW A;  1H3Z A;  4ELY C;  4CQN A;  4PJO F;  2L3R A;  3URG A;  4BDY A;  4P5N A;  5GMK m;  3CD6 T;  3HPW A;  5B6C A;  4M77 B;  1K9M U;  1VUB A;  1VQN A;  4PJO G;  1Q7Y U;  4J7F A;  3QYG B;  3GOX A;  2CS7 A;  3X25 B;  2PWY A;  1B34 A;  2K57 A;  2MWO A;  4JRK A;  4JJN K;  1K8A C;  3R6O A;  4FT4 A;  2X35 A;  1QP2 A;  2HAX A;  3X24 B;  4XTY A;  3SB2 A;  3Q1J A;  1NE8 A;  3L2V A;  3OW2 A;  1K8A U;  1QVF A;  2DIQ A;  3OYL A;  1WLF A;  5C1B A;  3OYI A;  4FIB A;  2K5L A;  5GAN 3;  5LL6 S;  3OYF A;  5DYI A;  5I2S A;  1PSF A;  1O9S A;  1FX7 A;  4A4G A;  4M75 E;  3PTA A;  2OTL T;  4OGC A;  1R7R A;  2MI6 A;  5GAM g;  1KC8 C;  3OBW A;  1M9S A;  2E6N A;  2DXC A;  5CCA A;  4M7D C;  4NOY A;  2RJC A;  4C92 F;  2MMP A;  2WSF E;  3CC2 A;  2LNV A;  4M78 F;  3RKW A;  3OA6 A;  2OTJ T;  4HT8 A;  2O4X A;  3JCM d;  4M77 D;  5GMK i;  4C0Z A;  4QW2 A;  3RKX A;  3CD6 A;  5KE2 A;  4ZGD B;  4BD3 A;  1U1S A;  3RES A;  4MZT A;  2ZCF B;  3OYD A;  5DLO A;  4FM4 B;  4N4H A;  1P92 A;  3CCJ T;  2GFA A;  5LJ3 f;  5FU6 B;  5CKD A;  3FPR A;  2KK4 A;  4KO8 A;  4C92 B;  3CCS A;  2DD4 A;  4BUG A;  1QW1 A;  4BY6 B;  3RIR A;  2K5F A;  3WVD B;  1K73 U;  4OP0 A;  1YIT T;  3VUB A;  2XDB A;  5LJ5 j;  4C0G A;  3CCM A;  5FRO A;  3L42 A;  2QXF A;  4X34 A;  3G4S A;  4DA4 A;  1UGS B;  3LH0 A;  4M75 B;  3V8L A;  5FTJ A;  5GAO p;  1YIT A;  2Q18 X;  4LDV A;  3FRN A;  1WQW A;  2WSC E;  3PNW C;  4OB3 B;  3L2U A;  5CCB A;  5GAN g;  2F5K A;  1YI2 T;  4M75 G;  4BE0 A;  4PJO C;  4Y28 E;  1I81 A;  4BI3 A;  3CCJ A;  4JS5 A;  4BAC A;  1YHQ A;  4EMK A;  4BY6 C;  1VQO T;  4ARI A;  5EPP A;  1KQS S;  4BE1 A;  2KMT A;  5D6Y A;  3ZJT A;  2BKD N;  1YCY A;  3FB9 A;  4C8Q A;  2E64 A;  2QA4 A;  3MHX A;  2EAY A;  2E10 A;  4XK8 E;  1BI0 A;  1QCS A;  3T9N A;  4AS1 A;  3TU4 K;  3V7S A;  3SWN B;  4IUP A;  2L5Q A;  4CRI A;  2YLB A;  4OF1 A;  1DJ7 B;  4N0A A;  1KQS A;  2V8I A;  2ZZD A;  1OI1 A;  1Q86 U;  1LJO A;  1YBY A;  3SD4 A;  3CF2 A;  2D9T A;  2D0Q B;  3SWN A;  2E1H A;  5FTK A;  1KG1 A;  1JJ2 A;  2RHY A;  1YJW A;  1IRE B;  3OS5 A;  5GAO r;  2RM4 A;  2A3L A;  1BI1 A;  3DB4 A;  1KD1 C;  4F7U F;  3TEE A;  3QXE B;  4LDW A;  3GPL A;  3OSS C;  3CCS T;  3LX7 A;  3UWN A;  1GXI E;  5GMK j;  5GMK e;  4C5E A;  5GAN f;  2CZ1 B;  2AHJ B;  2CGH A;  3GNG A;  2MM0 A;  4KDI A;  4KUI A;  2DO3 A;  5GAM h;  5FU7 B;  2VV5 A;  3SFM A;  1EIF A;  3A8H B;  1CZ5 A;  1UGR B;  2EFI A;  4RCC A;  4Y91 A;  3GLX A;  3JCM g;  1VQ8 T;  3C12 A;  4DOV A;  1HXD A;  3OYB A;  1WJQ A;  3VV0 A;  3MCA B;  2WSE E;  5J39 A;  1YJN A;  1W4S A;  4C92 E;  1X75 C;  2LC4 A;  4C0D B;  2D6F A;  1ZC1 A;  4JRI A;  3F70 A;  5GMK l;  3CC7 A;  2LTO A;  2EJF A;  3BFM A;  4M7A G;  5IN1 A;  5CKF A;  4M7D F;  2E5Q A;  1Y71 A;  4R55 A;  2X4W A;  1KQ1 A;  4ZN1 A;  4BI8 B;  2K3Y A;  3CCM T;  1N8R U;  1M4Z A;  5GMK h;  4JRQ A;  1M1G A;  4M7A D;  2JN0 A;  5CKB A;  4KT0 E;  2V8K A;  4EPC A;  3QQ8 A;  1ZBX A;  2RK1 A;  1D3B A;  2R57 A;  4LD6 A;  1VQ5 T;  2VXE A;  3OSV A;  4ME7 A;  4XU0 A;  5FRN A;  3C95 A;  2QA4 T;  1Y96 A;  3QUI A;  3P8B B;  3OYK A;  4HA8 A;  3QZ9 B;  3I56 T;  2PVO B;  2KDS A;  2Q1D X;  1JBM A;  3HFO A;  3MB5 A;  5GLF A;  5GAN 8;  2ZPF B;  1I9G A;  1Y96 B;  5FLX E;  5LJ3 h;  1BYM A;  2B25 A;  3KUF A;  3MEW A;  2X4Y A;  2FB7 A;  5I21 A;  2DTI A;  3QJ6 A;  1XOV A;  4UC4 A;  4YTL A;  3MEU A;  3DLL A;  3CCU A;  2MF2 A;  3LWI A;  4M78 E;  2R5M A;  3SDZ A;  1V29 B;  1B34 B;  1RI0 A;  3FPT A;  3EAE A;  4B9W A;  2LQ8 A;  3TRE A;  2OTL A;  3QZ5 B;  4B9X A;  2P0P A;  4F7U G;  3S6W A;  3JCM f;  2QQR A;  3CPW S;  3JCM W;  4ZTJ A;  3HRT A;  4M7A E;  5GAN h;  1Y7X A;  1RL2 A;  2K4Y A;  3PMI A;  1K73 C;  3S3O A;  4KLN A;  3CCQ T;  5HK3 A;  5GAN 2;  4IKF A;  5GAM f;  2E65 A;  1M5Q 1;  3GIB A;  4M7D E;  3QQ7 A;  3VJP A;  2EQU A;  2CYZ B;  4M7A A;  2BUD A;  2K2V A;  3HRU A;  4XQ3 A;  3TCJ A;  3V8K A;  3LYI A;  2VGN A;  1MGQ A;  3WVE B;  2EKO A;  2Q1C X;  4MZP A;  2ZPI B;  4Z02 A;  3JB9 G;  3FJP A;  3BQB A;  2HBP A;  3OY9 A;  4XTW A;  3PT9 A;  3JB9 H;  2YLC A;  1WPY A;  2DZ9 A;  2DXB A;  3S3N A;  1I4K 1;  2QI2 A;  3M59 A;  2X4J A;  2M1H A;  1WNL A;  3UPU A;  4E7H A;  2I2L A;  3QPH A;  3EFS A;  2PU9 B;  1H64 1;  3DLM A;  2P0K A;  3HKS A;  4J6Y A;  4PL6 A;  4M78 B;  4LDX A;  3JCM P;  2JVV A;  3GF5 A;  3MP1 A;  4N4I A;  3EFR A;  5C0M A;  2DEQ A;  4PJO E;  3HU2 A;  3FLG A;  2QQ9 A;  1Q82 C;  2XG8 D;  1BKB A;  4XU3 A;  4C8Q E;  5CR2 A;  3S3M A;  1BI2 A;  2FYK A;  3L1A A;  2LDM A;  4M78 A;  4PNO A;  3CMA A;  1M1K C;  2ZPE B;  5FU6 C;  3JCM b;  4OVA A;  5CKE A;  3OYM A;  1LNX A;  1VQ4 T;  1TH7 A;  3OMG A;  3V7R A;  3CBP A;  3ME9 A;  4BB7 A;  2QQA A;  2JNG A;  4LDU A;  3OS2 A;  3JB9 D;  3CME A;  3JCM X;  2GF7 A;  4V2S A;  1QDN A;  4IUT A;  2QTX A;  4QQG A;  2CZ0 B;  2NLU A;  1G3T A;  4NS5 A;  5CQY A;  1NJI U;  3GNF B;  3M4G A;  2G3R A;  3JCM h;  4C8Q D;  5GAN j;  4A53 A;  3LGL A;  3BDU A;  4M77 E;  4JLG A;  5FTL A;  1W2B A;  1WQ7 A;  2RA2 A;  1G3S A;  3CEY A;  2DD5 A;  4II1 A;  2DXU A;  2B8A A;  4E47 A;  3V7C A;  2DIG A;  2OTJ A;  2QQB A;  2Y4X A;  1MHN A;  4E7L A;  2DPP B;  3PMT A;  4HCB A;  4TVR A;  2ZPB B;  3JCM J;  1Q7Y C;  3ZBD A;  2IVW A;  2JZ2 A;  3P8H A;  4M7D D;  2RHI A;  2MM2 A;  3SWN C;  4RMO A;  3LGF A;  3OB9 A;  2M16 A;  2R58 A;  2VUB A;  3P8D A;  4FL6 A;  4XU1 A;  4XAX B;  4DQ2 A;  5EQJ B;  4C8Q B;  4PLI A;  1G3Y A;  3M56 A;  5LJ3 g;  5ERG B;  2EYQ A;  4JRP A;  1M1F A;  4IUQ A;  4BI4 A;  5CIU A;  5CK9 A;  5FRM A;  2BIV A;  2JUF A;  2EIF A;  1S3S A;  4C8Q G;  3A5Z B;  3JRZ A;  3FPU A;  4ARC A;  3DB3 A;  4RG8 A;  4RKU E;  4J7I A;  4QVD A;  2RJF A;  5A2Q E;  2KVQ G;  2LQK A;  2V8J A;  5A0L A;  1ZHI A;  3OYH A;  1YJN T;  1FXX A;  3ER0 A;  3HP9 A;  1WGS A;  1G3W A;  2LT4 A;  2RI3 A;  5HKC A;  5GAN 7;  4EMK C;  3LWH A;  4C92 D;  3OYC A;  2K5I A;  1NPP A;  1QVP A;  4F7U A;  2DJZ A;  1VQ7 T;  2ZGW A;  3CCL T;  2Q1A X;  3ZJU A;  1JRI A;  2L89 A;  5GAN 6;  3QSU A;  3M4Y A;  4A54 A;  4MML A;  1VQN T;  1LOJ A;  3A8G B;  3CCV A;  1G5V A;  3I56 A;  3CPW A;  4ZGE B;  4E7J A;  2FHD A;  2KQW A;  3KBG A;  3MP8 A;  3MP6 A;  1ZQ1 A;  2EJG A;  4M7A C;  1N9R A;  4OB1 B;  4XTX A;  4OGE A;  2JTF A;  3CBO A;  2LRQ A;  3NTK A;  3KXT A;  3ZJV A;  5HK0 A;  1JB0 E;  2DXT A;  2O01 E;  3OYJ A;  4CI0 C;  1AHJ B;  3L2Z A;  3C4S A;  2RHX A;  1VQL T;  1M8V A;  2HQX A;  1QVG S;  4M7D G;  1YIJ A;  5GAN d;  5LJ3 j;  1SSF A;  3M57 A;  3I55 A;  5J3B A;  2LT1 A;  4PKC C;  3OYE A;  2VGM A;  1I8F A;  5GAM e;  1VQP A;  2DK3 A;  3QHS A;  4M7D B;  4KDL A;  5GAN e;  2ZPH B;  3MO8 A;  4J5Y A;  3UT1 A;  1XQH A;  4C0F A;  3CCE T;  2RHU A;  3G71 A;  2CKK A;  1KD1 U;  4C92 C;  3FEO A;  4R56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...