5D70H

Crystal structure of mor03929, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
216
structure length
212
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSGISYSGSETYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGFGTDFWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granulocyte-macrophage colony-stimulating factor
publication title Molecular basis of in vitro affinity maturation and functional evolution of a neutralizing anti-human GM-CSF antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 212
sequence length 216
ec nomenclature
pdb deposition date 2015-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d70H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d70H01
3RPIA 3BSZL 1KCVL 3IU3B 3RJDA 3BW9A 4CBPA 2VAAB 4KV5E 1DQLH 2OTUB 4GRWB 5C92A 5DD3H 4QGYA 2VYRE 4Y5XB 3GBLA 5E00B 4TVPH 4QXGH 5E9DD 3I85A 1U3HA 4LLVA 2VDPL 5EZJA 2OL3B 4NO2B 3LKQB 5IT2H 3B5HA 3V0WL 3NBNA 2H6PA 4N8VA 5BRZB 2I9TB 5KANI 5GS3A 4XVJH 1YPZB 1MAJA 2C4FT 2FIRT 3WEXB 1OAZH 2A0LC 4GG8B 1DR9A 4AEEA 4R6UA 2ZWLT 4KRLB 5EIQA 2EE3A 3VWKA 4KDVA 3DIFA 1LP9F 1DZBA 4M4PA 3VWJC 3MR9B 4NZRL 3D69B 3QB7C 2ENYA 4I2XA 5DUMH 3IVKA 5FYJU 1TITA 2X42A 5E5MB 4FHBD 3F6IA 1K8DA 1QFHA 1YN6B 5JPMB 4JFFD 3L5HA 4FA8A 4XT1C 2H9GB 5I1EL 5JORB 4GW5B 3P0GB 3BN9D 3QXUA 4P9HH 5HD8C 3PWJB 3N1FC 5IEKA 1G7JA 5A2JH 4Y2DC 3HCVA 4Y19A 5SV3A 4KROB 2YHGA 4JG1L 1RSFA 3V0VA 3ULVC 3S97C 1NGPH 5F3HA 4WTZG 1BEYH 2IG2H 2WBJC 1AFVL 3LHPL 4WU5B 1KLGB 1TZHB 4APQB 2BXZA 3LD8C 1T0NA 2CO7B 4FZEH 4JFXA 4FRWA 1WT5A 5I2IA 1EXUA 1KN2H 1G7HA 2EECA 3TGXA 5CLWA 2DS4A 1EHLL 2NZIA 5T1LB 4RAUA 1OY3B 2AK4E 1QLFB 5KVMC 4GQPH 2GJ6D 1YA5A 2AQ3A 1MVFA 3ZHKA 5I73C 3MCLL 4K7PL 1WLHA 4PJHB 1VSCA 2X4OA 3B9VA 1AGCA 2F19H 2R0WH 3H6JA 2NY7L 3HE6A 2NZ9D 4CW1B 4NCC2 3WSQH 2D7QA 1QFWI 1OF2B 2L0DA 1SY6L 2NY4B 5F89B 4CJ1A 2ZCHL 2GK0B 3C5ZC 5C08A 3L5XL 3CZFA 4NSKA 3RY6A 4KJPD 2VR9A 2YMXH 3P77B 3G5XA 5L6YL 4L5FL 1KTLB 3FO2A 3MROB 2OR7A 5DMGC 4JZOA 3CK0L 1PD6A 1M05A 3KJ4B 3TA3A 1HIML 4WIQA 1HE7A 3TJHC 1G0YR 4O4YH 3ARBC 4PLOB 4I3GA 3O4OB 4HCRH 2NYYD 1F45A 2GITB 4Y89A 4F9LA 3WKNA 4HIHA 1CE1H 3ZMRA 3D85D 4HJ0C 3S3SA 4K7FA 5E6IC 4LSUH 3VXOB 2ZUVA 2XNAA 3BP5A 3PIQA 2H1PL 1U8HA 4UT9L 5I66B 1MF2H 3DYPA 5GPRA 3TYGH 2OL3L 5DVNA 4X6DE 4UTAL 3ETBF 1A4JB 4QGTA 2BERA 5DT1L 3U46B 4XMPH 2ARJA 3T0AA 5T33L 2VITA 2BC4A 1K2DA 3O3UN 3QIUC 3D3VE 4KRMB 4AEFA 4YAQA 8CGTA 4RDQF 3EYVB 2HFEA 4NUGH 4UQ3A 5D7IF 4U1IA 2O5ZH 5E8EB 1QBML 1QYGL 5KS9F 4ZFOB 2J4WL 4J3VA 1GGUA 1F3DJ 2XXCB 2NXZD 4L4TE 4RAVB 2BVQB 1S5HA 2QR0A 4XNXL 5BJTB 1YYMH 1QBLL 2PNDA 4BK4A 1RJYB 2QHRH 4FTVB 3LCYA 4NJAL 4MJ2A 3ECBB 3D25A 2ORBH 3TO4C 1M6OB 5E8OA 3UCRA 5C2BH 1KJ2A 1IKNA 1CWVA 4HUWB 5IKCB 1VB9A 5SX4I 2X70B 5F21B 1D5ZA 4RGMB 3T08A 1UCBH 1I9JH 5FV2A 2JJSC 4TNWF 1H3WM 1RUPH 2AJZA 3RDTA 1GAFL 4DKFH 4HBQA 5E8NA 1IL1B 4YHNA 3MLSL 3C08H 3VFVB 3VFRA 5D1XC 4DGIL 5CD3B 4RNRB 5F6IB 1YY8B 2BJML 1SEBA 1KTDB 1NAMB 3RPKA 2FJFA 2VDNH 2YUXA 4YBQD 1U8PA 2APVA 1IEHA 1CLYH 2FL5A 1G7PB 3OX8A 4KWUA 4I3RH 1Q72H 2BMKA 1I7TB 4FFYH 5TE4L 2BK8A 3N85H 4ZYKA 1ORQA 1XMWA 4GW4A 5CWSB 5E9DA 7FABH 2RB8A 3ROLA 1RFDL 2OR9L 1DBJH 4HPOL 5MERA 4ZUSA 3UTSD 4Z0XA 1N6UA 3MRCA 3U2SA 1X6NA 3GZKA 1QUNA 5FYLL 3KPPA 3U79A 1NFDB 3SKMA 5AZEL 2BNUA 3UO1H 3H42L 2A6DB 5MENB 1MHCA 2VDQH 3VFTB 1NLDL 3GIVB 3V6FB 1B4JL 1PZ5A 3C6LB 1MY5A 2QSCH 1E4XH 5KANG 2PYEE 1TFHA 4H20L 4KQ4L 3WKMH 4KI5C 4Q9QH 4YO0A 3QQ9D 1LO3H 2A77H 4D9QD 2EC9T 3CU7A 1JV5A 1NGYB 5CAYB 3DUSA 3MRLA 4LLDB 3X12B 3TNNA 1ZGLB 1G6VK 2J8UF 3DGGB 3JTSB 4JFFA 1F8TH 4OF7A 3MRBA 5M7QA 3UP1A 2DWEB 3CFCH 5E1AB 1I1FB 4PRDB 3TH2T 5D71L 1F4YL 1T2JA 1I4FB 3LN4B 3G5ZA 4OI9A 4HF5H 3PL6B 2LVEA 2DD8H 4CMHB 3DUUA 1UJTA 3RTQD 2MHAA 5DTFA 2FO4A 4HH9A 5I71C 2YXMA 4YQXL 3I3BA 5DYOA 4TOYH 2R9HC 3UZQA 3MJ9A 1U91B 3DVIA 5FGBA 1KCLA 2B1HH 3B9DA 4ZMAT 1NMCB 3RUGE 5I1HL 2HVJA 4JKLA 5BZDB 1MFAL 1KB9K 1FBIL 2AXFA 3QDJB 1U93B 1A0QH 2EKJA 3BKYL 3C2SA 3KPRD 5CEYA 4G7VL 5FECA 1C1EH 2LABA 4ZFOL 3CUPA 5MEPB 4M7LH 1LNUA 2NXYC 3W9DA 5E2TH 1CG9A 3PHSA 1PG7L 3MXVL 5L7XL 5D72H 4FQXD 1HCVA 2GJ6A 4JVPA 4PGBB 2BHZA 4QEGA 2AV1B 2BRRH 4JRYB 2G2RB 1WWBX 1QO3A 1W0VB 2A6IA 3ARUA 3W5MA 1LK2A 3EFDL 3LN5B 4MD0A 3IGAA 5GGUB 2GUOB 1JGVH 3RGVD 4XC3H 4NC0B 3GMNB 4L8CB 4WUUB 1IM9B 1XGTB 3F7PC 2DLIA 1NAML 2HFFA 3SDDB 2Q3AA 2XI9A 3BH9B 2AJ3A 3OPZL 5ACZA 3RBSA 1HHHA 5D1ZC 4MNQE 3D85A 1LO5A 1G1YA 4KTDH 4OLUH 1ULVA 4RDQG 2EIBA 3HUJE 4A6YL 2FX7L 4UT7L 3ZSTA 4I3SH 1X4ZA 5C09D 3NCEB 4U2YA 5HDBF 1NGXB 1I8IB 4P5TB 1HKLL 5E1HB 5ICXA 1R3KA 2AGJH 2PXYC 2K3TA 3MRQA 2VUOA 3QG6A 2CDFA 1UB6B 1UACL 1NEZB 5IBTH 4KTEH 3TC9A 5CILH 4MB3A 3I6KA 1SM3L 3UYPA 2ZPKH 1MUJA 5D7LB 4AG4H 1MHEB 1MHPH 2OTWA 3W0WA 3QHFH 3QUKB 5DRZB 5E24E 1YJDC 5FDWA 2P49B 1VADB 4MMXC 2BFVL 2GCYB 4A2LA 2IFFL 3RWDB 4OGZA 4NBXB 4OLZH 1VGKA 1LO0H 2I26N 4EN3D 5ITBL 1G7IA 4HZLA 5HGDA 1QNZL 3TIDA 2BDNH 1T89A 2NY6D 1VCAA 2E9BA 3MRIB 3ZO0A 2YBRB 5GISL 3NPSC 3ULUF 1T20B 3OKEB 1WBXB 1UB5B 4PJ7A 3OBAA 4WFEE 5HVGB 3BEVB 4Y4HC 4M62H 3QULB 4UV7H 1DEEA 5IHUH 5FF6B 4AT6A 2B4CC 3ZSSA 1PSKH 5EC1A 2R2EB 2Z8SA 1EEQA 4OZFH 3BZFB 1U3ZA 2VZSA 1AH1A 2BZDA 2AJXL 1T66C 4XBPB 1BX2B 4JY6A 3WIIL 1YMME 4JKMA 5EU3B 5C0JB 4HWBH 4J7RA 4HS6B 1F11B 1MFCL 2CD0A 4JE4B 1WJ3A 3K2UH 3KWWB 5J1SC 2J5LC 5CEZL 1BREA 1TZGH 4PJFE 3UTSA 2OZ4A 4DN4H 1ITBB 3OV6A 2Z93A 1SJEA 2HTKC 2EXYD 1JBJA 3SQOH 5TDOB 4ENED 3QDGB 2CR3A 5CGTA 4N8PA 5F88B 4J2XA 5MP6H 2FATH 1ORSB 4NQCE 5CZXC 5I1DB 3LQZB 3HRZA 4ELKB 4M7LT 2IFGA 4O5LL 2R8SL 4N0UE 1ZK9A 4Q74A 3U4BL 1K4DB 4JFZL 3CFIC 4PJ9D 4HLZH 3LS4H 1U9KA 4BSVB 2VUYA 5JDSB 3MOBL 5DJ6A 4TSAH 2YC1A 4ORGA 5F44A 3T1WA 1OAYL 1D6EB 1BFVL 3CFKB 2E9WA 4YHIB 1FFOA 2CO6B 3HMWH 3WIFA 4HIIB 3RI5K 5IW1B 5B39B 1IAKA 4ALAH 3H3PL 4H8WH 1MIML 2L7JA 4WO4C 1P9MA 3MV9E 3QQ3A 3OJDB 4M6OL 4JN2B 3RTQA 5AYUL 3FB8B 3HFMH 1JHLL 4GG6B 4XP9H 2VDMH 1AD0B 4PJGA 5CJQL 5F9WB 4YLQT 1AE6H 4J4PD 1R24A 3DO3A 4NRYB 1T21B 2IPKA 1DLFL 4PJ5E 4ZDHA 1BP3B 1ZLUH 4OFPA 4JKPH 4OD2B 5C9JA 1T5XA 1ZWIA 1I3UA 3WFCH 1I1CA 1T5WA 4LBEA 1NFIA 4N0CC 3KPRA 2I60L 5LGKA 2DM4A 5KOMC 3TBVA 4ONHB 2XWTA 8FABB 1BQHB 3ULUC 2CRIA 4LPCA 5DHYB 3RU8L 3CXHJ 1JN6B 2BOCA 5GJTL 4G8FB 2VAJA 5EIIB 4GMTL 4JY4B 4FQXA 1F6AA 1MLCB 4CRPA 1QLEL 1YNTB 1URLA 3WV0A 3NTCL 2ESVE 3EIFA 2G9HB 4GBXC 4JDZA 3TBTA 4U3CA 4YHOL 5JR1L 4YR6A 5JXED 2HN7A 3ULVE 25C8H 3RIAF 2X4RB 3Q6FB 3RGVA 1XGRA 3O2VL 4IRJB 4PJ8D 3RVXD 4PLKC 2FX8H 3AREC 5EUOE 2ICWB 3SE9H 4GKOA 1D9KD 1BVKB 1D5MB 1T04A 2ICEB 1JWUA 4DZ8B 3S35H 3FHAA 1TTGA 1MVUA 5FAAA 4F7CB 5JDJA 1G7QA 4HKBB 4M1CD 3T4AB 5ISZE 3SDYL 4M8VA 1ZLWH 1A64A 1NGZB 2W38A 4P2QB 4WFHD 3VFPA 3T0EB 2YRLA 3UBXA 1G84A 2NX5E 3UTZA 4G3YL 4G43A 5HGBB 1FGVL 3BPOC 1IAII 2OBGA 5HYEA 5GSVA 3AFLA 2C1OA 1VFBB 4K3DH 5GGTA 1W0WA 1HZHL 2N1KA 4CVZB 3C5JB 1JTPA 3G6JB 4X7SL 3G04A 5C09A 3QYCA 2NTFB 2EH8L 4FQLL 1CXLA 2WV3A 3MODH 4EVNA 1MFBL 4MJ6A 3MV7D 4HWUA 5GSRB 4OCSH 1KXQE 3BGMB 2ZNWA 3FB6B 3BIBX 1UVQB 1BBDH 4PRNB 4UQ2A 3NACH 3O4LB 4GXUM 3RWCA 3GMRB 3GDBA 2R4SL 1A1OB 1LP9E 1BJ1H 2UUDH 3A6BL 3B6SB 1KGCD 2P5EB 2W92A 1P4LA 1KB5B 3D18A 1GH7A 3EYQD 5ESAB 3IJSA 4G5ZL 3CSYB 3PXJA 4JHZA 4EN3A 1BF8A 2Z9TA 2X5PA 2A83A 1XR8B 4P4KB 3HLAB 1JPGA 1D5XA 4QNPE 4MAYC 4UT6L 1RUAL 2LU3A 3MCKA 4Z8FH 1NC4B 2APFA 2XZCH 5L9DH 4IDJL 5I15L 5TFSL 4X6CA 3VI4F 4BH8B 2VXUL 1KSRA 4HH8A 5HJ3A 5IMKA 2FCBA 3QNZA 4TULH 4MCZA 2W65A 4XPHL 3L5WA 5HHOD 4KTYA 3EJYD 4HBCH 1TLKA 4YGVB 5E7FA 1P7HL 43CAA 3CLFL 4HKZA 4NQDA 3PV7A 4NFDA 3SPVA 1CD9B 4G80B 1FZJB 3FQNB 1FNEB 1IT9H 4MNQD 2VL5A 1TVBB 4LPVA 1DQQB 2YPKB 3ES6B 3DX6A 5CIPB 3TBSB 1YUHA 3EHBC 1S7VB 1X44A 4X9BA 1WZMA 3GJFB 4H1LH 4HGMA 2G60L 3H8NA 3ZTJH 1MQKL 5DO2C 4YEEA 4NRZA 4EOWH 3O45B 3GB7A 5BXFA 4MXVF 5DI8A 1A6AB 1PX4A 1T7WA 4J8RA 3MRGA 1U8MB 3L3JB 4MD5B 2W9EH 5EB9A 3BZEB 4FFVD 3VD9A 1F90H 1EUTA 1NDMB 4LCYA 1EZVY 2PO6D 5JXAH 2WBJB 4HLJA 2IBGA 4C83A 1P6AB 4HGWB 5DR5H 3EYSH 2PTVA 3TNMA 2IPUG 3HC4L 3H3KA 3PP4L 5L2KA 4KC3B 2Y72A 4BQCA 4FFZL 2BY0A 1IQDA 3L3GB 4PJDE 1F3JB 1C7SA 4PJ9A 2W91A 1R5WB 4XTRC 2GAZA 4OQTH 3AM8C 1EPFA 3MX0A 1F4AA 4PJBB 1FIGL 4G8GB 2MNUA 2EDOA 1I7UA 2DQTL 4OSUH 3JV4A 4UU9A 4AIOA 2P7TA 4N68A 3TEUA 1KEGL 2XV6B 5FYKH 3FL7A 1RIVH 4AEIL 3FRUA 2XWBA 5EDXA 4G8EA 5IHZB 2EO1A 1C5DA 3ALWA 3T0BA 3MBEC 5MEOB 1J7VR 2ZUWA 5T1KD 4D9RE 1BAFH 2MQ0A 4K94L 2YA0A 4OUUA 3PWNB 4KI5E 3N1GC 4PRID 1Z9SA 3KDMB 4J4PA 4RWHA 4YHPA 4Z95H 2LV4A 4LDLB 3V8CA 4U6XA 3RVTC 3OKOA 4X8XA 1LVEA 4O02L 3GM8A 4LRIC 4OFDA 4LMQI 3OGCA 5E8PA 4F33B 1YMMD 4KKBD 3HAEG 3WFHA 2D9CA 2ZSVB 5E6IB 1JUFB 3K1KC 5D7IE 3F7VB 1GCFA 4HEME 3FN0H 5KS9E 4GAYB 4UUJA 2HRPH 1FYTD 4E5XB 4K23L 1KB5L 2VISA 5TDNB 2GSIB 1XR9A 2G75A 4KKCD 5D7JB 2EDTA 3VRIB 4NGHH 1U41A 2PYFB 4U7MA 1UWXH 5FCUL 1CL7H 3LEVH 3X17A 5JXEA 1T4KB 5I1AB 2WBWB 3VFSA 5DJZB 4RWYL 4PJ8A 3OKMA 2P46B 2PW2A 2F8VA 3VFWB 4OGAC 3I50L 3BAEL 2EDHA 1D9KA 1CFVH 1NAKL 2GJZB 1BFOB 5HHPA 1OTSC 5IJKC 1DBKH 4O2EB 4RFOL 2C7UB 2I07B 4HJJL 1FNAA 2O61A 1QEWB 2DI8A 2R0LH 1CDBA 5GRYA 2BSSA 3FRPA 2X1WL 4E41D 4QHLB 3EO9L 3TO4B 4JFOB 3VCLA 2PTTA 1FV1A 4DKEH 4UTBL 1I9RL 3SE3A 3B2VH 3LKSB 2VLLB 4L29A 5I1JL 3EYUL 4OCWH 4HXBH 3TN0C 3OKLB 3MV9D 1D3CA 3CD4A 4PTUA 5DK3A 2WINA 1MWAL 1UG9A 1P7QD 1F02I 3IFPA 5D1XB 4MDJA 4MXQD 5BVJB 5ENWA 4TN9A 4UOW0 4R0LB 4R4FL 5KSBB 1MCOH 3RUGA 3MV7A 5C7XH 2GIYA 4LCUB 5TPWL 2UZIL 3FAXA 4XC1L 1AHWA 2R29H 3LEXB 5FEBA 4M7JL 1LEGB 5AWNL 4HUVB 4U1LA 2WUBL 3DYOA 4S1QL 3TWCL 1ZVSA 1CXKA 1H8OA 4HULB 4GKNA 3BPLC 5HDQH 1T03H 2QADD 3VRLE 4HMCA 4LVOC 4XXDA 2ESVD 1K4CB 5JW5B 3ARDB 3JV6B 2B20A 3GI9L 3HMXA 3CFBA 4PS4L 5I74C 1XF3B 4AYFA 1WZLA 3QZWA 2J8UE 4M61A 2XY2A 1Q9KB 3BVNB 3K80A 1GOFA 5KVFH 4RMQA 1B0GA 4K3HA 3CJJA 1IZKA 4FQ1L 4YPGB 1TZIB 1WC7B 3DTXB 3QFDB 1FG9C 4HK0A 4RMUA 3VH8A 1NUFA 2ATPA 1UEMA 3X11B 2R15A 4ELMB 2YEZA 5HHOA 1AC0A 5ISZD 5HI5D 2HWZL 1MCPH 1ZS8A 1NUGA 3WIHH 2SEBB 4HWZB 3OXSB 1GHFH 4MNQA 2QL1A 1NSNL 2NX5D 4BSJA 4OCMC 1DUZB 2EZ0C 3NA4A 1IBGL 3QEUA 4U1SB 4U1KA 4DCQA 4UIKL 5DJAB 2QBWA 3DRTB 3RKDD 1Z3GL 3PQYB 1CFQB 1JGEA 1SBSL 3L9RA 5JUEL 2QKIB 4N0YL 3MRPB 3T3MF 3HC3L 3HS0B 4OD1L 5D6CA 1N8ZA 4F58H 2FHFA 3PABB 1S7SB 4X99B 5I71B 2APTA 2WANA 4JQVA 3GMMB 1KPRA 1UT9A 1HQRB 4E0RA 1EEUA 3IXAA 2PO6A 4X7TA 4DKDC 3ARYA 3OKKB 1C16B 1M71A 4RMSA 2H2SD 5C0RL 2YRZA 4WCYL 4XHQA 2ITCB 4NQXA 5ITFA 9CGTA 5C0CB 2NXYB 2CUMA 3D9AH 2IQAA 1OW0C 2MTPA 5F96H 1OTUD 1DCLA 1P84J 3MQIA 5CP7B 1F00I 1DE4B 5IB1A 3NCYP 1HSBA 5CUSH 3KYMA 3MUHL 1CE6B 1IGJA 4C56B 1YNLH 4ZUUA 1A2YA 3FQWB 1CLOH 2BNQB 2V2WB 1BBJA 1DQLL 4LSQL 2H3NA 3INUH 5DD3L 4BYHA 3CXDH 1NDGB 1PKQB 2NLJB 3MLWH 1IEBA 4BM7A 4MNGA 2WBKA 4JRXD 2WLYA 4P0DA 5T1KA 4OLXH 5KVEH 5IFJA 5MEQA 3PJSB 3UTTD 2KQMA 4GRLC 3C9NB 1AI1L 4PGCA 1HOCB 1MCWW 4PRIA 4YDLC 2R1XB 3ROOB 5HDBE 1QPPA 2CR6A 2X4PB 2OP4L 3WFDH 5DHVH 1MJ8L 5B22A 5ACLA 4OCXH 1YMMA 2ZCKH 2LQRA 3NZHL 4YDIH 1S7TB 2YRPA 3HNSH 5KG9A 1ACYH 1A7NH 1FAIH 1P6FA 1QSED 3DXAB 4OI7A 1CD8A 1KNOB 4JFPB 1ZANL 1GZQB 1FYTA 5JHLH 3BEWA 4KK5C 3WUWB 5DUML 4PJFA 4OAWA 3BO8B 1N7MH 5D2NB 5ILTH 3P11L 3QXAA 4CVUA 5DFVD 1MRDL 4BZ2H 2ZCLH 2V2TB 4WEMB 4V1DE 1CLZL 1BVLA 3MLTB 5EBMA 3UX9B 4IM8A 1YEFH 2Y1VA 3OAUL 5IB4B 1ZA6B 1H0DB 2ZUUA 3MXWH 5CSZA 5H37H 5C0EA 3QIBD 1JZ4A 3DWTA 3ULUE 2RFXA 5ANME 4PLNC 3LSOB 1PLGH 3SKJL 3U0WH 4P59L 1INEH 4RFNB 2VLJD 1PQZA 3R4DA 1VPOL 4E41A 4LK4A 4IMLB 3WNOA 2YD3A 2GJJA 3PDOB 1BOGB 5I1IH 5JIHA 1P4IH 3C60C 1RUML 4XNUH 4XZUA 2EDFA 3LKPB 3NFNA 3MV9A 4D9RD 1GOHA 2WM0A 4FG6D 3NPSB 1I3RB 1P7QA 1T1YA 4W81A 4AQ1B 4RGNC 3PWLB 5HHMB 1R5VA 3LKOA 5EFIA 1BIIA 3TIEB 1GZPA 3HZMA 3SE8H 2M8XA 4DQOH 1U8JA 5AEAA 4O58H 3EOBB 2FHCA 2P43B 3MV8B 4P2OC 3VXRE 4JO4H 5IG7A 2QSTA 3FO1B 4JJHA 32C2A 5CGYD 2OJZH 2P5WE 3T2NL 4EEEA 4O00A 1EMTL 4KI1A 3FB5B 4GFTB 4ZTOL 3OKDB 3QDME 4M7ZB 4DTGH 5M94B 4WI2A 1OPGL 2Q6WB 1JGDA 2X4TA 3BZ4A 2DN7A 1OCWL 2Z31D 3V4UH 4FQCH 2HLFD 4XRCB 2J5LB 1UJ3C 2YMXL 4IS6B 1KELH 2ESVA 4MX7A 4P46B 5IJVA 3MRMB 4PJEA 4AIZA 2F15A 3NN8B 3M1BA 4M02A 2ZSWA 2GEEA 1U8QB 3QIWD 4LU5L 5D1QC 3OJVC 3JWDH 4HIJA 4NYLB 3ILPB 2W60B 4Q7DA 1RIHL 4LRNL 3U9PH 4LP4A 4K7PY 3GSWB 1YQVH 1II4E 3M17B 5KSBF 4URTB 1HXMA 5HPOA 1MF2L 3ILQD 5HI3C 1S9VB 2IADB 5ISZA 1EBAA 1RMFH 1FP5A 3CVHL 1U8KA 3MBXH 4YPJA 5DQ9A 1QZ1A 4ZPTB 1AJ7H 5JMOC 2CDEA 4XMPL 5IB3B 2E6PA 4QTIH 5F7EL 3STZB 5I1LA 1N0XL 2NX5A 4L3AA 3FFCB 3ARGD 3QHZL 2ITDB 1C5CH 2JB5L 2CKBH 4WO4B 1BZ9B 3FQTA 4NZTH 1X4YA 5I16A 3ZKMD 1BGXH 3S6CA 4DUVA 1I1RA 3P30H 2IH3A 2E7MA 1JYVA 2GSGB 4O2FA 1EEYA 1CS6A 4X6FB 1Y0LB 4NHCH 1O0VA 2APBA 2NY1D 3MRJB 1UH2A 5C2BL 4XBGB 1IQWH 3NAAL 1U92A 3U0PA 4LHUB 5B4MC 4RZCB 3FTGA 3VJ6A 4D94A 4K8RC 4PJAF 2AAVA 1I9JL 2QLVB 3A6CH 5FHAH 5L88H 1T22A 3R06A 3F8UB 4KRPD 1EX0A 1OQOA 1YJDL 4Y4FD 3KHOA 4YXHL 5DK2B 4UIMA 5LCVH 3QUYC 4FS0A 3LOWA 3L3DB 1OP3K 4UDUA 1XIWD 2KUTA 4GBXB 4LEXH 5T3ZL 1LE9A 3GHBH 3K3QA 5DJ2B 3THMH 3IJYA 1I1YB 5FYJE 2YKLH 3QI9B 3MA7A 1F6FB 4ZOEA 1MHHB 2WUCL 2R69H 3OJMB 4BELD 3T2PA 4JRXA 2YPVL 4JAMB 1F58L 3UTTA 5E08H 3L3OB 3WHXB 1DBJL 5BRZD 5I8OL 2NY0C 2B4CL 2HMIC 1VACB 5C0AE 1F3DH 4KXZH 4YFDB 4M00A 3T77A 1ZT7B 3BIKA 2YPLE 3MNWB 3EUUA 4P3DA 4DGVH 1S7XA 5SX5H 2ATKB 4MS8D 3U83A 3UO1L 5F9JA 1XGQA 3QRGH 4W6WB 3S4SG 4ODVH 4MZ2A 3K8LA 3BPOB 3KJ6H 2VDQL 3CPLA 3VFMB 1QSEA 1W72A 3ELAT 1Z9OA 3RVUC 3EJJX 1Q9OB 1PYWA 3EO0B 5J11C 1A14H 3JTTA 1CQKA 3UYRH 1MJ7L 4ZUVA 4U0QB 2A77L 4P57A 1NJ9A 4HKXA 1CK0H 4I77L 2OSLA 5HYJA 3S8WA 3SE4C 3OMZA 4LLMA 3QQNA 3MMEA 3TCLA 2Y9RT 3U4EA 4NM4H 1KLUA 2AKRA 3QWOB 1MCBA 2QQNH 5CJ8A 5D5MB 2D7PA 5HYSB 1T1WB 4JO1L 1FNGB 4WI7A 4QWWC 5GS0H 4HS8L 4Z0BH 3VI4E 3V4VL 1V7MH 4NO5A 4XNMA 2ERJC 3O6LH 3QIBA 5I1KH 4KHTH 4EDXB 4FQ2L 4ERSH 5KTEH 2VLJA 4KK9C 2FLBT 4Z7UA 4WWKC 2IH1B 1PEZA 2B1HL 4APQD 4UV4L 4HD9A 4OZFB 1Z5LA 2A74B 2IPTL 1ZHNA 4RGOH 5H94A 5JZ7C 4JG0H 4JZJC 2PTUA 4KPHH 4Q0XL 1CZ8L 2JELH 5F3BB 5T1LD 3W9EB 4GKZA 1R5IB 3H9SB 4G8IB 4M7LL 4LKXB 4XCFH 5CEXA 1PG7W 1CGUA 4OJFH 3WUZA 3JUZA 4LARL 1UWGL 5EO9A 5E2WL 4ODUB 2F54B 4AMKH 1RD6A 3HAEB 4YNYA 4XCCL 1NGWA 2GHWB 1YECL 3PG2A 3OL2A 5J6GB 3IF1A 1KCKA 1AQDA 1JGVL 2Z91B 2FIKA 3V7AE 1T3FA 1BQUA 1HILA 4S1DD 1KFAL 5GHWH 3LIZH 3VW3H 3RY5A 1LD9B 3KYNB 2Z31A 3F7YA 5LGJA 5T1DH 3DRQA 4PR5A 4JGJA 4HSQA 4G6AC 3OGOE 3IDGB 2B39A 3VXSE 1VA9A 1I8KA 2UWEB 4XCNA 4JDVB 3SBWC 3LQMA 4HDIB 4V1DD 3CDCA 1NLBH 3QIWA 2FEEL 5IW6B 3REWA 5A2LH 3FT3A 4HHAB 3OG6B 5DVOA 3IDXH 4KTDL 3DGCR 2XTLA 3FCTA 2IC2A 3FQUA 5SWSB 5GRXG 1KG0A 5DWUL 1X5ZA 3VXNB 4EUPA 5DMKA 4ZSOE 4B7LA 3SKNB 4QRRB 1XF5A 2DIAA 2VR5A 1QG3A 2YPLB 2AGJL 1EH9A 4F8QA 5CSBA 4NKIH 4KKAC 5FO7A 5FK9B 2R0KH 2IAMD 4YC2C 3P4OB 3V5HA 4M8QA 5SWZB 4AH2A 4ZAKB 5IGXL 4X5XA 3ARGA 1RJLB 3VXMB 5EU6E 5INDB 5DFWH 4MA8L 4CU8A 4V2CB 3VA2C 4XP5H 3MBEB 1OARL 2DICA 3FOMA 3QUML 3QHFL 4Z7VF 3T65B 1UKTA 2DQDH 1DANT 4FTVD 2P24A 3A67H 4YDVB 2EEAA 3NABH 1ZA3A 3O3AB 4I5BA 4I4WA 4NOFA 4PBVC 3EDFA 1XGPA 4EI5D 1OWWA 1XCTA 3CC5B 1U8LB 5JPNA 1P2CB 4CVXA 2JCCA 2BSTA 1Y18B 3NCJH 3QDMD 3RL1A 4Z7WB 1F97A 5I19H 3B9KC 4LLUA 4PGEA 3ZZ1A 1I75A 4LMQE 4G7YH 4PJCA 2R2CA 4WTWA 1YEIL 4Y4FA 2A6JB 5FKPB 4XP4H 3IAPA 5T3XH 4X4XA 4R90H 2VE6B 4M62L 1XIWA 3Q3GB 3IU3A 4WNQB 5CJOH 1PSKL 5GRVK 4UOJA 2OTUA 4UBDC 4TUJB 1IGTB 4PJXB 4LCWE 4YZFF 4OI8A 2AVGA 1Y6MR 3HHRB 3L6FA 2XTJE 4JFDE 4Y5XA 5E03A 4XHJD 5E00A 1TVHB 3ARVA 4M5YH 1HH9A 5IOPB 1QACA 3UTPD 1OB1B 1ZGLP 1O5DT 4NO2A 3V5KB 4IRSC 3DV4A 2OJEB 5BRZA 2I9TA 3R0MA 1YPZA 2EIEA 5IF0A 4OLVH 1DQMH 3WEXA 1QHPA 4GG8A 4D0BB 4DZBB 4OT1L 5MEND 3DVGB 2A1WL 2A9ML 5FXCH 5MP6L 4R8WL 3DSNA 3CDGB 5FUZL 3D69A 5I18H 5IWLA 5C0DB 1FE8H 4M1DL 1EGJH 3SO5A 1KBGL 4L4VE 1RZ8A 5JPMA 1YN6A 3LS4L 2H9GA 2XQBL 3HG1E 2KL6A 5JORA 4GW5A 4ISVB 4NUJB 4TSAL 1HH6B 5L0QC 3PWJA 4AENB 3FKUS 5ESQA 1G9NH 3HMWL 5BV7C 1MFDH 1AGEA 4NO0D 3I84A 3SGEH 2FBJH 1MCJA 3E6FB 3X3FL 1UCTA 4NDMA 1F2XK 3KPMB 5EWIH 5FA4B 1E4WL 5IP4A 4LVOB 3HFML 2W1NA 1A7QH 5F9OH 3K74B 3ZKND 4HC1H 5I74B 4XXCC 1CLCA 3QDJD 1TZHA 4APQA 2CLVA 2D7OA 1ADQA 4I9WE 5JO5A 1TJIL 2HFGH 2V2XB 4JKPL 4PG2A 5JW4R 1MH5B 2VN7A 3GJEA 3WFCL 2CGRH 3C2AL 1AO7B 1YEEL 1A22B 3MRFB 3SGJC 5T1LA 4G9FB 4H1LB 4P4RB 1QLFA 5CEZD 4KDWA 4KY1L 3IFNL 5GZOD 4R96B 5F8RC 2VZTA 3GBNH 4JRYD 4PLJC 3T3ME 5C0AD 1FNLA 1Q1JH 2OM5A 3L3HA 4PRHE 4XBEH 3VRJA 4CW1A 1IZJA 3D39E 5ABDE 1OF2A 25C8L 2MCPH 4XNZB 5F89A 1TJGH 1I7RB 1LDPH 4WUUD 4ZO9A 4J6RL 1FJ1B 1WCBB 3SE9L 4CDGC 1IM9D 4GXVL 1NANH 1FO0L 5JQ6L 1JNJA 5ETUB 1KTLA 5DRWA 4Z7OF 1V3MA 3SDDD 3S35L 1FFRA 4RGNE 2GITA 4XPBL 4H0HB 4G6ML 4V1DA 3SGDI 2BVPB 3MGTB 3AS3A 5BS0B 1RZ7L 1U3HC 5B38G 3KPSE 2N7BA 3PWPE 1E28B 3QPQC 2F53B 4LLWB 3R0NA 1QSFB 5C8JB 5ANMA 1RU9H 3V95A 1SYVB 2F5AH 4L9LB 1VKXB 3BOVA 1P7KB 1QBBA 3AS0A 4IOFD 4TYUA 5D70L 2HT2D 3MODL 1ZLSL 3ARFB 2G5BB 2IAMA 3VWKC 4OIIH 5E8EA 2HYMA 2RCSH 1FH5H 4WI6A 3DO7B 1LE5B 1JWMB 5D7LD 1H8SA 5JIIA 4PRPE 2OK0H 4RAVA 2XYCA 3CMOH 4PUBH 3Q1SH 3VI3E 4GRLB 4JPIB 2UY6A 2WSKA 1YQ2A 3E2HC 1KCRH 2EEBA 1RJYA 2W59A 4FTVA 4YDLB 5KSAB 4C55A 1JGLL 3ECBA 5E8DL 1U8NB 1M6OA 3V4PH 2IMNA 2CSPA 4MA1B 5DD6B 4HUWA 4UILL 4NQSB 5IKCA 2X70A 4ZO6A 1V05A 4N0RA 4MQ7B 3VDAA 5D9SB 2XZCL 1CU4H 2VDPH 3E8UL 5JA9A 2NW2B 1IMHC 3AAZA 5L8JB 3E0GA 4MJIE 4QHUB 4RNRA 2HJLA 1YY8A 2DJSA 3RX7A 1AXSB 4KMQA 1KTDA 1IRAY 1HYSC 1NAMA 3VXSD 4X80H 2FH6A 2P8LB 4P48A 1DL7L 1WT5C 2EDKA 2XZQH 5EBWB 2R56L 4NZRH 2H26B 4HJGB 3U6RB 4EBQL 2H41A 3C8HA 1RJZB 2I27N 4O9HL 3KLSA 5EOCL 3GSOB 4R3SB 4OLEA 3AY4A 1J88A 2DJ4A 4Z6AT 3U7YH 4LQ1A 3BI9X 1GJIA 2Q7YB 5I1EH 4PRHB 1XF1A 3HE6C 2ADJA 3UAJD 3KPTA 4N8VG 3WYRA 4L8BB 1F90L 2A6DA 4PREA 5MENA 3VFTA 4R2GB 5A16B 3RVVD 1QRNB 3GIVA 4XVUC 3V6FA 4Q58C 4Q9BA 3BWAB 1CI5A 3RY6C 4PG9B 3DPBA 4N5ED 3BRFA 4FXGB 3ZKXB 5CZKA 3EFFA 1EA9C 3TA3C 3MZGB 1JZ8A 4LLDA 3X12A 4QRUB 1IAIM 2ZOLA 3JVGC 4RGNB 3CX2A 5CCKL 4JFHD 4F9LC 4PRBB 4PJXF 1AD9B 2AJUH 1AFVH 3LHPH 4P3WA 2B1AH 1I1FA 4PRDA 4MJ5B 4P2OB 4OSUL 3GEWB 1I4FA 3LN4A 4RIRB 3UTOA 4YXKL 2DBJA 1BM3L 5FYKL 4NO0A 2DQHH 3F5WA 1J1XL 5ALCL 3IDNA 3SN6N 4FQQB 5LBSH 3MCLH 1HHKB 1ZHLB 1XH3A 4JQIL 5LGHH 5BZDA 4N9GB 5KZCD 3QDJA 4XH2B 1SY6H 4MHHI 4LCWD 3S3PA 1ONQB 2XTJD 5AG8A 3L5XH 4DK3A 3H0TB 5MEPA 1TXKA 3WO4C 3BDYL 5EO1B 5D1QB 3H9YA 1E27B 3ARSA 2EDYA 3N1MC 4WHYG 4L5FH 43C9A 4JPVL 2ZUYA 3CK0H 3PWVB 2NY5C 2AV1A 3BISA 4JRYA 1HHIA 5C0AA 2ID5A 2X4SB 5EC2B 1W0VA 1IKNC 3LN5A 3N06B 3ET9F 4NGHL 5GGUA 3VE0B 5DD1H 4FQIH 4P2CG 3ZHDA 4IRJD 3QO0B 2RGSA 3OWEA 3LPGA 3RDTC 2H1PH 5FM5M 2Y5EA 3CDFA 4UT9H 4L8CA 2V9RA 4WUUA 2EYSB 3FO0H 5J13B 2OMBA 3KPNB 1OGAE 3X13B 2OL3H 1IM9A 4UTAH 1FN4B 2OX5A 1CFVL 3MNZB 1XGTA 4PJAE 1G6RL 1S8DA 3Q48A 2X7LA 4ZXBC 4P5MB 5T33H 3SDDA 3MJ7B 1RZKC 1ROWA 4P2QD 3T0ED 4H26B 2IQ9H 3AU1B 1QYGH 4XMLH 1KCUH 2B5IB 5EU5B 1JI2A 4X4ZA 5F97E 5J4MA 1J5OL 5GGRB 5TQ2H 2VXQL 5F7WC 4PV9B 4XNXH 2C9AA 1NGXA 1I8IA 4JQXA 3O3EB 3BD3A 4OFVA 1UZ6F 4POUB 1IFHH 3S34L 1EVTC 1DP0A 1OT2A 2Z8VC 3TPKA 4UAOB 2VSDA 4HQQH 5D2LB 1NEZA 4I9WD 5C7XL 4HFWB 3I75B 4N9OB 5DHVB 3OKNB 1XZ0B 2R29L 3W82A 5DA4A 3MLSH 5D7LA 3O4LD 1RI8A 5JW3H 4NPYB 3LPWA 1SJHB 2VKWA 3S96B 1KT2B 2P5ED 3BDXA 4NNYA 4X9HA 1BQSA 1VADA 3A0OA 4NC2B 4OLWH 2GCYA 1T03L 3GSNA 2VQUA 3BN9C 2QHLA 2FECL 4GO6B 5JOEA 2NY0B 1WAAF 4P4KD 3SY0B 4ETYA 1C5BH 4Y1AB 5TE4H 2PN5A 2VXTH 1NC4D 3MRIA 3T8XB 4BUHA 4AK1A 2DL2A 4U3HA 1RFDH 2OR9H 2YBRA 1FQ9C 3OKEA 1UB5A 4YWGH 1U8OB 2ZP0T 3BEVA 3ZLQC 3QULA 5FGBC 5J11B 5FYLH 2M1KA 3DX8B 2R2EA 4EDWL 3VXSA 3QEQB 3RZWA 1PDKA 3RP1A 3DROA 1MCPL 4KJWD 1GL4B 1HINL 2BNRB 1NLDH 1BX2A 1B4JH 5EU3A 5DLMH 4HS6A 1F11A 3D6GA 4PJ7F 4YUEL 5DK0B 1PW3A 3UJTL 2AV7B 3KXFE 5GQBA 2IMMA 4ZUWB 1NCWL 2IANB 4TQEL 4ZSOA 4OZIB 1JNNH 5KN5B 2NZ9C 2DI7A 1GGBH 3RZCB 5TDOA 4PJIF 1XF4B 2JJVA 5F88A 3G6AA 1FSKC 2WBJD 1ORSA 2FJGB 4YHLL 4J3XA 4NQEE 1Z6JT 3LQZA 3DETD 1FG2B 4NN6C 3WHE0 4KJPC 2FB4L 2QQQA 2CXKA 4JZJB 4PRPD 1K4DA 2X9WA 5F7LB 3IKKA 4D8PB 1SQ2N 3B43A 1ZHKB 3MUJA 4BSVA 5JDSA 5HTSA 5I1HH 3D9AL 2NYYC 4WV1A 1MFAH 2ADFH 1D6EA 5IHLB 3HZYA 4BFIB 4OTXL 1N5YH 3ZKQD 4YHIA 3VGFA 2V5YA 5CUSL 4OKDA 4U0RC 2VXSH 4MDIA 1OHQA 4G7VH 5B39A 5E70A 4ZQKB 1CLOL 4OF0A 3CFDB 3X14B 3INUL 3MXVH 3QEGH 4K8RL 5L7XH 4MJID 3CXDL 4JN2A 2FO1A 3FB8A 4GG6A 1AGBB 1AD0A 2D7NA 1T6WA 3RIFK 4CMMB 1INDL 3IDIA 1T21A 4RQQB 3LPFA 3TJHD 5DURB 4OD2A 4M9PA 4LCWA 3PF2A 1W8OA 2GFBB 5I6XC 3NCBB 4OCXL 4ONHA 8FABA 2NXZC 1BQHA 5FM4A 1GC1H 2VO5A 1ACYL 2DYPD 4ZPVA 1JN6A 1EAJA 5JW4N 4G8FA 1YEJH 4DUWA 5EIIA 4PJGF 5K9JL 4DEPC 2CKBB 1MLCA 3CFEB 5D7JD 2G9HA 5C0FB 1WTLA 4Z7VE 4F57L 2VDLL 1T89C 5J9PB 4PD4K 4TUKL 3PXHA 5IMOB 4XWOD 2X4RA 1N5AB 3Q6FA 2ED8A 4IRJA 1CVSC 1A02N 4BZ2L 2WNGA 4NNXB 2ZCLL 3GMQB 4A6YH 1BVKA 4UT7H 4X4YB 1D5MA 1S9WB 3O6FB 2BY3A 4ONOA 1YEFL 4XAKE 1HKLH 5CINL 3DX7B 1EEZA 4F7CA 1JWSB 1WSST 4HKBA 4JO3H 2W0FB 4YBQC 3UBXI 1UACH 1RPQA 1Q0YH 2ZUQC 3U0WL 1NGZA 4QHMB 4P2QA 1MFNA 3T0EA 1F4HA 1SM3H 3MRDB 3KNBA 5TE6H 4YZFE 1E0OB 5I1IL 4CVZA 4XNUL 1DEDA 4BZYA 1R0AH 4UB0L 4TVPD 4RSVA 2IFFH 2R1WA 3CZJA 4R4ND 1KJMB 4LHQB 3QEHB 2XY1A 3RJQB 5EBLB 1H3XA 1Q9WB 1QNZH 1KULA 3TO2B 3F7QA 1UEYA 3BGMA 3QFJB 2FDBP 3UXFA 1ZXQA 3FB6A 1UVQA 4OF3A 5ACMA 4X98B 6FABH 1IGCH 4PRNA 3QQ9C 5GISH 3O4LA 3GMRA 3MPCA 1A1OA 1YMHB 4CAGA 4NN5C 3EYOB 3F7RA 3B6SA 5FGCE 4DTGL 2P5EA 3CH8A 1KB5A 3ARDD 3CSYA 2R1YA 4BK5A 4FQCL 3MUGB 1LEKB 5AAWA 1KELL 1B6UA 4P4KA 3HLAA 3LDBC 1BWMA 4X5LA 2WIIB 5BO1H 15C8H 3QBTB 2R2HB 3U1SL 4KVNL 1NC4A 2VDRH 3FB7A 4OKVB 4BH8A 1SEQL 1P9MC 3U9UB 3RTQC 4CJ0A 4L8SB 4I2XE 5LXGL 3JWDL 3P40A 1WFTA 3BUYB 2EYTB 3CXHK 2WP3O 4HEPG 5HGHB 5HDOA 3U9PL 5C0BB 4WTXA 4YGVA 3C5SB 4I18B 4H0IA 1J87A 1RMFL 3JWOC 1IAMA 1FZJA 3FQNA 1FNEA 1TVBA 2E27L 1DQQA 4MWFB 5CIPA 3BH8A 3BXNA 1IC7L 1S7VA 2R8SH 2XA3A 4MVBD 3L1OL 3GJFA 5GS2H 4MJ4A 3U4BH 3PQYD 1CDHA 4FQXC 1YC7A 1EJOL 4UINL 4Y19E 4QRSB 4LVEA 1A6AA 4WHCA 5H35A 1JNHB 1INQB 1U8MA 1OAYH 3L3JA 3WD5L 4MB5A 1BGXL 4POYA 4JREC 3P30L 3RGVC 4ZOAA 3DUHA 2WBJA 1AGFA 4GSDH 3H3PH 4LGPB 4WEBL 4HGWA 2CUHA 1UXWB 4BH7B 3Q2CA 3VXUB 3EZJB 5AYUH 3L3GA 2X6MA 2DQFB 5C2UB 4ETQB 2AK1H 4QRPB 3CSGA 2XOTA 4ZOBA 3SGKA 1OSZA 1WBZB 5LCVL 3WXVH 4Z7OE 4C56D 3EGSA 4LEXL 1J11A 3OF6D 2FNBA 3AMLA 4TSCH 2EE9A 1RVFL 3RU8H 5IHZA 5HDLA 3IU4L 5CSGA 3WN5B 4MJIA 1ES0B 1CICB 4GMTH 5EA0H 4OZIF 2R69L 1QLEH 3NTCH 1TTFA 4HS3A 5J3HD 2X2YA 2X41A 3BW9B 4OZHB 1B9ZA 1UKQA 2O5YL 3O2VH 4B7IA 4TNWK 3GRWH 4XAWH 5DQDL 2P8PB 3GSRB 4F33A 1BJ1J 2NY2D 5K9OA 3N9GH 4YIQB 2ZSVA 3BP7B 1JZ3A 1WEJH 3DXAD 4P23D 3F7VA 4LLVB 3SCMD 4HX1B 4GAYA 4ODVL 2DYPA 2FYYB 4YBLC 1MI5B 4E5XA 3KXFD 3SDAB 3BP4A 5J56B 5TDNA 3T3PE 2GSIA 3NH7H 4EN3C 5A2KH 4ZD3H 1EAPB 2XG4A 5D7JA 5HGGS 3SDYH 3VRIA 1A14L 4YK4C 1CK0L 2NY6C 4L3CA 4MQXD 3IAQA 1T4KA 4G3YH 5I1AA 1CFNB 3N0PB 5DJZA 3BHBB 2JJWA 3LY6A 2NY3D 3VFWA 5B8CB 3GSUB 2RR3A 2GJZA 2QQNL 3BYTA 4X7SH 2EDEA 4O2EA 2C7UA 2WWMD 4R9HA 1M7DB 5KSVB 3BE1L 4RBPK 5GS0L 1K8DB 1MCKA 5C86A 1V7ML 1QEWA 3B5TA 1MFBH 2DIJA 5I1KL 3O81A 1C8PA 5EOCJ 4QHLA 2KBGA 2IF7A 2JIXB 2C3GA 4ERSL 2DMKA 2YWZA 3EYFA 4JFOA 3LKSA 4U6YA 4K2UH 2VLLA 3UBXG 2R4SH 3KPOB 5J1TC 1G9MC 5BV7L 3OKLA 3DVFA 3V8OA 3HCVB 3QHTC 4JG0L 2VR4A 4Y8DC 5K9KB 4QCIB 4G5ZH 4O2CB 3V0VB 5HHMD 1CR9H 3KS0H 5LQBL 2EXYC 4XCFL 4R0LA 4ENEC 5KSBA 2LTQC 4UT6H 1RUAH 4LCUA 3MV8D 1T0NB 4IDJH 2D0HA 3LEXA 1RK0B 1MLBB 3GSVB 1EXUB 2JJTA 2VXUH 1WICA 2D7MA 4HUVA 1M4KA 3IRZA 1J8KA 2DLHA 5E9DE 4JFQA 1CXIA 5CHNB 3LIZL 4N1EA 5HHVH 2C3VB 1K4CA 5JW5A 3ARDA 4XNQB 3VW3L 4P46D 3CLFH 3JV6A 1QOKA 1GYAA 1AGCB 5T1DL 3V6ZB 3IDUA 3QXWA 3HE6B 1VESA 1Q9KA 1K3ZA 4FMKA 3TPUB 2WQRA 1BZQK 4P3CL 5BZWA 4C4KO 1RHFA 4YPGA 5C08B 3DTXA 2FWOB 3QFDA 1MQKH 3CZFB 4NSKB 4IIQC 5FOBB 3IDXL 4PIRF 3G5XB 3X11A 5CJ5A 4X0KA 1NMAL 4PJAA 3PGCB 4HZAA 4J4PC 1JZ2A 3TA3B 3LRGA 2VMFA 4X6EA 2IGFH 4JFFE 1B6DA 2AP2A 2SEBA 2CH8A 4HWZA 3OXSA 1JPTL 3HC4H 3RY4A 3FFCD 4NKIL 3DBXA 3PP4H 3O41A 1DUZA 1TETL 4RISL 4FFZH 4U1SA 5DJAA 1T7YA 3PQYA 1CFQA 1GSMA 4M48L 3O8XB 1B0RA 5C07B 4Q6IB 4BA8A 2QKIA 5BMFH 3HS0A 4PV8B 3L7EB 5J1AA 4XP5L 1FIGH 1UM4L 12E8L 4X99A 1RIUH 1I1AB 2MPAL 5E6YA 5JXEC 3MJ8B 3GMMA 2ED7A 2A73B 2H45A 2DMCA 4PJ8C 3RVXC 2HFEB 3SDXB 3A67L 4P99A 3OKKA 1IC1A 1C16A 4CN6A 4F9PA 1D9KC 3IXTA 1H3VA 3GNML 5J0BA 2ITCA 4K94H 3WO4B 2N56A 2VLRB 2QR0B 3LH2H 1JRHI 4M1CC 4GOSA 4J3WA 4G7YL 5CP7A 4S10A 3QRFM 2GJ6E 1KB9J 5I1GH 4LNVA 4U2ZA 1A6WL 5HVHB 1CIDA 4O02H 4XGZB 5E8OB 4R90L 3SE3C 2I9LA 1CE6A 4C56A 3TFKD 3OF6A 1J1PL 5CJOL 3FQWA 4DVBB 3QI9D 4HCRA 4NWUL 2V2WA 4WI9A 5D7SH 2D31B 1NDGA 1PKQA 1JPFB 4OBSA 4LIQL 4NIKB 5TF1H 3VFRB 4NN7C 4U4BA 3PJSA 4M5YL 1M7IB 2LVCA 3C9NA 5CGMA 2R23B 1HOCA 4OCNC 1S9XB 2R1XA 3ROOA 1IGFL 5ERWB 4ZXBB 2FJFB 2QTEA 5EZIH 2X4PA 1AHWC 1UZ6E 5DJ0A 4NCC1 3ZDYF 2Q76B 3QQ4B 1HXYB 2C26A 3HE7B 3I50H 1S7TA 2GI7A 4MSWB 1HDMB 1VEMA 3OAZK 2D0GA 3WL9B 5A3ID 3DXAA 3ROLB 1FL6B 3SCMA 3KPLB 1KNOA 4JFPA 1AKJD 1OSPL 1GZQA 4HJJH 3KXFA 3EYQC 3WUWA 1D5BA 4DOHE 1FE8L 1A9EB 1JPSH 2MMXA 4QY8A 3BO8A 1NBYB 1MJUH 1EGJL 1Q94A 2X1PA 5D2NA 3ZE2F 3WNLA 5E4IA 3F12B 3EO9H 1RURL 2BNUB 5T5NG 2V2TA 4UTBH 2BHYA 3MLYL 1NKRA 1WAAE 4IJ3C 2X05A 3ZTNL 6CGTA 5I1JH 1EFQA 2GTZB 2ARJQ 2JLLA 3MLTA 1PZ5B 3OR6B 2X40A 3G9AB 4YO0B 5IB4A 1G9NL 1MWAH 1H0DA 3W0WE 1MFDL 3DUSB 3MLZL 3MRLB 3EJYC 4S11A 3TNNB 4WU7B 4XPTL 4YHYB 4R4FH 4Y16B 3ULVH 3LSOA 3MRBB 1EZVX 2EDQA 2VABA 5J6HB 5ICYA 1RUKL 5F9OL 1YY9C 1YEDB 3FRPG 4M7JH 4HC1L 4S0TD 3PDOA 5AWNH 1BOGA 4P2RB 2WUBH 2E7HA 4S1QH 3TWCH 4KKLD 1EHXA 5J12B 2E7LA 3V6OA 4PY8J 1LK3H 2CLRB 2MHAB 3SJVB 2CGRL 4WGVB 1I3RA 3QJFB 4PJ7E 2IPUK 3PWLA 4JQVC 4FFVC 4W4OA 5HPMB 1CT8B 4JM2B 5JHDB 3GI9H 3O9WC 1P84K 1N2RB 3O2DH 2PO6C 3EOBA 1B2WL 3BN3B 3EDJA 3MV8A 4R26H 3BJ91 2A2QT 2P8MB 4ESKA 5B3JE 4XBEL 3FO1A 4HG4J 3DOSA 4PJIE 5CEYB 4F7PA 5JMRA 1EUUA 3CUPB 3FB5A 3OB8A 4LPWA 3W9DB 2PCPA 1AQKH 3O6ML 2Q6WA 4QOKE 1ZKAA 3IFLH 2KQNA 2Z4QB 3TT1H 1I9IH 2W9LA 4IS6A 2HWZH 1ZT4B 4LGSB 5F7YC 3UTSE 4DWHA 5JLZB 4P46A 2NY5L 3MRMA 1JNLH 2F74A 3MNVB 4NNPL 3QUXB 1KJ2L 3NN8A 3HI1B 5ID0B 3BPNB 1U8QA 1BD2E 4M6MH 3QZWG 1IBGH 4UIKH 5F7HA 3VXQB 5TF0A 5F8QC 5JUEH 1XT5A 3ILPA 2W60A 1YN7B 1PY4A 5SWSD 3HC3H 4OD1H 2IBBA 3GSWA 3M17A 3MRKB 4D9QE 2E9IA 3U7AA 3VH8G 4PJEF 1S9VA 2IADA 4QRRD 3RIAK 4ZPTA 2AJ3B 1RU9L 3PV6B 4YDJB 4YDKL 5ACZB 3D5OF 4LOUD 5AD0B 5IB3A 2YD4A 3U82B 1RZKL 1LO5B 1V3JA 5SWZD 3STZA 3NIGF 1P5UA 1UZ8B 4ZAKD 3FFCA 5C0RH 4U0RB 2V5MA 3VXMD 4WUKL 4OIIL 5I17A 2H8PB 2VZOA 2VOTA 2WAHA 1D5IH 2ITDA 2DTMH 1FH5L 3WFEH 4TUOB 2LU4A 2V7NA 1UM6L 4KKCC 4OCLC 1JE6A 3CMOL 3E6HA 4PUBL 2GSGA 3KLDA 4Z77A 4PJGE 3QG6B 4EIZC 5LWYH 1Y0LA 2GY7B 1KCRL 3ZDZF 3MRJA 4X5WB 2V5RA 4LSQH 3V4PL 3I6KB 1JZ6A 1MUJB 1P5VA 2X4QB 4EKXA 3KPRE 4HUMB 5DMIL 2O5XH 1NBVH 4U1JB 5I6XB 4QT5B 5FDWB 1JPST 1CU4L 1AI1H 4JEGB 5DK2A 4DEPB 3L3DA 3IDYC 5DD0L 4F7EB 1HEZB 4CVWA 1DVFB 3NPZB 1AGDA 2OP4H 5HGDB 5DEGB 3S98A 4EXKA 1MJ8H 4X80L 5DJ2A 1I1YA 3NZHH 3QI9A 5DJDB 5F9AC 3QXVA 2XZQL 1NCUA 1MHHA 1ZANH 4TSBH 1A6VH 3IDJB 1P1ZA 3MLRL 1V7NL 4JAMA 4MXQC 2A38A 2OQJB 3C6SB 1DEEB 2D7TH 3WHXA 1CFSB 1R3IL 5CMAA 3P11H 1JI1A 3U7YL 4M93B 1MRDH 1O7VA 1RULL 1CLZH 3L95B 1J1OH 1WQVT 5F1OB 1WIOA 2QQLL 2ATKA 3TBWB 2QJDA 1QFWH 2EE2A 1WFUA 3OAUH 2XACC 5F6HJ 3RNQA 1A1NB 3VFMA 4JGUA 2X89D 2QADC 3MYJB 2K7QA 1AKJA 1Q9OA 3T09A 3EO0A 3SKJH 4MZ3A 5JIKA 4P59H 5C09E 2OMNA 4M6NL 4QHKJ 2Z93B 1A3QA 1SJEB 1VPOH 1VENA 4YXLL 1L6XA 5GIRB 5EOQL 5BQ7B 2R0ZL 2AJUL 2B1AL 5J7CC 5IMMB 1RUMH 1X5HA 5GRJH 1N6VA 3RWEB 5IROA 1FNGA 4M1GH 1DLHB 4X7FC 4X6BB 3D1MC 5FO9B 5HI5C 3KPQB 2DQHL 3OB0K 1KYOK 4ORGB 4XMKL 5LBSL 2IH1A 1Q38A 1NCAL 5LGHL 4OZFA 2V17L 3T2NH 1DTUA 1EMTH 3RBGA 5IVXB 4ZTOH 3RKDC 1KC5H 1OPGH 1AO7D 5ID1A 4X6CE 5F3BA 1CDUA 1NQBA 4HWBA 1OCWH 2DQJH 4G9FD 4G8IA 1QR4A 3FZUD 1I3GL 3G5VB 1XCQB 1EFXB 4XWGH 1HK6A 1R24B 4Z7UF 4ODUA 1FPTH 4N0FB 5C9JB 1X7QB 4NQDE 2HLAA 1UM5L 2H2SC 1NFIB 1RZIB 2WWKT 4LSSL 4LU5H 4F3FB 5SX4H 5KVGH 5DD1L 4FQIL 3TBVB 2XWTB 4ZS6D 1RIHH 4LRNH 5IW3A 3MOQA 1WBYB 3ZT5A 4YHMH 1RZGB 4OF8A 2YUVA 1OTUC 3FO0L 3BKMH 4B53A 1LD9A 4FQXB 1VEPA 4GT7A 3QWQB 3CVHH 2XKNB 4RBPH 2J6EH 5C70A 1S7UA 3IDGA 1OAQH 2EEDA 4YR6B 2UWEA 5F7EH 1X5AA 4JDVA 1CBVL 1JF6A 4HDIA 1N0XH 4MB4A 4S1SH 5IW6A 3QHZH 2MWCA 4PGJA 2IQ9L 2JB5H 4XMLL 1RK1B 1KCUL 5L2KE 3W0WD 5FYKD 2C3WA 3KG5A 1J0KA 4UMGA 1RY7B 1QSFD 4OZGF 5SWSA 3FQXA 4I0PB 4JM2F 4OCYL 5TQ2L 1MVUB 4JR9L 3UDWA 3MFFB 5TGBB 2D4DA 4IHOB 5AG9A 3SKNA 4QRRA 2Y6SD 4GW1A 4C57C 1FDLL 4WW2B 5DVLA 1I8MA 1IFHL 1ZT1B 3IFOA 3ARFD 3VFPB 5FK9A 4NJ9L 3P4OA 3UBXB 5SWZA 3NAAH 4ZAKA 3GI8H 4HQQL 1RJLA 2CMRL 3VXMA 3E3QC 5K59F 5INDA 5KBNC 2P42B 5GGSB 1YJDH 2HAZA 4YXHH 3MRRA 1B88A 4AL8L 5JW3L 1N6QL 1JIBA 4JHAH 4NRXB 1J10A 1A7OH 2HT4D 5KSAD 3GMPB 5T3ZH 4OLWL 5A2IH 4YDVA 5EPMA 5LG1A 4BFGA 5IM7B 3FOLB 3C09C 3NFPB 5INCB 4Y5VA 2HRLA 1U8LA 1C5BL 2WUCH 1P2CA 3TZVD 3UEZA 2VXTL 3TP4A 1S7RA 1GGCH 2P45B 3QIBC 4FZ8L 2YPVH 4QOKD 2AERT 2WQ8A 2AK4B 1F58H 4A6YB 1TTUA 1P4LB 3E1F1 3MLPA 2Q8BH 5FKPA 5I8OH 1IVLA 2B4CH 2EXWD 4YWGL 2KDGA 4KK8D 4EN3B 2VE6A 3M8OL 3Q3GA 3NIFF 4WNQA 1D5XB 4HV8B 1PBYA 4TUJA 1IGTA 4PJXA 4LQFL 1BD2D 3H2WA 2JCCF 2AI0L 5CBEA 4M3KB 4FG6C 4PJCF 5GRWA 1TVHA 3DSFL 3QNZB 5DLML 4Y4KB 4DAGH 4MCZB 3FT4A 1MCRA 1MJ7H 4LSRL 3WBDA 2MCG1 4ONGH 3V5KA 4I77H 4LLQB 1NCCH 3GGWB 3OR7B 1MCHA 43CAB 4HKZB 3C8KA 4GQ9H 4GRWF 2PETA 2YS4A 1JNNL 2VL5B 4D0BA 5CGYC 4F7TB 1GGBL 3DVGA 3DX6B 4WFHE 5I76B 3K2MC 4R2GD 1H5BA 1QRND 2FD6H 4JO1H 1NMBH 3HZVA 1J86A 3B9EA 3CDGA 4HS8H 4NBYB 3V4VH 2X89A 4NRZB 2Z31C 4KAQL 3IS1X 3VG9B 5TQ0H 2HLFC 4X6DB 3ZDXE 2XPGB 3GB7B 3CH1B 5DI8B 4FQ2H 3MRGB 1N59B 4CKVX 1YPZF 1EBPA 1QLRA 3D3VB 4NUJA 4ISVA 3QIWC 1HH6A 2LTQB 4LCYB 4UV4H 3MV7E 2HKHL 3OSKA 2ADFL 1V8HA 2EDDA 2IPTH 4NQVB 2FJHA 1N5YL 3ZE1F 5GRVL 2VXSL 4Q0XH 1CZ8H 1DQDL 4WHDA 4L4TB 3F62A 4XX1G 5DD5H 1ZV5A 3ILQC 3E6FA 4KUZL 3STLB 3KPMA 3QEGL 2IBZY 5FA4A 1KGCE 5CD5D 4LARH 1UWGH 5E2WH 2WIMA 3BMWA 4GAGL 3DURA 4RFEB 3Q0HA 4XCCH 3BX7C 5D96B 1YECH 3ARGC 2V2XA 5I8CA 1JHTB 4OD3L 1KFAH 2LE9A 5GGTL 3FRUB 1KJVB 1WIPA 4XCYB 1AO7A 1C5DB 3ULUH 3MRFA 3ZKMC 3KGRA 4G9FA 4H1LA 4IIQB 1FORL 5DJXB 1JF1B 1GC1L 2OI9B 4R96A 4LSPL 1YEJL 3DMMD 3TVMB 5HHOE 3ZT6A 3GJFK 2VZUA 1FFQA 2NY1C 2FZ3B 3EJZD 2XXMB 2MKWA 4KH2A 5T1MB 5E8PB 3UPCA 3W11C 3PDGA 2E8ZA 4M5ZL 2D2OA 1F5WA 4LCIL 4KRPC 5EUKA 3CFJA 3QNXB 4Y4FC 5JTWA 1JGUH 3VXPB 3I02B 3T0DA 5DWUH 4WDIA 2BP3A 5DRXB 5IBLD 5ETUA 1L4IA 2YN3A 2G75B 3TH3T 4Z7QE 1XIWC 3V0AC 4PJHF 1PX3A 2ZZUT 4OQTA 1KV3A 2A6KB 4JO3L 1FLTX 5IVXF 3VFSB 5IGXH 1Q0YL 4Y5XC 1WAAA 4PJ8B 3OKMB 5DSCA 1HN1A 3VGBA 3MGTA 1FZKB 3GKZA 4Y5YB 4MA8H 2PYEB 3EDDA 4M4RA 3T0VA 2LU7A 4LVNB 3CX5K 1OARH 3QUMH 4GLRI 5DA0B 5TE6L 4LLWA 3G6DL 4U6HB 1QSFA 3ZL4L 5C8JA 5F1IA 3B8YA 2YWYA 3L3KA 2X4UB 2C4FU 4XP1L 3HI6H 1R0AL 5DC4B 1SYVA 4L9LA 1VKXA 1H15A 1PGRB 1ZVHA 3FN9A 4EUPG 2DF3A 1FV1B 3ARFA 3NGBB 4IOIA 4LNRB 2G5BA 4MS8C 5C0IA 3ARZA 1BFSA 1IGYA 3WE6A 3WS6A 4JCMA 3DO7A 1A6UH 1LE5A 5IWLC 1JWMA 5T5FH 3QH3B 3HA0A 3WLWD 6FABL 1IGCL 4FQJH 2WINB 4HUUA 1YEIH 4MNGE 3U36B 3RFZC 1O7SA 3MACL 4FMFA 1YYLL 4LLYB 5ENWB 3MFGB 4JPIA 1BMGA 2H2PD 4PRIE 3RUGB 5KSAA 4BZ1L 3MRHB 1U8NA 4NQDD 2DQIL 3ZE2E 1FFPB 2FGZA 2P47B 4GKSA 4PJIA 5BO1L 15C8L 1ZLVH 1A6ZB 4JB9L 4Z7NF 4H5SB 3TZVA 3DVNB 5D9SA 4KHXL 2VDRL 4HUKB 5IBUB 5AUMB 4QOKA 4HIEB 3H9HA 1FYTE 3NFSH 4WW2F 1FVDB 3AB0C 2KKQA 1FRGH 1DBAH 1UYWL 3HAEH 3QZWB 4X4ME 4XP6L 4APQC 2P8LA 4M61B 4OT1H 4TTDD 7CGTA 2A1WH 4PG2C 3FFDA 2A9MH 2EO9A 2BNRD 1BD2A 4R8WH 4Q2ZB 5EBWA 4IJ3B 5FUZH 3U6RA 3BQUB 5DXWA 1RJZA 1PEWA 5L2KD 4M1DH 3GSOA 1LO2H 4HK0B 4R3SA 1L7TL 3IETA 1KBGH 1VFAA 4PY7B 3MLVH 3S9DB 2YEZB 3LVEA 2IAND 1K3IA 1KACB 1BQLL 2XQBH 4NKQB 5FYJH 3RZCD 2FGWL 1ZS8B 4MYWB 4E41E 4MNQB 5DJ8B 1U6AH 3HPLA 5A16A 1CF8H 1QRNA 4OV6F 4S1DC 1JHKL 3BWAA 3GSQB 4GSDL 4PG9A 3UJIL 5ELIA 3HUJB 4FXGA 3V5DA 2ZG2A 3PNWB 1JVKA 1JGEB 1G7LB 3X3FH 4XNYH 1E4WH 4QTHB 3EKCA 4QRUA 2E7CA 4NO3B 5J8OA 4D9LH 4G6JL 1NFDF 1QQDB 4OQ1A 3RNKA 3RKPA 3O9WB 4HKJB 1AD9A 5T3XE 2AK1L 1F2QA 3HN3A 3MJGX 2W9DH 1TJIH 4X7TB 4PPTA 3WXVL 1U0QA 5E2UL 1QD0A 5FUOH 5C0ND 3C2AH 1YEEH 1IAIH 4TSCL 4NQXB 5ITFB 3RVWD 2UYLA 4KY1H 3FT2B 3IFNH 3D87B 1LEIB 4LCCC 2V5TA 5EA0L 1S9KC 2BHUA 3S5LA 1HHKA 1KPVA 1ZHLA 2IAMC 3RHWF 4EZMA 4PJEE 1IGJB 1MAMH 4YH6A 4N9GA 4KDTA 1XGYL 1ZHBA 3BESR 3JV5A 3SDCB 5DJYB 3WIHA 1ZE3C 4J6RH 3GRWL 4RA0C 4XAWL 5IVZA 3H0TA 4X6DF 4DN3H 5EO1A 4X8JB 5I1CL 1HNGA 4GXVH 1T6VN 3PGFH 1FO0H 5JQ6H 5T1KB 3N9GL 2RBLA 1WEJL 3V2AR 1S3KL 1ZEAL 4JPKL 3PWVA 3K4AA 1ZSDA 3DMMA 5GGVH 3VD4A 1ZTXH 3NH7L 4XPBH 5EC2A 1KIQB 4ZD3L 3RWIB 3GIZH 4G6MH 3VE0A 4EI5C 4RGMC 1YMMB 3QO0A 1RZ7H 5DEFB 3ZDZE 2EYSA 5JNYA 3O6FD 3X13A 3AXLB 3BEWB 4PJFB 4BQ8A 2HTLD 5BOZG 4F15C 5CFHA 4Z9KB 3HB3D 1G9EA 4P5MA 5IFAH 1FNHA 3HMXL 5D70H 3TESA 3MJ7A 3QXAB 1T2XA 3OB0H 4JHWL 5K33A 1ZLSH 5KSUB 1OWRM 4NQCB 3BPCA 2D3VA 4H26A 1NGQH 2IALA 3QG7H 3QUZD 4I1NB 4XHJC 3W39B 3V6BR 3DLQR 5EU5A 5KAQF 4N0UB 4NM8H 4LFHG 3AY4C 1KPUA 5GGRA 4K2UL 2EYRB 4PV9A 1FYHB 4PFEA 4OB5L 1L7IL 5DZNA 4L3ED 3DECA 3QNYB 2HT3D 3O3EA 5DHXB 1JGLH 4LP5A 5E8DH 1MREL 3IDYB 4CADA 1CR9L 4UILH 1A47A 3DV6A 4LLAA 1I3VA 3QFJD 4HFWA 1AP2B 4MMZC 3U7WL 3I75A 3UC0L 5DHVA 1IILE 3LAFA 1XZ0A 3E8UH 2EC9U 5DS8A 2AABL 4JHBA 3NFNB 3MV9B 4JFEE 1G0DA 4U7SA 1SJHA 3VWJB 1P7QB 3S96A 4JRXE 1A7RH 1R5VB 3LKOB 3UTTE 3T1FB 5DVKA 4KU1A 1U8JB 4G42B 4PJ5B 5FIEA 5HHVL 2DKSA 1DL7H 3O0RL 4NP4L 5IG7B 1OTTD 2R56H 4GXUN 3MA9H 1HYRC 4EBQH 3T8XA 1LHZA 3X3GH 4OGXL 4O9HH 5DVMA 5EOCH 2DQCL 1OM3L 1T83A 3BZ4B 1QSEE 2J3SA 4W68A 5CJXA 3E3QE 4Y2DB 2QADB 5GS0D 3VFUB 1MWAB 4KZEL 2ESVB 3TF7C 5C0BD 3GMLB 5IJVB 3DX8A 1JRHL 3P4MB 2CIKA 3ZKNC 4FNLL 2FR4A 5HYJE 3ALPA 3QEQA 1CFBA 5GGQH 2VXVH 2IGFL 1MQ8A 1U36A 4Q6YA 3CMGA 2BNRA 5TH2B 3GUTA 1JF5A 2XN9E 2Z92B 5EUOB 4JVUA 3LD8B 4XX1E 5ALBL 2UVEA 1LILA 5DK0A 1ODAA 4YHZL 2F8OA 2DBLH 2AV7A 1HXMB 1WF5A 3GO1L 5CCKH 4XCEA 4LEOA 5ISZB 2IANA 5BMFL 5L2JA 4OZIA 1C12B 5DQ9B 1F4WL 5DUPH 5HHQB 2CDEB 3RZCA 2Y36L 5I73B 3BRGC 1XF4A 1RIUL 2VLJE 2FJGA 4Z7UE 5I1LB 2NX5B 3ZYIA 3MO1B 1CFTB 3VGAC 1NL0H 4YXKH 1DFBH 4AM0B 1ZAGA 5E2JA 1BM3H 1FG2A 4WFGD 4J1UB 2B2XH 3VXUD 5E4EC 2QQKH 4NZUH 1N26A 1J1XH 5ALCH 2LAAA 2AXHA 5I16B 3C5ZB 3FQRA 2CDGB 2ZKHH 4ODXB 1ZHKA 2EIZB 3SDDC 4D3CH 3LH2L 4JQIH 1CIUA 5IK3B 1QRKA 3VG0L 5I1GL 5IIEA 3ARBB 3H7BB 2P1YA 5HI4D 1IEAB 1U92B 1UQSB 3BRDA 3BDYH 2AXGA 2VDKH 4ZQKA 3FTGB 3CFDA 1UA6L 1J8HE 1LP9B 5D7SL 2V6HA 2E7BA 4JPVH 4BUGA 4JQXC 1CICD 5TF1L 3VDCA 1AGBA 4CMMA 1WWCA 4OZGE 4IOFC 5FB8B 1MRFL 4ONFL 2HT2C 4RQQA 4ODTL 3HZKB 4YFLF 1LGVA 1AIFB 3I3EA 1X5LA 1K8IB 5EZIL 4BJLA 3QIUB 2PR4L 1NCTA 2A9NL 3ZYOA 4F7MA 2XFXB 3KLAA 2DKUA 1MI5D 3SDAD 5K59E 4GAJH 1G6RH 4GG6F 2CKBA 5GJSL 3P4LA 1CVRA 3CFEA 2XRAH 2M2DA 2ADGA 5C0FA 1JPSL 2VLKE 4ZS7H 1MJUL 1J0YA 5J9PA 4GH7B 1M7XA 4NHUB 4FN0A 4NKOA 3RWGA 1N5AA 4P3DB 1NCDH 2XA8L 4NNXA 2H32H 3CCHB 1J5OH 3CPLB 4GJTB 2VXQH 5D8JH 4XVTL 4X4YA 5DDHB 3O6FA 1PYWB 3DI3B 3AVEA 4ZUVB 4KGLA 4XPFL 1NJ9B 2YD9A 3DX7A 1MNUH 4HKXB 4KQ3L 4CUCA 5IQ7L 3CVIH 3S34H 2W0FA 4LKCB 3WDHA 5DJCB 5T3XD 3ULVL 2JIXD 4QHMA 1BHGA 3MMEB 5A43C 1MJJA 3NIFE 3MRDA 2AKRB 3L3IA 1QR1B 3QUZA 4Y88A 3C09B 4M3JA 4OM1H 4ZUTB 3CU1A 5CP3H 4PBWD 2F9BT 5D7KD 3EAKA 1KENH 2JCCE 5HYQB 4PJDB 3MCG1 2YZ8A 3KYKH 4PJCE 4L3EA 1LK3L 4Y2OA 3UAJC 1KJMA 2V9QA 2I5YH 4POZD 3QEHA 4LSTL 5IMLB 2VLJB 5EBLA 1Z9MA 2GQHA 1Q9WA 1HHGB 4HUXB 3RVVC 3O2DL 1Z5LB 3QFJA 4FXLA 4GRWE 1ZHNB 5EU4A 4N5EC 4R26L 4X98A 5H94B 1NEZG 4CN1A 5J06A 4NKMB 3G6JF 4PGDB 1HQ4B 1YMHA 1CXHA 3SO3C 3EYOA 5CEXB 1AQKL 3IFLL 4XI5D 4WV1C 3EZ8A 1E4JA 1QKZH 5C3TA 4EDWH 3TT1L 1I9IL 3MUGA 5EO9B 4F2MB 5BRZE 1LEKA 4IMKC 3CSPA 3WNPA 2YUWA 3GFUA 1YPZE 4YNYB 1HINH 1JNLL 1R3JA 2R2HA 3VFGH 3IF1B 1T0MB 2CKNA 1AQDB 2FIKB 4E42A 4OKVA 4M6ML 5D7IB 4YUEH 3U9UA 1FCCA 5IV2B 5KS9B 3UJTH 3V7AG 2EC8A 4L8SA 3NA9L 2Y06L 3BUYA 1B4RA 2ARWA 3J7HA 5F9WC 2EYTA 1NCWH 4TQEH 5HGHA 3DRQB 4PR5B 5C0BA 2J2ZA 4I48B 3U0TB 3P3YA 4QXWA 2V7HB 4QRTB 4BQ6A 1MPAH 2DIBA 3C5SA 4I18A 4XCNB 4YHLH 3BP6B 2XTJC 4K3GA 2FLRT 4MWFA 3REWB 3FT3B 2FB4H 3FQUB 4HK3N 3RAJL 1RV6X 5C07D 1Y6KR 3O8XD 1D5IL 2Q7NA 1QTYT 2DTML 3WFEL 2YA1A 4QRSA 2VJXA 5I0DA 3IJHA 1ND0B 5HGAB 1F42A 4W70A 1JNHA 5GZND 1I1AD 4WWID 1KCSL 2FH8A 4R7DB 4OTXH 4IRJC 2B8OT 3V5HB 5LWYL 4M7KH 1H8NA 3MYZA 3BKJL 3S37X 4X5XB 1UKSA 3QSKB 1A4KB 2DAVA 4XPGL 3DNKA 3UZEA 1UXWA 4BH7A 3HPJB 3MRNB 1A3LL 2C3XA 2VZ1A 3VXUA 5F70A 4K8RH 4CNIB 4JFED 4MQSB 3ESVF 1RUQH 2VLRD 3FOMB 2O5XL 2DQFA 1NBVL 2OS7A 1RZJC 2VLME 1INDH 2BVOB 2CJUH 3LQAC 4HPYH 1WBZA 5EO0A 3T0EC 3CVHB 1ZA3B 2GT9B 1GGYA 4I5BB 4PJHE 3RL2B 2RHEA 3GHEH 2F58H 4K9EC 4OFIA 4Y7MA 5FYLE 3ULSB 1S9YB 3K4ZA 3ARWA 3LN9A 5D1ZB 5DFTA 5JPNB 2CLZB 4GRMB 3JZ7A 2VDOH 3RWHB 5B39G 4KRPB 4EI6B 3WN5A 3I3DA 1FNSH 5K9JH 1ES0A 1CICA 4OV5B 1N4XH 4TSBL 3LEYH 1A6VL 4EIGB 4PJBF 3MUZ1 4X4XB 3HR6A 4GMSL 5CJBA 2EDNA 3TT3L 4ZXBD 4F57H 1XIWB 2D7TL 2VDLH 3TH4T 2YOCA 5HYJD 4TUKH 4X4MA 2J8UB 4OZHA 2PXYB 4I0KA 3L6FB 2XN9D 2P8PA 2R4RL 3GSRA 4XB7A 3HE7D 4NWTL 1J1OL 3VFNB 4YIQA 1K6QL 3BP7A 1QFWL 1FL5B 1HH9B 4HX1A 4Q9CA 2FYYA 5CINH 5KJRH 1MI5A 4U1HB 3SDAA 4BKLB 1BQHG 1RHHA 3DV4B 3QO1B 1ZLUK 2VWEC 1EAPA 1IGMH 4P4KC 2DB8A 1L0YA 2XWJB 5I8EB 1TQBC 5IF0B 1OAUL 1A6TB 3MC0A 4LASH 4MD4B 1CFNA 3BHBA 1BJMA 1IC4L 5B8CA 5J89A 1EDQA 3GSUA 3OXRB 3G5YA 5GRJL 2ZOKB 4OFYD 4WENB 4UB0H 4Z7NE 4M1GL 4PP1D 1M7DA 5KSVA 1R3LA 1RZ8B 4Y16D 4QNPF 4EXPX 4ZFZA 1ZOXA 4Y4HB 1EHNA 4FTVE 4KJWC 1YEKH 2JIXA 2OYPA 4B0MM 3SQBA 1NC2D 1U58B 4HWEL 4DUXA 5EH1A 4P2RD 4J3SA 5ESQB 3WJLA 4JGMA 5ADOL 4H25A 1TDQA 3FO9B 1EHAA 3KPOA 1AGEB 2FBOJ 4KMTL 4ZFFA 1J8HD 1L9NA 3SJVD 1KC5L 5K9KA 2ZG3A 4NDMB 4QCIA 4JZNA 4O2CA 4HGKC 4HIXL 2DQJL 1ZLWK 4JM2D 5JHDD 4LSVL 5EZOH 3TM6A 3AB0B 4M6AA 1S7QB 4XWGL 4U3XA 2J88H 3EDKA 3LB6D 1SJXA 3U1SH 4KVNH 2CLVB 5JO5B 3DETC 3BUTA 1FPTL 2JKXA 3GJEB 1RK0A 1SEQH 1MLBA 2OLDA 3GSVA 2DDQL 1HI6B 4PB9H 4NC1E 5KVGL 5LXGH 4NFBA 2OXHA 4ODWB 5GS1A 5F7DB 3S7GA 5ICZB 4HFUH 1B0WA 4PRAA 5CHNA 3UTPE 4YHML 2C3VA 3WXWH 3SGKC 3LZFH 4XNQA 4JN1H 3BKML 4O51B 1JK8B 3QR2A 1EGJA 2VLKD 3L3HB 4Y0GA 3V6ZA 3QUXD 1K85A 2ZUSA 3VRJB 2J6EL 3F58L 2E27H 1NFDE 1OAQL 1MFEH 4JLRA 3TPUA 1IC7H 4Q97A 1U95B 3L1OH 5MENE 3BIAX 4ZODA 4PJDF 5DQJA 4WW1A 2FWOA 2UUDK 1JZ7A 4S1SL 4KZDL 5FOBA 1EJOH 1FZOB 4UINH 1QA9B 2VERN 5IEHB 3PGCA 1CDJA 4TNVF 5DRWB 3WD5H 1GPOL 1GGIL 2HJFB 3JVGA 4ZNEA 2MSPA 4FXKA 3WNMA 4V1DB 4WEBH 4I8DA 4OF5A 2BOBB 4HC1A 1P4BH 3WNNA 2CPCA 3GI8L 4KI5F 3T0WA 4ELMF 5MI0C 5C07A 3O8XA 4Q6IA 1SMOA 4ZTPL 1ETZB 5GRUH 1MCDA 1GIGL 5D7JC 5EN2B 4PV8A 5ANMB 2VTFA 3DX9B 3L7EA 4DGYL 4LCCB 1I1AA 1OT1A 3MJ8A 1SBBA 4JHAL 1KIPB 4XWOC 1R3HB 1NCBH 3A6OA 1A7OL 2A73A 2IAMB 4ODSH 4S2SB 3SDXA 2D03H 5JOPE 3QDJE 4NFCA 1RVFH 2JB6A 3UYOD 3K46A 4JFYB 3IU4H 3SOBH 5IB2A 3VFOA 4JFEA 3AREB 4EQ2A 2R2BA 3OAYK 2VLRA 1GGCL 2ADIB 4TRPH 5E94B 5CEZE 1JYXA 1S7WA 5CZVL 3LS5H 5IQ9B 2Q8BL 1DVFD 1MCWM 4OZ4B 2O5YH 3AS2A 4JRYE 4XGZA 3VXRB 5DQDH 2YD7A 1KIUA 4EI5B 3BGAA 3DYMA 4U6VL 4DVBA 2P5WB 5EBGA 3KR3L 2D31A 2WK2A 3QDMB 4DJMA 4OGYL 4Z76A 1JPFA 5E5UB 3KS0J 3AAZB 4WUUE 2IJ0C 3LKRB 4ODHL 4LSDA 1XEDA 1BLNA 1SVZA 1FGNH 2HJLB 2X4NA 1M7IA 4R4NC 2R23A 4R0LC 3QUMB 4DAGL 4W4NA 1S9XA 4F15B 4ONGL 5ERWA 4ZXBA 1NCCL 4Z78B 3P0YL 1Z9LA 4MAUL 1TNNA 3RWJA 1ADQL 1FL3B 4GQ9L 1Z2KA 2Q76A 2JJTC 3QQ4A 1HXYA 2XN9A 3BKCL 3PGDA 3HE7A 1FAKT 4MSWA 1HDMA 3WL9A 2AQ1A 1J05B 2FD6L 1NMBL 1FL6A 3PE9A 3KPLA 5C6TL 3BE1H 5DZOA 3QJHA 3ARDC 2M26A 4FQHB 4R4BB 4K07A 4KROD 1A9EA 1J9CT 1FFNB 5TQ0L 1YDPB 2DQUL 1NBYA 5KW9L 3VXTA 2ADJB 3WDIA 3F12A 3BFOA 5DRNB 5KVDH 1T80A 5CKGA 5HY9B 4PREB 4P9HC 4KMLB 4JJ5B 2GTZA 4MAYB 1XF2B 3OR6A 5I8KL 2LFGA 4CU6A 5BV7H 2QSVA 3VRLF 1JMZA 4OFYA 5D7LE 4DKAA 3EFFB 3EOTH 2Q86B 4FFWD 3STBA 2VLMD 2ZOLB 4WU7A 1UWXK 5DD5L 2FRGP 5LQBH 4Y16A 2ICWJ 5FYKU 4PP2A 5FYLD 4MXVE 2NMSA 4HK3J 5J6HA 5C1MB 5I30L 4J3UA 1NC2A 4MVBC 5DMYA 1YEDA 1GXEA 3QDAA 4P2RA 1KLFA 2NY4D 2PKDA 1FLRL 1KIRB 1J8HA 4NO0B 2CLRA 5EZLB 3F5WB 3SJVA 3IDNB 4WFFD 3ULUL 3O3DA 3QJFA 1WZ1L 2NR6D 2J8HA 1EFXD 2DLTA 3QA3B 1H9VA 4OZGA 5HPMA 1CT8A 4JM2A 1AY1L 5JHDA 1XH3B 1NBQA 1N2RA 1DBML 2PF6A 4OFKA 4F9PC 3L7FB 5C0GB 4P3CH 2P8MA 1C7TA 4LFHD 4MA3B 5GRZA 4JPWL 3AGVA 3T4YA 1E4XI 4LDEB 1LO4L 1RZFH 5LJYH 43C9B 1NMAH 4V2BA 2Z4QA 4NT6B 1JGUL 5MHSE 1ZT4A 1FVCA 1P69B 1HHIB 5D4QA 5JLZA 5C0AB 2VIRB 2VLKA 3MNVA 3QUXA 3UZVB 1A9BB 3HI1A 1JPTH 2FEDD 5ID0A 3QDGE 2XZZA 3P9MB 5GGSY 3EDEA 3D0LB 1TETH 4RISH 3VGAB 5F7UA 3VXQA 5D93C 4M48H 1YN7A 4TPRL 4J3OC 4KJYA 4R7NB 2WZPD 5E4EB 2DRUA 4I0PD 3HI5H 3MRKA 1S8DB 3BD4A 2X7LB 1UM4H 12E8H 5J3HC 2MPAH 3WLBA 3QCTH 3S36H 3HI6L 3PV6A 3MJ6A 3OHXA 4JFHE 4YDJA 3RA7L 2DOCA 5AD0A 4CGTA 3B8SA 3PP3K 4IEFB 4QYOB 4X7DC 2NY2C 3QXDA 4L9DA 3D0VB 1UZ8A 1N0LA 4P23C 3GNMH 2H8PA 3VMOA 1SY6A 3SCMC 2C5DC 4F37F 2DWDB 3Q6GH 4TUOA 1A6UL 1T7XA 5T5FL 3LRSA 3H3BC 3V79C 4FQJL 5D2NC 1FO0B 5LAXB 3ARTA 4DFIA 1X5KA 2E3VA 1A6WH 4DW2L 4GG6E 1U8IB 4MQXC 3MV01 2AEPL 1KTKE 1J1PH 2NY3C 2VAAA 4NWUH 4OLYL 4X5WA 1KEML 4MA7L 1J12A 2X4QA 2W0KA 4P9ML 2FX9H 4LIQH 4U1JA 2WWMC 4QT5A 4I0CC 2AK4D 3G08B 2BCKB 4NNYB 5EORL 5FHBH 2OL3A 1IGFH 3LKQA 4RFNC 3GSNB 4F7EA 1HEZA 1DVFA 2DLFL 5AYQA 1A6PA 2FEEI 3NFSL 5DEGA 4LL9A 1FRGL 1Q0XL 1DBAL 1SYSB 4WHYH 2P48B 5DJDA