5D70H

Crystal structure of mor03929, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
216
structure length
212
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSGISYSGSETYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGFGTDFWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Granulocyte-macrophage colony-stimulating factor
publication title Molecular basis of in vitro affinity maturation and functional evolution of a neutralizing anti-human GM-CSF antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 212
sequence length 216
ec nomenclature
pdb deposition date 2015-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d70H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d70H01
2QV2A 4YDVB 4MNQE 3TZVB 1UA6L 4KQ3L 1TENA 3FKUS 1H8SA 3QCUH 4NGHH 5L7XL 2AW2A 4LKCA 3EZ8A 2VERN 2ZNXA 4G42A 1JMZA 6FABH 1D5MA 1R3JB 3MV11 1OAZL 4PJCF 4YIQB 3GB7B 4HWBL 3SDXE 1U8LB 3VA6A 1B0GA 5IIEB 2GJJA 5E2UH 3MODL 4Y1AB 1R5WA 1W0VB 4JFDD 4OGXH 2DQEL 4OV6F 5IFHL 4B41A 1I85C 1NEZB 1MREL 4LCWE 4NFBA 1NMAL 3RVWC 2CK0L 3GJFB 2IBBA 3TF7C 2ZKHL 3DVNA 4Q9RL 1UH2A 4NQEA 1BGXH 4PB9H 1V3LA 3D85A 3MRFA 1FAIH 2IPKA 5J1AA 4M5YH 4L8CB 4NQSA 5KVEH 4KKLC 3DROA 1M1SA 1NFKA 1RZKL 1F11B 2VLKA 4N8CL 3KVQA 3RKDD 5DTFA 4HWEL 5BQ7A 5F6HI 5LQBH 3MRNB 2BVQB 4UILL 1FRGH 5TJWK 1LWRA 4LSTL 1D5XA 3O9WD 5DQ9B 5DJ0B 1I9EA 3RGVD 4LQFL 3IDXL 1AD9A 4JZNB 1KTKE 1XEDA 2VXVH 4X9GA 3WHE0 1S9WA 5HGDB 2D31A 5HPMB 3BEWA 4JDVB 2IFFL 4U6TA 5GRWA 2OR9H 3ECBB 3BJ91 4GBXB 4ONFL 3PHOB 4FTVA 2IANA 1FBIH 1G7JA 2X4RA 4OIBA 3RA7H 3RP1A 2Q8AH 1WSST 4PJ7A 3UTQB 1Z5LA 1JWMA 2RB8A 1F4WL 2F5BL 2UV3A 4Y16D 2MNUA 2F19L 2HT4D 5SWSA 1WUNT 5SWZE 3C60B 2NYYD 3HFML 4W70A 1A64A 4HS8L 5C70A 3IKCA 3TJEL 2X7LB 1CGSH 5C0FB 4PJGF 1NL0L 1R3LB 4S1RL 4HJJH 5AAMA 1WZMA 5HY9A 1UJTA 4ZXBC 3NA9H 3S3PA 3VXTA 3RPIB 4NCDA 2C1PB 5GHWL 2QTEA 4Y19A 5HHOB 5FB8A 1W72B 5FO8B 3SGKA 3AS2A 3BHBA 5HHVL 1S9XB 2P46B 5DXWA 3CXHJ 1CFTB 1JI2A 2X4PB 4XNQB 1EEYB 4KJQC 4LOUD 5I8OL 2QR0A 4HDIB 5J8OA 3BZEB 3VG9B 3LN5B 4GG6F 2A83B 4NOFA 5F7HA 4RWHA 3WDJA 3GKWH 4W6XB 5C86A 4KI5E 2WANA 3RVVC 1OLLA 2Z31D 3NFPB 2P8PA 5EOTA 1YJDH 2CLZA 5JW3H 2EIDA 3CSGA 3MCLH 5FHAL 5CKAA 4EUPH 1P1ZA 4HK0B 4EVNB 2XQYG 4HUNB 2NTFA 5D2NE 4H26B 2FZ3A 4YX2L 5LKNA 1IAOB 3TBSB 5D1ZD 2CKBB 3N1MC 5C92A 3GMPA 5DJDA 1MQKL 2EH7H 3MMEB 2EYSB 3GDBA 4V2BA 5FAAA 3QIWB 5IBLC 3X3FL 2DWEA 2DIAA 3GI8L 1SEQH 5DK2A 5HGAB 3BJLA 1T03H 1GGBH 5E8NA 5I1DA 3CLFL 4FQXC 3S96B 5ALBL 1T7VA 3V4UL 1MCHA 1BX2A 3W81A 4PRIB 5LAXA 4TTGA 1W8OA 3IRZA 5T3XD 2DIBA 3CFKB 3MLUH 5C08B 1PZ5B 5IOPA 4XPBL 4HFWB 1U93A 1FLRH 4RA3A 5FECB 4K7FB 3OKLB 2WBJC 1MPAL 3SDAB 3TVMC 5F7NC 3NABL 3IJHA 4L1DA 4YZFF 3CMOH 3QDMB 2E9JA 1MHPH 1T1ZA 3RI5F 3WD5L 2YD1A 4FS0A 3H9HB 1T3FB 3GIVB 4NN5C 1DVFA 1ETZB 2VZOA 4Z7VF 5T3XH 4P2OD 3VFNA 3BYYA 4EDWH 5E7BA 1SMAA 1INDL 5EPMA 3W11D 4HUXA 3MJ7B 5E99H 5F3HA 3WXWH 4OLUL 4ODUB 3MXVL 4OQTH 1AJ7L 3ZE2E 1CE6B 1PX3A 2ATKA 3T1FA 2OI9C 4JEGB 3ZKMD 5D7JA 3P2TA 1ZTXL 3B2UD 5CGYD 1D7FA 4ZUVB 4CJ0A 1DUYA 2HG5B 3BUYA 5D7KE 5C2UB 4LLMB 1KIUA 2QQKL 5ACMA 3RUGE 4C83A 4ZSOE 4I0CC 4MJIA 5HI5D 1AIFB 3LN4A 3ES6B 1ZGLA 1RZ8B 4CW1B 5GSRB 4OZHB 1UWEL 1AC6A 3WUZA 1G9MC 4U6HB 4BSVA 1JHLL 4L8SB 2ID5A 1P6AB 3T2QA 1ITCA 1QRNE 2HJFB 1HSBA 3OJ2C 4NNYB 4G8GE 2WP3T 4HD9A 4NO0A 4LQ1A 1N59A 3VFWA 5IB5B 4WFHD 1DQMH 2N7AA 1HKFA 1KFAL 1A6UH 1CXHA 3JWDC 3PGDB 2HAZA 1H5BB 4O00A 2OX5A 4PJCB 4CUCA 3D2UA 2ZPKH 4MJ5B 4BZYA 2QADB 1QSEA 4UU9B 3GRWL 1G1YA 4G6FD 5DZNA 3GO1L 5D9SA 2NNAB 4Y5YB 2HWZH 5I17A 1OP9A 3LSOA 2XY2A 3CPLB 5EA0L 1CBVL 4QCIA 5FUCC 1VEPA 5DC4B 2UWEF 5C0GA 3V6BR 4N0RA 3AREB 2QQQA 4R0LB 1GGUA 5ESVA 1KV3A 2A9ML 1FSKC 3QXDB 4PGEA 5DWUH 3K1DA 5B8CA 2GI7A 4NQVA 4S2SA 5FA3A 2B2XH 4UT7L 1IE5A 2BVTA 1MCNA 1S7XB 3H9SE 4HIJA 4LSPL 1KEGH 4MNHB 1A9BB 4XCYB 5JHDB 1JWUB 3V5HA 2FATH 5F21B 1YEHH 5CSBA 1ADQH 3GMNB 3JZ7A 2Y5TB 2DLGA 2LAAA 2W60B 1P84K 2Y06H 3MJGX 1LNUB 5C7XL 4ZPTB 4X5LA 2YD5A 2CLRA 2DKMA 3GUTB 3BPOB 3I75A 5A16A 1MCLA 5CIPA 3RZCB 1C7TA 1XGUA 5B38A 1MIML 3STBA 2GQHA 4X7DC 1FZOB 2R9HD 4O51B 1JZ4A 1ZE3C 4ZTPL 3BZFA 2FO4A 4XTRD 3EDEA 1NDMB 1OAXH 4JFOA 5EOQL 1BQLH 5M94B 1YUHB 2YHGA 5D2LE 3N1PC 3WEXB 5A3ID 1MCOL 1ODAA 1ND0B 4G9FD 4OZ4A 4O9HL 2APTA 1H3PL 4XAWH 1RHHB 3ARSA 1NGXB 2IC2A 1A5FL 3GZKA 1D9KD 1T80A 1JCKA 2B0SH 1UFUA 5F1KC 1KN2H 2F5AL 2IH1A 5JXEA 3DECA 6CGTA 4JE4B 2BDNH 5EU4A 1GYAA 4TSBH 4WFFE 4BFEA 3B43A 5AUMB 1XGRA 2IADB 5E4IA 1KB5H 2ICES 2NLJB 2NQCA 4QYOA 3I2CH 4N68A 4TULL 3VRIB 4QY8A 2H9GB 1NDGB 4M1CC 2OTWA 4NO3B 1FO0A 1SVZA 1IAIM 5FGSA 3UO1H 5HHQA 1MCDA 4WWKC 3QHFL 4OGYH 1T7XA 1GGYA 1MCWM 4U2ZA 2FX8H 5HHMB 1A6TA 1I85A 1YN7B 3MR9A 5B4MC 1CD9B 1RIVL 4RMWA 3K7UA 2VDRL 3GSRB 43CAB 1KLUB 1K3IA 2Q86A 1W2KT 3CDYA 4RA0C 2HFFA 3RJQB 4YHYB 3EO9H 1WEJL 5IMLA 1QLRB 5FGCE 3FFCE 5EC2B 2H1PH 2J88L 5J6GA 3AUVA 3O3AB 5E6ZA 2OQJA 1P5VA 4JKKA 4XCEA 2HVKB 4HLZG 4F57H 3FONA 4HKJA 1X5KA 5IVOA 2CIIB 1JPSL 1IGCH 1E4XH 3DTXA 4XCFL 1DBMH 2EXYC 2RFXB 1J9CT 2EXWD 2I9TB 3FRUB 4L4TA 2ZCHL 1T7ZA 3FT4B 8FABA 4U49A 4Z7VB 5HYIA 4PJ5D 5H37H 2AGJH 3N50A 4Q74A 4IJ3B 5C0BA 3BVNB 3NH7L 2JCCF 3V0VA 3U30B 1UKQA 1CFSB 3ELAT 3EYSH 4WFED 1QBML 2I60L 5GRZA 1ACZA 2AK4B 1SBSL 3P4NA 2K7PA 3WIHA 1OAUL 4M02A 3HG1D 1LP9A 1QRKA 2X4TB 4NO5A 4FXGA 2NX5A 3G5VB 3MUGA 3JTTA 1N4XH 3WNPA 4QXWA 4JFPA 4ZXBA 4OGAC 3RWGA 2FJFA 5EULV 3B9AA 1OGAB 4KTDH 5C09A 3VXUE 4Y4KD 3TBVB 3S34H 1RUKH 2P48B 3DXAA 3TO4D 4RWYL 2OZ4L 1FVDB 2B1AL 3ZTNL 1OD7A 1KPUA 4P23D 4YPGA 5IMOB 1OB1B 2XWTB 4XCNA 5CWSB 2FECL 4F15B 3BKCL 1HSAB 1LD9B 4MQ7A 1RJYA 4L8BB 5DK0A 4QRRA 3AU1A 5F7MC 4NRYA 1KN4L 5HYQA 2AVGA 3QRFM 1I3RB 4O2EA 2IG2H 4YR6B 5DJXB 5AG9A 4FFYH 1E28B 2OYPA 2JLLA 5EIVA 4PJIE 1DUZA 1ZVSB 2B4CL 2L4OA 4OB5L 1T20B 1U3HC 4OFKA 3RNQB 4NQXB 3K4DA 1BD2A 7CGTA 4YDKL 2XWBB 5HPOA 3MJ9H 1Q1JL 4BQ6A 2C1OB 2JB5H 4FQXA 4K23H 2Q20A 4Z0XB 5I66B 4BQBA 3B9DA 4ZD3L 5LBSH 1FVEB 4O2CB 4F7CB 4YXKH 1WIOA 2UWEB 4NZTL 3N0PB 2C4FU 1OAQL 1SMOA 3MO1A 3MGTB 4PS4L 1ZHLA 5GGSY 4MD4B 5KAQF 5HHNA 4JGJA 1HYSD 4UQ3A 5DGRA 3BOVA 4XCCL 7FABL 2WBJA 5J12C 3F7YA 4NRXB 3TVMA 3WBDA 1SYVB 3I6LD 4U3CA 5IJVB 5L0QB 1X5FA 1H3GA 1NCAH 3PP3H 1LEIA 3SCMB 3ARWA 4FQHB 4PJ8D 5SWQB 2FECI 1RZGA 5I9QB 4L3EA 5CZXD 4J3OC 2K9UA 2XT1B 5IHBA 5KG9B 1CVRA 1HYRC 3C8KB 5E1AA 4PTTB 1T0MA 4R4FL 5C07D 5ISZD 1OSZA 3K3QA 2CH8A 4OJFH 5F1NB 2R4RH 4PRHB 5CUSH 2VC2H 3IYLW 3D1MC 2DICA 2A9NL 4R2GC 1A6PA 5L2KA 1F90L 1XIWC 3P73A 3BP5B 4XNUH 5CJBA 3RDTD 4NO2B 2H32H 3PDDA 2VLRD 3ULSA 3TFKD 2DBLH 3HZMA 4PG9B 4HBQA 5HHXL 3MUZ1 3UPCA 3ARRA 1VADB 1IEHA 1F3RB 4ONHB 4WJ5B 3GSUA 4KMQA 1T21B 4NQTA 4OBRA 4FQ2L 3SKMB 1DCLA 1KELL 3E8UL 2UVFA 3KHQA 5IBUG 4MA7L 3DMMA 43C9A 3NGBB 3QDAA 4M7KL 5T5NF 1ZHKA 3CXHK 4R7DB 3SJVE 2HFEB 1LDSA 3NACL 3QRGL 2I5YH 1KC5H 3QCVH 1YEJL 3FHAA 4XC3L 1KJVA 4KK8C 3GSWB 5B39A 3VW3H 1A0QH 1MVFA 2R29H 3C5ZB 5D93C 1C5BH 1BBDH 1AGBB 2AEIT 1QPXA 2CMRL 4F37K 1FAKT 3K46A 1MLBA 4GMTH 1CVSC 1XGPB 4RX4D 1JL8A 4GXUN 2YUXA 3T4AA 2P5ED 1JPGB 2BNQB 5JPMB 1PY4A 4KKCD 5D7SH 1QSFD 3R8BB 2Y07H 1BZ7B 3T09A 1QFOA 2GKIA 4H8WL 2VL5B 2XV6B 4WW2C 4MXWL 4OQ1A 4LSQH 3UZVB 4NT6A 3RY5A 2J7LA 3CFEA 4AMKL 2W9DL 4JY6A 2MKWA 3N1FC 2VH5L 4YHPB 4NPYA 3MRPB 1DE4A 2X4NB 3THMH 2NZ9C 1NKRA 4P9ML 3RVUD 1YMMA 5C8JB 5KN5B 3O3BA 3H0TB 5IFAH 1TZGL 3QEQA 1B0WA 4M93B 1R24A 3S4SG 4CVXA 2A77L 5GGSA 4FXKA 4N8VB 2V5TA 2G5RA 3LS5H 1MAMH 3EFFB 1JGLL 4JFYB 3HMXL 3IETA 3QISA 2ADFL 4RRPA 2DLIA 3NZHH 1PKQB 1N6QH 2FB4L 3B5HA 2JCCB 3MYZA 4WHCA 4KRPB 2B5IC 1BQSA 4M03A 2CQVA 2ED8A 4NJ9H 2IGFL 1RJLA 4C56D 3VFTA 5DUPL 5BVPL 5DJYB 2IAMD 4XVSH 5DQDL 2PCPA 2EKJA 2EDEA 3TH2T 2XZZA 3KPPB 1QFWM 5CSZA 1CU4H 4J8RB 3VXRA 4XNYH 3NCYS 4WVRA 3GMLA 4JRYB 4JDTH 3S7GA 1CGVA 4LFHG 3ARUA 4LGSB 4LSRL 3EJZC 3WIFA 3CFJA 3UTTB 3FFDB 5L2JA 3L3GB 4EIGB 3SDXA 5K9KB 1LK2B 1X5GA 3GHBL 3RL2B 1TJHL 1HILA 5KOMC 3CMGA 3PXHA 5AYQA 1EBAA 2A6JA 4LASL 1IEBB 1CLYH 2VWEC 4JFZH 4X80L 1NCCH 5FUOL 2H2PC 4YHKH 4JLRA 3T0EB 4ZUUB 5CEZD 4HGMA 4MD0B 4XNZB 4MHHG 4RAUB 2HTLC 3ULUD 3V6FB 1KOAA 4XB7A 3MRKB 2VZVA 2V7HB 5KJRH 3DSFH 1WLHA 2PTVA 4JFFA 3NCYP 3QEHB 4PRPD 3GJEB 3V7AE 1AXIB 5A2KH 5GRJH 3PWPB 2XOTA 4ELKB 1QR1A 2VXSH 3RIFK 3DHMA 4XP9L 3DVGA 3MLWL 3ULUH 1UM4L 1FNSL 2AJZB 3IDJB 4PJHE 3VXNA 4JFXB 4NBZB 2DYPD 5I1KH 3EFDH 1ZEAH 4X5XB 3UTZA 2E7LC 1T89A 1YY9C 3P9WB 1AFVH 1NMCB 2OTUA 5EO1A 4D9RE 1S7WA 5CMAB 5EUOA 1CFQA 3U79A 3X12B 1NSNL 3NIGE 3OZ9L 2D4FA 5JDSA 5ADOL 4NM8L 3EOAA 1KACB 4WHDA 4ERSH 1DN0A 4QGTA 5SWZA 1EGJA 3ZKXB 2D2OA 5J0BA 3LRSB 1HOCB 3MV8A 4X0KB 5D7IB 1XR9A 2H2SC 3QXTA 3NFSL 4WEUD 4ZFZB 3TT3L 3PV6A 3MNZB 3M1BB 5EZJA 1CE1L 4X6CB 3TT1H 4WEBH 3TNNA 1S8DA 3VGBA 1CQKA 3UBXB 3QAZB 2YS4A 3QO1B 4U1IB 1WTGT 4ZNCD 1UJ3B 1CF8L 3BH9B 1VCAA 2WINB 3QWRD 4PY7A 3EIFA 4LCUB 2X4QB 3SE3C 5L8LB 2XI9A 1W72L 1K4DA 4JFDB 5FYJL 4OKVA 1MLCA 1AHWC 1S5HB 3B6SB 2AKRB 3EDJA 4U1SA 4OLXL 3WKMH 3SGEH 5BW7A 3KWWA 4C54A 1IL1B 2NY0C 5B38G 3O2DL 3DV4B 2ZOKA 4ZYKA 1AXSA 1JGVL 1IGIL 4ISVB 4UOW0 4F37F 2GSIA 4I0PB 3PP3K 1QFUL 2OBGA 5F7DA 3RWJB 5DRWB 2DQDL 5GXBB 1JGUH 3EO0B 2Y7QA 1FGVH 4MA8H 3TBTB 4EXPX 3FO9A 3I6KB 4PG2C 2IPUG 1U3HA 4JFHE 5KANG 5KW9H 3U7WH 2BVPB 3O9WB 1X5ZA 4JZOB 2CKBL 3WJLA 2OS7A 4Z78B 3RGVB 1WFUA 1HQRA 1TZIB 3OGCB 4QRQA 4ZTOH 4N9GB 1QOKA 1NCDL 2HYMA 4EDXA 2H3NB 1MQ8A 1FZMB 3S9DB 1OY3B 3G04B 3G5ZA 4MNQD 2GJ6A 4YFDB 1QQDA 4PTUB 5CSGA 4OZFG 5KSBA 1X4YA 3S3SA 5I2IA 5DJAB 4LSDA 4MQXD 5JOPD 4DZ8B 3L6FA 2DQHL 3WFHB 2F54A 3GMOB 2ED7A 4JM2D 2JIXA 1OPGH 4K3DH 4GUPA 5DMGC 1NC2A 3O6MH 1MAKA 3AFLA 5IW1A 4MS8C 3BXNA 4Q9BA 3QPXH 1MNUH 4XBGB 3SDYL 1WK0A 4PLNC 1Z9MA 5DJCB 4JN1H 4LCWD 3VG0L 3M45A 5ILTH 2G75B 1FZKA 5D1XB 1KT2B 1E27A 1XGQA 5CD3B 4EQ2A 3INUL 3MLZH 1A3LL 5ICYB 1QTYT 1XIWA 5F9WC 3SDDD 4ELMF 4EUPB 3S37L 4HIIB 2KH2B 4ZO7A 5HGBA 4R3SB 3WMSA 3VGAC 3FB5B 2PYFB 1ZVYA 3VWKD 5KSVB 2DM7A 4LSVL 4JANB 3S6CA 2VYRE 1JHKH 1JNNL 2Z31B 5BO1H 1QRNA 2YN3A 3I50H 3PWVA 4RGNC 5JR1H 2VOTA 5DD5L 1T2JA 5MEQB 3KLHD 2NXYD 3BW9A 3ZTJG 4PB0L 4M6ML 3BMVA 5D1ZB 5LGKA 1M6OB 4JAMA 2EEAA 2BHUA 3PL6D 4YBLC 3IFLH 1FLTX 3T0WA 2IQ9L 5J06A 2O5XL 2UVEA 1HE7A 3OKNA 1I9JL 4AZ8A 3LMJH 3Q6FB 4Y1AE 3OF6D 5CILH 5E4EB 5GGTL 1WF5A 3HA0A 3L3HB 4GOSA 4HT1L 1EJOH 4LRNL 3NPSB 1A1NA 1AR1C 2FSEA 3K2MC 2DI9A 3WE6A 3O2VH 5BV7H 5SWZD 2H6PA 3TJHC 2DJ4A 5DT1H 4N9OB 2CUHA 2V2TB 1F45A 3RIFF 3EYQC 3V6OE 1Q9LB 1CFVH 4PY8J 5CP7B 5BS0A 5DSCB 2X4UB 5GIRA 4UINL 3VGGA 1XAUA 4ZO6A 2AXHA 4P2OB 4NFCA 4WW2A 4G6JH 5C0EB 3QB7C 4GSDH 5IF0A 5DR5H 1GIGH 3D69A 3OKMA 3S5LA 4TNVF 2VL4A 4X5WB 5FUZL 2VZTA 1OTTC 4PBVC 3V0WH 3HPLB 4IRJD 1GXEA 2PXYA 3DRQB 2XA8L 4I48B 2XICA 4KI5D 1WBXB 1CDGA 4YEFA 1K6QL 4KPHH 4QXGL 4U1LA 2AJYL 5IV2B 5JW4R 1NGWA 3I9GH 2AK1H 2YR3A 4U6XB 4BQ8A 3PWUB 4I0KA 4TVPL 2QSCL 3Q5OA 4G8IA 4RQQA 2SEBB 3G6DL 1YDPB 1F4YH 2NY4B 4QHLB 4NNPL 4M1GH 4LPWA 2DQGL 1WQVT 1OLZA 4Q6IB 2DMCA 4YNYA 2VIRA 1LEGA 4H20L 5IBTL 3GSOA 5KVDL 5I1CL 3OAUL 4NWTH 2D0GA 3QJFA 2ITDB 1HH6B 2VR5A 3JTSA 4PIRF 3CVIH 1HXYA 2KKQA 1K9TA 3HE7B 4KHXL 1MUJA 1CDJA 4JG0L 1FYHB 2CGRL 4U1GB 3RNKB 2DQUL 3KXFD 1KTDB 3VD3A 3LDBB 4YFLF 3RAJL 3UCRA 4IMLB 5CEXA 2FD6H 1XF5B 2FIKB 2NY2C 4X6BB 3EHBC 2B4CC 2CJUH 4EI6A 4G6FB 2A73A 3WFDL 4E9LA 4HH9A 5INCB 4LHUD 4JKWA 5E2VL 3VFPB 5JW4Q 1JNJA 3V52L 4NM4H 3OKOB 1YPZA 1TJGL 2YRPA 3QDJD 3AM8C 2JKXA 4LEXL 4UQ2A 1NCWL 4P57B 1I9RH 1WAAF 1FNEB 1YA5A 1JZ2A 3MJ8A 1IGYA 1LEKA 4E5XB 3O3EB 2ZUQC 4O4YH 3STLB 2HTKD 2HRLA 1S7UB 5E2JA 2QL1A 5IUSA 1D6EB 3K80A 3IAQA 4HBCL 1HWGB 1UVQA 4RZCB 2QKIA 5D7KD 1CXLA 1ROWA 4PGZA 3EOTH 5C08E 3GGWA 3Q3GA 1E4JA 4Q0XH 4YAQB 4QXTA 3B8YA 5GS1C 2J6EL 5D5MA 3QDME 2E7LA 2EYRA 4OKDA 4JRXE 2HMID 1I8KB 2LU3A 4FOMA 1BJ1J 4JG1L 1NLDL 1I1AC 1VFUA 3KHOA 5B39G 2R0KH 5C9JA 2C7UA 2JE8A 4G8GD 4ZUSB 4HLZH 1GC1H 2V7NB 3IXAB 5J4MA 1U3JA 4U1MA 4OCYL 4XHJC 3SQOH 1TVHA 1MY5A 3K8MA 1N2RB 2G2RA 2QJDA 5DEGA 4CNIA 1U2HA 3O45B 1N8ZA 3MRRB 32C2B 1KB5B 1KSRA 1D9KB 1JN6A 4A2MA 2VLJE 3LQAL 2VJXA 3IFNH 4KK9D 1U8QA 1JFQH 4JPKL 5GGRY 4ELMB 3QHTC 3O4LB 4FMKA 1A7QL 4P4RB 4EIZC 4F3FB 5BXFA 5TE4L 3CFDB 5I71C 3ZE0E 1HHIA 1WITA 1RK1A 3QPQC 1T5XB 4HGWA 5FK9B 3H9SD 2ILLA 5ENWB 2XQYK 2J1KA 4YHOL 1I3GL 3VI4F 1VGEL 3GRWA 5EG6C 1AHWA 5FFLA 5DZLA 4U1JA 4I77H 3UJIL 4X99B 5C0DB 2XZQL 2VE6A 1LMKA 1BPVA 2XY1A 1N0XH 4HKZA 5D72L 4D0CB 3CK0H 1IEAB 4ZUWB 5LJYH 4HFUH 4PJCE 1KCUL 2XKNA 3CAFA 2PXYD 4JB9H 4P3CH 3FN3A 3ARXA 4XMPH 3TWCL 4KK6C 1G7MB 4C55A 1NJ9A 1OF2B 5I1IL 1WTLA 2VDPH 4H8WC 1JTTA 4QRPD 1F42A 3DUSB 3BYTA 1E6JL 4PG2A 4NQCA 3BWUC 5BZWA 3IU3A 15C8L 4P48A 2FJGB 4XNMB 3QNZB 1BVLB 4YE4H 1TCRA 1H8OA 4CKVX 3TESA 1EAPB 5KSAC 1Q9KA 1FNGA 4CN4A 1P7KB 3GM8A 4KZDH 4LDEB 3AS3A 3ZSSA 1CLZL 5K59F 4WDIB 1KCVH 3O8XC 4PJ5B 4MXQD 2XZAL 1FC2D 2ZZUT 5JHDE 4GKSB 2HVJA 4P4KC 3MTRA 4S0SD 3MLVL 4TVPE 5I1AA 3U36A 4WFFD 3C6LD 5HSFA 2X9WA 5J3HD 1DANT 1RIHH 4GAYB 3QFJE 3HG1B 5DF0A 1MRFH 3MRMA 3Q6GH 4JO4L 4PGBA 4MA3A 3WFBL 1YEFL 3SY0A 3D6GA 1IILE 4XPHH 4Y5XB 5CJ8A 4LPXA 1WT5C 4NIKB 4JCLA 1JRHH 2X44D 5I74C 5C0JA 5IM7A 4XPAL 1RUPH 3M17B 3QQ9C 4TUJA 4Y4KB 3NFNA 3TO4B 1KIRA 3MRQA 3IDGA 4P23B 3TYFB 1ED3B 3TZVC 3TH3T 2AEQL 3C6SB 2BOCB 3U46B 1DBKL 3FFCD 5IHUL 4PJGE 3ARGD 1RUQL 1JZ7A 3LEXA 3FB6B 4BZ1L 4R4BA 1OVZA 5FM4A 1A6VH 2VDQH 3L7EB 4OLZH 3VCLA 4EI5B 2ARJB 3KR3H 1BJ1H 3ALPA 5T1DH 5GJTH 4PJAA 2OXHA 4AG4L 4XMKL 1PX4A 3ULUF 3IAGC 4XPFH 1SEBA 5GRUL 1K85A 3HLAB 5GGRA 4YDJB 4YHLL 5J6HB 4N0UE 4HC1L 2VQTA 4GG6E 3EO1B 2OJZL 4U3XA 2R2HB 5F70A 3FB7B 4PJEA 4X4MA 5GGQL 2CLVB 3MRBA 5I76B 5I8EB 3RTQA 3BWAA 2DD8L 2CIKA 4PJDB 5HHME 2P24B 4OV5A 2MCPL 1HIML 5GS3A 5JO5B 4TRPL 5DD3H 3ZDZF 4OF0A 3MLXL 5L6YH 4AIXA 3HC0B 3ARBD 1K3ZA 4ORZC 3HUJF 4WY7L 4ODHL 4OZGF 5LGHH 5BZDA 2XRAL 3E2HB 1L0YA 3KDMA 4I2XB 5E9DD 3MV9D 3MRHB 5I15H 4PJ8B 1KIQA 4MYWB 5CLTA 1VKXA 2DLHA 1QVOB 3OX8B 1GPOL 1RIUL 2GEEA 3ULVD 3VGHA 1KEMH 2H32B 5H2BA 3VXUD 1S3KL 3P0VH 1GZPB 1TETH 2A6IB 2LV4A 1G0DA 3OB8A 5C07B 5TPWL 2YA2A 4GBXC 4OD1L 3SKNB 1HHHB 2ADIB 4LSSH 2BNUA 2VUOA 2GTWB 4YZFE 2WW8A 2ADJB 1MJJB 1U8MA 5E6ID 5L88L 4P2RB 3HZVB 2VXUL 2O5YH 4A6YL 4Z7VE 1M7DA 3ULVH 5IVXA 2VLRB 2O26U 1GJIA 2XPGA 4M6NH 3Q0HA 1ZT1A 5J1SC 1G9NL 1NLBH 4DGYL 1CTOA 4OGZA 4P3DB 4QHMA 2WZPD 1K8DA 1K2DB 4PJXB 1J12A 5ERWA 1G84A 1DEEA 1HEZA 4P5KA 3W0WB 4L3CB 1UGNA 2OZ4A 2YD9A 3DV6B 1H0DB 4N90E 3BRFA 4FQLH 2ZG2A 1P5UA 2VMFA 4PV9A 2YRLA 3OKKB 2MPAL 2C5DC 1AY1L 5CJQH 4BZ2L 3ILPB 1TVBA 4LNRA 4HJGB 4N0YL 3ZDXF 3QIUC 1OGAE 2G60L 3OXSA 3BKML 3U4BH 2ZCKH 4KUCD 1XF2B 4LFHD 2OSLB 4NZJA 1ZK9A 3SE9L 3WLWD 3LKSA 3O6LH 2B20A 2V2XA 2YA1A 3FQNB 4LCYA 1MHHA 3PG2A 3E6FB 2GIYA 5EFIA 1QSFB 3QIWC 4TSAL 3AM8A 2BSSA 3FTGB 1H3VA 4YGVA 5DLML 4GG8A 4UV4H 1KJ3H 5AWNL 3FOMA 2LVCA 4Z7OF 4XWOD 3HMWL 3A67H 4OLVH 1OGTB 3HC3L 3BRGC 3DBXA 5MP6H 3K81A 4L8DA 3U2SA 2MTPA 2EICA 5DJ8B 4FQ1L 2APFA 3TNMB 3SDAC 5DJ6A 3DX8B 3T2NH 1CIDA 4R8WL 4QRSA 2UWEE 1IFHH 5DYOB 2F74B 2AI0H 2UY6A 5C0CD 3WXVL 4LSUL 1WCQA 2Z92A 2X4SA 1FIGH 4KDTC 2PW2B 3IGAA 5MEPB 4PGCA 3S98A 25C8H 4RFNB 3HHRB 5ESAB 1S7TA 5GS1A 4XH2A 4BJLA 2VO5A 1KNOB 3OXRB 3SJVD 4HPYL 5JZ7C 4LIQL 5FM8A 2XWJA 1I1AA 5FKPA 4Z7WA 2GY5A 5CFHA 5IQ9B 1BFOA 4ODXA 3ARDD 1C5DA 5JQ6H 1AP2B 1Y18A 2RCSL 4OFDA 1BAFH 3TGXA 1RVFL 5T3ZE 4I3GA 2HLFD 2B39A 3QCUL 4NGHL 3I84A 4JY4B 3RVXC 3PDOB 3QA3A 3VE0B 2ESVE 2DQTL 1IAKA 1A14H 4JN2B 1JZ6A 1IAMA 1SM3H 6FABL 4NFDA 4PBXA 4MAYD 3BIKB 1F4HA 3V4VL 1Q72H 1P7QA 1UB5B 1WV7T 1YECH 3BESR 3H3KA 4RAHA 2AXFB 1EZVY 2K3TA 3QDGB 2KZ1B 4V2CB 2JJVA 1AO7D 1DQDH 4R96A 1MI5A 5E2UL 4OM1H 1PLGH 3DX6A 5JHLH 1T0NB 4F8QA 5TDPA 3BP7B 4LCCC 4KJYA 4RNRA 5CP3A 1UC6A 1JUFB 4UDUB 2BNRA 1BBJB 1IQDA 4PUBH 2P44B 1BGXL 1FN4A 1FAIL 4M5YL 3STZB 5DMKA 1H5BC 4JHWH 3IDNA 3TPUB 2QADC 4GKNA 5HI3D 3QUYB 4Z7UA 3V8OA 1U0QA 3IFOA 5EU7E 4PRPB 1NC4D 5LQBL 2Z4QB 2MKLC 2WAHA 3L1OH 1VFAB 4NZRH 4PJFE 5BVJA 4HKBB 1EMTL 3M07A 4TPRH 3LHPL 3F7RA 4WI2A 4NKOA 3RWFA 4B7LA 3MLTB 4S1QH 4K9EH 2VXVL 5CIPH 5ESQA 3AREC 4R4ND 1IM9B 4OFIA 2BNQE 2DYPB 3QNXB 4HZLA 3TO2B 5DURD 1V8HA 1B6DA 1XF4B 1EV2E 2W0FB 1EAJA 4P46D 2YK1H 2A74A 3V79C 1FBIL 4YEEA 2A38A 3HUJB 5ANMA 2Q8AL 4ODWA 4OZGB 3UTPE 2EECA 5EB9A 3HAEG 4M43H 5KSAA 4J4PC 1BFTA 4KZEH 2BZDA 1MH5B 2GAZA 3HMXA 4U2YA 3O8XA 4UT6H 1IGMH 1EX0A 3REVB 2GITB 3DRTA 3BPOC 1HZHL 4M5ZH 3TBWB 4HJJL 4L4VE 3RZCC 4PRDB 4G80B 1FZJB 3D9AL 3NA9L 4M3JA 1PG7H 4QGYA 4BSWB 1S78C 4OUUB 3TLRA 3RWIA 4OZFH 5EIIA 5E94B 2W9LA 3IDIB 3U48A 5J13B 5DFVD 1CGUA 1PKQE 2VABB 1A7RH 1WJ3A 1WT5A 2IH3A 2JCCE 1JF1A 3IFPB 4OF7A 4NJAH 4XWGL 4ZFOB 2QQLH 3DGGA 4J1UA 3GKWL 3RWHA 3HZKA 4MXVF 2A1WL 5I1GH 4NKQB 1IAIH 3AY4C 4YDVA 3MJ6A 3HCVB 1YJDL 3TZVA 4UBDD 3O0RH 2Y1VA 3C9NB 3P0YH 4N1CA 1UZ8B 4JRYE 1QZ1A 1EEZB 3CXDL 4LU5H 1CL7H 2EH7L 2P7TA 1R3JA 5JDJA 5KOVC 3UTTE 3GBNH 1SEQL 2K1MA 4PLKC 4YIQA 1GGBL 4MQTB 4OF8A 2BJMH 5GZNC 3GB7A 1T03L 4AT6A 4N1EA 1U8LA 4Z6AT 5IIEA 2P5WB 4I8DA 4Y1AA 4UV7L 3LZFH 8CGTA 1M7IB 1BLNB 5JLZA 1NEZA 4Q7DA 3WHE1 1T22B 1KXQE 1QLFB 3GJFA 1SJHB 3T0EE 4OD2B 5DJ2B 3SGJC 4OLWH 4MLIA 4YHYC 4WTXA 5GGVL 4J6RH 5D8JH 3CMOL 4L8CA 1MHPL 2XACC 5IMMB 1Z0NA 1OAKH 4IBLT 3BKJH 4RGOH 2YUVA 4M7ZB 1KB9J 4CL7A 4MNQB 1TJIH 5DO2C 2P45B 3X3GH 5T3XL 4EDWL 3MRNA 2BVQA 5IQ7L 3PWPE 4DKEH 1RZJH 5DQ9A 5E99L 4QKXB 5DJ0A 2CDFA 5E08H 3WXWL 4WNQB 4JM2B 3OPZH 4JZNA 1L6ZA 1NFDF 1AGDB 4OQTL 4W81A 2FLRT 1L4IA 4I3SH 5HGDA 1BM3H 4JO3L 5HPMA 4JDVA 3ECBA 3L5XH 4GBXA 4CADB 3PHOA 2WLYA 1MFBL 5DJZB 3UTQA 3AMLA 4RISH 3U30C 1JPFB 3LQAC 3H3BC 1T04A 3SDDB 4O58L 4KQ4L 1P2CB 1U8IB 4GQ9H 3C60A 2ARWA 4HGKC 2D7TH 3U7AA 5BJTB 2EO1A 3L3KA 3VWKB 2X7LA 2WLZA 5C0FA 2PYEA 1B0RB 1JF6A 1R3LA 2A6DB 4MWFB 3SOBL 2FR4B 4O5LL 3V4PH 3VFMB 5IEKB 3VXPB 3RPIA 2C1PA 5I1LB 1IKNC 2BOBB 4YHIB 5HHOA 1MJUH 1W72A 5FO8A 5A2LH 1AKJA 3WL9A 1S9XA 1UM6H 1CFTA 1DLHB 2WBKA 2X4PA 3IJSB 4XNQA 3SDCD 4KUZL 2E7MA 4XBEL 4BFIA 2Z9TA 1DQLH 1G7QA 2ZPKL 3PL6B 4F15C 3O2DA 3BZEA 3LN5A 2A83A 2EDHA 2DQCL 1OP3H 2Y25A 2OL3H 1M05A 1VPOH 1FL6B 3NTCL 3FL7A 3R0MA 4KKAC 3CVHB 2BSTB 4LPVA 1IM3B 3W9EB 1FORH 2Y6SC 4HK0A 3LRHA 4KGJA 1VB9A 5FYLD 2M26A 1BVKB 4H26A 4B0MM 1C1EH 1IAOA 5DWUL 4D2NA 3TBSA 2CKBA 5E6YA 3T4YB 4Q2ZA 1OW0A 4NQDE 2B2XL 2EYSA 2X1WL 3QIWA 1PKOA 5HGAA 1NAMH 3S96A 5IT2H 1KGCE 4PLOB 5DRZB 1KEGL 3KYOB 2FATL 3C5JB 1YEHL 4PRIA 4GMSH 5FYLH 3G5YB 1OSPH 2Y06L 3CFKA 1P9MC 5C08A 1PZ5A 1BFSA 3EBAA 4HFWA 4L4JA 5FECA 3KPNB 4K7FA 3OKLA 3MV7D 3SDAA 4Y89A 5L0QC 3EGSA 3QDMA 2X70B 3FB8B 1X7QB 3SCMC 4DJMA 3H9HA 4ZDHB 5I9QC 3OR6B 4WCYH 1N26A 3GIVA 1A1OB 1ETZA 1OTSC 1J8KA 4KDTA 2EE2A 1Q94A 4F7MB 1NGYA 5DVOA 1OAXL 3OWEA 1BQLL 5D2NB 3QBTB 1HCVA 1CLOL 4LRIC 5AZ2H 3MJ7A 4CU7A 1G9MH 2PN5A 5E03A 2GK2A 2W65B 4ODUA 1CR9H 1CE6A 4ACPA 5DD1H 1BFVH 3BP4B 4BM7A 4ZUVA 2R56H 1AGEB 2HG5A 4LLMA 3HI6L 2JB6A 5IFJB 2BDNL 3KXFB 4TSBL 1YNKH 2AXGB 4UTAL 3VXSA 3ES6A 4KV5F 4HHAA 4XPTH 4PJ7F 2R39A 1KB5L 3MGOB 4CW1A 4OD3H 5GSRA 4OZHA 2WIIB 1GGIH 2XN9A 3I2CL 3MFFA 3N1QC 5D96B 3NGBC 3VMPA 3I02B 2QQNL 3UO1L 2FEEI 4GRMB 4LHUB 4WV1C 5TE7H 4OGYL 1BZ9B 3D87B 2EIBA 2FX8L 2HJFA 4KJWD 3QDJB 4F58H 5FOBB 5IB5A 5EU7C 5KZCD 4HJ0C 5GGTA 4PRNA 5H8DA 4Z8FH 3C5ZC 3PGDA 3UAJC 1H5BA 5T1KD 5HYJE 4MJ5A 4UU9A 4M00A 2Y36H 3MROB 2NNAA 4FFWC 5F1IB 3CPLA 3LS4H 1QHOA 5KVFH 4D8PB 3ULVF 2ICCA 3RUGB 5T3XE 4ZSOB 5I0ZA 3WJJA 2N1KA 1FE8H 3VDCA 3PHSA 3V5DA 3AREA 4GXVH 2G5BA 3QXDA 1TCMA 2EDFA 5TDNB 3RL1B 1G7LB 3HNTL 3FJTA 1A7OH 5HYSG 2KL6A 2EKSB 4M7LT 5GZOC 1RK0B 4XCYA 4FMFA 5JHDA 1JWUA 2VXQH 3EYSL 4M93C 3GMNA 2Y5TA 3CD4A 2W60A 4LF3B 1F3JA 1LNUA 1C08B 3QUXD 1QFWH 3GUTA 1X3DA 3QIBD 5I1JH 4NKDB 3H6JA 5T5NG 3RZCA 1T2QH 2GYSA 5GJSH 4WWKD 4BH8B 1FZOA 1PY9A 5HDQL 1TPXB 3EW3B 2ICEB 1XGYH 4BQ9A 1GGCL 4EN3C 3V5KB 5B21A 4BKLB 1NDMA 4NNXB 4M8QB 1QNZL 4F7PB 4KUCF 1A02N 5TH2B 5JIIA 1YUHA 4PP2B 4LVNC 4QRTB 4WUUD 4KRNA 1E4XI 2VN4A 3G6JE 1MRDH 1ND0A 4M61B 4N5EC 1RHHA 3H9SB 4WENB 4TSCH 4ZOCA 3GNML 4D0DA 1X9QA 1XCTB 1NGXA 2IG2L 3AY4A 3WUWG 4FFYL 1DLFH 3VRLF 4YWGH 5GS0D 4S0TD 3BD3A 1VFBB 4QEGA 1N6VA 1CT8B 3TYGH 5AUMA 2IADA 4JRXD 2NLJA 3MJ9L 3QWQB 4QRPB 1SY6H 4G43B 3VRIA 2H9GA 1NDGA 4FFZH 4NO3A 2MMXA 4XNZC 3NAAL 3UTSD 3CDGA 3T0AA 5GS0H 4YXKL 3TV3H 4GW1B 4LLUB 1SJEB 5JQHC 1YN7A 1BIIB 1JNHB 3GSRA 4Z0BH 43CAA 5D2LB 4ZODA 3BP6B 4HS3B 1LO2H 1V3MA 5JXAH 1QLRA 2BRRH 4OIIL 3CZJA 4PP1C 4EQ3A 3BD5A 5DRNA 1EGJH 2C3XA 4V1DE 4JHZA 5L8KB 5C1MB 2FL5B 2J6EA 2VLJD 4OGAD 1JVKA 1XT5A 1KXTB 5T1LD 2HVKA 1R3KB 2FBJH 4WGWB 4CN1A 1D5IH 4B5EA 4Y4HD 1NMCC 1TQBC 1UCTA 4OJFL 2R4RL 5M7QA 1ZANL 5CUSL 2NXZD 2VC2L 1NBZA 3CIQA 2RFXA 5DUMH 5B3JF 2I9TA 3RWDB 3FRUA 1PG7W 4AIOA 3H7BB 4XC1H 4XNUL 3GM0A 4APQD 2DBLL 4UNTA 3ZKXC 1ZHNB 3QHZH 3BVNA 1OP3K 1KTLB 5DTFB 2CKNA 4YFLI 4LDLB 1BOGB 3GKZA 2JF1A 3N85L 5IK3B 2AK4A 1FO0L 3V95A 3D3VD 5FGCB 1I7ZB 3ARGB 1IGJA 4NOBA 3X14B 4CMMB 3TCLB 2X4TA 5A1AA 1RY7B 3F7VB 3QAZC 4G6MH 3G5VA 5IBUB 1NGPL 1UJ3C 1KC5L 4WUKH 5C0AD 3BEWB 1B3JA 3LD8B 3U4EB 3QCVL 2FX7H 3PQYA 2J8UA 1JV5B 1IKNA 4XMLH 1OGAA 5FA4B 3D39D 4U1HB 4ELME 3RVTD 3O4LE 3VW3L 1AH1A 1EO8H 1FVDA 2R29L 3BIAX 4PJ7B 1FFOB 5IMOA 5GS2H 4EXKA 2XWTA 5CWSA 1RFDL 3FQWB 4K71B 4GMTL 1HSAA 1LD9A 1EHLL 3EOBB 3ORJA 4L8BA 4QRUB 1HNFA 1B6UA 3QQNA 3C2SA 3MRJB 1KCRL 4KRMB 3SGDH 3O6KL 4WTZA 5FGRA 1I3RA 4YR6A 3CSBA 5D7SL 5DJXA 3BT2H 1MHEB 4U1NB 2Y07L 3VXMD 2DM3A 3PP4H 3UYRH 3RKDC 5ITBH 2ZSVB 1ZVSA 1T20A 3ARBB 5FB8B 4LSQL 3CSYB 3QFJD 3SKOB 3D25B 3GFUA 3RNQA 4XP1H 4YC2B 3MV9B 5E9DB 5I8KL 5MI0B 4I5BB 3O9WC 4NQXA 5MEND 3RGVC 2XWBA 3THML 2C1OA 5L9DH 3DSNA 4Z0XA 5I66A 1EHAA 1HDMA 5IFAL 1FVEA 4O2CA 3VXUB 3WIHL 4F7CA 4HMEA 2YZ8A 3BPCB 2UWEA 3MGTA 2X41A 4MD4A 4OLYH 1EHNA 1P9MA 3QP3A 5EOTB 1JYNA 3LS5L 3VD9A 1MAML 4WEMB 1UA6H 4KQ3H 2FHFA 3S4SB 4NRXA 5E6IB 1HH9B 1ORSB 4LVEA 3DPBA 1CD1B 1SYVA 5IJVA 3GSVB 3TN0D 4Y16C 1N6QL 3SCMA 2HT4C 4FQHA 5SWQA 2E27H 3GMPB 1OHQA 3O3DB 5IESH 2NYYC 4U7KA 4NJ9L 5KG9A 1OAZH 5DK2B 2VDKH 4PJIB 4HWBH 4ZNEE 3C8KA 3MRDA 4PTTA 1BX2B 5EZIL 4ALAH 1UQSB 3MODH 4LRIA 3BDXA 4NN7B 1FFQA 2DQEH 2VR4A 4HX1B 5F1NA 5IFHH 4PRHA 4OI8A 3HG1E 3TH4T 1MREH 4HV8B 1I7RB 1T4KB 1YJDC 3CX5K 1RZFH 3BP5A 5CJXA 1FYTA 4LOUC 1SJXA 5LVEA 4NO2A 4I4WB 4RGMB 1A9EB 4WFGD 5HHMD 1RHFA 5ITFB 3GMMB 4PG9A 4GAGH 1VADA 5D7LA 4N8CH 4KMTL 2P8MB 4ONHA 2FDBP 3W39A 4WJ5A 4ZQKB 2VZUA 1I1RA 1T21A 1XCQB 3SKMA 2NY7H 3G08B 3QI9D 4JFZL 5EPMB 4HUXB 4IM8A 4WRLA 3F5WB 4YHKL 4HC1A 2EDLA 5E2TH 1C12B 3L95B 4R7DA 4RDQG 4Y8AA 1WWWX 4DOHB 5D1ZC 5F8RC 3IDMB 1N5YH 1LP9F 2OTPA 2YMXH 3U82B 3DSFL 4ZAKD 3P9LB 1A6ZA 3EYVB 1MIEH 2X6MA 3GSWA 1ZAGA 3C5ZA 3BPNC 4HUUB 4OCNC 2Z35B 5E4EC 5CEZL 1PFCA 3H3PL 2EZ0D 3GSQA 1AGBA 4QXUH 3RKPA 1XGPA 3ULUL 2XTJC 5DHYB 3EFDL 2LU7A 1ZEAL 1MFEL 1JPGA 1IBGL 1F4XL 1E4KC 5JPMA 5BRZB 1AFVL 3CCHB 1NL0H 4S1RH 1WAAE 5C0CB 2EC9T 3MBED 4XAKE 5A43C 3RU8L 1BZ7A 3MSPA 5GHWH 1N59B 3GEWB 4LLYB 4P2OC 2VL5A 4N90D 1V7ML 4PLJD 2HT3C 4I2XE 4KROC 3OR7B 2P49B 3FAWA 3W11C 2B1HH 3SJVB 4ERSL 2R23A 4ZMAT 2W38A 2HH0H 4YHPA 5I8OH 1A6WH 1YY8B 3MRPA 5AD0B 1L0XA 3ARDB 1QSEB 3CDFA 4JFED 5KN5A 5C8JA 3H0TA 4A6YA 4H1LG 2A0LD 3ZKMC 4JHBA 5CGYC 3P11H 2PW1B 1ZT7B 3LV3A 4N8VA 2E9IA 3EFFA 3HAEH 4JFYA 4JO1H 4P2RE 5FHAH 4FABH 4XI5D 5HI5C 4MAYB 1NMBH 5E8OB 2VLRE 2HTLD 5B8CB 4Q6IC 1XFPA 5F7KC 3K0WA 1BOYA 4MDIB 3FQUB 3WKNA 3GI8H 4P59H 1AO7B 4IMKC 4FRWA 4WI4A 3V4UH 5DJYA 4RBPH 4N5UA 3W0WE 3PGFL 3KPPA 3WDIA 5DVKA 2EE9A 2X89D 4RFOL 3WNLA 1MHCA 4NKIL 4U1GC 3RWEB 1ZT4B 4JRYA 2CLRB 2DBJA 2Y72A 3RWCB 3MOBH 1CFNA 5A16B 2M1KA 5B38B 3N1GC 3FFDA 3T2OA 4ESKA 1P4LB 3L3GA 4L3AA 4MA8L 5K9KA 1NC4B 3RL2A 2EDXA 1ZMYA 3L7FB 4AEFA 3R4DA 3U9PH 5IEHB 2PNDA 3QUZD 1KULA 3HNVH 1OM3H 2LQRA 4WHTB 2NW3B 5F7WC 3VI4E 1CDHA 2A6KB 1BIHA 3LKQB 1D5BB 4OLEA 4ZUUA 3UC0H 4ZTOL 4MD0A 3T0EA 2VAJA 2L7JA 4QOKA 3MXVH 4RAUA 5DURB 2H2SD 3V6FA 5T3ZD 3CFCL 1RU9H 3MRKA 4XP6H 5D6CB 4BFBD 3QEHA 3GJEA 3IF1A 3SGKC 2ESVD 1X4XA 3MACH 5F9OL 2QQKH 3PWPA 4ZS6C 4ELKA 1ULVA 4OZFB 2NY3D 4K07A 3VFGH 3SGEI 1OPGL 2AJZA 3IDJA 4K3DL 4JFXA 1UWEH 3O6ML 3DX7B 4QYOB 5DDHB 5T3ZH 1YN6B 2FYYB 4X5XA 1WBZB 5K9OB 1MNUL 5HHQB 1I9IL 5CMAA 1ONQB 2R9HC 3GBLA 4PJBF 3X12A 4JN1L 5ILTL 1DDHB 2I26N 4JPVH 2APXA 4XTRC 3MLZL 1JHTA 4NCC1 4PD4J 1RZIB 5K59E 2J8HA 4U4BA 3PWNA 4K2UL 3VH8A 3ZYIA 1EERB 5IMLB 4AIZB 3FOLB 4HIEB 4HIHA 4N8PA 1NCBH 5FM5O 4RFEA 4Q9QH 5A3IC 2AJ3B 3LRSA 1HOCA 5DUBB 4MVBC 3O11B 4L5FH 5D7IA 1RD6A 4DN3H 4ZFZA 4TVSa 4UB0L 1D9KC 3M1BA 3I50L 4X6CA 3S36X 4MSWA 5JR1L 4YHNB 1QHPA 3S8WA 4UOW1 1DBJL 3UBXA 2E5EA 5FO7B 1O7VA 4K3JH 3QO1A 4M1DL 2V2WA 4PJHB 4U1IA 3RPKA 2BNQD 2A9MH 1UJ3A 3ABZA 3IFLL 4ONGL 5F9JB 5GGVY 2WINA 3QDGE 3BKYH 2EE3A 4FZ8H 3LKNB 4HSQA 4LCUA 2X4QA 1LE5B 4GO6B 3IU4L 4JFDA 5CILL 2ERJB 2R1XB 2NY1C 1S5HA 3B6SA 5I1HL 1EJOL 4AK1A 4X7SH 3O2VL 3ZYOA 1IL1A 3DV4A 5DT1L 4OCRH 5C0ND 4ISVA 1U8KB 2BY2A 3ULUE 4TN9A 3IKKA 4OCWH 4PGDB 4L4VD 3JTTB 3Q48A 3V9FA 1DP0A 3RWJA 1MIMH 5DRWA 4PRPE 1EEUA 3CVHL 4ZTPH 3TBTA 4G6JL 4IRSD 2DWDA 1IGFL 1MF2L 5DR5L 5EORH 1GIGL 5F9DC 2BVPA 3O9WA 4Z78A 3JVGC 4PBWD 3RGVA 3KPQB 1I8MB 3V0WL 2EXWC 3OGCA 5EOCJ 3X13B 4DAGH 1MCOH 4Q97A 4N9GA 4NHUB 3D0VB 5HGHB 2H3NA 3ZDZE 3JV6B 1FZMA 4PR5B 5HYQB 1T66D 3G04A 2COQA 2AK1L 3HUJE 4OZGE 3ESUF 3BZ4B 2PTTA 5I19H 1Q0YH 4JM4L 1DUZB 3BDBA 4DZ8A 3WFHA 1NUDA 1YC8A 2N7BA 4Y16A 4GJTB 3VRJB 3GMOA 1RULH 4JQIH 4KH2A 3UTTD 1MRCH 4YFEA 1BD2B 3L5JA 4DK3A 4DKFL 1FL3B 4FQXB 4QTIH 5BCAA 4HPOL 4DWHA 4UAOB 4NWTL 3BE1L 4Y5XC 4H88H 2OL3B 3CVIL 4XBGA 1GH7A 1GCFA 1REIA 1RIVH 4Y4KC 2G75A 4UQ3B 1KT2A 1WWBX 5CD3A 5EUOF 5ICYA 1DQJB 3SDCB 3TVMB 5ICZB 1WEJH 2FD6L 4EUPA 3TBYA 5D6DC 2CJUL 4ETYA 4HIIA 4TOYH 3MNVB 4LPTA 4F9PC 3QULB 3FB5A 2PYFA 2XXMB 4NN5B 1W0WB 4JANA 5GISL 3WHXA 4LVHB 1NAMB 2Z31A 4NM4L 4L9LB 5EN2B 4HQQH 1F00I 1I4FB 1I1CA 2Q1EA 3GMRB 1JPSH 3NCJH 1I9RL 1MJ8H 3ARZA 3ZDXE 2IPTH 5D1ZA 2DQIH 3U4AA 1M6OA 1N7ML 4O4YL 2OI9B 3OKYA 4TNWK 4J23A 1XMWA 1EEQA 3WDHA 3HZMB 2P5WE 3KPOA 3Q6FA 2E6QA 3AROA 3NH7H 3L3HA 3FAXA 5AZEH 1HYSC 4KTEL 4Q0XL 5J9PB 3MV7B 5C6TH 1ZLSL 2V2TA 1Z3GL 1E4KA 3E2HC 3V0AC 1F6AB 3MUY1 1Q9LA 4XP4H 5CP7A 4OI7A 4PJ8C 3FHQA 4OQTA 5DSCA 2X4UA 3BEVB 5HBBA 5CZXC 4Z7OE 1LO0H 1SYSA 4XXDB 4P2OA 5JXEC 5C0EA 5JOPE 1J5OH 4LLWB 4WHYH 4RWYH 5B39B 4HH8A 4LVOB 1PEZA 3FZUD 1UACH 2B1AH 4RBPK 2HFGH 2CDEB 4EOWL 3S97C 5INDA 4X5WA 5F7YC 4HULB 4WTZG 3FQRA 3BKCH 4RMSA 3VD4A 2W9EL 3QEUB 4I48A 4LLQA 4PJBB 3RDTC 1WBXA 5IV2A 3TFKC 3GSXB 1QEWB 3IFNL 4IOIB 3OJDB 4XVUD 5I75C 4U6XA 1J7VR 3PWUA 1JFQL 1EXUB 2HJLB 1VHPA 4UNUA 5E70A 4OZIF 1H15B 2B4CH 4OB5H 4JDZB 1EK3A 1FSKB 2DLTA 3FT3B 4I0PD 4QTHB 5KSBF 4Z77B 4JY6B 3GSNH 4Q6IA 4NQDD 1DL7L 4X8JB 1I8LC 4JPWH 5JNYB 1PVHA 3EYUH 3EYOB 3IJYB 2WQRA 5EOCH 1TTUA 3HTLX 1E4WH 4YDKH 4E41E 4IMKA 4U6YB 1KGCD 1YEKH 2YKLL 3I6GA 5DMYA 3QEQB 2ITDA 1HH6A 3O4OB 3RX5A 1R24B 3VWJD 5EC1B 3DIFB 4R26L 1URLA 2M2DA 1GZQB 1CTNA 5KZCB 3CK0L 1GOFA 4GKZB 1KTDA 4HFUL 1D5ZB 4JB9L 4XMPL 4R9HA 2FIKA 1XF5A 5T1KB 2VDPL 1A4JB 3DYOA 3WO3B 1LHZA 1WWCA 4X4XA 4Y4FD 3VFPA 1J11A 3F12B 4PY8I 4E42A 3OKOA 5IGXH 1I7UB 3HR6A 1WC7A 4YE4L 4R4FH 2BCKA 1IQWL 4P57A 1BHGA 4PREB 3OKEA 1ADQA 3T65B 2F15A 1FNEA 1K5NB 4N0FA 3A6BH 2OMNA 1QYGH 3GMLB 3S35X 4KZDL 4E5XA 3O3EA 5GGUB 3STLA 1KCVL 1S7UA 2JJUA 4G5ZL 1FJ1A 3KPLB 4OSUH 2QBWA 4I3RL 3AAZB 4JQXC 1FIEA 5L2JB 3RVUC 4RZCA 5D1XD 1U8NB 2R2EB 5HHXH 2Z0BA 3LQZA 4Z7NF 1WBYA 5T5FH 4P9HL 4IEFB 3QG7L 3NMEA 3QUXB 4JVWA 3QPQD 3Q6GL 4MA7H 4RFNC 2AEPH 3QIBB 2A2QT 4JLRB 4M7KH 2KBGA 4MD5B 1U9KA 4XPHL 3UJJL 2ZUVA 2R1WB 1I8KA 4WWKB 3W9DB 1JRHL 5EU5B 5DQJA 5LXGH 3QRGH 1RUPL 1HI6B 5HJ3A 1DEDA 4ZUSA 1UB6A 1YEJH 4HWZB 3IXAA 2CO7B 2DDQH 3TIDB 3ROOB 1T1YB 4WI3A 1H3UA 4WU5A 2IAMC 1VDGA 4KHTL 4WUUB 4ETQB 4ODTH 3B83A 4KK6D 4WW2F 5HYJD 4G9FA 1A6VL 3O45A 2VDQL 4OLZL 3LH2H 3F58H 1KB5A 3MFGB 1BQHG 1INQB 3KR3L 1HWHB 2XXCB 4LLAA 2B7DT 1V05A 3KLAB 5T1DL 5GJTL 1D9KA 1P4IH 1BREA 1S7WB 1J0IA 4RAVB 5F44A 3X11B 1U3ZA 2Q7YB 4XVJL 4ELMA 2J8OA 3KXFE 4H0GA 1Q0XH 4KK5D 4P4RA 4F3FA 3CFDA 4JR9H 5DC9B 3EOAB 1ERNA 3UYPA 4MXVE 4JRXB 1Q9OB 4HUVB 3ARQA 1DN0B 3SN6N 2LFGA 1T5XA 2R15A 5FK9A 2V6HA 3UTSB 2Q3AA 4TNWF 4LLVB 4P4KD 2ED9A 2V5MA 1JRHI 3QDJE 3PV6B 5DD0H 5DD3L 4X99A 4LDOB 3AXLB 4WI5A 5L6YL 2C3HA 3TNNB 1IEAA 4ZUWA 3UJTL 5H94B 3LKPB 2UZYB 1G7MA 1J0KA 3QDHA 4JGMA 1N6UA 3DUSA 2VLJB 1T1WB 2AEWA 5T1LB 1KEML 3WO4B 4UUJB 3LIZL 4OCLC 1ZGLM 4PY7B 3P0VL 1TETL 1MOEA 5I6XC 1U2CA 2ITCA 4Y4HB 3LPFA 3K1KC 1K4DB 2FJGA 4XNMA 2NY4D 3QNZA 1BVLA 4JY5H 4TUKH 2NXZB 3JVGA 5DQDH 3WYRA 5HD8C 1EAPA 1M4KA 3DMMC 3LRGA 1N64H 4FFVC 1YPZF 1YQ2A 5TQ2L 3WIIH 1AXSB 1P7KA 3K4AA 3ULVL 2DTMH 4APQB 1VEMA 2GSIB 1A47A 4WDIA 1FDLH 2C3WA 4M6NL 4PJ5A 4LSRH 5KSUA 4XBPB 4NZDA 1VA9A 3HE7D 4GKSA 2EC8A 2EH8H 1NFDE 4P2CG 1G7PB 3D3VB 2CDGB 2FNBA 5SV4A 3HG1A 4LASH 4P2QE 1HINL 1FFRA 2EIEA 4K55A 5J13C 4PD4K 4HLJA 5CJQL 3KPRE 1UXWA 4JKPL 4Y5XA 1J8HD 5C0AB 3MBXH 4UMGA 5D5MF 2ZCKL 4OZIB 1P6FA 4Y4KA 3H2WA 3D39B 2BVEA 3TO4A 3QQ4B 2ZUXA 4ODBD 2VDOH 1MY7A 4C4KT 5JA9A 4P23A 4CBPA 3TYFA 3ZYJA 1ED3A 5TF1H 5D6DA 3C6SA 3O6LL 1V5JA 4V1DD 3OB0K 4F9PA 4W4OC 2G9HB 3MLWH 1ZA6B 5JW4M 1UCBH 2N4IA 3AVEA 2ARJA 4YQXH 5JOEA 4DVBB 5IJKC 3MJ9A 5IW1B 5C0IA 3B2VH 2MWCA 3VXMB 1G1CA 1S7QB 5HVWA 4OCMC 3VH8G 4UV4L 3HLAA 1KJ3L 4ODVL 4YDJA 1FZKB 5J6HA 3QFJB 3OZ9H 3EO1A 3A67L 5ADOH 1A1MB 1ORQB 1XIWB 3KJ4C 4WIQA 5FKAB 2VXTH 1S7SA 5MENB 4QRPE 2R2HA 3FB7A 1PQZB 2IALA 5FCUH 2CLVA 3T2NL 4HW6A 5I76A 5HGBB 5I8EA 2ZUTA 1OQXA 4PJDA 1OARL 2P24A 5GRXG 3T0DA 4NC1E 2AI0L 3MNWA 5JO5A 2GK0B 2GCYA 2JELH 3TT3H 3UBXG 4M7ZC 3ZE1F 4BUHA 5ACLA 1CE1H 5IB2B 3PWVB 4NWUL 3M8OH 5B3NA 3HC0A 1DN2A 3ME0A 1S5IH 4PJGB 4DVRH 4MQXC 3TN0B 1FPTH 4TQEH 4I2XA 4NRZB 5A2JH 5ETUB 4X7FC 4PJ8A 1J1PL 4JM2C 1IGTB 1LO4H 1QVOA 3EJYD 4Q6YA 3OX8A 3QIUD 5JQ6L 1TDQA 2H32A 1BAFL 2LAGB 1GZPA 2WUCL 3O4LD 2FJHB 5C07A 3O6FD 1NH6A 4G7VL 5ISZA 4N0UB 4GG6B 3SKNA 1HHHA 2ADIA 2GTWA 3HI5L 4PJFF 4X9HA 2ADJA 1MJJA 3WE6B 4R7NB 1SM3L 1U92A 2VDLH 4NQEE 2H6PB 3QFDA 3O2DH 4GLRH 3SDDC 3RDTA 2VDML 1JGVH 1Q72L 2F9BT 4P2YA 4BH7B 2VLRA 1AD0B 4JQVC 1YECL 3RQ3A 5MEOB 1YMHB 4GQPH 4U05A 2GUOB 3VWKC 4OM1L 2DQDH 2VAAB 4P3DA 2YPLD 4H1LH 1PLGL 4MHHI 5DD6A 1K2DA 4PJXA 5JHLL 3KJ6L 4NUJB 1O0VA 3QI9B 4L3CA 3NN8B 2FGWL 3DV6A 1I8LA 1H0DA 5ID0B 4PUBL 2CKBH 2EEBA 3KLHC 2NXYC 4LLDB 4DGVL 4D0BB 4AL8L 3KLDA 4G3YH 4JHWL 3ILPA 3NIFF 5FO9B 5KS9A 3HE6D 4HJGA 1T89C 1BECA 3SE8H 4FTVE 4ZAKB 1P4BH 1IARB 1OT1A 1NGWB 2CR3A 1KF9B 1UEYA 3PIQB 2RJMA 4KV5E 4OIAA 3I3DA 3L1OL 4NZRL 4PJ7E 3CDCA 4NP4L 2GFBB 3T8XB 2AAVA 4JZJB 3MLSH 2DQHH 4RX4A 5SWSE 4K9EL 5F7EH 1U8PB 3FQNA 3W5MA 4YNYB 2VIRB 4AEEA 2P5EA 3E6FA 2B5IB 1S9YB 2QHRL 2JK5B 1QSFA 2YK1L 1KENL 2PTUA 1QSVA 3WN5B 3OTTA 2MHAB 3MBEB 5LCVH 3QO0B 4M43L 2VTFA 2YWZA 4KZEL 1JJUA 1VACB 1LK3H 5E9DE 3MV9E 3INUH 3DOSA 1A3LH 3HAEB 4WWID 3SPVB 3BMWA 1OGTA 3PGCB 2JJSC 4UT6L 4YUEH 1IGML 4CU8A 3RIAK 3DVFA 1HHJB 5E00A 3TNMA 5DJ8A 4JQXA 3ULVE 4IRJC 4JFEB 4M5ZL 4FN0A 5JMRA 2UZXB 1R0AL 4KI5C 1J10A 4PJEF 1JPST 5E24E 2J2ZA 3O2WL 1FH5H 2PW2A 5BW7C 5MEPA 5ESAA 4Y5VB 4YXHH 2HKHL 1U6AH 5D2NC 1A7RL 1KNOA 3OXRA 4RIRB 4EI5D 2UYLB 5CD5D 4NJAL 4RMRA 3LKRB 5IQ9A 2IQ9H 1AP2A 2V17H 1CCZA 2N56A 3LEYH 4C56A 1I9JH 3DURB 3CLEH 1IAIL 4X9FA 2ZCLL 2NY5L 4LEOA 2IAMA 2UUDK 5I18L 1L7IH 3O0RL 4JY4A 3PDOA 3NIDF 3P0YL 4HT1H 4F7TB 5JIHA 3WJLC 2AABH 1U91B 3G5XB 4JN2A 2PR4H 4JJ5B 2VNCA 3QH3B 4LU5L 1KCSL 4BQCA 1AE6H 5D5MB 3BIKA 5KANI 4H0HB 2BRQA 1UB5A 3GBNL 4Y0GA 1WFTA 5D96C 5CS7A 2AXFA 5GRVL 3T2PA 2YD8A 4XAKD 2C7UB 3DUUB 2O93L 3LZFL 4J4PD 4G8EB 3QUZB 3BP7A 4PV8B 4KDWA 4KKNA 1JUFA 1TVHB 4OLWL 1BBJA 4JKLA 5DEGB 4Y2DD 5DI8B 3VRLE 4J6RL 5F89B 4DOHE 3STZA 1N8ZB 3CU7A 2EDYA 3D5OF 1A7BA 3BKJL 3K2UH 4RGOL 2BVUA 3TPUA 3C5SB 2HTKC 1K6QH 1TJIL 5I1EH 1IKFH 4URTB 1Y0LB 3X3GL 4PRPA 2Z4QA 1VFAA 2ESVB 1U8QB 4HKBA 2QSCH 1IAII 4P2RD 3QXAB 1RZJL 1J86A 4FZEL 5E08L 4MB3A 2NY3B 4ZUTB 2CRMA 3OPZL 4NNPH 4LKXB 1U95B 3MLTA 3QQ3B 4HXBH 1BP3B 1KXVC 2DYPA 3QNXA 4CVZB 1BM3L 3WNOA 5BRZE 3TO2A 4IS6B 1XF4A 1T83C 1CL7I 3L5XL 2HMIC 3OAUH 3CU1A 5C0CE 1EZVX 5FV2A 3Q5YA 4OFYD 1BWMA 1BMGA 1XR8B 1Q8MA 3HUJA 2ICWJ 4OZGA 3W0WD 2GSGB 1T5WB 4WO4D 4RISL 1ACYH 1N5AB 3KYKL 4G6AD 1SBBA 2C3VB 2KDGA 3HRPA 1M7XA 1MWAH 4Z95H 4GQ9L 1ZA3B 4MJ6B 3RAJH 3GJFK 5F1SA 2D7TL 1QSEE 2FEDD 3REVA 2GITA 1ZSDA 1AGCB 4GKOA 3TBWA 4HCRL 4G80A 4PRDA 4QHKJ 1FZJA 5E2VH 1U41A 4NQCB 4PJFB 2Q87A 5B3JE 1TPXC 2YSSB 1RZKC 5BZWB 1PYWB 1RZ7H 1OAYH 1RAMA 1MJUL 4KK9C 1TJGH 4OUUA 3RX7A 3R0NA 1FG9C 1UM6L 2XZCL 1JPTL 1X6NA 5E94A 1RMFH 3IDIA 3QG6B 4AEHH 5CZVL 1NCWH 2VABA 1D6VH 1DQLL 1Q9KB 4AH2B 3H9ZA 3LEVL 3IFPA 5IWLC 3QWRA 2OL3L 1AO7E 1CZ8L 1VPOL 4HBCH 4YXLL 3S88H 4XP5L 4DTGH 5EIQA 4R97B 3HCVA 2ZOLB 4MDJB 1F58H 1A2YB 5I1AB 4U0RB 2DKUA 1FORL 1X5HA 1NCUA 4W4OA 5DHVH 3UPRB 3FQXB 1EEZA 5DA0B 2NMSA 5IJKA 5JW5B 2X9YA 2PXYC 4N0CD 4PGBB 4K7PH 3D48R 4L4VB 5TGBA 1NAML 1MCEA 3UDWA 5C0JB 4NUGH 2NPLX 1MFCH 4IRSB 4GMSL 5F7UA 4H5SA 5FYLL 1BLNA 1OSPL 3IDGB 5EBWB 5FDWB 5F9WB 1T22A 1QLFA 1SJHA 4OD2A 3HC4L 5DJ2A 3ISWA 4XZUB 4ONOA 4P9HC 4FG6D 3VGAB 3MYJA 4LMQI 5IMMA 1R5IB 3HNSH 5JORB 3FO2B 4G7YH 3RIAF 1C5CL 5EBLB 4MNQA 4MXQC 2Z8RA 4LBEB 3TC9A 4S11A 3DUHA 1RJZB 1JYXA 5GGRB 4NHCL 5AZ2L 4JRWA 4FA8A 1A7QH 3W82A 3C6LC 4WNQA 4JM2A 5J3HC 1ZGLP 1CR9L 2H45A 3HB3D 3QDGD 5DD1L 2XYCA 5EBMB 1BFVL 1DBBL 2KZWA 5D4QA 5MERB 3BWAB 3W2DH 4CADA 2NZIA 4J3VA 2AV1B 4ZOEA 2DJUA 2R56L 3ZYZA 3DI2B 4UDTB 4PFEA 4LCWA 5DVMA 5E8EB 3QUKB 4PJ9D 3UJIH 4M8VA 1JPFA 3RRQA 2Q3ZA 3BGFC 3LB6C 3SDDA 1BVZA 3EUUA 4XPTL 5K9QI 3NZ8B 1P2CA 1U8IA 4OD3L 3E3QE 4JQVA 3WLBA 1JZ3A 1GGIL 1ZS8B 2CD0A 2NR6D 3ARGC 3QUYD 5BJTA 3VWKA 3TEUA 2QSQA 3BGMB 4MMXC 1B0RA 4MWFA 2A6DA 3AB0C 3P0GB 2Q76B 4K3GA 2FR4A 4EKXA 1QLEL 2Z8VC 1DBAH 3VFMA 5IEKA 3LD8C 4HIXL 5F71A 4F58L 4HG4J 5I1LA 5I8CB 2BOBA 4YHIA 5IVNA 3C2AH 5DEFB 4QLRA 2BNUB 4Z8FL 1DLHA 1IM9D 2IFGA 1U8MB 4M9OA 2W91A 4G8FB 4D3CL 5F3BA 3P3YA 3ILQD 3PL6A 4K8RD 4K71C 1O5DT 3KPMB 4RMVA 5C0BE 3MRLB 1MAJA 1FL6A 3QEGH 3LS4L 3OF6A 4M48H 2C9AA 4OBSA 1NFIB 3CVHA 1ZLUH 1BJ8A 2BSTA 1IM3A 1FE8L 3W9EA 4X4ZA 4XXCC 3OG4B 2J4WH 4K8RH 4GXVL 1JP5A 1BVKA 1LP9E 3ARBC 3LKOB 3T4YA 2NX5E 3OHXB 4JO4H 1UKSA 3G6JF 5MHSE 5JOFB 1IMHC 1TVBB 3E6HA 1A7OL 3GBMH 4FQCL 4WU7B 3QUMH 1AR2A 5DRZA 4ZPVB 3OXSB 3ULVC 3DXAE 3KYOA 2BXZA 1U36A 3C5JA 4KVCL 1QPPA 3JWOH 3G5YA 5HYSB 4MZ2A 2JJSA 3GK8H 2AEQH 1LE9B 1UYWL 3KPNA 1X5LA 1CIUA 5F88A 1DBKH 5E6IC 4IRJA 5IHUH 1RUQH 2V2XB 5I1JL 4BZ1H 1T2QL 2IMNA 3GSNB 2X70A 3FB8A 2DLEA 1X7QA 4YK4B 1NEUA 4ZDHA 3D18A 3OR6A 1XGYL 2WMPA 5D71L 4BELD 1NGQL 1NANH 1RUAL 5GRUH 5D2NA 5T33H 1HXMB 2R2BB 4NN7C 1QBLH 1ZXQA 4F9LC 2X4OA 2YEZB 5TQ0H 1BD2E 4NQDB 1MRDL 1VEOA 2W65A 2PO6D 4LMQE 1JNLH 3F65A 4TSCL 4P5TD 2APBA 5GGQH 5KTEH 2D9CA 1G9EA 1A4KB 2P5WD 2P42B 1LO5B 1DLFL 4RGMC 2DD8H 2PUQT 1GAFH 2X42A 2NY6D 3VWJB 1AGEA 4HKXA 4W4NA 3U83A 2I07A 2WQ8A 2Z92B 4TRPH 3WUWB 4RDQF 2X4SB 5IFJA 3KXFA 2ZG1A 5GS1B 1EFXD 2AXGA 3WLWC 1LQSR 3MGOA 2XRAH 2LTQC 2WIIA 1SY6L 3MRGB 5TDOB 2CXKA 4L3EE 1QFWI 3KPSD 1T1XB 4FFZL 5K9JH 1FL5B 4GRMA 4LHUA 4Y4FB 5EH1A 5GS0L 1GPOH 3MOAH 3TV3L 1T7YA 4BK5A 1BZ9A 1KYOK 1DANU 1RIUH 5IVZB 2CUIA 1MEXH 2ORBL 3QDJA 5FOBA 4OD1H 4P3WA 5EU3A 5FYLE 4OUOA 3R1GL 4XB8A 1LO2L 5ADPH 5JXAL 3MZGB 2BRRL 4TUOB 4XWOC 12E8H 2LVEA 5EWIH 2E7BA 1PAMA 2MFNA 3MROA 4A6YH 3CH1B 2DAVA 3EDFA 4EN3D 2FBJL 2AJXH 1D5IL 3KYAA 5F1IA 1MI5B 4UIKL 4D8PA 3RUGA 4ZSOA 3VFOA 4KKBC 4LPCA 5TDPB 5DUML 1INEH 1OTUD 3MV7E 4RNRB 3ZLQC 1B2WH 5FF6A 4X98B 5E8DH 4XC1L 5TDNA 4K3HA 3RL1A 1B4JH 4E41D 1T83A 1G7LA 3HPJB 2UZIH 1X5JA 1AY1H 2JJWA 1TIUA 3ARDC 4GW4B 4GKNB 3EYFA 4G8GA 3T0BA 4M3KB 2EKSA 4UNVA 4YHZL 4K94L 3HR5B 1RK0A 4DEPC 5I16B 4P5MB 2OJEB 2RR3A 1JWSB 1UXSA 1XF1A 4KAQL 4LF3A 3C09B 1C08A 2WP3O 3SE9H 3T3PF 1YYML 3ARFD 5HYJB 3RWFB 4NN6C 1FCCA 2F53D 4G6ML 4NKDA 2EEDA 2HN7A 4PJBE 1KPRB 4HF5H 5HI4D 3RTQC 4RSVA 4MAYC 3CSPA 1UENA 3CFIC 2J12B 4HZLB 4K7PX 4BH8A 2ICEA 2RIKA 4XMLL 5FUCE 2A74B 1LO3H 5DRXB 4TSAH 3V5KA 3HRZB 4BKLA 1EO8L 4M8QA 3L3DB 5IB1B 4JKMA 4F7PA 4U0QB 3TA3D 5TH2A 2HP4A 4PP2A 4QRTA 4KJPD 2OM5A 5F7FA 1OCWL 2EDRA 2OP4H 5IWLA 5FV1L 3O8XB 4DGIL 4M61A 3L3JB 3H9SA 1YMME 1XCTA 1KTRL 4FQ1H 1A3RH 1JF5A 5AEAA 3BT2L 3QEQE 4R8WH 3S36L 4P4KB 2WWMD 4Z76B 5HI3C 3PP4L 4C58B 2DRUA 5ITBL 1S9VB 2QLVB 4IOFD 3WXVH 4LSUH 2M8XA 3F6LA 2VISB 2FCBA 5EIIB 2B8OT 4YH6A 1CDCA 3WSQH 4LAQL 5HDBF 4D9LH 4CVWA 4HPYH 2IH3B 4OF5A 4QRPA 4LIQH 3SBWC 5FGBA 4G43A 4R4NC 1I7TA 2AJSH 2BFVL 3DGGB 1LGVA 4OZHF 4GW1A 4LLUA 1SJEA 2RCSH 1LILA 4P46C 4EEEA 3BGAA 4OLYL 1BIIA 1JBJA 4YBQD 1JNHA 4MX7B 4QHUB 1MELA 5D2LA 3VXRE 2FRGP 3BP6A 3LAFA 4GFTB 4YDLC 3G6JB 1QO3B 4HS3A 2DQTH 3SO3B 3JUZA 1YQVH 1Z6JT 1MCKA 2E27L 3V6ZB 3T04D 1UM5L 2NW2B 2P7TB 2FL5A 5HVHC 5IESL 3V4VH 3VFUB 2VDKL 5GQBA 3EDKA 4R90H 4XPGH 1R3KA 4M6AA 4AT6B 3SGDI 1N0LA 4ALAL 5IG7A 3B9KD 4X7TB 4R6UA 5EUKB 3C6LA 1MVUB 5JLZB 1I1FB 2O5ZH 2NY5C 2ARJQ 3RWDA 3B3IB 2EDNA 1RZFL 2E7CA 3H7BA 4JO2H 5DFVC 1HKLH 1C16B 1J8HB 5F9AC 2AJVL 3E3QC 5IMKB 2I9LB 1ZHNA 3U9UB 4GAGL 5I0DA 4JFFE 1KTLA 5SX5H 3P77B 1R6VA 3U7YH 3VMOA 3PJSA 1MCRA 1BOGA 2NY7L 4WUUE 5IK3A 4UBDC 1EMTH 3LHPH 3FQTA 1I7ZA 3FFCA 1ZLUK 3ARGA 4V1DB 3Q2CA 3X14A 4CMMA 2CDFB 3TCLA 1CICD 3FCTB 3F7VA 5E2TL 4QWWD 1N5YL 3R06B 4DN4H 3SKUD 4ODSH 2YMXL 3U4EA 1KCKA 1ES0B 4ZO9A 1JV5A 5EUOE 5FA4A 2ATPB 1QUNA 4X6FB 5E8PB 4U1HA 1U8OA 1MIEL 1G6RH 1ZWIB 3DVIA 1FFOA 3OJMB 2ERJC 3GI9H 4AJ0A 5SX4H 4IIQC 4QXUL 1T04B 3FQWA 4F7EA 3EOBA 1JGDB 4QRUA 4HUWB 4QNPE 1RZJC 3MRJA 3MV8E 3OQ3B 3UTSE 2WM0A 2FLBT 3L3KB 4F33A 5LG1A 1HZHH 5I30H 2PYEB 1MHEA 4U1NA 3C8HA 3D9AH 3ZHKA 5CCKL 5SV3A 2QHLA 4XXCA 1LDPH 5J11C 2ZSVA 1YC7A 3ARBA 4YGAB 4FP8H 5EU6D 3CSYA 1AKJB 3SKOA 3FN9A 4P2QD 3WL9B 3D25A 4AENB 5ALCH 3RHWK 2B1HL 5E9DA 3MV9A 4I5BA 2HH0L 3KPRD 4BFIB 1A6WL 1G7QB 4FQPA 3MCKB 5DVNA 3QIUB 1WFOA 1WZ1L 3UZEA 4XWGH 3VXUA 3AS0A 3WFEL 1M05B 3BPCA 1FNLA 1PJ9A 2A1WH 3O6FB 1B9ZA 3P11L 1UEMA 5IW6A 4H1LB 5H35A 4GT7A 4JO1L 4FQIL 3S4SA 1EHXA 1J0HA 5E6IA 4FABL 1HH9A 1ORSA 2VUYA 1CD1A 3GSVA 3MRCB 3QSKB 1NMBL 3CXDH 3MV01 1HQ4B 2Q7NA 4Q2ZB 2FX9L 3MC0A 3O3DA 1ZV5A 5D1QD 3BQUD 3KYMB 3IDYC 4P59L 4RRPG 1QACA 3G9AB 4POZD 1V3JA 4PJIA 3BIBX 4PGJA 3CFBB 2YPLB 4UAOC 5DMJB 2R2CA 1UQSA 4HX1A 4UV7H 3D3VE 5CKGA 4F9LA 2VB5A 4NSKB 4HV8A 3QZWA 1I7RA 1T4KA 2VLLB 1YNTB 2XTJD 3K8LA 1I75A 3LCYA 3SDCC 1YEIH 3MOBL 4MNGB 4GRLD 5GGVH 5C0AE 2BP3A 3EGSB 4I4WA 3HE6B 1A9EA 5E7FA 5ITFA 2VLME 4OZIE 3BRDA 4WI9A 3GMMA 2I27N 3D39E 4I9WD 3OMZA 2GJ6E 1MJ7L 4H25B 5KSBE 1Q94B 3GMQB 4LVHC 1NGYB 2P8MA 4ZQKA 4L9LC 3U9PL 1KJ2H 3K74B 3P4OB 1XCQA 2HT3D 3HNVL 4M62L 3G08A 4KROD 1OM3L 1S7VB 1TQCB 1U8HB 5IQ7H 2F54E 4IHOB 4HG4K 1B88A 1EVUA 3F5WA 5CHNB 5ICXB 3UC0L 1C12A 3L95A 2Q8BH 1GVIA 5EO9B 5JMOC 3IDMA 1NUFA 2BERA 1AQKL 1B4RA 4S1DD 4UIMB 4JO3H 3VXME 3IS0X 1RU9L 3RY4A 4XP6L 5IHZB 1CYGA 4X83A 3P9LA 4S1SH 4AM0B 3EYVA 5IW3A 1MFBH 1MCPH 1GHFH 3MACL 4X8XA 4HUUA 2J8UF 2Z35A 2JB6B 2X9XA 2DJSA 2I25N 4NQED 5CBEB 3VFGL 3D85D 5DS8B 5MENE 4O02H 3VXSB 4O58H 4KQ4H 4HHAB 4KGLA 4W6YB 2X05A 1NAKL 3DI3B 5J57B 4FQQB 1K8IB 4NC2B 5T3ZL 2XN9B 4UTBH 3MFFB 4W68A 4PRAB 5DHYA 1HNGA 2VLKD 4GXUM 5BRZA 3CCHA 2IBGA 4G9DB 1KLGB 4FNLL 2QSTA 1TZHB 3SOBH 5C0CA 1F97A 4O5LH 4JPVL 4QT5B 1XZ0B 3QCTH 4LCCB 4WI7A 3H7LA 4LLYA 5E2WH 2BVYA 3S35L 4PRNB 2IQAB 3OR7A 3OAYH 2EDOA 4LVOC 2XG5A 5TE6L 3SJVA 3FN0L 1A6AB 3FT2B 4KUZH 1NCBL 4XBEH 4CMHB 4Q9QL 3DWTA 1YY8A 4L1HA 5AD0A 3ARDA 1MFDL 4L5FL 4FTVD 3NCFB 3ZKND 4Z7NE 2IAND 2DQCH 2ZSWB 1X5AA 4DN3L 3PWLB 1KIPA 3L3IB 1T0PB 3T08A 3BN9D 3N9GH 3NTCH 1VSCA 2Z8SA 2PW1A 1ZT7A 2P47B 3IXTB 5SWSD 4K3JL 1AXTH 3V5DB 3EDDA 4MAYA 3ZSTA 2G5BB 5E8OA 35C8L 4WFGE 2D03L 4Y2OA 3V6OC 5BS0E 1MCBA 3BKYL 4IRZH 4P99A 2R0ZL 4FZ8L 4MDIA 5KVGH 3FQUA 1AO7A 1QR4A 5JIKA 3MA9H 4Y19D 5IHLB 4KJWC 3O4OC 3FO1B 4X7SL 1YNLH 4ZS6D 1HHKB 4DUXA 4OCSH 1F3JB 1K4CB 4OCRL 3RWEA 1BEYL 4Y2DB 1ZT4A 5CLWA 3DHJA 2EO9A 3RWCA 4OCWL 2HT2D 1KBGH 3MLRL 2FIRT 1P4LA 2AJUL 3P9MB 4LL9A 3G9VA 1G0XA 2DQFB 5HHPB 1NC4A 5EORL 1KPVB 3U0TB 3L7FA 1J1OL 5IEHA 2D9QB 4DW2H 1RUMH 4G6KH 1Q9WB 1JGEB 1CLOH 2W92A 4WHTA 2NW3A 3U1SH 3SBWA 2A6KA 3C60C 3LKQA 1D5BA 3ZHLA 2GY7B 4POYA 4DAGL 1MWAB 2CUMA 4JHAL 4JFQB 3RHWF 4MVBD 3JBG7 5CJOH 3P4MB 4K3EH 1L7TL 4HK3J 4D0DB 4P46A 2P8LA 1UADC 4U3HA 3FMGH 3OGOE 5D6CA 4WO4B 5I19L 5E5MB 4X6DF 2F8VA 1Q0YL 1V7NH 2RGSA 4YJZL 3SKJL 2BXYA 3HI6H 3AS1A 5SX5K 2BVOB 4LCIH 1X6LA 2IBZX 5F72S 1Y6NR 4OZFA 1RULL 4JQIL 1IT9H 4UTAH 1MRCL 4LHUG 3GIZL 3L3OB 4PYGA 1TTGA 3QUXC 2D3VA 3VG9C 4JFEE 1G7HB 3DX7A 5DDHA 4DZBB 1YN6A 2FYYA 3QIBC 4QTIL 1CG9B 5F1OB 3U0PB 3P30L 1WBZA 1DVFD 2QQNH 3LOWA 5K9OA 4WI6A 4M7LH 2R4SH 4H88L 3CDGB 3MRIA 2D7PA 1ONQA 1YEGH 2NY1D 1UH3A 1YPZE 5B22A 3DETD 1DDHA 2VWEE 2DQJH 4Z5RB 2APWA 3ZT7A 1RZIA 4M4RA 1FNHA 2V5SA 4AIZA 3FOLA 4HIEA 2D7QA 5DHVB 1OW0C 1QKZH 5DRNB 4TOYL 2AJ3A 1CDYA 3IB4A 5DUBA 5D7JD 3O11A 2W0KA 4NBYB 4MCZA 3HN3A 4E0RA 4HQQL 4XRCB 4HXAH 4M6OL 4MJID 4YHNA 3NCJL 3QJHB 5GS0C 1MJ8L 3ETBF 1NBZB 5FO7A 4MMZC 2IPTL 4PJHA 3A6CH 3PABB 2F8OA 3REWB 2DQIL 5D5ME 3H9YA 4NDMB 5BRZD 1RURH 5HDLA 1IC4H 2R0LH 1XF3B 3D0LB 3HI1B 5F9JA 3RGHA 1X5YA 1U58B 3HNTH 3OKDB 3JUYA 3LKNA 5EO0B 3VMNA 3QWOB 1LE5A 1QBAA 4NO0D 3IVKB 3VDBA 2RAMA 2R1XA