5D6YA

Crystal structure of double tudor domain of human lysine demethylase kdm4a complexed with histone h3k23me3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
SITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
total genus 20
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6yA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6yA02
2XDPA 3OYKA 3LGLA 5C6SA 3OS2A 4QQGA 3OYLA 2RHIA 2LRQA 4IUPA 1WJRA 4PLLA 2YRVA 3MEWA 2RO0A 4N4GA 2RJCA 4ZTFA 3PMIA 3ME9A 2D9TA 2IG0A 4ZTJA 2X4XA 3PMTA 4PL6A 4X34A 4C5EA 2DAQA 2RI5A 3O8VA 4C5IA 1WJSA 3L2WA 2GF7A 4A4HA 1SSFA 1OZ3A 2NLUA 2X4WA 3DB4A 3E9FA 4EDUA 3OA6A 3L2QA 5FROA 4BE1A 4E7KA 2O4XA 2RI3A 4B9WA 3OYEA 2F5KA 4L59A 3OQ5A 3FDRA 2R58A 2G3RA 5IAYA 4N4IA 3OYMA 2R5MA 4HCZA 4FU6A 3QKJA 1OI1A 3FLGA 3OYGA 3LGFA 3OMCA 3OYCA 2DIGA 2E6NA 2HQEA 2EQMA 3UT1A 3QIIA 3OS1A 2LTOA 4QQDA 4IKFA 4LD6A 2M1HA 4GY5A 2EQJA 4IUQA 2DIQA 5D6YA 3OS0A 3OYAA 1N27A 2BIVA 3PFSA 3OYJA 4C5GA 4A4GA 4BE0A 3S3OA 4BACA 3C4SA 5KE3A 3L2VA 4IUTA 4E7LA 3OMGA 4Z02A 5J39A 4PLIA 2MWOA 2L89A 2BKDN 3MP8A 2JTFA 3FEOA 4IUVA 2R5AA 3P8HA 1G5VA 1XNIA 4E7HA 5KCHA 2P0KA 2QQRA 3S3NA 4FL6A 5D6WA 3ASKA 3MO8A 2HQXA 2E5QA 5CIUA 3L2UA 4QW2A 5KE2A 1H3ZA 1KHCA 3PNWC 1OZ2A 2RJDA 3OB9A 2MWPA 3LH0A 3M9QA 2EQUA 3S3MA 2K3YA 3BDLA 4QQ6A 3MP6A 2GFAA 4Q5WA 3F70A 3ZEHA 3P8DA 2RJEA 2M16A 4UC4A 3MEUA 5FRNA 2RHZA 3NTIA 3NTKA 3L42A 2VYTA 3E9GA 3Q1JA 5KH6A 1WJQA 2LDMA 2L8DA 2PQWA 3H6ZA 2O4XB 2CKKA 2BUDA 2B8AA 3LX7A 3MEAA 2K3XA 3GOXA 1WGSA 2X35A 3UWNA 4CRIA 2RI2A 3OYNA 4QVZA 2GFUA 2LCCA 5KCOA 4II1A 3FC3A 4IURA 4NS5A 4RG2A 2XK0A 3SD4A 4A4FA 1MHNA 2RHXA 3H8ZA 5D6XA 3QBYA 3OYFA 5C0MA 3LYIA 3OYDA 2R57A 3CEYA 3MEVA 3QJ6A 2FHDA 1OYXA 3NTHA 5IN1A 4E7JA 4OVAA 2EKOA 5J26A 4BDYA 2X4YA 4IUUA 5M9OA 3LLRA 3EAEA 3OYHA 4B9XA 3MP1A 2QQSA 2M0OA 4N4HA 3S6WA 3DB3A 2L3RA 2JZ2A 3META 2EFIA 4A4EA 3DLMA 2LVMA 4BD3A 3OYIA 2WACA 3KUFA 4BDZA 3OYBA 4BE2A 3OY9A 2RHYA 2EQKA 2RHUA 4C5HA 1RI0A 3L2RA 4E7IA 5FRMA 2RJFA
chains in the Genus database with same CATH superfamily
2XDPA 3EGDB 5FWBA 4MZTA 1KQSA 2RK2A 3X25B 3ME9A 2D9TA 2FPEA 5LJ3g 3M59A 5DYIA 5FWCA 5L8RE 3L2WA 4M7AB 3L1AA 4J9FA 1ZUKA 8ATCB 2MMPA 3L2QA 4BE1A 3EH1A 1VIEA 3OYMA 4ESRA 3SWNC 3JCMX 1OI1A 4PKCC 1RAGB 3OYCA 2OAUA 5KYUB 2DF6A 3CC4A 4KULA 2F2XA 1Q81U 4M78C 3OYAA 2H8HA 1VQNQ 1J3TA 1VQKQ 4J9IA 2FZCB 2CZ7B 4E7LA 1G2BA 4Z02A 1GRIA 1UGQB 1GCQC 2LZ6B 3P8HA 4XTXA 1IO6A 3S3NA 1OQKA 1BIBA 2OAWA 1WZOA 5KE2A 2D6FA 2FVUA 4CC3A 4FYVB 4OGCA 5LJ5d 4ELYC 1U06A 3BDLA 3CMAQ 2DFUA 2O01E 2H3JA 2CP3A 3MCAB 3JB9I 1E32A 1JB0E 2QG9B 3NTIA 2EJGA 1PC0A 2FO0A 2DJQA 3CC4Q 2LC4A 1GCQA 2VV5A 3M55A 2C0IA 1M9SA 4DBHA 3J81E 3A8MB 1A0NB 2LQ8A 3M53A 4TVRA 3ZJTA 3LLRA 4Z8AA 1QDNA 2XDDA 2JZ2A 1Y71A 3META 3CBMA 4BDZA 2KRMA 2RHYA 4PJOG 4CQNA 5IXBA 2EQKA 5GAN4 2KROA 2RD1A 1RI0A 1E6HA 1I9GA 1JXOA 3OYKA 3CC7T 1PCXA 2MOXA 3UATA 1Y96B 4M75C 4Z89A 2FRWA 2CT4A 1UB4A 2NLUA 1Y7XA 2NUTB 2RH2A 1BK2A 1AWWA 4N4IA 2CUDA 3QKJA 5GAMd 3FJPA 2ZGWA 1YJNQ 4C8QB 2KGTA 3SB2A 2KXCA 2HMAA 1O54A 5C1BA 1N6AA 1YWPA 3QDFA 2AK5A 2ED0A 2QEXT 1X01A 3L2ZA 1M1KU 3OMGA 4MZMA 2P4TA 1QCNA 1D1CA 3M0UA 3KBGA 4ARCA 5LJ3e 1QLYA 3M9QA 4OP0A 2RB6A 4JRIA 1VA7A 1SSHA 1BCMA 1X43A 2V8IA 4FYXB 4DOVA 4LD9K 2EYYA 1OV3A 5GAN5 2EBPA 2HKQB 1PSFA 1T0JA 4XK8E 4JZ3A 4JRKA 2HCKA 3M5AA 1RAIB 5LJ3j 2FHDA 3E19A 5KYUA 2WSCE 1I5OB 4HVVA 1VQ9A 3DLLA 4AFZC 3S6WA 2LMJA 3KUFA 4JS4A 4KH0B 4A54A 5B6CA 3I56T 2KK4A 5IHNA 4ME7A 4C8QA 4E2FB 3WXMB 1TH7A 2RA2A 2NUTA 2YRVA 4M77F 4PFOA 1V76A 1X6OA 1GBRA 1HK9A 3DB4A 2NUPA 5FW9A 2RQRA 3OYEA 3EG2A 1QKWA 2W10A 1ZBJA 2QAZA 4AQ7A 1UGRB 2XD0A 1B07A 2CP6A 1VQ9Q 4M7DB 1VQ6A 5CKFA 4E6RA 2CREA 2AZSA 1QVFA 4IUQA 2QQBA 1AWJA 2C0TA 1X2QA 4N0AA 1M8VA 2DVEA 5LJ5e 5I21A 2BKDN 1VQPQ 2JTFA 2O9SA 1CZ5A 3G6EA 3H0IA 2ATCB 4LXCA 2YHTA 1M5Q1 3ASKA 4M7AG 4FIBA 1KHCA 3H0HA 5ERGB 4C8QF 3REBB 3GP8A 1GL5A 2JV2A 3MP6A 2ZPHB 2DEUA 2YLCA 2QA4Q 3JB9D 1BIAA 3E9GA 4F7UF 1VQMA 1XQHA 2AIRB 1WGSA 1JJ2S 1W2BP 4OMNA 4FT4A 4M77C 2BZ8A 4M7DE 2HL3A 4BY6C 1I5LA 3NTHA 4B6MA 5J26A 1Q82R 2QI2A 2QQ9A 4A4EA 2WACA 4LDWA 5KYWB 2DNUA 1MV3A 1M1KC 4F17A 1UUEA 1E7OA 3M4YA 4PJMA 1Q7YU 2EYWA 1MUZA 4IUPA 4OB2B 4N4GA 1X2KA 4M7DF 4BI3A 1ZUYA 3OSSC 4X34A 2M02A 1E6GA 3X24B 2EGEA 2EYQA 3RKXA 4KDIA 2F5KA 2R58A 2H3EB 2JXBA 1G3WA 1NZ9A 5GLFA 2KNBB 1VQLQ 2VVKA 3A98A 1WQWA 2JN0A 3CCVQ 1JRIA 1T0HA 1N27A 3BY7A 4A4GA 4OB1B 4HCBA 1G3SA 3CXCP 4BB7A 3MP8A 1QW1A 2EPDA 3FEOA 3O5ZA 2L0AA 3QG1A 2QA4T 2KAFA 5KYYB 5GAOp 3VKIA 1VQOQ 4JRQA 4FM4B 4C0FA 4ATOA 4J9EA 1CKAA 3I56A 1NJIU 3OB9A 2RJDA 2RQTA 3V8LA 1GXIE 3I9QA 2E65A 4Q5WA 3CXCS 3CCET 3JCMd 3CCQT 4M77G 1YBYA 1GCPA 1I07A 1OPLA 2G6FX 2O4XB 3MEAA 5DM7R 4F7UA 3WVDB 2OTJA 3A8OB 2XI9A 2LCCA 1ZSZA 2CH4A 4FYYB 4F04B 4M77E 2F2WA 4FW2A 1NM7A 2F5TX 4NL2A 4JJCA 2X4YA 5GAMe 1AEYA 5I2SA 3KFVA 2AT1B 3JCMV 4OMFB 3OY9A 2KYBA 4C5HA 3OW2S 2BZYA 4A4KA 3FB9A 3OYLA 1TUCA 9ATCB 3V7SA 1UHFA 2K57A 4PLLA 3GIBA 4PJOC 3PIOA 2RO0A 3M0RA 1I0CA 1YJ9Q 3CCVT 2ROTA 3HU3A 1C6VX 2D0NA 1SSFA 3X26B 5LJ5f 4F7UB 4E7KA 2O4XA 4M7DD 3HSBA 2K5IA 2MAMA 3OQ5A 3DKMA 5A0GA 2ABLA 2CP7A 2YUNA 3EH2A 5FU7C 1KQSS 1I4K1 4AG1C 2DKGA 4OB0B 2Q1CX 1SPKA 4PJNA 3X28B 1KQ1A 1VQ4Q 2O31A 3FPTA 2L89A 3CCSA 1VYVA 1YFNA 2E70A 4JDSA 2V1RA 3V7CA 2WSFE 3REAB 5A2QE 1YHQA 1FX7A 2DE0X 4MDXA 1IHWA 1K9MU 2C0OA 3NGPA 5D7UA 3QUIA 4J7FA 1K73R 1HYOA 3CF2A 1JJ2A 1OU9A 3JCMf 5GAN6 1OPKA 1Y57A 3UA6A 2DTOA 4ANJA 1NYGA 2DILA 2A7YA 2COWA 4ELZC 4ZGEB 5FU7B 1WJQA 1VQ8T 2RF0A 3PT9A 1Q86R 4R55A 1VQ6T 3CCST 3EGDA 4RKUE 5KCOA 3HHTB 4IURA 3MHXA 1GFDA 4A4FA 3VS5A 3QPHA 3LYIA 1M90R 2R57A 1WDXA 1RAEB 2IPOB 4OVAA 4L6V5 4QT7A 1UTIA 1D0XA 4MZPA 4M78B 3MPUB 1BCOA 1M1GA 1W4SA 2MYSA 1K8AU 1X75C 4E7IA 4O6JA 1EFNA 1IB8A 4M75E 2PU9B 5C6SA 2LNHB 2W0ZA 2LRQA 1ABQA 1KD1R 1WHKA 5FTMA 2GQIA 2K4YA 1UEBA 2E5KA 4LNPA 1M2VB 3O8VA 1NJIC 4MDWA 4LDVA 1OZ3A 3A1PA 5I11A 4M7AF 3CBPA 3VRYA 1O75A 4ZGDB 2RI3A 4OMOA 2PWYA 3I35A 2X51A 5GAMg 2EQMA 2VGMA 2K9GA 5D6YA 4X9CA 1NYFA 3FPRA 2YRDA 3JCMb 4BACA 1SHGA 5J39A 2MWOA 1QMCA 1VQ5Q 2DXTA 3CBOA 1YNZA 2FZGB 4J8OA 4EPCA 2A3LA 1RAFB 1VQ8A 3EHRA 1ABOA 2E5QA 1VQ6Q 1IGUA 3PNWC 4RTUA 1KQSP 1W6XA 2X4JA 3MEUA 1ZSZB 3VS3A 2L2PA 1LNXA 3OYYA 5ECAA 4FSSA 3Q1JA 5EQJB 3RERA 2L8DA 3VS2A 2NUPB 1M90U 4BUGA 3MKDA 1VQMQ 3EFOB 4C0DB 5EPPA 4DBRA 1QVFP 2DJZA 2O2OA 2RHXA 1S3SA 1FMVA 2CDTA 5IH2A 1LOJA 4M75B 5GANf 3PTAA 4HCCA 4HXJA 4A53A 1WXBA 1UGVA 3CCLT 3I5RA 3EGXB 2PVOB 5KYYA 2DEQA 1Z9QA 2MIOA 5I22A 2JS0A 3SEMA 4PK4A 2GCXA 4YTLA 1SHFA 2MI6A 1OEBA 2JT4A 2RQVA 5HKCA 1JBMA 3MEWA 3PE0A 4ZTFA 2IG0A 4XTWA 2COYA 2KT1A 4JPBW 1S72Q 2LX9A 1I8FA 5GANh 2DERA 4PFZA 4EDUA 2FL7A 2XMFA 4FCYA 2DL8A 3CCMA 1PKTA 2LW6A 1UDLA 2DTHA 4F7UE 3ZBDA 1DJ7B 3LGFA 2SEMA 3QIIA 2LTOA 2JVVA 1M3BA 2DLPA 1LPLA 1K73C 3QHSA 2KE9A 1QVGA 1HXDA 4PFPA 3AHUA 3ULRB 1VQNT 2ZPEB 2EYXA 1MNEA 4OMMA 3CCLA 3A5ZB 3CC7Q 2ED1A 3QWZA 5KYWA 2P0KA 1LJOA 1D09B 4J6XA 1WXUA 3HFNA 1OZ2A 1YI2T 2MWPA 3M54A 3M56A 2P84A 1KD1U 3NPFA 2K7AA 3CCRQ 3QQ7A 3NMZC 3CCMT 1EZZB 3P8BB 2DYIA 2RK1A 2GTOA 5FTKA 1SRLA 2FB7A 5GAMf 4KGXB 3QXEB 2OTLQ 2RI2A 2YDLA 1PSEA 2LJ0A 2SRCA 2XU8A 4M7AC 4RV0A 3H8ZA 4KRTA 2RQUA 3QBYA 5CKBA 1Y96A 1YCYA 3VU3C 2HSEB 3RNJA 4BI4A 2J06A 3VS4A 1Q82U 3HRTA 4BD3A 4C92F 2YUPA 3CCJA 5KYXB 4OMLA 4M7DG 3VS1A 1ZX6A 4IIMA 2XHCA 2K3BA 2DXBA 2V8JA 4KUIA 2WSEE 4KT0E 1VQ7A 3EFRA 2RHIA 5CAIA 3GPLA 3TIWA 2Y90A 2CH4W 4LDUA 1PD1A 3MB5A 5I2MA 4F16A 2YSQA 5HY6A 3OA6A 5FROA 2CP5A 1GFCA 2NUZA 3FDRA 4X1VA 3C0CA 1UECA 1XTDA 2R5MA 1IXDA 2X9HA 1QVPA 2BZXA 3CD6A 1FWZA 2HQEA 5GAOr 5GANe 2DX1A 2E6ZA 2FG0A 1V1CA 3PFSA 2JS2A 2CYZB 3RBBB 4WTOB 1WFWA 5KE3A 2L3SA 2DD5A 3CCJT 1SRMA 4F7UG 2FRYA 3CCEQ 3EGUA 1Q86U 3FPUA 1N8RU 1T3LA 2QTVA 1D1BA 2JMAA 1Y0MA 2P0QA 2XICA 3CPWA 2HKNA 3S3MA 2D8JA 5KYNA 1QCOA 2YUOA 1QWFA 4RTZA 2Q1DX 3ZEHA 4C92C 4EMKB 1K9AA 3P8DA 2M16A 5FRNA 3HFOA 3QZ9B 4LUEA 3OW2P 2HEQA 3G7ZA 1U1SA 5IXFA 1RL2A 4HVWA 3H6ZA 2JM8A 2CKKA 2F1LA 3EG0A 1IHVA 1ARKA 2E3IA 1UFFA 4QVZA 4AS1A 2HQHA 5D6XA 1WX6A 2L3QA 4HA8A 5C0MA 1QCFA 4ZN1A 5IN1A 1H92A 3OBWA 3RMSA 2EKOA 4IUUA 4AG2C 4J5YA 3OYHA 4FYWB 2Y4XA 2ZZDA 3NFCA 2A37A 4N4HA 4E7ZA 3PIPA 2O9VA 2CZ1B 1KK7A 3VS0A 2RHUA 5FRMA 4ARIA 4Y92A 1UGSB 3M58A 4RTXA 4QQGA 3CD6T 5FTJA 4LDXA 3HU1A 3CCUQ 1M90C 1WPYA 1PKSA 2DD4A 3JAME 5AT1B 1WHMA 4RTTA 5FU6C 4A4HA 4BI8B 1VQ4T 2KEAA 4M75G 2AHJB 5GAMj 2B25A 4WF2A 3JV3A 1KD1C 3LWHA 2G3RA 3ER0A 2E41A 1UJYA 3TSWA 3TEEA 4RMOA 5C18A 3HKSA 1D0YA 1M27C 1B7TA 3L2VA 1M2VA 2DTIA 4PLIA 2QXFA 4E47A 1F1BB 2GTJA 4IUVA 1Y07A 2ESWA 2R5AA 3VS7A 4E7HA 2DVJA 7AT1B 4FL6A 1I1JA 2OTJT 1KHIA 2E4HA 1RLPC 1FXXA 1AWOA 1NPRA 3QC8A 4FW1A 1VQ4A 1QVFS 1CKBA 2OI3A 2VYTA 2OTJQ 4J9CA 2B8AA 3JRZA 2QDLA 4JZ4A 1YIJQ 2LT4A 2A08A 2DL3A 3CC7A 3HTRA 2I2LA 4RTVA 5FU6B 4C0ZA 1MHNA 4J9GA 4XTZA 3OYDA 2LQKA 3VJPA 4EMGA 4C92D 1ZA2B 3NHNA 1Q7YR 5HK3A 3G6ET 2PVGB 1W2BS 2KDSA 3QJYA 1U5SA 2X3WD 2EGAA 2EFIA 3DLMA 1KIKA 4PNOA 3I5SA 3OYBA 4C92E 4PJOA 4KO8A 2RN8A 1U8RA 4M4ZA 2RJFA 1T3SA 1C1AA 2BE9B 3OS2A 3SHWA 1YCSB 4AFUC 2DO3A 2XIDA 1VQPA 4ZGJB 2CT3A 2RJCA 1KC8U 2PZ1A 1TS9A 3GF5A 1GBQA 4PJOB 3V7RA 3CCQA 5GAN8 2PNIA 4M78G 2KXDA 4M7AA 1X6BA 2K5LA 3UPUA 4FU6A 2KMTA 1QCSA 2ZCFB 3UDCA 3JCMQ 1KG1A 3PGGA 5LJ3f 1ZSZC 2HSPA 2KRNA 3CC2T 2CP2A 1OU8A 5HCKA 5EG2A 1VQPT 3E2UA 2JNGA 2JUFA 2GGRA 2K2MA 4FSXA 3QDRB 1H3HA 3JB9J 1M8MA 2VKNA 3CC2Q 1H3ZA 4QVCA 2KBTA 1VQNA 2ROLA 4Y28E 4QQ6A 2ENMA 2GFAA 2E64A 1NG2A 2QGFB 2QGGA 3QYGB 5CCBA 1RI9A 1VYTA 5CCXA 3H0FA 2RHZA 5CVIA 1BI2A 4J7IA 2MM2A 3CCVA 1KFZA 1QWEA 3NTKA 2PJHB 2OTLT 1VQLT 4XTVA 1CSKA 4KLNA 5GMKm 3UWNA 4PJOE 1PD0A 1RACB 1XOVA 5GAN2 1MV0B 3THKA 4NS5A 2CGHA 2RM4A 1ACMB 4NL3A 2DRMA 4GLMA 4JRPA 4PJOD 2KQWA 2YLBA 4JJNK 3CC4T 5M9OA 3ZFJA 4B9XA 1M3AA 3QSUA 2C06A 1VIFA 3CXCA 3VUZA 3BFMA 4C0DC 2DK3A 1WYXA 1S72T 5DLQE 3GLXA 3RESA 4JLIA 3EG1A 4M75D 1QP3A 2HZYA 4N0AC 1WJRA 2KVQG 2XKOC 1G8XA 3BDUA 2KYMA 4HT8A 2X3XD 2EAYA 2VXFA 3CMEA 1WHJA 2DBMA 2DRKA 5J3BA 5LJ3d 4C5IA 2GF7A 1ZA1B 2K79A 1VYUA 1QVGS 2KI7A 3RIRA 3JCMe 1R8OB 4HCZA 1FMKA 3HL8A 4AT1B 1VQOT 4GY5A 1LVKA 2RQWA 5GAOq 1W1FA 1YI2Q 5GMKe 3VUBA 1ZSGA 2HBPA 2JTEA 3HRSA 5CD1A 1P92A 3CCUT 3G4ST 5D6WA 2JMCA 1NPPA 2QTXA 1YJ9T 3C12A 3URGA 2EVRA 1YWOA 1K0XA 2K6DA 4ZNXA 2EQUA 1WXTA 2DETA 2KY9A 3FIFA 2E12A 3M0SA 4UC4A 3CCQQ 1MNDA 1RLQC 3H41A 3MJXA 4XU1A 1KC8R 5GMKl 3X20B 1JQQA 1D3BB 2VUBA 2K3XA 4J6WA 2X35A 4M7AE 2MPXC 1MMGA 3GNGA 3OYNA 4QVDA 3CCSQ 2A0FB 1IRXA 3HPWA 1MMNA 2PVDB 3BW1A 3RDVA 1G3YA 4BDYA 3EAEA 4KDLA 3MP1A 1PWTA 3G71Q 1K9MC 2VC8A 1OOTA 2L3RA 2VWFA 2LX7A 4C8QD 1ZLMA 1RABB 1VQKT 4M77B 1PRMC 4C92A 1R0BG 4AMCA 3ZJVA 2DZ9A 1YP5A 2AKKA 5DLOA 2E1HA 4XAXB 5LL6S 2HBWA 3PMIA 1YIJT 1EX4A 2LNVA 3JCMP 1M2OA 3TVTA 4PL6A 5GAN7 1VQMT 4VUBA 2DM1A 1AZGB 4D8KA 2DXCA 1AOJA 1K1ZA 2X4WA 3E9FA 3LH5A 1H8KA 5LJ5h 2O88A 3FLGA 4KUDK 3RKYA 1D1AA 2KSSA 2Y4YA 3OS1A 4IKFA 4LD6A 2EQJA 3QWYA 3QO3A 2P4RA 1VQ7T 2OX7A 5GAOn 3JCMh 1KQ2A 6AT1B 1K76A 1VQ9T 2AKLA 2DL5A 1G5VA 1D0ZA 4ORZA 2PUOB 3CMEQ 1KC8C 3SDZA 2JW4A 5GMKh 1VQ8Q 2YXYA 4L5GA 3LH0A 2YUJA 1BB9A 3M0TA 2B86A 2EJFA 2DXUA 4KGZB 1TG0A 5GANd 1FMWA 4BY6B 2A28A 2J6FA 4F14A 5KH6A 2LDMA 4JS5A 5GMKj 1JJ2P 1WNLA 3G71T 2XDBA 4RCBA 1PHTA 1YJ9A 4M78A 3JCMJ 4CRIA 2LCSA 4D8DA 2DYBA 4CC4B 1YJNA 2D0QB 5CK9A 2NYSA 3MEVA 3QJ6A 1WI7A 1EIFA 1OYXA 2DPPB 4E7JA 1BI3A 4CI0C 2DL7A 1X27A 4WCIA 2GBQA 4RCCA 1W70A 3C95A 2J7IA 1K73U 2QEXQ 3VYHB 3C94A 1LCKA 3RR6A 3G1JA 1H641 2EGCA 2LJ1A 1B34A 2QASA 3A8LB 4OMQA 5CKEA 1SEMA 3G6EQ 3FRNA 5IHKA 1RUWA 2DAQA 3RKWA 5L23A 3VYGA 2J6OA 3G4SA 1C0MA 3CPFA 3VS6A 1VQ5A 2JTMA 3SFMA 4B9WA 1IZ6A 4L59A 2D8HA 3M0QA 5GJVB 2AZVA 2J6KA 3OMCA 3UT1A 1TXQA 2QQAA 4HKEA 4RTWA 3V8KA 4J6YA 3OS0A 3T9NA 1ZBXA 4C5GA 3M0PA 4E7SA 1VOMA 1OX8A 4LN2A 1KSWA 2KR3A 2MF2A 1XNIA 2QQRA 1NBEB 3GNFB 3U23A 5CIUA 2CSQA 1RAHB 1V29B 1IREB 4QW2A 2EYZA 4EIKA 5GAMh 2COZA 3JB9H 1UJ0A 5GJWB 2RJEA 2ZPBB 3L42A 4AFQC 4KH1B 5A0DA 1MMAA 4DBFA 4XU3A 4HVUA 4XQ3A 4DQ2A 2VGNA 4LUDA 3AT1B 4HT9A 5FLXE 1R0CB 3JCMg 2Q19X 1AZEA 3JCMW 1NEBA 2QDYB 3G4SQ 2LQNA 3TU4K 2QQSA 2M0OA 2M9UA 2DL4A 3R6OA 4C92B 3DB3A 4M77A 4EMKC 5LJ5j 2LVMA 4BE2A 4XTYA 4PJJA 1YHQT 1YJWQ 1B3QA 2RPNA 1ZQ1A 2CP0A 1YITQ 1U3OA 1WA7A 3LGLA 3M57A 3CQTA 2GQVA 3EHQA 1Q95G 2BTTA 3TSZA 1N8RC 2E10A 2YUQA 4ZTJA 3TCJA 2EJ9A 4C5EA 1YJWT 4J9DA 4KODA 5GAN3 3I55A 1WJSA 1YHQQ 2FYKA 2EKHA 2YT6A 4FT2A 1YITT 1SG5A 4EMKA 1AHJB 3CCRA 3OW2A 2MM0A 1WHHA 4C0GA 2VB6A 3UF4A 5IAYA 1O9SA 1UE9A 2KRSA 4KBMB 1Q82C 4RTYA 3BQBA 5DYGA 1BU1A 3QQ8A 1TUGB 2E6NA 1QP2A 4D6WA 2DIQA 3EGXA 1B34B 5LJ5g 2EQIA 3CMAT 4IUTA 4ZN3A 2OTLA 5CQYA 3IQLA 1Q7YC 4X9DA 3LW5E 1QVGP 2I0NA 4M7DC 1NE8A 4RG8A 3I55T 1RADB 1ZHIA 3ZJUA 3V8JA 5GAOl 3L2UA 1FYNA 2D1XA 2EW3A 2K3YA 1YIJA 4Y91A 1YJWA 1Q81R 1WLPB 1MMDA 4M78D 2LQWA 3CPWP 3WVEB 3CCMQ 2JM9A 2CUBA 2YRCA 1BKBA 2CZ0B 5IHIA 1OULA 4C8QC 4LE9A 2FZKB 2PQWA 2DA9A 3LGAA 1M4ZA 2GFUA 1N9SA 3J7AF 2RMOA 3FC3A 1PM3A 3H9NA 1ZUUA 3JB9G 1JU5C 2BE7D 3JSCA 4A63B 1WIEA 4J9HA 5KYXA 1Q86C 4XU0A 3CEYA 2VXEA 3EG3A 1TSFA 1VQOA 1AT1B 4K11A 5AYFA 1G3TA 1QQJA 1Q81C 5CKHA 4MMLA 5CQXA 2E3HA 2FPDA 5FTLA 3A8HB 1VQLA 3CPWS 3OS5A 2QYZA 1CZ4A 1OX9A 1YJNT 3SWNA 1TOVA 1YI2A 1X69A 4XTUA 1M3CA 1PNJA 3PMTA 1N9RA 2ECZA 1K4US 3G71A 2NWMA 3GBQA 2EWNA 1WHLA 1JXMA 2M51A 4IIOA 4DA4A 1TU0B 2ZPFB 2MK5A 5A0LA 2V1QA 1TWBA 1BYMA 3ZL7C 3JB9F 3M4GA 1PG5B 1JEGA 1S72A 3KXTA 2Z0WA 3ZGZA 3LHDA 2M1HA 3FJ5A 1AWXA 2ZPGB 1UHCA 2BIVA 1WLFA 4BE0A 1BI0A 3S3OA 3CCJQ 1WHGA 3C4SA 5CKDA 4CC7A 3LWIA 2PUKB 3VRZA 3EG9A 5CO7A 5GAOm 3CMET 2HNIA 1QKXA 4DOWA 5FTNA 3JCMc 2YWWA 2DMOA 4DEYA 2J05A 1VQ7Q 1NEGA 4R56A 2K5FA 4OB3B 4JLGA 4P5NA 4DEXA 1HD3A 2CSIA 2F2VA 1SF9A 4JJDA 4OMPA 5GANg 3CD6Q 4J9BA 2Q1AX 3LX7A 2BUDA 3GOXA 1D3BA 3A8GB 5CCAA 1G83A 1Z9ZA 1NLPC 3I56Q 2DBKA 1K8AR 2HL5C 2LJ3A 3SD4A 4M77D 1S1NA 3QWXX 3VV0A 2ZPIB 1XJWB 1IGQA 1N8RR 5GANj 3CCEA 4HCKA 4PJLA 2F69A 2EIFA 2MCNA 5LJ3h 2YVLA 4EMHA 1M1KR 2JJ9A 3CC2A 3CMAA 2QEXA 4M75A 4O5VA 4M78F 2XG8D 2L3PA 2IIMA 3OBYA 2QA4A 2VASA 4M78E 2LT1A 3OSVA 2GNCA 3HU2A 1M1FA 3BE3A 1U1TA 3PVQA 3EFOA 3UA7A 1R7RA 1X6GA 2DZCA 1PRLC 3EFSA 3EG9B 2L5QA 3RUXA 2X4XA 1M30A 2RI5A 2FPFA 2LP5A 4MMKA 4PJOF 3TQ7P 2PTKA 3QYHB 3PVLA 2RNAA 4J83A 8AT1B 4OGEA 4V2SA 1AVZC 1K9MR 2HD0A 4RUGA 3OYGA 5CR2A 1AD5A 1UG1A 2DIGA 4NOYA 4QQDA 3J80E 5EC7A 2Q18X 3OYJA 5HK0A 1VUBA 1K8AC 1NLOC 5DY9A 2HDAA 1RAAB 1VQ5T 1BBZA 1MGQA 3SWNB 5KCHA 1TUDA 4M75F 2KT8A 4XU2A 3MO8A 3HP9A 2HQXA 4GLKA 2QK0A 4C8QG 1BI1A 1WQ7A 4GBQA 4CC2A 1ZC1A 2FEIA 3CCLQ 1N5ZA 2IVWA 4C92G 2CS7A 4JJBA 3F70A 1JO8A 2JOYA 2A36A 1UGPB 3CCRT 3INZA 1W2BA 1HSQA 2HAXA 4R0KA 3R6NA 2M0YA 3CCUA 4DBQA 1HJDA 1R77A 2OJ2A 3QZ5B 1YN8A 2CZ6B 2LCLA 4M7AD 1VQKA 4II1A 1NJIR 3D7SB 3HRUA 4RG2A 2P0PA 4Z88A 2XK0A 1CR5A 4KGVB 3OYFA 4JUVA 4LDYA 3E1SA 3TREA 3I55Q 2ZAEA 4AFSC 1SKUB 2V26A 4M7DA 1KJWA 5GMKi 1TTHB 1K0SA 3OYIA 4C8QE 4QKUA 4OF1A 5IT9E 1YITA 3N5BB 1I81A 2V8KA 2K2VA 3RMQA 3L2RA
chains in the Genus database with same CATH topology
4A4KA 1UGSB 3FB9A 3M58A 2XDPA 3OYLA 4QQGA 1B34A 3CD6T 4MZTA 5FTJA 3V7SA 3GIBA 2K57A 4PLLA 1KQSA 4LDXA 4PJOC 3PIOA 1WPYA 2RK2A 2RO0A 1M90C 3A8LB 3HU1A 5CKEA 3X25B 3ME9A 2D9TA 3FRNA 3M59A 5LJ3g 5DYIA 3CCVT 2DD4A 2DAQA 3RKWA 3JAME 3HU3A 5L8RE 3VYGA 3L2WA 5FU6C 4A4HA 1SSFA 4M7AB 3X26B 4BI8B 3G4SA 3CPFA 3L1AA 5LJ5f 1VQ4T 4F7UB 3L2QA 2MMPA 1VQ5A 2JTMA 4M75G 3SFMA 4BE1A 2O4XA 4E7KA 4B9WA 2AHJB 5GAMj 3HSBA 1IZ6A 4L59A 2K5IA 4WF2A 2MAMA 1VIEA 3OQ5A 3LWHA 3DKMA 5A0GA 2G3RA 3ER0A 3OYMA 3SWNC 2E41A 3JCMX 1OI1A 5FU7C 4PKCC 1KQSS 1I4K1 3OMCA 3OYCA 2OAUA 3UT1A 3CC4A 4KULA 2QQAA 4HKEA 1Q81U 4M78C 3V8KA 3TEEA 4RMOA 2DKGA 4J6YA 4OB0B 3OS0A 3OYAA 2Q1CX 5C18A 3T9NA 1ZBXA 3HKSA 4C5GA 3X28B 2CZ7B 1KQ1A 4E7LA 3L2VA 4Z02A 2DTIA 3FPTA 4PLIA 2QXFA 2L89A 1UGQB 3CCSA 4E47A 2MF2A 4IUVA 1Y07A 2R5AA 3P8HA 4XTXA 2E70A 1XNIA 4JDSA 4E7HA 2QQRA 3GNFB 3S3NA 3V7CA 2WSFE 4FL6A 1BIBA 5A2QE 1YHQA 1FX7A 2OTJT 5CIUA 4MDXA 1KHIA 1V29B 4QW2A 1IREB 5KE2A 2D6FA 5GAMh 2FVUA 1K9MU 4OGCA 5LJ5d 3JB9H 4ELYC 3QUIA 1FXXA 4J7FA 1Q81C 3BDLA 1NPRA 2O01E 3QC8A 2H3JA 3MCAB 2RJEA 3CF2A 1JJ2A 3JCMf 5GAN6 3JB9I 1VQ4A 1E32A 2ZPBB 1JB0E 1QVFS 2DTOA 3NTIA 2EJGA 3L42A 2VYTA 2A7YA 4ELZC 5A0DA 4ZGEB 5FU7B 4XU3A 1WJQA 1VQ8T 2LC4A 2B8AA 3JRZA 3PT9A 4R55A 1VQ6T 2LT4A 4XQ3A 3CCST 2VV5A 4DQ2A 2VGNA 3CC7A 3M55A 2I2LA 4RKUE 5KCOA 3HHTB 5FU6B 4IURA 4HT9A 3MHXA 4C0ZA 4A4FA 1MHNA 3QPHA 5FLXE 4XTZA 1M9SA 3LYIA 3OYDA 3JCMg 2Q19X 2R57A 2LQKA 3A8MB 3J81E 3JCMW 3VJPA 4EMGA 4OVAA 2QDYB 4C92D 2LQ8A 3M53A 4L6V5 4TVRA 3ZJTA 3LLRA 5HK3A 3TU4K 1QDNA 3G6ET 2PVGB 2XDDA 2QQSA 2M0OA 2M9UA 3R6OA 2KDSA 3QJYA 3DB3A 4M77A 4C92B 4EMKC 4M78B 4MZPA 2JZ2A 1Y71A 2EFIA 3META 3DLMA 2LVMA 4BE2A 3CBMA 4XTYA 4PNOA 3OYBA 4BDZA 1M1GA 1YHQT 2RHYA 4PJOG 4C92E 4PJOA 4CQNA 1W4SA 4KO8A 2EQKA 5GAN4 1K8AU 1X75C 2RD1A 1RI0A 4E7IA 1U8RA 4O6JA 1ZQ1A 1I9GA 2RJFA 3OYKA 4M75E 3LGLA 3CC7T 2PU9B 5C6SA 3M57A 3OS2A 2GQVA 2LRQA 2DO3A 1Y96B 1N8RC 2XIDA 1VQPA 2K4YA 4ZGJB 2RJCA 4M75C 1KC8U 5FTMA 2E10A 4ZTJA 1UEBA 3TCJA 2EJ9A 4C5EA 1YJWT 4KODA 3O8VA 5GAN3 4MDWA 1WJSA 3I55A 3GF5A 1NJIC 4LDVA 1UB4A 1OZ3A 2NLUA 2FYKA 4PJOB 4M7AF 3CBPA 4FT2A 3V7RA 1YITT 1O75A 1AHJB 4EMKA 4ZGDB 3CCQA 5GAN8 2RI3A 3CCRA 3OW2A 2MM0A 1Y7XA 2RH2A 4M78G 4C0GA 4M7AA 1W2BS 2K5LA 5IAYA 4N4IA 2B25A 1O9SA 3UPUA 4FU6A 3QKJA 2KMTA 5GAMd 3FJPA 4KBMB 1QCSA 2ZCFB 3UDCA 2ZGWA 1Q82C 2PWYA 3JCMQ 3BQBA 5DYGA 4C8QB 3PGGA 5GAMg 3SB2A 2E6NA 1KD1C 2EQMA 1KG1A 1QP2A 1O54A 5C1BA 1N6AA 5LJ3f 4D6WA 2VGMA 2DIQA 5D6YA 1B34B 4X9CA 3FPRA 3CC2T 5LJ5g 2QEXT 1X01A 3L2ZA 3JCMb 4BACA 3CMAT 1M1KU 4IUTA 4ZN3A 3OMGA 5EG2A 5CQYA 5J39A 1VQPT 2OTLA 2MWOA 2JNGA 2JUFA 1Q7YC 4X9DA 3LW5E 4MZMA 2DXTA 2P4TA 4FSXA 3CBOA 4M7DC 3QDRB 1NE8A 4RG8A 3I55T 4J8OA 4EPCA 2A3LA 3JB9J 1VQ8A 1ZHIA 3ZJUA 3KBGA 3V8JA 5GAOl 2E5QA 4ARCA 3L2UA 1H3ZA 3PNWC 4QVCA 5LJ3e 3M9QA 4OP0A 2RB6A 2K3YA 4JRIA 1YIJA 4Y91A 1YJWA 1VQNA 4Y28E 4QQ6A 5CCBA 2GFAA 2E64A 2X4JA 3QYGB 4M78D 4M7DD 3WVEB 3MEUA 5CCXA 5CVIA 2RHZA 1BI2A 2V8IA 1LNXA 3OYYA 4J7IA 1BKBA 2CZ0B 2MM2A 4DOVA 3CCVA 4LD9K 3Q1JA 4C8QC 5EQJB 3RERA 3NTKA 2L8DA 2PQWA 5GAN5 2PJHB 2OTLT 1VQLT 1PSFA 1M90U 4BUGA 4XTVA 4KLNA 4XK8E 5GMKm 3UWNA 3LGAA 4PJOE 1M4ZA 2GFUA 1N9SA 4C0DB 3J7AF 5EPPA 1XOVA 4JRKA 5GAN2 3FC3A 4NS5A 2CGHA 2DJZA 2RM4A 3JB9G 3JSCA 3M5AA 2RHXA 4NL3A 1S3SA 5LJ3j 1Q86C 4XU0A 4JRPA 3CEYA 2VXEA 2FHDA 4PJOD 2KQWA 3E19A 2YLBA 1VQOA 4JJNK 1LOJA 2WSCE 4M75B 3CC4T 1VQ9A 5M9OA 5GANf 3ZFJA 3PTAA 4HCCA 3DLLA 5AYFA 4B9XA 4A53A 3QSUA 3S6WA 5LJ5j 2C06A 3CCLT 1G3TA 1VIFA 3CXCA 3VUZA 2PVOB 3BFMA 3KUFA 5CKHA 4A54A 4MMLA 4C0DC 5CQXA 3I56T 4JS4A 5B6CA 2KK4A 2DK3A 1S72T 2DEQA 5FTLA 4ME7A 3A8HB 5DLQE 4C8QA 1VQLA 2GCXA 4YTLA 3CPWS 3OS5A 2MI6A 3GLXA 3WXMB 3RESA 4JLIA 4M75D 1QP3A 1TH7A 5HKCA 1CZ4A 2RA2A 4N0AC 1WJRA 2KVQG 2XKOC 3SWNA 1JBMA 2YRVA 3BDUA 3MEWA 1YJNT 4ZTFA 1YI2A 4M77F 4XTUA 2IG0A 4XTWA 3PMTA 4HT8A 1N9RA 2EAYA 3G71A 2VXFA 3CMEA 2EWNA 2LX9A 5J3BA 5LJ3d 4C5IA 1X6OA 1I8FA 2GF7A 5GANh 1HK9A 3DB4A 4EDUA 2FL7A 4DA4A 2ZPFB 3CCMA 5A0LA 3OYEA 1QVGS 2LW6A 4AQ7A 1UGRB 2DTHA 3RIRA 2XD0A 4F7UE 3JCMe 1R8OB 4HCZA 3ZBDA 1BYMA 1DJ7B 3LGFA 4M7DB 1VQ6A 5CKFA 3JB9F 3M4GA 3HL8A 3KXTA 1S72A 1VQOT 3QIIA 3ZGZA 2LTOA 2JVVA 3LHDA 2M1HA 4GY5A 1QVFA 4IUQA 2QQBA 5GAOq 1K73C 2ZPGB 3QHSA 2BIVA 1WLFA 4N0AA 1HXDA 5GMKe 1QVGA 4BE0A 3AHUA 1BI0A 3S3OA 1VQNT 3VUBA 1M8VA 2ZPEB 3C4SA 5CKDA 2DVEA 5LJ5e 3CCLA 5I21A 3LWIA 2BKDN 2HBPA 2JTFA 1CZ5A 2PUKB 3A5ZB 3HRSA 5CO7A 3G6EA 5GAOm 3QWZA 3CMET 2HNIA 4DOWA 2P0KA 5FTNA 1LJOA 5CD1A 1P92A 2YHTA 4J6XA 5D6WA 3G4ST 3CCUT 1NPPA 1M5Q1 3ASKA 2QTXA 1YJ9T 4M7AG 4FIBA 3C12A 3URGA 1KHCA 3HFNA 1OZ2A 3JCMc 1YI2T 2MWPA 2EQUA 3M54A 5ERGB 4C8QF 4R56A 3GP8A 2KY9A 3M56A 3FIFA 2JV2A 2K5FA 3MP6A 4OB3B 1KD1U 4JLGA 4P5NA 2E12A 2ZPHB 4UC4A 3QQ7A 2YLCA 3CCMT 3JB9D 3P8BB 5GANg 1BIAA 2RK1A 3E9GA 4XU1A 4F7UF 5GMKl 2Q1AX 5FTKA 2FB7A 3X20B 3LX7A 1D3BB 1VQMA 2VUBA 1XQHA 2BUDA 5GAMf 2K3XA 3GOXA 1D3BA 4J6WA 1WGSA 3A8GB 2X35A 3QXEB 1JJ2S 4M7AE 3GNGA 2RI2A 5CCAA 3OYNA 4QVDA 4FT4A 4M77C 1PSEA 2XU8A 4M7AC 3SD4A 4RV0A 4M77D 3H8ZA 3QBYA 5CKBA 3VV0A 4M7DE 1Y96A 3HPWA 2ZPIB 4BY6C 1YCYA 2PVDB 3BW1A 3NTHA 3VU3C 1G3YA 3CCEA 5GANj 1I5LA 4BI4A 2F69A 2EIFA 5J26A 4BDYA 5LJ3h 2QI2A 2YVLA 3EAEA 1Q82U 4EMHA 4KDLA 3MP1A 3HRTA 1K9MC 3CC2A 2VC8A 3CMAA 2QEXA 4M75A 2L3RA 2QQ9A 4M78F 4O5VA 2XG8D 4BD3A 4A4EA 4C8QD 4C92F 2WACA 4LDWA 3CCJA 3OBYA 1VQKT 2QA4A 4M7DG 4M77B 4M78E 4C92A 2LT1A 2XHCA 3OSVA 3HU2A 1M1FA 1M1KC 2V8JA 2DXBA 4KUIA 1U1TA 3M4YA 3ZJVA 2WSEE 1Q7YU 4KT0E 2DZ9A 1VQ7A 1R7RA 3EFRA 2RHIA 2DZCA 4OB2B 4IUPA 5DLOA 2E1HA 5CAIA 4N4GA 3GPLA 4XAXB 4M7DF 3EFSA 5LL6S 4BI3A 3PMIA 1YIJT 2Y90A 3TIWA 2L5QA 2LNVA 3OSSC 4LDUA 2X4XA 3RUXA 3JCMP 4PL6A 4X34A 5GAN7 2RI5A 4VUBA 1VQMT 3MB5A 5I2MA 2DXCA 2X4WA 4MMKA 3E9FA 5HY6A 4PJOF 3OA6A 5FROA 3X24B 3QYHB 2EYQA 4J83A 3RKXA 2F5KA 4OGEA 4V2SA 4KDIA 3FDRA 2HD0A 2R58A 5LJ5h 1XTDA 2R5MA 1G3WA 1NZ9A 1QVPA 5GLFA 3FLGA 3OYGA 5CR2A 4KUDK 3RKYA 3CD6A 2KSSA 1FWZA 2DIGA 2HQEA 2Y4YA 4NOYA 3OS1A 5GAOr 4QQDA 3J80E 4LD6A 5GANe 4IKFA 2E6ZA 1WQWA 2EQJA 2JN0A 2Q18X 1JRIA 1N27A 3BY7A 3PFSA 3QO3A 2CYZB 3OYJA 5HK0A 1VQ7T 1VUBA 4A4GA 1K8AC 4OB1B 5DY9A 5KE3A 2DD5A 5GAOn 3CCJT 4HCBA 4F7UG 1G3SA 3JCMh 1VQ5T 1KQ2A 4BB7A 3MP8A 1QW1A 1VQ9T 3FEOA 3QG1A 2QA4T 1MGQA 2KAFA 1Q86U 1G5VA 3FPUA 5GAOp 1N8RU 3SWNB 5KCHA 3VKIA 4JRQA 1KC8C 2PUOB 4FM4B 4C0FA 4E7JA 3SDZA 4ATOA 4M75F 4C8QG 4XU2A 3MO8A 3HP9A 2HQXA 4GLKA 5GMKh 2P0QA 1BI1A 2XICA 3I56A 1NJIU 1WQ7A 3CPWA 3OB9A 2RJDA 1ZC1A 4L5GA 3LH0A 2YUJA 3V8LA 1GXIE 3S3MA 2IVWA 2E65A 4C92G 2CS7A 2EJFA 2Q1DX 3ZEHA 2DXUA 4Q5WA 4C92C 3F70A 4EMKB 3P8DA 2M16A 5GANd 5FRNA 2JOYA 3CXCS 3HFOA 3CCET 3JCMd 1UGPB 3QZ9B 4M77G 4BY6B 3INZA 3CCQT 3CCRT 3G7ZA 1W2BA 1U1SA 1YBYA 2HAXA 1RL2A 5KH6A 2LDMA 3H6ZA 5GMKj 3CCUA 2O4XB 1WNLA 2CKKA 3MEAA 3G71T 5DM7R 4JS5A 4RCBA 2XDBA 4F7UA 3WVDB 1YJ9A 3A8OB 4M78A 3JCMJ 2OTJA 4CRIA 3QZ5B 2CZ6B 2LCLA 4QVZA 2XI9A 4M7AD 4AS1A 1VQKA 4ARIA 3QQ8A 2LCCA 4II1A 1YJNA 3HRUA 2D0QB 4RG2A 2P0PA 2XK0A 5CK9A 5D6XA 1CR5A 4M77E 3OYFA 4HA8A 5C0MA 4JUVA 4LDYA 4ZN1A 3E1SA 3MEVA 3QJ6A 1EIFA 1OYXA 2DPPB 5IN1A 3TREA 1BI3A 3OBWA 2F5TX 4CI0C 3RMSA 2EKOA 4NL2A 2X4YA 5GAMe 4IUUA 4J5YA 3OYHA 4M7DA 2Y4XA 4RCCA 2ZZDA 3NFCA 5I2SA 5GMKi 4N4HA 3C95A 3PIPA 3OYIA 2CZ1B 3JCMV 4OMFB 4C8QE 1K73U 3OY9A 4OF1A 5IT9E 1YITA 3N5BB 2RHUA 3VYHB 3C94A 4C5HA 1I81A 2V8KA 2K2VA 3RMQA 3L2RA 3OW2S 5FRMA 1H641
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDP A;  3OYK A;  3LGL A;  5C6S A;  3OS2 A;  4QQG A;  3OYL A;  2RHI A;  2LRQ A;  4IUP A;  1WJR A;  4PLL A;  2YRV A;  3MEW A;  2RO0 A;  4N4G A;  2RJC A;  4ZTF A;  3PMI A;  3ME9 A;  2D9T A;  2IG0 A;  4ZTJ A;  2X4X A;  3PMT A;  4PL6 A;  4X34 A;  4C5E A;  2DAQ A;  2RI5 A;  3O8V A;  4C5I A;  1WJS A;  3L2W A;  2GF7 A;  4A4H A;  1SSF A;  1OZ3 A;  2NLU A;  2X4W A;  3DB4 A;  3E9F A;  4EDU A;  3OA6 A;  3L2Q A;  5FRO A;  4BE1 A;  4E7K A;  2O4X A;  2RI3 A;  4B9W A;  3OYE A;  2F5K A;  4L59 A;  3OQ5 A;  3FDR A;  2R58 A;  2G3R A;  5IAY A;  4N4I A;  3OYM A;  2R5M A;  4HCZ A;  4FU6 A;  3QKJ A;  1OI1 A;  3FLG A;  3OYG A;  3LGF A;  3OMC A;  3OYC A;  2DIG A;  2E6N A;  2HQE A;  2EQM A;  3UT1 A;  3QII A;  3OS1 A;  2LTO A;  4QQD A;  4IKF A;  4LD6 A;  2M1H A;  4GY5 A;  2EQJ A;  4IUQ A;  2DIQ A;  5D6Y A;  3OS0 A;  3OYA A;  1N27 A;  2BIV A;  3PFS A;  3OYJ A;  4C5G A;  4A4G A;  4BE0 A;  3S3O A;  4BAC A;  3C4S A;  5KE3 A;  3L2V A;  4IUT A;  4E7L A;  3OMG A;  4Z02 A;  5J39 A;  4PLI A;  2MWO A;  2L89 A;  2BKD N;  3MP8 A;  2JTF A;  3FEO A;  4IUV A;  2R5A A;  3P8H A;  1G5V A;  1XNI A;  4E7H A;  5KCH A;  2P0K A;  2QQR A;  3S3N A;  4FL6 A;  5D6W A;  3ASK A;  3MO8 A;  2HQX A;  2E5Q A;  5CIU A;  3L2U A;  4QW2 A;  5KE2 A;  1H3Z A;  1KHC A;  3PNW C;  1OZ2 A;  2RJD A;  3OB9 A;  2MWP A;  3LH0 A;  3M9Q A;  2EQU A;  3S3M A;  2K3Y A;  3BDL A;  4QQ6 A;  3MP6 A;  2GFA A;  4Q5W A;  3F70 A;  3ZEH A;  3P8D A;  2RJE A;  2M16 A;  4UC4 A;  3MEU A;  5FRN A;  2RHZ A;  3NTI A;  3NTK A;  3L42 A;  2VYT A;  3E9G A;  3Q1J A;  5KH6 A;  1WJQ A;  2LDM A;  2L8D A;  2PQW A;  3H6Z A;  2O4X B;  2CKK A;  2BUD A;  2B8A A;  3LX7 A;  3MEA A;  2K3X A;  3GOX A;  1WGS A;  2X35 A;  3UWN A;  4CRI A;  2RI2 A;  3OYN A;  4QVZ A;  2GFU A;  2LCC A;  5KCO A;  4II1 A;  3FC3 A;  4IUR A;  4NS5 A;  4RG2 A;  2XK0 A;  3SD4 A;  4A4F A;  1MHN A;  2RHX A;  3H8Z A;  5D6X A;  3QBY A;  3OYF A;  5C0M A;  3LYI A;  3OYD A;  2R57 A;  3CEY A;  3MEV A;  3QJ6 A;  2FHD A;  1OYX A;  3NTH A;  5IN1 A;  4E7J A;  4OVA A;  2EKO A;  5J26 A;  4BDY A;  2X4Y A;  4IUU A;  5M9O A;  3LLR A;  3EAE A;  3OYH A;  4B9X A;  3MP1 A;  2QQS A;  2M0O A;  4N4H A;  3S6W A;  3DB3 A;  2L3R A;  2JZ2 A;  3MET A;  2EFI A;  4A4E A;  3DLM A;  2LVM A;  4BD3 A;  3OYI A;  2WAC A;  3KUF A;  4BDZ A;  3OYB A;  4BE2 A;  3OY9 A;  2RHY A;  2EQK A;  2RHU A;  4C5H A;  1RI0 A;  3L2R A;  4E7I A;  5FRM A;  2RJF A; 
#chains in the Genus database with same CATH topology
 2XDP A;  3EGD B;  5FWB A;  4MZT A;  1KQS A;  2RK2 A;  3X25 B;  3ME9 A;  2D9T A;  2FPE A;  5LJ3 g;  3M59 A;  5DYI A;  5FWC A;  5L8R E;  3L2W A;  4M7A B;  3L1A A;  4J9F A;  1ZUK A;  8ATC B;  2MMP A;  3L2Q A;  4BE1 A;  3EH1 A;  1VIE A;  3OYM A;  4ESR A;  3SWN C;  3JCM X;  1OI1 A;  4PKC C;  1RAG B;  3OYC A;  2OAU A;  5KYU B;  2DF6 A;  3CC4 A;  4KUL A;  2F2X A;  1Q81 U;  4M78 C;  3OYA A;  2H8H A;  1VQN Q;  1J3T A;  1VQK Q;  4J9I A;  2FZC B;  2CZ7 B;  4E7L A;  1G2B A;  4Z02 A;  1GRI A;  1UGQ B;  1GCQ C;  2LZ6 B;  3P8H A;  4XTX A;  1IO6 A;  3S3N A;  1OQK A;  1BIB A;  2OAW A;  1WZO A;  5KE2 A;  2D6F A;  2FVU A;  4CC3 A;  4FYV B;  4OGC A;  5LJ5 d;  4ELY C;  1U06 A;  3BDL A;  3CMA Q;  2DFU A;  2O01 E;  2H3J A;  2CP3 A;  3MCA B;  3JB9 I;  1E32 A;  1JB0 E;  2QG9 B;  3NTI A;  2EJG A;  1PC0 A;  2FO0 A;  2DJQ A;  3CC4 Q;  2LC4 A;  1GCQ A;  2VV5 A;  3M55 A;  2C0I A;  1M9S A;  4DBH A;  3J81 E;  3A8M B;  1A0N B;  2LQ8 A;  3M53 A;  4TVR A;  3ZJT A;  3LLR A;  4Z8A A;  1QDN A;  2XDD A;  2JZ2 A;  1Y71 A;  3MET A;  3CBM A;  4BDZ A;  2KRM A;  2RHY A;  4PJO G;  4CQN A;  5IXB A;  2EQK A;  5GAN 4;  2KRO A;  2RD1 A;  1RI0 A;  1E6H A;  1I9G A;  1JXO A;  3OYK A;  3CC7 T;  1PCX A;  2MOX A;  3UAT A;  1Y96 B;  4M75 C;  4Z89 A;  2FRW A;  2CT4 A;  1UB4 A;  2NLU A;  1Y7X A;  2NUT B;  2RH2 A;  1BK2 A;  1AWW A;  4N4I A;  2CUD A;  3QKJ A;  5GAM d;  3FJP A;  2ZGW A;  1YJN Q;  4C8Q B;  2KGT A;  3SB2 A;  2KXC A;  2HMA A;  1O54 A;  5C1B A;  1N6A A;  1YWP A;  3QDF A;  2AK5 A;  2ED0 A;  2QEX T;  1X01 A;  3L2Z A;  1M1K U;  3OMG A;  4MZM A;  2P4T A;  1QCN A;  1D1C A;  3M0U A;  3KBG A;  4ARC A;  5LJ3 e;  1QLY A;  3M9Q A;  4OP0 A;  2RB6 A;  4JRI A;  1VA7 A;  1SSH A;  1BCM A;  1X43 A;  2V8I A;  4FYX B;  4DOV A;  4LD9 K;  2EYY A;  1OV3 A;  5GAN 5;  2EBP A;  2HKQ B;  1PSF A;  1T0J A;  4XK8 E;  4JZ3 A;  4JRK A;  2HCK A;  3M5A A;  1RAI B;  5LJ3 j;  2FHD A;  3E19 A;  5KYU A;  2WSC E;  1I5O B;  4HVV A;  1VQ9 A;  3DLL A;  4AFZ C;  3S6W A;  2LMJ A;  3KUF A;  4JS4 A;  4KH0 B;  4A54 A;  5B6C A;  3I56 T;  2KK4 A;  5IHN A;  4ME7 A;  4C8Q A;  4E2F B;  3WXM B;  1TH7 A;  2RA2 A;  2NUT A;  2YRV A;  4M77 F;  4PFO A;  1V76 A;  1X6O A;  1GBR A;  1HK9 A;  3DB4 A;  2NUP A;  5FW9 A;  2RQR A;  3OYE A;  3EG2 A;  1QKW A;  2W10 A;  1ZBJ A;  2QAZ A;  4AQ7 A;  1UGR B;  2XD0 A;  1B07 A;  2CP6 A;  1VQ9 Q;  4M7D B;  1VQ6 A;  5CKF A;  4E6R A;  2CRE A;  2AZS A;  1QVF A;  4IUQ A;  2QQB A;  1AWJ A;  2C0T A;  1X2Q A;  4N0A A;  1M8V A;  2DVE A;  5LJ5 e;  5I21 A;  2BKD N;  1VQP Q;  2JTF A;  2O9S A;  1CZ5 A;  3G6E A;  3H0I A;  2ATC B;  4LXC A;  2YHT A;  1M5Q 1;  3ASK A;  4M7A G;  4FIB A;  1KHC A;  3H0H A;  5ERG B;  4C8Q F;  3REB B;  3GP8 A;  1GL5 A;  2JV2 A;  3MP6 A;  2ZPH B;  2DEU A;  2YLC A;  2QA4 Q;  3JB9 D;  1BIA A;  3E9G A;  4F7U F;  1VQM A;  1XQH A;  2AIR B;  1WGS A;  1JJ2 S;  1W2B P;  4OMN A;  4FT4 A;  4M77 C;  2BZ8 A;  4M7D E;  2HL3 A;  4BY6 C;  1I5L A;  3NTH A;  4B6M A;  5J26 A;  1Q82 R;  2QI2 A;  2QQ9 A;  4A4E A;  2WAC A;  4LDW A;  5KYW B;  2DNU A;  1MV3 A;  1M1K C;  4F17 A;  1UUE A;  1E7O A;  3M4Y A;  4PJM A;  1Q7Y U;  2EYW A;  1MUZ A;  4IUP A;  4OB2 B;  4N4G A;  1X2K A;  4M7D F;  4BI3 A;  1ZUY A;  3OSS C;  4X34 A;  2M02 A;  1E6G A;  3X24 B;  2EGE A;  2EYQ A;  3RKX A;  4KDI A;  2F5K A;  2R58 A;  2H3E B;  2JXB A;  1G3W A;  1NZ9 A;  5GLF A;  2KNB B;  1VQL Q;  2VVK A;  3A98 A;  1WQW A;  2JN0 A;  3CCV Q;  1JRI A;  1T0H A;  1N27 A;  3BY7 A;  4A4G A;  4OB1 B;  4HCB A;  1G3S A;  3CXC P;  4BB7 A;  3MP8 A;  1QW1 A;  2EPD A;  3FEO A;  3O5Z A;  2L0A A;  3QG1 A;  2QA4 T;  2KAF A;  5KYY B;  5GAO p;  3VKI A;  1VQO Q;  4JRQ A;  4FM4 B;  4C0F A;  4ATO A;  4J9E A;  1CKA A;  3I56 A;  1NJI U;  3OB9 A;  2RJD A;  2RQT A;  3V8L A;  1GXI E;  3I9Q A;  2E65 A;  4Q5W A;  3CXC S;  3CCE T;  3JCM d;  3CCQ T;  4M77 G;  1YBY A;  1GCP A;  1I07 A;  1OPL A;  2G6F X;  2O4X B;  3MEA A;  5DM7 R;  4F7U A;  3WVD B;  2OTJ A;  3A8O B;  2XI9 A;  2LCC A;  1ZSZ A;  2CH4 A;  4FYY B;  4F04 B;  4M77 E;  2F2W A;  4FW2 A;  1NM7 A;  2F5T X;  4NL2 A;  4JJC A;  2X4Y A;  5GAM e;  1AEY A;  5I2S A;  3KFV A;  2AT1 B;  3JCM V;  4OMF B;  3OY9 A;  2KYB A;  4C5H A;  3OW2 S;  2BZY A;  4A4K A;  3FB9 A;  3OYL A;  1TUC A;  9ATC B;  3V7S A;  1UHF A;  2K57 A;  4PLL A;  3GIB A;  4PJO C;  3PIO A;  2RO0 A;  3M0R A;  1I0C A;  1YJ9 Q;  3CCV T;  2ROT A;  3HU3 A;  1C6V X;  2D0N A;  1SSF A;  3X26 B;  5LJ5 f;  4F7U B;  4E7K A;  2O4X A;  4M7D D;  3HSB A;  2K5I A;  2MAM A;  3OQ5 A;  3DKM A;  5A0G A;  2ABL A;  2CP7 A;  2YUN A;  3EH2 A;  5FU7 C;  1KQS S;  1I4K 1;  4AG1 C;  2DKG A;  4OB0 B;  2Q1C X;  1SPK A;  4PJN A;  3X28 B;  1KQ1 A;  1VQ4 Q;  2O31 A;  3FPT A;  2L89 A;  3CCS A;  1VYV A;  1YFN A;  2E70 A;  4JDS A;  2V1R A;  3V7C A;  2WSF E;  3REA B;  5A2Q E;  1YHQ A;  1FX7 A;  2DE0 X;  4MDX A;  1IHW A;  1K9M U;  2C0O A;  3NGP A;  5D7U A;  3QUI A;  4J7F A;  1K73 R;  1HYO A;  3CF2 A;  1JJ2 A;  1OU9 A;  3JCM f;  5GAN 6;  1OPK A;  1Y57 A;  3UA6 A;  2DTO A;  4ANJ A;  1NYG A;  2DIL A;  2A7Y A;  2COW A;  4ELZ C;  4ZGE B;  5FU7 B;  1WJQ A;  1VQ8 T;  2RF0 A;  3PT9 A;  1Q86 R;  4R55 A;  1VQ6 T;  3CCS T;  3EGD A;  4RKU E;  5KCO A;  3HHT B;  4IUR A;  3MHX A;  1GFD A;  4A4F A;  3VS5 A;  3QPH A;  3LYI A;  1M90 R;  2R57 A;  1WDX A;  1RAE B;  2IPO B;  4OVA A;  4L6V 5;  4QT7 A;  1UTI A;  1D0X A;  4MZP A;  4M78 B;  3MPU B;  1BCO A;  1M1G A;  1W4S A;  2MYS A;  1K8A U;  1X75 C;  4E7I A;  4O6J A;  1EFN A;  1IB8 A;  4M75 E;  2PU9 B;  5C6S A;  2LNH B;  2W0Z A;  2LRQ A;  1ABQ A;  1KD1 R;  1WHK A;  5FTM A;  2GQI A;  2K4Y A;  1UEB A;  2E5K A;  4LNP A;  1M2V B;  3O8V A;  1NJI C;  4MDW A;  4LDV A;  1OZ3 A;  3A1P A;  5I11 A;  4M7A F;  3CBP A;  3VRY A;  1O75 A;  4ZGD B;  2RI3 A;  4OMO A;  2PWY A;  3I35 A;  2X51 A;  5GAM g;  2EQM A;  2VGM A;  2K9G A;  5D6Y A;  4X9C A;  1NYF A;  3FPR A;  2YRD A;  3JCM b;  4BAC A;  1SHG A;  5J39 A;  2MWO A;  1QMC A;  1VQ5 Q;  2DXT A;  3CBO A;  1YNZ A;  2FZG B;  4J8O A;  4EPC A;  2A3L A;  1RAF B;  1VQ8 A;  3EHR A;  1ABO A;  2E5Q A;  1VQ6 Q;  1IGU A;  3PNW C;  4RTU A;  1KQS P;  1W6X A;  2X4J A;  3MEU A;  1ZSZ B;  3VS3 A;  2L2P A;  1LNX A;  3OYY A;  5ECA A;  4FSS A;  3Q1J A;  5EQJ B;  3RER A;  2L8D A;  3VS2 A;  2NUP B;  1M90 U;  4BUG A;  3MKD A;  1VQM Q;  3EFO B;  4C0D B;  5EPP A;  4DBR A;  1QVF P;  2DJZ A;  2O2O A;  2RHX A;  1S3S A;  1FMV A;  2CDT A;  5IH2 A;  1LOJ A;  4M75 B;  5GAN f;  3PTA A;  4HCC A;  4HXJ A;  4A53 A;  1WXB A;  1UGV A;  3CCL T;  3I5R A;  3EGX B;  2PVO B;  5KYY A;  2DEQ A;  1Z9Q A;  2MIO A;  5I22 A;  2JS0 A;  3SEM A;  4PK4 A;  2GCX A;  4YTL A;  1SHF A;  2MI6 A;  1OEB A;  2JT4 A;  2RQV A;  5HKC A;  1JBM A;  3MEW A;  3PE0 A;  4ZTF A;  2IG0 A;  4XTW A;  2COY A;  2KT1 A;  4JPB W;  1S72 Q;  2LX9 A;  1I8F A;  5GAN h;  2DER A;  4PFZ A;  4EDU A;  2FL7 A;  2XMF A;  4FCY A;  2DL8 A;  3CCM A;  1PKT A;  2LW6 A;  1UDL A;  2DTH A;  4F7U E;  3ZBD A;  1DJ7 B;  3LGF A;  2SEM A;  3QII A;  2LTO A;  2JVV A;  1M3B A;  2DLP A;  1LPL A;  1K73 C;  3QHS A;  2KE9 A;  1QVG A;  1HXD A;  4PFP A;  3AHU A;  3ULR B;  1VQN T;  2ZPE B;  2EYX A;  1MNE A;  4OMM A;  3CCL A;  3A5Z B;  3CC7 Q;  2ED1 A;  3QWZ A;  5KYW A;  2P0K A;  1LJO A;  1D09 B;  4J6X A;  1WXU A;  3HFN A;  1OZ2 A;  1YI2 T;  2MWP A;  3M54 A;  3M56 A;  2P84 A;  1KD1 U;  3NPF A;  2K7A A;  3CCR Q;  3QQ7 A;  3NMZ C;  3CCM T;  1EZZ B;  3P8B B;  2DYI A;  2RK1 A;  2GTO A;  5FTK A;  1SRL A;  2FB7 A;  5GAM f;  4KGX B;  3QXE B;  2OTL Q;  2RI2 A;  2YDL A;  1PSE A;  2LJ0 A;  2SRC A;  2XU8 A;  4M7A C;  4RV0 A;  3H8Z A;  4KRT A;  2RQU A;  3QBY A;  5CKB A;  1Y96 A;  1YCY A;  3VU3 C;  2HSE B;  3RNJ A;  4BI4 A;  2J06 A;  3VS4 A;  1Q82 U;  3HRT A;  4BD3 A;  4C92 F;  2YUP A;  3CCJ A;  5KYX B;  4OML A;  4M7D G;  3VS1 A;  1ZX6 A;  4IIM A;  2XHC A;  2K3B A;  2DXB A;  2V8J A;  4KUI A;  2WSE E;  4KT0 E;  1VQ7 A;  3EFR A;  2RHI A;  5CAI A;  3GPL A;  3TIW A;  2Y90 A;  2CH4 W;  4LDU A;  1PD1 A;  3MB5 A;  5I2M A;  4F16 A;  2YSQ A;  5HY6 A;  3OA6 A;  5FRO A;  2CP5 A;  1GFC A;  2NUZ A;  3FDR A;  4X1V A;  3C0C A;  1UEC A;  1XTD A;  2R5M A;  1IXD A;  2X9H A;  1QVP A;  2BZX A;  3CD6 A;  1FWZ A;  2HQE A;  5GAO r;  5GAN e;  2DX1 A;  2E6Z A;  2FG0 A;  1V1C A;  3PFS A;  2JS2 A;  2CYZ B;  3RBB B;  4WTO B;  1WFW A;  5KE3 A;  2L3S A;  2DD5 A;  3CCJ T;  1SRM A;  4F7U G;  2FRY A;  3CCE Q;  3EGU A;  1Q86 U;  3FPU A;  1N8R U;  1T3L A;  2QTV A;  1D1B A;  2JMA A;  1Y0M A;  2P0Q A;  2XIC A;  3CPW A;  2HKN A;  3S3M A;  2D8J A;  5KYN A;  1QCO A;  2YUO A;  1QWF A;  4RTZ A;  2Q1D X;  3ZEH A;  4C92 C;  4EMK B;  1K9A A;  3P8D A;  2M16 A;  5FRN A;  3HFO A;  3QZ9 B;  4LUE A;  3OW2 P;  2HEQ A;  3G7Z A;  1U1S A;  5IXF A;  1RL2 A;  4HVW A;  3H6Z A;  2JM8 A;  2CKK A;  2F1L A;  3EG0 A;  1IHV A;  1ARK A;  2E3I A;  1UFF A;  4QVZ A;  4AS1 A;  2HQH A;  5D6X A;  1WX6 A;  2L3Q A;  4HA8 A;  5C0M A;  1QCF A;  4ZN1 A;  5IN1 A;  1H92 A;  3OBW A;  3RMS A;  2EKO A;  4IUU A;  4AG2 C;  4J5Y A;  3OYH A;  4FYW B;  2Y4X A;  2ZZD A;  3NFC A;  2A37 A;  4N4H A;  4E7Z A;  3PIP A;  2O9V A;  2CZ1 B;  1KK7 A;  3VS0 A;  2RHU A;  5FRM A;  4ARI A;  4Y92 A;  1UGS B;  3M58 A;  4RTX A;  4QQG A;  3CD6 T;  5FTJ A;  4LDX A;  3HU1 A;  3CCU Q;  1M90 C;  1WPY A;  1PKS A;  2DD4 A;  3JAM E;  5AT1 B;  1WHM A;  4RTT A;  5FU6 C;  4A4H A;  4BI8 B;  1VQ4 T;  2KEA A;  4M75 G;  2AHJ B;  5GAM j;  2B25 A;  4WF2 A;  3JV3 A;  1KD1 C;  3LWH A;  2G3R A;  3ER0 A;  2E41 A;  1UJY A;  3TSW A;  3TEE A;  4RMO A;  5C18 A;  3HKS A;  1D0Y A;  1M27 C;  1B7T A;  3L2V A;  1M2V A;  2DTI A;  4PLI A;  2QXF A;  4E47 A;  1F1B B;  2GTJ A;  4IUV A;  1Y07 A;  2ESW A;  2R5A A;  3VS7 A;  4E7H A;  2DVJ A;  7AT1 B;  4FL6 A;  1I1J A;  2OTJ T;  1KHI A;  2E4H A;  1RLP C;  1FXX A;  1AWO A;  1NPR A;  3QC8 A;  4FW1 A;  1VQ4 A;  1QVF S;  1CKB A;  2OI3 A;  2VYT A;  2OTJ Q;  4J9C A;  2B8A A;  3JRZ A;  2QDL A;  4JZ4 A;  1YIJ Q;  2LT4 A;  2A08 A;  2DL3 A;  3CC7 A;  3HTR A;  2I2L A;  4RTV A;  5FU6 B;  4C0Z A;  1MHN A;  4J9G A;  4XTZ A;  3OYD A;  2LQK A;  3VJP A;  4EMG A;  4C92 D;  1ZA2 B;  3NHN A;  1Q7Y R;  5HK3 A;  3G6E T;  2PVG B;  1W2B S;  2KDS A;  3QJY A;  1U5S A;  2X3W D;  2EGA A;  2EFI A;  3DLM A;  1KIK A;  4PNO A;  3I5S A;  3OYB A;  4C92 E;  4PJO A;  4KO8 A;  2RN8 A;  1U8R A;  4M4Z A;  2RJF A;  1T3S A;  1C1A A;  2BE9 B;  3OS2 A;  3SHW A;  1YCS B;  4AFU C;  2DO3 A;  2XID A;  1VQP A;  4ZGJ B;  2CT3 A;  2RJC A;  1KC8 U;  2PZ1 A;  1TS9 A;  3GF5 A;  1GBQ A;  4PJO B;  3V7R A;  3CCQ A;  5GAN 8;  2PNI A;  4M78 G;  2KXD A;  4M7A A;  1X6B A;  2K5L A;  3UPU A;  4FU6 A;  2KMT A;  1QCS A;  2ZCF B;  3UDC A;  3JCM Q;  1KG1 A;  3PGG A;  5LJ3 f;  1ZSZ C;  2HSP A;  2KRN A;  3CC2 T;  2CP2 A;  1OU8 A;  5HCK A;  5EG2 A;  1VQP T;  3E2U A;  2JNG A;  2JUF A;  2GGR A;  2K2M A;  4FSX A;  3QDR B;  1H3H A;  3JB9 J;  1M8M A;  2VKN A;  3CC2 Q;  1H3Z A;  4QVC A;  2KBT A;  1VQN A;  2ROL A;  4Y28 E;  4QQ6 A;  2ENM A;  2GFA A;  2E64 A;  1NG2 A;  2QGF B;  2QGG A;  3QYG B;  5CCB A;  1RI9 A;  1VYT A;  5CCX A;  3H0F A;  2RHZ A;  5CVI A;  1BI2 A;  4J7I A;  2MM2 A;  3CCV A;  1KFZ A;  1QWE A;  3NTK A;  2PJH B;  2OTL T;  1VQL T;  4XTV A;  1CSK A;  4KLN A;  5GMK m;  3UWN A;  4PJO E;  1PD0 A;  1RAC B;  1XOV A;  5GAN 2;  1MV0 B;  3THK A;  4NS5 A;  2CGH A;  2RM4 A;  1ACM B;  4NL3 A;  2DRM A;  4GLM A;  4JRP A;  4PJO D;  2KQW A;  2YLB A;  4JJN K;  3CC4 T;  5M9O A;  3ZFJ A;  4B9X A;  1M3A A;  3QSU A;  2C06 A;  1VIF A;  3CXC A;  3VUZ A;  3BFM A;  4C0D C;  2DK3 A;  1WYX A;  1S72 T;  5DLQ E;  3GLX A;  3RES A;  4JLI A;  3EG1 A;  4M75 D;  1QP3 A;  2HZY A;  4N0A C;  1WJR A;  2KVQ G;  2XKO C;  1G8X A;  3BDU A;  2KYM A;  4HT8 A;  2X3X D;  2EAY A;  2VXF A;  3CME A;  1WHJ A;  2DBM A;  2DRK A;  5J3B A;  5LJ3 d;  4C5I A;  2GF7 A;  1ZA1 B;  2K79 A;  1VYU A;  1QVG S;  2KI7 A;  3RIR A;  3JCM e;  1R8O B;  4HCZ A;  1FMK A;  3HL8 A;  4AT1 B;  1VQO T;  4GY5 A;  1LVK A;  2RQW A;  5GAO q;  1W1F A;  1YI2 Q;  5GMK e;  3VUB A;  1ZSG A;  2HBP A;  2JTE A;  3HRS A;  5CD1 A;  1P92 A;  3CCU T;  3G4S T;  5D6W A;  2JMC A;  1NPP A;  2QTX A;  1YJ9 T;  3C12 A;  3URG A;  2EVR A;  1YWO A;  1K0X A;  2K6D A;  4ZNX A;  2EQU A;  1WXT A;  2DET A;  2KY9 A;  3FIF A;  2E12 A;  3M0S A;  4UC4 A;  3CCQ Q;  1MND A;  1RLQ C;  3H41 A;  3MJX A;  4XU1 A;  1KC8 R;  5GMK l;  3X20 B;  1JQQ A;  1D3B B;  2VUB A;  2K3X A;  4J6W A;  2X35 A;  4M7A E;  2MPX C;  1MMG A;  3GNG A;  3OYN A;  4QVD A;  3CCS Q;  2A0F B;  1IRX A;  3HPW A;  1MMN A;  2PVD B;  3BW1 A;  3RDV A;  1G3Y A;  4BDY A;  3EAE A;  4KDL A;  3MP1 A;  1PWT A;  3G71 Q;  1K9M C;  2VC8 A;  1OOT A;  2L3R A;  2VWF A;  2LX7 A;  4C8Q D;  1ZLM A;  1RAB B;  1VQK T;  4M77 B;  1PRM C;  4C92 A;  1R0B G;  4AMC A;  3ZJV A;  2DZ9 A;  1YP5 A;  2AKK A;  5DLO A;  2E1H A;  4XAX B;  5LL6 S;  2HBW A;  3PMI A;  1YIJ T;  1EX4 A;  2LNV A;  3JCM P;  1M2O A;  3TVT A;  4PL6 A;  5GAN 7;  1VQM T;  4VUB A;  2DM1 A;  1AZG B;  4D8K A;  2DXC A;  1AOJ A;  1K1Z A;  2X4W A;  3E9F A;  3LH5 A;  1H8K A;  5LJ5 h;  2O88 A;  3FLG A;  4KUD K;  3RKY A;  1D1A A;  2KSS A;  2Y4Y A;  3OS1 A;  4IKF A;  4LD6 A;  2EQJ A;  3QWY A;  3QO3 A;  2P4R A;  1VQ7 T;  2OX7 A;  5GAO n;  3JCM h;  1KQ2 A;  6AT1 B;  1K76 A;  1VQ9 T;  2AKL A;  2DL5 A;  1G5V A;  1D0Z A;  4ORZ A;  2PUO B;  3CME Q;  1KC8 C;  3SDZ A;  2JW4 A;  5GMK h;  1VQ8 Q;  2YXY A;  4L5G A;  3LH0 A;  2YUJ A;  1BB9 A;  3M0T A;  2B86 A;  2EJF A;  2DXU A;  4KGZ B;  1TG0 A;  5GAN d;  1FMW A;  4BY6 B;  2A28 A;  2J6F A;  4F14 A;  5KH6 A;  2LDM A;  4JS5 A;  5GMK j;  1JJ2 P;  1WNL A;  3G71 T;  2XDB A;  4RCB A;  1PHT A;  1YJ9 A;  4M78 A;  3JCM J;  4CRI A;  2LCS A;  4D8D A;  2DYB A;  4CC4 B;  1YJN A;  2D0Q B;  5CK9 A;  2NYS A;  3MEV A;  3QJ6 A;  1WI7 A;  1EIF A;  1OYX A;  2DPP B;  4E7J A;  1BI3 A;  4CI0 C;  2DL7 A;  1X27 A;  4WCI A;  2GBQ A;  4RCC A;  1W70 A;  3C95 A;  2J7I A;  1K73 U;  2QEX Q;  3VYH B;  3C94 A;  1LCK A;  3RR6 A;  3G1J A;  1H64 1;  2EGC A;  2LJ1 A;  1B34 A;  2QAS A;  3A8L B;  4OMQ A;  5CKE A;  1SEM A;  3G6E Q;  3FRN A;  5IHK A;  1RUW A;  2DAQ A;  3RKW A;  5L23 A;  3VYG A;  2J6O A;  3G4S A;  1C0M A;  3CPF A;  3VS6 A;  1VQ5 A;  2JTM A;  3SFM A;  4B9W A;  1IZ6 A;  4L59 A;  2D8H A;  3M0Q A;  5GJV B;  2AZV A;  2J6K A;  3OMC A;  3UT1 A;  1TXQ A;  2QQA A;  4HKE A;  4RTW A;  3V8K A;  4J6Y A;  3OS0 A;  3T9N A;  1ZBX A;  4C5G A;  3M0P A;  4E7S A;  1VOM A;  1OX8 A;  4LN2 A;  1KSW A;  2KR3 A;  2MF2 A;  1XNI A;  2QQR A;  1NBE B;  3GNF B;  3U23 A;  5CIU A;  2CSQ A;  1RAH B;  1V29 B;  1IRE B;  4QW2 A;  2EYZ A;  4EIK A;  5GAM h;  2COZ A;  3JB9 H;  1UJ0 A;  5GJW B;  2RJE A;  2ZPB B;  3L42 A;  4AFQ C;  4KH1 B;  5A0D A;  1MMA A;  4DBF A;  4XU3 A;  4HVU A;  4XQ3 A;  4DQ2 A;  2VGN A;  4LUD A;  3AT1 B;  4HT9 A;  5FLX E;  1R0C B;  3JCM g;  2Q19 X;  1AZE A;  3JCM W;  1NEB A;  2QDY B;  3G4S Q;  2LQN A;  3TU4 K;  2QQS A;  2M0O A;  2M9U A;  2DL4 A;  3R6O A;  4C92 B;  3DB3 A;  4M77 A;  4EMK C;  5LJ5 j;  2LVM A;  4BE2 A;  4XTY A;  4PJJ A;  1YHQ T;  1YJW Q;  1B3Q A;  2RPN A;  1ZQ1 A;  2CP0 A;  1YIT Q;  1U3O A;  1WA7 A;  3LGL A;  3M57 A;  3CQT A;  2GQV A;  3EHQ A;  1Q95 G;  2BTT A;  3TSZ A;  1N8R C;  2E10 A;  2YUQ A;  4ZTJ A;  3TCJ A;  2EJ9 A;  4C5E A;  1YJW T;  4J9D A;  4KOD A;  5GAN 3;  3I55 A;  1WJS A;  1YHQ Q;  2FYK A;  2EKH A;  2YT6 A;  4FT2 A;  1YIT T;  1SG5 A;  4EMK A;  1AHJ B;  3CCR A;  3OW2 A;  2MM0 A;  1WHH A;  4C0G A;  2VB6 A;  3UF4 A;  5IAY A;  1O9S A;  1UE9 A;  2KRS A;  4KBM B;  1Q82 C;  4RTY A;  3BQB A;  5DYG A;  1BU1 A;  3QQ8 A;  1TUG B;  2E6N A;  1QP2 A;  4D6W A;  2DIQ A;  3EGX A;  1B34 B;  5LJ5 g;  2EQI A;  3CMA T;  4IUT A;  4ZN3 A;  2OTL A;  5CQY A;  3IQL A;  1Q7Y C;  4X9D A;  3LW5 E;  1QVG P;  2I0N A;  4M7D C;  1NE8 A;  4RG8 A;  3I55 T;  1RAD B;  1ZHI A;  3ZJU A;  3V8J A;  5GAO l;  3L2U A;  1FYN A;  2D1X A;  2EW3 A;  2K3Y A;  1YIJ A;  4Y91 A;  1YJW A;  1Q81 R;  1WLP B;  1MMD A;  4M78 D;  2LQW A;  3CPW P;  3WVE B;  3CCM Q;  2JM9 A;  2CUB A;  2YRC A;  1BKB A;  2CZ0 B;  5IHI A;  1OUL A;  4C8Q C;  4LE9 A;  2FZK B;  2PQW A;  2DA9 A;  3LGA A;  1M4Z A;  2GFU A;  1N9S A;  3J7A F;  2RMO A;  3FC3 A;  1PM3 A;  3H9N A;  1ZUU A;  3JB9 G;  1JU5 C;  2BE7 D;  3JSC A;  4A63 B;  1WIE A;  4J9H A;  5KYX A;  1Q86 C;  4XU0 A;  3CEY A;  2VXE A;  3EG3 A;  1TSF A;  1VQO A;  1AT1 B;  4K11 A;  5AYF A;  1G3T A;  1QQJ A;  1Q81 C;  5CKH A;  4MML A;  5CQX A;  2E3H A;  2FPD A;  5FTL A;  3A8H B;  1VQL A;  3CPW S;  3OS5 A;  2QYZ A;  1CZ4 A;  1OX9 A;  1YJN T;  3SWN A;  1TOV A;  1YI2 A;  1X69 A;  4XTU A;  1M3C A;  1PNJ A;  3PMT A;  1N9R A;  2ECZ A;  1K4U S;  3G71 A;  2NWM A;  3GBQ A;  2EWN A;  1WHL A;  1JXM A;  2M51 A;  4IIO A;  4DA4 A;  1TU0 B;  2ZPF B;  2MK5 A;  5A0L A;  2V1Q A;  1TWB A;  1BYM A;  3ZL7 C;  3JB9 F;  3M4G A;  1PG5 B;  1JEG A;  1S72 A;  3KXT A;  2Z0W A;  3ZGZ A;  3LHD A;  2M1H A;  3FJ5 A;  1AWX A;  2ZPG B;  1UHC A;  2BIV A;  1WLF A;  4BE0 A;  1BI0 A;  3S3O A;  3CCJ Q;  1WHG A;  3C4S A;  5CKD A;  4CC7 A;  3LWI A;  2PUK B;  3VRZ A;  3EG9 A;  5CO7 A;  5GAO m;  3CME T;  2HNI A;  1QKX A;  4DOW A;  5FTN A;  3JCM c;  2YWW A;  2DMO A;  4DEY A;  2J05 A;  1VQ7 Q;  1NEG A;  4R56 A;  2K5F A;  4OB3 B;  4JLG A;  4P5N A;  4DEX A;  1HD3 A;  2CSI A;  2F2V A;  1SF9 A;  4JJD A;  4OMP A;  5GAN g;  3CD6 Q;  4J9B A;  2Q1A X;  3LX7 A;  2BUD A;  3GOX A;  1D3B A;  3A8G B;  5CCA A;  1G83 A;  1Z9Z A;  1NLP C;  3I56 Q;  2DBK A;  1K8A R;  2HL5 C;  2LJ3 A;  3SD4 A;  4M77 D;  1S1N A;  3QWX X;  3VV0 A;  2ZPI B;  1XJW B;  1IGQ A;  1N8R R;  5GAN j;  3CCE A;  4HCK A;  4PJL A;  2F69 A;  2EIF A;  2MCN A;  5LJ3 h;  2YVL A;  4EMH A;  1M1K R;  2JJ9 A;  3CC2 A;  3CMA A;  2QEX A;  4M75 A;  4O5V A;  4M78 F;  2XG8 D;  2L3P A;  2IIM A;  3OBY A;  2QA4 A;  2VAS A;  4M78 E;  2LT1 A;  3OSV A;  2GNC A;  3HU2 A;  1M1F A;  3BE3 A;  1U1T A;  3PVQ A;  3EFO A;  3UA7 A;  1R7R A;  1X6G A;  2DZC A;  1PRL C;  3EFS A;  3EG9 B;  2L5Q A;  3RUX A;  2X4X A;  1M30 A;  2RI5 A;  2FPF A;  2LP5 A;  4MMK A;  4PJO F;  3TQ7 P;  2PTK A;  3QYH B;  3PVL A;  2RNA A;  4J83 A;  8AT1 B;  4OGE A;  4V2S A;  1AVZ C;  1K9M R;  2HD0 A;  4RUG A;  3OYG A;  5CR2 A;  1AD5 A;  1UG1 A;  2DIG A;  4NOY A;  4QQD A;  3J80 E;  5EC7 A;  2Q18 X;  3OYJ A;  5HK0 A;  1VUB A;  1K8A C;  1NLO C;  5DY9 A;  2HDA A;  1RAA B;  1VQ5 T;  1BBZ A;  1MGQ A;  3SWN B;  5KCH A;  1TUD A;  4M75 F;  2KT8 A;  4XU2 A;  3MO8 A;  3HP9 A;  2HQX A;  4GLK A;  2QK0 A;  4C8Q G;  1BI1 A;  1WQ7 A;  4GBQ A;  4CC2 A;  1ZC1 A;  2FEI A;  3CCL Q;  1N5Z A;  2IVW A;  4C92 G;  2CS7 A;  4JJB A;  3F70 A;  1JO8 A;  2JOY A;  2A36 A;  1UGP B;  3CCR T;  3INZ A;  1W2B A;  1HSQ A;  2HAX A;  4R0K A;  3R6N A;  2M0Y A;  3CCU A;  4DBQ A;  1HJD A;  1R77 A;  2OJ2 A;  3QZ5 B;  1YN8 A;  2CZ6 B;  2LCL A;  4M7A D;  1VQK A;  4II1 A;  1NJI R;  3D7S B;  3HRU A;  4RG2 A;  2P0P A;  4Z88 A;  2XK0 A;  1CR5 A;  4KGV B;  3OYF A;  4JUV A;  4LDY A;  3E1S A;  3TRE A;  3I55 Q;  2ZAE A;  4AFS C;  1SKU B;  2V26 A;  4M7D A;  1KJW A;  5GMK i;  1TTH B;  1K0S A;  3OYI A;  4C8Q E;  4QKU A;  4OF1 A;  5IT9 E;  1YIT A;  3N5B B;  1I81 A;  2V8K A;  2K2V A;  3RMQ A;  3L2R A; 
#chains in the Genus database with same CATH homology
 4A4K A;  1UGS B;  3FB9 A;  3M58 A;  2XDP A;  3OYL A;  4QQG A;  1B34 A;  3CD6 T;  4MZT A;  5FTJ A;  3V7S A;  3GIB A;  2K57 A;  4PLL A;  1KQS A;  4LDX A;  4PJO C;  3PIO A;  1WPY A;  2RK2 A;  2RO0 A;  1M90 C;  3A8L B;  3HU1 A;  5CKE A;  3X25 B;  3ME9 A;  2D9T A;  3FRN A;  3M59 A;  5LJ3 g;  5DYI A;  3CCV T;  2DD4 A;  2DAQ A;  3RKW A;  3JAM E;  3HU3 A;  5L8R E;  3VYG A;  3L2W A;  5FU6 C;  4A4H A;  1SSF A;  4M7A B;  3X26 B;  4BI8 B;  3G4S A;  3CPF A;  3L1A A;  5LJ5 f;  1VQ4 T;  4F7U B;  3L2Q A;  2MMP A;  1VQ5 A;  2JTM A;  4M75 G;  3SFM A;  4BE1 A;  2O4X A;  4E7K A;  4B9W A;  2AHJ B;  5GAM j;  3HSB A;  1IZ6 A;  4L59 A;  2K5I A;  4WF2 A;  2MAM A;  1VIE A;  3OQ5 A;  3LWH A;  3DKM A;  5A0G A;  2G3R A;  3ER0 A;  3OYM A;  3SWN C;  2E41 A;  3JCM X;  1OI1 A;  5FU7 C;  4PKC C;  1KQS S;  1I4K 1;  3OMC A;  3OYC A;  2OAU A;  3UT1 A;  3CC4 A;  4KUL A;  2QQA A;  4HKE A;  1Q81 U;  4M78 C;  3V8K A;  3TEE A;  4RMO A;  2DKG A;  4J6Y A;  4OB0 B;  3OS0 A;  3OYA A;  2Q1C X;  5C18 A;  3T9N A;  1ZBX A;  3HKS A;  4C5G A;  3X28 B;  2CZ7 B;  1KQ1 A;  4E7L A;  3L2V A;  4Z02 A;  2DTI A;  3FPT A;  4PLI A;  2QXF A;  2L89 A;  1UGQ B;  3CCS A;  4E47 A;  2MF2 A;  4IUV A;  1Y07 A;  2R5A A;  3P8H A;  4XTX A;  2E70 A;  1XNI A;  4JDS A;  4E7H A;  2QQR A;  3GNF B;  3S3N A;  3V7C A;  2WSF E;  4FL6 A;  1BIB A;  5A2Q E;  1YHQ A;  1FX7 A;  2OTJ T;  5CIU A;  4MDX A;  1KHI A;  1V29 B;  4QW2 A;  1IRE B;  5KE2 A;  2D6F A;  5GAM h;  2FVU A;  1K9M U;  4OGC A;  5LJ5 d;  3JB9 H;  4ELY C;  3QUI A;  1FXX A;  4J7F A;  1Q81 C;  3BDL A;  1NPR A;  2O01 E;  3QC8 A;  2H3J A;  3MCA B;  2RJE A;  3CF2 A;  1JJ2 A;  3JCM f;  5GAN 6;  3JB9 I;  1VQ4 A;  1E32 A;  2ZPB B;  1JB0 E;  1QVF S;  2DTO A;  3NTI A;  2EJG A;  3L42 A;  2VYT A;  2A7Y A;  4ELZ C;  5A0D A;  4ZGE B;  5FU7 B;  4XU3 A;  1WJQ A;  1VQ8 T;  2LC4 A;  2B8A A;  3JRZ A;  3PT9 A;  4R55 A;  1VQ6 T;  2LT4 A;  4XQ3 A;  3CCS T;  2VV5 A;  4DQ2 A;  2VGN A;  3CC7 A;  3M55 A;  2I2L A;  4RKU E;  5KCO A;  3HHT B;  5FU6 B;  4IUR A;  4HT9 A;  3MHX A;  4C0Z A;  4A4F A;  1MHN A;  3QPH A;  5FLX E;  4XTZ A;  1M9S A;  3LYI A;  3OYD A;  3JCM g;  2Q19 X;  2R57 A;  2LQK A;  3A8M B;  3J81 E;  3JCM W;  3VJP A;  4EMG A;  4OVA A;  2QDY B;  4C92 D;  2LQ8 A;  3M53 A;  4L6V 5;  4TVR A;  3ZJT A;  3LLR A;  5HK3 A;  3TU4 K;  1QDN A;  3G6E T;  2PVG B;  2XDD A;  2QQS A;  2M0O A;  2M9U A;  3R6O A;  2KDS A;  3QJY A;  3DB3 A;  4M77 A;  4C92 B;  4EMK C;  4M78 B;  4MZP A;  2JZ2 A;  1Y71 A;  2EFI A;  3MET A;  3DLM A;  2LVM A;  4BE2 A;  3CBM A;  4XTY A;  4PNO A;  3OYB A;  4BDZ A;  1M1G A;  1YHQ T;  2RHY A;  4PJO G;  4C92 E;  4PJO A;  4CQN A;  1W4S A;  4KO8 A;  2EQK A;  5GAN 4;  1K8A U;  1X75 C;  2RD1 A;  1RI0 A;  4E7I A;  1U8R A;  4O6J A;  1ZQ1 A;  1I9G A;  2RJF A;  3OYK A;  4M75 E;  3LGL A;  3CC7 T;  2PU9 B;  5C6S A;  3M57 A;  3OS2 A;  2GQV A;  2LRQ A;  2DO3 A;  1Y96 B;  1N8R C;  2XID A;  1VQP A;  2K4Y A;  4ZGJ B;  2RJC A;  4M75 C;  1KC8 U;  5FTM A;  2E10 A;  4ZTJ A;  1UEB A;  3TCJ A;  2EJ9 A;  4C5E A;  1YJW T;  4KOD A;  3O8V A;  5GAN 3;  4MDW A;  1WJS A;  3I55 A;  3GF5 A;  1NJI C;  4LDV A;  1UB4 A;  1OZ3 A;  2NLU A;  2FYK A;  4PJO B;  4M7A F;  3CBP A;  4FT2 A;  3V7R A;  1YIT T;  1O75 A;  1AHJ B;  4EMK A;  4ZGD B;  3CCQ A;  5GAN 8;  2RI3 A;  3CCR A;  3OW2 A;  2MM0 A;  1Y7X A;  2RH2 A;  4M78 G;  4C0G A;  4M7A A;  1W2B S;  2K5L A;  5IAY A;  4N4I A;  2B25 A;  1O9S A;  3UPU A;  4FU6 A;  3QKJ A;  2KMT A;  5GAM d;  3FJP A;  4KBM B;  1QCS A;  2ZCF B;  3UDC A;  2ZGW A;  1Q82 C;  2PWY A;  3JCM Q;  3BQB A;  5DYG A;  4C8Q B;  3PGG A;  5GAM g;  3SB2 A;  2E6N A;  1KD1 C;  2EQM A;  1KG1 A;  1QP2 A;  1O54 A;  5C1B A;  1N6A A;  5LJ3 f;  4D6W A;  2VGM A;  2DIQ A;  5D6Y A;  1B34 B;  4X9C A;  3FPR A;  3CC2 T;  5LJ5 g;  2QEX T;  1X01 A;  3L2Z A;  3JCM b;  4BAC A;  3CMA T;  1M1K U;  4IUT A;  4ZN3 A;  3OMG A;  5EG2 A;  5CQY A;  5J39 A;  1VQP T;  2OTL A;  2MWO A;  2JNG A;  2JUF A;  1Q7Y C;  4X9D A;  3LW5 E;  4MZM A;  2DXT A;  2P4T A;  4FSX A;  3CBO A;  4M7D C;  3QDR B;  1NE8 A;  4RG8 A;  3I55 T;  4J8O A;  4EPC A;  2A3L A;  3JB9 J;  1VQ8 A;  1ZHI A;  3ZJU A;  3KBG A;  3V8J A;  5GAO l;  2E5Q A;  4ARC A;  3L2U A;  1H3Z A;  3PNW C;  4QVC A;  5LJ3 e;  3M9Q A;  4OP0 A;  2RB6 A;  2K3Y A;  4JRI A;  1YIJ A;  4Y91 A;  1YJW A;  1VQN A;  4Y28 E;  4QQ6 A;  5CCB A;  2GFA A;  2E64 A;  2X4J A;  3QYG B;  4M78 D;  4M7D D;  3WVE B;  3MEU A;  5CCX A;  5CVI A;  2RHZ A;  1BI2 A;  2V8I A;  1LNX A;  3OYY A;  4J7I A;  1BKB A;  2CZ0 B;  2MM2 A;  4DOV A;  3CCV A;  4LD9 K;  3Q1J A;  4C8Q C;  5EQJ B;  3RER A;  3NTK A;  2L8D A;  2PQW A;  5GAN 5;  2PJH B;  2OTL T;  1VQL T;  1PSF A;  1M90 U;  4BUG A;  4XTV A;  4KLN A;  4XK8 E;  5GMK m;  3UWN A;  3LGA A;  4PJO E;  1M4Z A;  2GFU A;  1N9S A;  4C0D B;  3J7A F;  5EPP A;  1XOV A;  4JRK A;  5GAN 2;  3FC3 A;  4NS5 A;  2CGH A;  2DJZ A;  2RM4 A;  3JB9 G;  3JSC A;  3M5A A;  2RHX A;  4NL3 A;  1S3S A;  5LJ3 j;  1Q86 C;  4XU0 A;  4JRP A;  3CEY A;  2VXE A;  2FHD A;  4PJO D;  2KQW A;  3E19 A;  2YLB A;  1VQO A;  4JJN K;  1LOJ A;  2WSC E;  4M75 B;  3CC4 T;  1VQ9 A;  5M9O A;  5GAN f;  3ZFJ A;  3PTA A;  4HCC A;  3DLL A;  5AYF A;  4B9X A;  4A53 A;  3QSU A;  3S6W A;  5LJ5 j;  2C06 A;  3CCL T;  1G3T A;  1VIF A;  3CXC A;  3VUZ A;  2PVO B;  3BFM A;  3KUF A;  5CKH A;  4A54 A;  4MML A;  4C0D C;  5CQX A;  3I56 T;  4JS4 A;  5B6C A;  2KK4 A;  2DK3 A;  1S72 T;  2DEQ A;  5FTL A;  4ME7 A;  3A8H B;  5DLQ E;  4C8Q A;  1VQL A;  2GCX A;  4YTL A;  3CPW S;  3OS5 A;  2MI6 A;  3GLX A;  3WXM B;  3RES A;  4JLI A;  4M75 D;  1QP3 A;  1TH7 A;  5HKC A;  1CZ4 A;  2RA2 A;  4N0A C;  1WJR A;  2KVQ G;  2XKO C;  3SWN A;  1JBM A;  2YRV A;  3BDU A;  3MEW A;  1YJN T;  4ZTF A;  1YI2 A;  4M77 F;  4XTU A;  2IG0 A;  4XTW A;  3PMT A;  4HT8 A;  1N9R A;  2EAY A;  3G71 A;  2VXF A;  3CME A;  2EWN A;  2LX9 A;  5J3B A;  5LJ3 d;  4C5I A;  1X6O A;  1I8F A;  2GF7 A;  5GAN h;  1HK9 A;  3DB4 A;  4EDU A;  2FL7 A;  4DA4 A;  2ZPF B;  3CCM A;  5A0L A;  3OYE A;  1QVG S;  2LW6 A;  4AQ7 A;  1UGR B;  2DTH A;  3RIR A;  2XD0 A;  4F7U E;  3JCM e;  1R8O B;  4HCZ A;  3ZBD A;  1BYM A;  1DJ7 B;  3LGF A;  4M7D B;  1VQ6 A;  5CKF A;  3JB9 F;  3M4G A;  3HL8 A;  3KXT A;  1S72 A;  1VQO T;  3QII A;  3ZGZ A;  2LTO A;  2JVV A;  3LHD A;  2M1H A;  4GY5 A;  1QVF A;  4IUQ A;  2QQB A;  5GAO q;  1K73 C;  2ZPG B;  3QHS A;  2BIV A;  1WLF A;  4N0A A;  1HXD A;  5GMK e;  1QVG A;  4BE0 A;  3AHU A;  1BI0 A;  3S3O A;  1VQN T;  3VUB A;  1M8V A;  2ZPE B;  3C4S A;  5CKD A;  2DVE A;  5LJ5 e;  3CCL A;  5I21 A;  3LWI A;  2BKD N;  2HBP A;  2JTF A;  1CZ5 A;  2PUK B;  3A5Z B;  3HRS A;  5CO7 A;  3G6E A;  5GAO m;  3QWZ A;  3CME T;  2HNI A;  4DOW A;  2P0K A;  5FTN A;  1LJO A;  5CD1 A;  1P92 A;  2YHT A;  4J6X A;  5D6W A;  3G4S T;  3CCU T;  1NPP A;  1M5Q 1;  3ASK A;  2QTX A;  1YJ9 T;  4M7A G;  4FIB A;  3C12 A;  3URG A;  1KHC A;  3HFN A;  1OZ2 A;  3JCM c;  1YI2 T;  2MWP A;  2EQU A;  3M54 A;  5ERG B;  4C8Q F;  4R56 A;  3GP8 A;  2KY9 A;  3M56 A;  3FIF A;  2JV2 A;  2K5F A;  3MP6 A;  4OB3 B;  1KD1 U;  4JLG A;  4P5N A;  2E12 A;  2ZPH B;  4UC4 A;  3QQ7 A;  2YLC A;  3CCM T;  3JB9 D;  3P8B B;  5GAN g;  1BIA A;  2RK1 A;  3E9G A;  4XU1 A;  4F7U F;  5GMK l;  2Q1A X;  5FTK A;  2FB7 A;  3X20 B;  3LX7 A;  1D3B B;  1VQM A;  2VUB A;  1XQH A;  2BUD A;  5GAM f;  2K3X A;  3GOX A;  1D3B A;  4J6W A;  1WGS A;  3A8G B;  2X35 A;  3QXE B;  1JJ2 S;  4M7A E;  3GNG A;  2RI2 A;  5CCA A;  3OYN A;  4QVD A;  4FT4 A;  4M77 C;  1PSE A;  2XU8 A;  4M7A C;  3SD4 A;  4RV0 A;  4M77 D;  3H8Z A;  3QBY A;  5CKB A;  3VV0 A;  4M7D E;  1Y96 A;  3HPW A;  2ZPI B;  4BY6 C;  1YCY A;  2PVD B;  3BW1 A;  3NTH A;  3VU3 C;  1G3Y A;  3CCE A;  5GAN j;  1I5L A;  4BI4 A;  2F69 A;  2EIF A;  5J26 A;  4BDY A;  5LJ3 h;  2QI2 A;  2YVL A;  3EAE A;  1Q82 U;  4EMH A;  4KDL A;  3MP1 A;  3HRT A;  1K9M C;  3CC2 A;  2VC8 A;  3CMA A;  2QEX A;  4M75 A;  2L3R A;  2QQ9 A;  4M78 F;  4O5V A;  2XG8 D;  4BD3 A;  4A4E A;  4C8Q D;  4C92 F;  2WAC A;  4LDW A;  3CCJ A;  3OBY A;  1VQK T;  2QA4 A;  4M7D G;  4M77 B;  4M78 E;  4C92 A;  2LT1 A;  2XHC A;  3OSV A;  3HU2 A;  1M1F A;  1M1K C;  2V8J A;  2DXB A;  4KUI A;  1U1T A;  3M4Y A;  3ZJV A;  2WSE E;  1Q7Y U;  4KT0 E;  2DZ9 A;  1VQ7 A;  1R7R A;  3EFR A;  2RHI A;  2DZC A;  4OB2 B;  4IUP A;  5DLO A;  2E1H A;  5CAI A;  4N4G A;  3GPL A;  4XAX B;  4M7D F;  3EFS A;  5LL6 S;  4BI3 A;  3PMI A;  1YIJ T;  2Y90 A;  3TIW A;  2L5Q A;  2LNV A;  3OSS C;  4LDU A;  2X4X A;  3RUX A;  3JCM P;  4PL6 A;  4X34 A;  5GAN 7;  2RI5 A;  4VUB A;  1VQM T;  3MB5 A;  5I2M A;  2DXC A;  2X4W A;  4MMK A;  3E9F A;  5HY6 A;  4PJO F;  3OA6 A;  5FRO A;  3X24 B;  3QYH B;  2EYQ A;  4J83 A;  3RKX A;  2F5K A;  4OGE A;  4V2S A;  4KDI A;  3FDR A;  2HD0 A;  2R58 A;  5LJ5 h;  1XTD A;  2R5M A;  1G3W A;  1NZ9 A;  1QVP A;  5GLF A;  3FLG A;  3OYG A;  5CR2 A;  4KUD K;  3RKY A;  3CD6 A;  2KSS A;  1FWZ A;  2DIG A;  2HQE A;  2Y4Y A;  4NOY A;  3OS1 A;  5GAO r;  4QQD A;  3J80 E;  4LD6 A;  5GAN e;  4IKF A;  2E6Z A;  1WQW A;  2EQJ A;  2JN0 A;  2Q18 X;  1JRI A;  1N27 A;  3BY7 A;  3PFS A;  3QO3 A;  2CYZ B;  3OYJ A;  5HK0 A;  1VQ7 T;  1VUB A;  4A4G A;  1K8A C;  4OB1 B;  5DY9 A;  5KE3 A;  2DD5 A;  5GAO n;  3CCJ T;  4HCB A;  4F7U G;  1G3S A;  3JCM h;  1VQ5 T;  1KQ2 A;  4BB7 A;  3MP8 A;  1QW1 A;  1VQ9 T;  3FEO A;  3QG1 A;  2QA4 T;  1MGQ A;  2KAF A;  1Q86 U;  1G5V A;  3FPU A;  5GAO p;  1N8R U;  3SWN B;  5KCH A;  3VKI A;  4JRQ A;  1KC8 C;  2PUO B;  4FM4 B;  4C0F A;  4E7J A;  3SDZ A;  4ATO A;  4M75 F;  4C8Q G;  4XU2 A;  3MO8 A;  3HP9 A;  2HQX A;  4GLK A;  5GMK h;  2P0Q A;  1BI1 A;  2XIC A;  3I56 A;  1NJI U;  1WQ7 A;  3CPW A;  3OB9 A;  2RJD A;  1ZC1 A;  4L5G A;  3LH0 A;  2YUJ A;  3V8L A;  1GXI E;  3S3M A;  2IVW A;  2E65 A;  4C92 G;  2CS7 A;  2EJF A;  2Q1D X;  3ZEH A;  2DXU A;  4Q5W A;  4C92 C;  3F70 A;  4EMK B;  3P8D A;  2M16 A;  5GAN d;  5FRN A;  2JOY A;  3CXC S;  3HFO A;  3CCE T;  3JCM d;  1UGP B;  3QZ9 B;  4M77 G;  4BY6 B;  3INZ A;  3CCQ T;  3CCR T;  3G7Z A;  1W2B A;  1U1S A;  1YBY A;  2HAX A;  1RL2 A;  5KH6 A;  2LDM A;  3H6Z A;  5GMK j;  3CCU A;  2O4X B;  1WNL A;  2CKK A;  3MEA A;  3G71 T;  5DM7 R;  4JS5 A;  4RCB A;  2XDB A;  4F7U A;  3WVD B;  1YJ9 A;  3A8O B;  4M78 A;  3JCM J;  2OTJ A;  4CRI A;  3QZ5 B;  2CZ6 B;  2LCL A;  4QVZ A;  2XI9 A;  4M7A D;  4AS1 A;  1VQK A;  4ARI A;  3QQ8 A;  2LCC A;  4II1 A;  1YJN A;  3HRU A;  2D0Q B;  4RG2 A;  2P0P A;  2XK0 A;  5CK9 A;  5D6X A;  1CR5 A;  4M77 E;  3OYF A;  4HA8 A;  5C0M A;  4JUV A;  4LDY A;  4ZN1 A;  3E1S A;  3MEV A;  3QJ6 A;  1EIF A;  1OYX A;  2DPP B;  5IN1 A;  3TRE A;  1BI3 A;  3OBW A;  2F5T X;  4CI0 C;  3RMS A;  2EKO A;  4NL2 A;  2X4Y A;  5GAM e;  4IUU A;  4J5Y A;  3OYH A;  4M7D A;  2Y4X A;  4RCC A;  2ZZD A;  3NFC A;  5I2S A;  5GMK i;  4N4H A;  3C95 A;  3PIP A;  3OYI A;  2CZ1 B;  3JCM V;  4OMF B;  4C8Q E;  1K73 U;  3OY9 A;  4OF1 A;  5IT9 E;  1YIT A;  3N5B B;  2RHU A;  3VYH B;  3C94 A;  4C5H A;  1I81 A;  2V8K A;  2K2V A;  3RMQ A;  3L2R A;  3OW2 S;  5FRM A;  1H64 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...