5D70H

Crystal structure of mor03929, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
216
structure length
212
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSGISYSGSETYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGFGTDFWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of in vitro affinity maturation and functional evolution of a neutralizing anti-human GM-CSF antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Granulocyte-macrophage colony-stimulating factor
total genus 45
structure length 212
sequence length 216
ec nomenclature
pdb deposition date 2015-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d70H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d70H01
2AS5M 5JIPA 4HS3B 2DWEA 2W9DL 4G3YH 2DWDA 3MRIB 3PDOA 5J12C 2BRQA 2YRLA 4ONHA 2VR4A 5IFAH 3B9KA 3OGOE 3SQOL 2G60L 3GI9L 3O11B 4NN6B 4FZ8L 3D85A 2CK2A 4KKAD 1EHLL 4ZQKB 2M1KA 2JJTC 3B3IA 3NACH 2YUWA 2B4CC 2QKIB 4PJ7E 2RR3A 4X9IA 4KRPD 2HYMA 4PGCB 2E7HA 1UG9A 5HHMB 1KJ3H 4XXDB 4Y88A 2HVJA 5GRVL 5IB2B 3ULVH 2VZ1A 1YNLH 5HHQB 1QBBA 3PE9A 1JFQH 1P7QA 1HCVA 4PRIB 3T0EC 4HPOH 5IMMA 1OPGL 2AJUL 2QV2A 4U1MB 2ZPKL 1ZGLA 4ZUUA 5IMOB 1HXMA 5D1XC 3ZE0F 1J86A 4JZJA 1YMMA 4QWWD 2ZKHL 4HG4J 2YR3A 3GSNL 4OBRA 5I71B 1F58L 1HXMB 4FG6D 3VXSE 1T0PB 4L4VA 2P8LA 4Y4FB 5SWZA 4PJFA 1I1RA 3EO1A 5DJYB 3KNBA 3RNKA 4NSKB 3KG5A 3P30L 1MCWM 4WWID 4CDGC 1J0YA 4CMMA 3TA3B 2PR4L 3V6OA 4OLVL 1KLUB 2O26U 1RZKH 1DQJB 3BEWB 4JGUA 1YMMD 3FB6B 5EA0L 4HAGA 5KW9L 2F53D 1WT5C 4ZTPL 1FFRA 1KIPA 2E5EA 5E1AB 2A83A 2Y5EA 3QFJA 1FN4A 1HNGA 4X5WB 5DK2B 1Z9SA 8FABB 3RBGA 4BFGA 1XEDA 1KFAH 5FGSA 1FCGA 5KJRH 3OX8A 4CDHA 3BQUD 3SDDC 2HAZA 4Z7WF 4ZS7L 4I8DA 4I48A 1ZS8B 2YHGA 4NO0D 4GXUM 4OGYL 5SX5K 1ZLWH 2X4NA 4WHTB 1V3LA 4LCYB 2ZCLH 3P73B 2IFFH 1GPOH 3BKCL 4ZXBD 4YXKH 3QR2A 2DMBA 2FDBP 1YN7B 3DSFL 4RRPA 1I7TA 3O6KL 3O45B 1A9BA 4LNVA 2P43B 1E28B 2Y9RT 4TNVK 1ZVYA 4WV1C 1EUUA 2HN7A 3OHXA 1YECL 2D3VA 5EORL 3HPJB 4LBEA 4X7DC 3RWJA 3O4LD 5B38A 4NC1C 4PJXE 1T5WA 5DYOB 4KZEL 3TGXA 5HI3D 2YA0A 1T5WB 5DMJB 5GS1C 3GO1H 5GGVY 2AV7A 4P2RB 3G5ZA 2R23B 3MLUL 2NX5A 4D2NA 1CE6B 4JFYA 2A6IA 3DECA 4DN3L 4TRPL 5J6HB 3BKYH 3G9AB 4NO5A 4QCIB 4TN9A 5BRZD 2NY0B 4ELMF 1GRWA 4NQVB 4EJ1C 3MSPA 4DW2H 4V1DB 3V6FB 4XPTL 2YSSB 3KPRB 3HC4H 5TFSL 4HFWA 1FFPA 1P9MA 2HT3C 1N3NB 2PO6D 4ERSH 3L3GA 1JNHB 5ITBL 4XP5H 1E6OL 4JQXA 3BISA 4LVOB 2FWOA 3PWPB 3IDXL 4NBZB 3WLBB 2VZTA 1X5LA 4P5TB 1YUHB 4WV1B 1DBBH 5H94A 3QDJB 4PLJC 1RZJC 1CBVL 1T0MA 1CFSB 5E6IC 4UAOB 2IANE 2DQDH 3QRGL 4JPVL 3WFEH 4P9MH 1GOGA 3HE7D 3WNOA 3U7AA 2FIRT 2WANA 1T2QH 3EYUH 4RGOL 4HH8A 3AB0C 2VC2L 2YPKA 1JWSA 1ZT4B 3H9HB 2KL6A 3QH3A 4IOFD 3RPIB 3L6FB 1UCTA 3NZHL 4JFQB 5HYJE 5FUOL 4MD0A 4ERSL 4LSQL 1NUFA 4YDJA 3PP3H 3O6FC 3HE7A 1U8OB 2QHRL 5KG9B 1X5ZA 4OLYH 2A1WL 3ZMRA 3U46B 2Y72A 5DA0B 2HP4A 1NL0H 4Y5VC 1HSAA 4GG8B 1D5ZB 3DYPA 1PZUB 3S96B 2A6KA 4RBPK 4HUVB 3E6FB 4LLDA 5EZJB 2AJSL 2R1YB 5MEOA 4G8GA 4G43A 1BF2A 4PGEB 5C09E 1KGCE 3LQZB 5EU6B 2BNRB 3VFVB 4Y19E 2C26A 4JVUA 4G42A 4CADA 1DSFH 3GNMH 1U92A 3RGVC 1OF2B 3QPQD 1R3IH 3MRCA 2Q8BL 1RUAL 5GRYA 5I1HH 2AEQH 5GGTL 4I13B 4M7LL 5HGHA 5ESQB 4IRJC 1Z3GL 5E0QA 4OLYL 4LPVA 3MNVA 1ZTXH 3X12B 5IVZA 4TVPD 3Q1SH 2IH1A 3T65A 1LO0L 3RVUC 2GSGA 3BAEH 5EU4A 2ZCHH 3DGGB 4WTWA 4QHMA 3L3JA 1N6VA 5FYKU 1MLBB 1CICB 2DKSA 2QL1A 1IGYB 4XP4L 5GS2H 3TNNA 1NJ9A 3C5SB 4BFEA 3JBG7 1IVLA 2PN5A 3VGHA 4JQXC 4FQLH 4IOIA 1X6LA 1QD0A 4GKNB 3S37H 1GC1L 1HOCB 4N0YL 3MYJA 1DANT 4Z95H 5KOMC 2A6DA 3O9WB 4R4BB 5I16B 1NMBL 2RHEA 3VXOA 4NN6C 4PLNC 1KF9B 5FXCH 4DVBB 4HLZG 4HWBH 1TIUA 1CXLA 1DN2A 5E4EB 3QEQB 1HYRC 2HTKD 3LN4A 3OKLA 3LHPL 1J8HE 2J7LA 2EXWC 4GO6B 5KOVC 3HG1A 3VE0B 1M1SA 1FG2A 2EEBA 1OP9A 4B5EA 2DM3A 1OTTC 5CIPA 3HMXL 1JYVA 5I1GL 5GGQH 2V5RA 3OZ9L 3QJHA 2CDEA 4F3FA 1MJUH 1QR4A 2Y7QA 5JTWA 3NFPB 2DB8A 2Q6WB 3QG6B 2IF7A 3QJHB 5I0ZA 4NWUL 5TF1L 3S36H 1JTTA 4OD2A 3GK8L 5I17A 2JB6B 3ZHKA 3AS2A 3ZYOA 2DLFL 2FB4L 3BHBB 3BKYL 5ID1A 1FGVL 4QXUL 1LK3H 3N9GL 1QFUL 4MNHA 1CGUA 4P4RA 3MA7B 3KR3H 5D72L 3O81A 4UIMA 2D31A 1LK3L 3N9GH 2PXYB 1G7JA 3PWLB 2UZXB 2OQJA 3SJVB 3EJYD 5KZCD 1UM5H 3DIFA 2IANB 1KELH 4RFEA 1YC8A 2HFEA 3WO4C 2D7PA 4W6WB 4JHWH 4IRSB 3K0WA 1FC1A 2CDFA 4JQVC 3LKQA 2JB5L 2DYPA 3HMWH 3LV3B 4YWGL 4JO2H 1TVHB 4M1DL 5JXEA 4HIJB 4MNQE 1FH5L 3WMSA 3ZYIA 1FL3A 3QWRA 4YX2H 4YHIA 1S5HB 5GSVB 4R26H 2OMBA 4XBGA 3A6BL 2DJ4A 1YQVL 4M7ZB 1DP0A 3MLVL 1QNZL 4PJ7F 5DJ2B 2EDNA 2NY0D 5F1IB 5BW7C 1E4WL 2YPLA 5TGBB 2DQEH 4FP8L 2X7LB 4P59H 2GITB 1T6VN 1UKQA 3P9MA 2O5ZH 3KJ6L 3K2MC 1FIGH 1FNAA 5L2KB 3VXME 3NTCH 3UTTA 5J6GA 3B5HA 3JTTA 3LEVH 3WJLC 2YK1H 3QYCA 3LEYL 3EO1B 3KLDA 1G7IB 1P84K 3C2SA 4U3XA 1TQCC 3O3DA 4D3CH 4YR6A 4R26L 2XZQL 5I1CH 3B9EA 2XQBL 3L3DB 5F1NA 5L88L 3MLTB 3Q3GA 2BC4A 4M7JH 5DT1L 1I4FA 3V4VL 1U91B 2VZOA 3E3QE 3UZEA 4X5WA 4YXLL 3QFDB 5DTFA 5DUPL 1CTNA 1YEFH 1V5JA 1U8NA 1F00I 4LLUA 1UXWB 4J4PC 4LVEA 3QHFH 3AVEA 5F72S 2EYRA 5T1MB 5DI8A 4TVPE 3SKUD 5K9OA 3OB0H 4OZIF 4XPGH 3IDYC 3BPNB 5HSFA 3FT2A 4OV5B 5HJ3B 5DVKA 4S1RH 2OR9L 4PJIE 2HG5A 1SYVB 1C16B 1S7VB 1T89C 3IYLW 3ZLQC 1FZJA 2FR4A 2F5BL 2UYLB 3DO7A 2BJML 3HC0B 4H8WL 1U8LA 1CDYA 1SYVA 4LHUA 4GG8A 3F65A 2BK8A 5FO9A 4NJAH 3UC0L 2EXWD 1OW0C 1WSST 4YDLC 1J1XL 3GSQB 3GSVB 2R1YA 1MCJA 1LWRA 1DDHA 3QEGL 4FQXA 3QEHA 4DGYH 1FYTB 3VH8B 4PJCE 1J0IA 4HIIB 3T65B 2JK5B 3RIFF 3PP4H 3FCTA 3S35H 1U8PB 1JPSL 1FYTA 3FL7A 5C08E 1Z0NA 3JZ7A 3DV6A 4I1NB 4A2LA 1OB1B 4ZOEA 3VGAC 5L0QC 3D18B 1FGNH 3N1GC 1VFBA 4OCXH 5CLTA 3VG0L 4R0LB 5MERB 3VXPB 5ITBH 1F6AA 1WQVT 1XF3B 4WI9A 5GS0H 5CSZB 4OGAC 4XP1H 3T3PF 2KPNA 4OB5L 4D9RE 1N4XL 3IAPA 1JWUA 3MBXL 3V5KB 1Q72H 4ZDHA 4JRXB 5D5MB 4RGNC 3ARBC 2XTJE 3I02B 5EFIB 3DXAA 1NCCL 3HNTH 4AEEA 2FZ3B 4L4TE 2BY0A 1CL7I 4Z7VA 1X4YA 2FGZA 1XF2A 5D2LE 2QSQA 4ZSOA 4P23C 2R4SL 3U36B 4L9DA 5C0BE 4BUHA 3WXWL 2X4TA 3RJQB 2ICEA 4UT6H 3GSUB 5JIIA 3VFNA 3D39A 3KVQA 1A6AA 1YEJH 4ZTOL 3RZCD 2X9YA 3PNWB 2F15A 1OTUD 1FG2B 3C6SA 2H8PB 3CDGB 4I18C 5I1AB 1RIHL 1BBDH 1A1NB 3G6AA 4HDIA 4PJIA 4YHOL 5JW4Q 1LEGA 4P5KA 3CLEL 5HYSA 1HI6B 1J8HD 1I9RH 1KEML 2WSKA 2R0WL 4F3FB 2WINB 1ZAGA 5DQJB 3C87A 1LEIB 5F6IB 1NBZA 4L9LB 4HKJA 1A6TA 4YC2B 3C60D 5ICXA 2EDQA 1UJ3A 1NMCC 2PUQT 1INQA 1T5XB 4X6BB 2DBLH 2XQYG 1MRCH 5DZOA 5JO5B 3CK0H 3BWUC 4YHIB 1R3IL 1IGTB 3KJ4B 1FFNA 2PW1A 4MNQA 1MRDH 2R15A 2JELH 1TZIB 4PJBE 5KN5A 2LU3A 3GI8L 3V5DA 2N56A 4Q9QH 4QY8A 1MCFA 2W1NA 2ZCKL 4QOKA 5F9OH 2V5YA 3ARZA 3KYKL 4X0KB 2IAMD 3SGEI 3U0PA 1P1ZB 1YQVH 4IRZL 5MEQB 3DROB 4K2UH 3OXRA 1T3FA 2VXVL 4FABH 4GRWE 3W2DH 1EO8H 1MHCA 3O2DH 3HRPA 3U0WH 2Q76A 5CJOH 3CUPA 3X11B 1QBMH 3WIIL 1TVBA 5KS9F 4E9LA 4I3RH 4L1HA 4DUWA 1ZHKA 1KENL 2BNQE 4X80L 3OKKB 1XT5A 1AO7B 3GBML 3KPMB 1RK0B 1OHQA 1KYOJ 2W0LA 3B4NA 2X89D 1WLHA 4PY7A 1MFCL 2EKSA 1P7KA 4N0CC 4R96B 4PJGF 3HE6B 3Q5TA 3KDMA 3UBXI 2I07B 4GSDL 3NPSB 4YZFF 1FNLA 3IDMA 4HWEH 3D2UA 3QJFA 2CO7B 2EDLA 4ELMB 2XY2A 1AHWB 4Z76A 1KN4L 4LKXB 1IZKA 4Z7QE 5LWYL 1ERNA 1W0VA 2NY1B 3TBWB 4LCCA 2VIRA 5CGTA 4HS8L 5FO8B 4F15B 4NUJB 4D8PB 4JRWA 4G6FD 4CN1A 5F9WB 1K3ZA 4I18A 3QNYA 3D2UD 4G9DA 3ULSB 3B9VA 4XXDA 3VXRA 4JM2A 5JR1H 3DVGA 1YEDB 1J1PL 2F19L 4PUBH 5I1KL 2BNUB 3LY6A 1I3RA 3IFPB 4QRPB 1SY6A 4FFZH 5E6IA 1EVTC 1YY9C 1ZWIA 1ZHBA 3DARA 3SKOA 3ZDZF 1AD9B 4KGJA 4GMSH 3BH9A 1PSKL 1M7IB 2XKNA 1FZMA 2FO4A 4QGTA 4U6VH 4MJ5B 2HKHH 3QUKA 1FZMB 2FO4B 1HXYA 4LDLB 3MV11 4OSUL 1BOYA 3MBEB 4LU5H 2A74A 5AD0A 4PG2C 1VKXA 2C3XA 1JZ5A 4Y5YA 4K9EH 32C2A 4OTXH 4G6MH 4OI8A 4APQC 3HG1E 5IB5B 1S7VA 2DBLL 4X6FA 3TZVC 3K4AA 4LSUL 2AJYL 3MJ8B 4Y4FC 1MFDL 1T4KB 3L3IA 1K8DB 1RZ8A 4GBXB 1OVZA 3VI4F 5SX4H 1J0HA 3EOBB 1U8KA 1Z9OA 3DMMB 4FQXB 5FGBC 1EPFA 2FD6L 4LP5A 4BQCA 2RCSL 3JTSA 1U3JA 3KXFA 1RZFL 3IU4H 4XC3L 5D7JC 1FNGB 3BGFC 3R0NA 1CD9B 4A2MA 1T21A 1QFWL 4JO3H 3R0MA 3B3IB 4P2OC 1Q9WA 3OX8B 3VFUA 1C08B 5J89A 5GSRA 3KLHD 1MFBL 2F8XC 4HPYH 4P2CG 4CAGA 4OZ4B 1WITA 5JQHC 3WIHA 1NJ9B 2E9BA 3TBVA 3T08A 3HR5A 2VXTL 3KXFD 3HI1B 1H3GA 4X8XA 4ELKB 3OJDA 3IAGC 3U0TA 3O3DB 3GB7A 5DEFA 1FPTL 5FB8B 4QRQB 3STBA 4PB0H 1AKJB 1WCBB 2AI0L 1UT9A 2PCPA 4FQ2H 3QIBB 5EA0H 2A73A 3QA3A 2VKXA 5KVMC 3I02A 1XF1A 4Q9RH 1ODAA 1S3KH 4PBVC 5SWZB 3QUMB 4D9RD 3I85A 2WUCH 5I8EB 3QCUL 2YRZA 2DLHA 3HR6A 5SWZE 3U36A 3MLZH 1RZGB 4ZTOH 5CJ8A 2EE3A 2GEEA 4ZUUB 5IMOA 4DK3A 3CSYA 4KK6D 3FB7A 4OD1H 1S7UA 1C1EH 2ZUUA 5C0FB 3NCBB 4S1RL 3KLAB 3BPCA 1A64A 4KK9D 4M43L 4OZGB 5FUCE 3NFNB 3SCMB 4CJ1A 4UOW1 1QBAA 1LGVA 4ORGA 4F7EA 5E9DE 4AQ1B 4X6DF 1SM3L 1S7RA 4XNQB 1MWAA 3RKDC 4ORGB 3MUJA 3QNZA 3DBXB 3PP3K 4MNGB 2P46B 4HC1L 5ALCL 4F7MA 1U95A 1VFUA 4EDWL 1AD0B 3D48R 2KH2B 4O51B 4TVSa 1KIQB 3AAZA 2WP3T 5F21B 3T77A 1N5YL 1JRHI 5HVHB 5B3NA 3A6CH 1TVHA 4GAFB 1BOGB 3G9VA 4Z5RA 2YPVH 1XIWD 3GMLB 5CJOL 1VDGA 1NPUA 4MA7H 4NRXB 4N68A 1ZHLB 2VAAA 1YPZE 2VXVH 5I74C 1ZOXA 3RI5K 1B3JA 2VR5A 4PJCB 3QDHA 1OGTA 3HN3A 1IC5H 4G6JL 4H26B 3CU1A 3RAJH 2C3WA 1VHPA 3DYMA 2OZ4L 3NTCL 3K3QA 1BX2A 1HCFX 4ACPA 1RULH 1SEQL 1X9QA 2VDPH 2P45B 5EC2B 2DLTA 2DWEB 4M5YL 3ZSTA 2ZCLL 2HFFB 1ZHKB 1AXSA 2ERJB 1IAIM 1G7QA 2A6KB 5J6HA 3MRQB 1QRKA 5EUKB 1IFHL 4XNMA 5IIEA 1J7VR 3RVXC 1RJZA 2HJFB 1YEKH 1HKLL 2P5WE 3UJTH 4HFUH 4K8RC 4P5TC 4YR6B 3AY4C 1KC5H 3GI8H 4Q9QL 2HJFA 5IT2H 4JY5L 4Y1AE 1BECA 4UTBL 1P4LA 1I3RB 3IFPA 3D2UB 4IHOB 5MHSD 1GGIL 1QTYT 3QAZC 3EYQC 2BDNH 1MCDA 4EI5C 4CU7A 1SYSA 1FYTE 4P9HH 3HUJF 4P59L 2NY0C 2DQTH 3MRHA 1CICD 2BSSA 3B9DA 3KPOA 4JPKH 4P2OD 2AJXH 4HT1H 3MNVB 2XT1B 1SVCP 1AFVL 3ELAT 3KPOB 2F54D 1KJVB 3I6GB 1NGPL 4RMSA 4K3HA 3H9SB 2NXZC 1MCCA 1L9MA 4RWYH 5DEGA 3FTGA 1CICA 1BJMA 1NFDA 4JRYB 1F4WH 1FNFA 3RVTD 4J8RB 1QLFA 5CGYC 2O5YL 2X44D 3PQYE 5T3ZE 3FT4A 2F54A 4PLOB 4V1DE 3KXFE 4G6ML 1DCLA 4M8QA 5ENWA 4I5BA 3MRMA 1BP3B 5KSBE 3GHBH 3BKML 3H0TB 2PO6C 3QI9A 4JPIB 4L8BB 2DDQH 2Q3ZA 2VXUH 3BH8B 4M7KL 2SEBA 1A1MB 2A83B 1P2CB 4YGVA 3FO2B 3ZE1F 4ODVL 1QLEL 3LRGA 5L6YL 2ATPB 1A1MA 4HKZA 5KTEL 2VZUA 5F6HI 4DQOH 2VLKE 3ARQA 3P9LA 4XNZB 4YDJB 4IS6A 4LVHC 1R5WB 4FQCL 2X4RB 1D5XB 4P4KA 4UILL 4XPAH 5JMOC 3BRGC 3WS3B 4ODSH 4GRWH 5GGRB 1GGBL 3IDGA 4KWUA 5DJ8B 1ZANL 1B9ZA 5F8RC 3VFGH 2MCPL 4OT1L 2NY7L 1J05A 2YEZB 1I7RB 3QCVH 3B2VH 4PJ9A 1AGDA 4M48L 4EUPH 1GGBH 5DD5H 1AKJA 1WCBA 3D85D 3G6JF 2X1XR 3RAJL 5KS9E 5JOEA 4XVTL 3GSNA 2UY7A 1Q1JL 5GIRA 4EIGB 4BELD 3MO1B 2ZSVB 1DVFD 2R69H 5DRZA 5L2JA 5HY9A 3FKUS 2AXFA 4P2RE 1HIML 1L7IH 4KJQC 2Z8WC 5DMGC 5DRZB 1T66C 3AY4A 3K74B 5D7IA 5DMYA 1WAAF 4LLQA 1E4KC 4X6DB 2WQ8A 4TUKH 3UZQA 2FCBA 4KJWC 4NPYB 1RJLB 4LPTA 1DVFA 1TJIH 4R4BA 3EGSB 3DV4A 1K4CA 2X9XA 3BT2H 5I8CA 3D39B 3FOLB 4BSWA 4I3SL 1JZ6A 1NFIA 4KI5F 2G2RA 1KTDB 4NQSA 2BNQA 3EHBC 4UBDD 5JNYB 2ICWI 3W0WD 5GGVL 3C60C 4UU9B 2FATL 1FFPB 5DQ9B 2ED7A 4IDJH 3O9WA 4KI5D 1KT2A 2DS4A 3VW3L 5FGCB 5E2TL 5ICXB 5TQ0H 1EZVY 2XPGB 3TN0B 3WDIA 1FORL 1N6UA 1XGYL 3IRZA 4JRXE 1HZHH 5D5ME 4JJ5A 3B9AA 2BNQD 2F53A 2APTA 1K8IA 1MRDL 5AEAA 4L4TB 2HKFH 3QIUB 4HXBL 5BOZG 4X6FB 3UO1H 2ARWA 3MA7A 3QIUA 4I4WA 1LD9B 4TTDD 1KC5L 2XQBH 4HXBH 1VGKA 5F3BB 1IAIL 4UTBH 5DWUL 2CLZB 2YUVA 3ULVF 3A6BH 4FFYL 5HHME 5BVPH 1MCRA 4NRZB 3SDXE 4YX2L 1DUZA 2MOVA 1KIPB 1PVHA 5C7XL 1GZQB 4JFDD 3U4AA 3QIUD 5FUOH 4U6TA 3RWCB 2Q86B 2GUOA 1RUKH 3SDAB 5A2LH 1DBJL 2VLRA 4FP8H 1S5HA 3THMH 2Q86A 5IHZB 1TZHA 1RULL 4G8GB 4U6VL 4ODWB 5IB3B 1KCUH 3WFBH 5HD8C 4N90D 3TBYA 2HLAB 3QUZD 3F7VA 4NQCB 4L5FH 3ULUF 2DYPB 1J87A 2NTSP 1EK3A 1NDMB 3CAFA 3O4OB 1QKZH 5EBMB 3UMTA 3CC5B 1AHWA 5C1MB 3GSRA 4WI6A 3BPOB 5DJZA 2NX5D 3ECBA 4ZOCA 2NY4C 3HNTL 2VITA 5I8EA 1IEAA 3QUZA 1JVKA 1KENH 1C8PA 3QUZB 3QI9C 4ZOAA 3I50H 5DYOA 1DLHA 1N64H 1U8HB 3HS0B 3SBWA 3FQNA 2BNUA 5DSCB 4R8WH 5JORA 3LH2L 2BHYA 1DUYA 2AQ1A 4MQ7B 3LQMA 1A6PA 4U2ZA 5FDYA 3E3QC 2R23A 1JHTA 3BMVA 2YUXA 3CNKA 1QKZL 3ZE1E 2IPKB 2LAGB 4PP1D 2I5YH 4JDVA 4Y2DC 2MWCA 1IM3A 1NGZB 2W9DH 2VISA 2ZUSA 5D7SL 1GC1H 3QDGB 1A7PH 2YMXL 3KPRE 5T1MA 4DTGL 1B4RA 4L3EE 4S1QH 3L7FA 3RX5A 3OR7B 3ARDB 4U31A 1D9KC 4NNYA 1R5WA 5HDOA 3WLBA 2WM0A 4YXKL 1X5JA 3QXUA 3EOAB 4YDVA 1ZA3A 2KQNA 1U2HA 4GKZA 4OCWH 1NUDA 5FV1L 2ADIA 2FBJH 1AP2B 1BEYL 5B3JF 3QI9B 4LHJB 1JNNH 5ESVA 5T5NF 5L6YH 2NY2B 4OLWH 3NABH 4WUUB 3NIDF 2B1AL 2F74B 1RZ7L 5T5NG 4AIZA 4TUOA 1HINH 1T0NA 1KFAL 4PTTA 2RGSA 3VMOA 2CUIA 5ANMB 2MKWA 3WE6A 4JCLA 2YBRA 4QRSA 2OL3B 3VRIA 4FFWC 4JO3L 2A6JA 4JM4H 3HB3C 1MIEL 4J4PD 2WWKO 5ISZE 1RUKL 3FZUC 2XN9D 3M17B 4RISH 5T1KA 1ZS8A 1I1AC 3VCLA 1KB5L 1MIEH 4KJYB 1MIMH 3GUTB 5FKAB 3CFCH 4HKBB 5L88H 3QIBA 4HF5L 3EYFA 1CVSC 2ID5A 4OM1L 3MREA 4UTAH 3SQBA 1SJVA 3NACL 5FM5M 5D1ZA 2P8PB 5GSVA 4KUCF 2UZIH 2XN9A 4MXVE 1DEDA 3BT2L 5IG7B 2XTJC 3IDJA 5T1KD 4WEMB 4NZUH 2B5IB 3BIBX 3QO0A 5D1QA 2E9WA 1H3PH 5F9JB 5J13B 3DX8A 5MERA 1C12B 1MH5B 1HH9A 5GS0D 4U1KA 4PJDE 3NAAH 4NRYB 4B50A 2XYCA 43CAA 3BN9D 1D6VL 4ETQA 4U6XA 4NN7C 1TJHH 2F53B 3VFWB 5F93C 4YHYB 3Q48A 4ODUB 5EU5A 4MGXA 3KJ4C 4EOWL 3WL9A 4X4ME 2Z35B 5DJ0B 1KPUA 3JWDH 2XWTA 3ZDXE 3DURA 3EAKA 3PL6A 2EH7L 2PYEE 4M5YH 5D1QD 3U6RA 3HRZA 5MHSE 4Z7NF 3OBAA 4QF1B 5LBSL 5LJYH 5T33L 2XQYK 3UBXG 1FO0L 5CKGA 5IOPA 4UUJA 2ZG1A 1JPGA 4E41B 3IF1A 5D5MF 1WWAX 1AD0A 1P9MC 4HIHA 4FFVC 2DD8H 3PWPA 4ODBD 1EBPA 2D7NA 3F7RA 3L3OB 4DEPC 4M93C 3MRBB 2GSIA 4QRPD 3CVHB 1F90L 1IARB 4FFWD 4PB9H 3ARBD 2J8UE 4HKZB 4AMKL 1CFSA 1J8HB 5KSAC 5CEZL 4EXPX 2FSEB 1FFNB 2Z0BA 5D72H 4G9DB 1F11A 3D6GA 3OG6B 5IGXH 2AEPH 3CFJA 5CBAA 3VXNA 1JCKA 1SHMA 5J11B 1UXSA 4PP1C 4U1JA 1YEIH 5IW1B 1BX2B 1T7YA 4M62L 3BGMA 4K3DH 2FGWH 2X4NB 3U30B 3ZYZA 2DYPD 4CVZA 3ARBB 1CDHA 3AM8A 5ACZA 4QRRE 3HPJA 5JXED 3UTSB 4PRHD 5DJCA 3MNWA 2ICWB 3K1DA 4U05A 1F90H 1R3KA 4PB9L 4RQQB 4XNMB 1MOEA 1EO7A 1RVFL 2BY1A 3DWTA 4P48A 1P1ZA 2OX5A 2H2PD 3IB4A 2ZOLB 3QPQC 1JZ7A 1YYML 2CDFB 4UDTA 3DV4B 2H1PH 3DRTA 1G1YA 1HKFA 4PJ8A 4ZFFA 4YK4B 5D2LA 4XNZC 4WI8A 2NTFB 3TYFB 2VDOH 5HYQA 1QFHA 4L8SA 1YEEL 3KPRA 3RVUD 3MV7D 2P8MB 3HI5L 1D5IH 2DTSA 5EO0B 4CU6A 4G8EA 1KTLA 5MP6L 1ZLSH 1YA5A 5E2TH 3FO9B 1XF3A 5F7NC 2V9QA 2ESVD 4X5LA 3U2SA 4LSTL 4PG9A 4RIRA 3WS6C 1CLCA 1VGEL 2OP4H 4YK4C 5D71L 5F3HB 1JBJA 1YNTB 3RGVD 2IPUK 3WUWB 4FQJL 4HZLB 3UO1L 2VQ1B 1JPFA 2YZ1A 1CL7H 1YYMH 4E0RB 4H20H 1ZWIB 5BRZB 2VDRL 4JJHA 1LDPH 3CDCA 3L5WB 5DJ6B 3WXVH 2R1XB 5I8KH 2QTEA 4EVNA 4FXKB 4WTXA 3GMRB 3QXAB 1MJ7H 1BLNB 2R4SH 4M6ML 5BV7B 2OXGA 5KSAA 1YNLL 3VXMB 1U8OA 5F7UA 4P99A 5KG9A 4OZIE 4FS0A 4BQ8A 5IR1A 3E0GA 1DBAL 1A1NA 3ULVC 1CDBA 3MRIA 3PDOB 2A9NH 3QDJE 1TTFA 3T0WA 3FO1B 1T1XB 3IXTA 4HC1A 5E00A 1WZ1H 4Y19D 1RZGA 1LEIA 2UWEE 4HKXB 4LHUD 4U6YB 3IJHA 4CNIA 2LQRA 4HIEB 2Q6WA 4C4KT 3QG6A 5D1QC 3SQOH 5B8CA 3WV0A 1OD7A 3VFGL 4ONFL 4G6AC 1GGUA 1JZ2A 5E8NB 3DVNB 2ERJC 4QTHB 3MV8A 1A4KA 4XNUH 5DD0L 3UPAA 3PP4L 1NMBH 3RVTC 4JFDE 3BZEA 4XCFH 4ZUWB 1BHGA 1MQ8A 4KXZI 4X6DA 2WBWB 2ILLA 3E2HC 3RU8L 4ODSL 1OY3B 3A6CL 2YRPA 3MV8D 5IBTH 3RIAK 3KS0H 2UZIL 2YD8A 4N8CL 5HDBE 3RVWD 2CQVA 3CU7A 3V79C 1RJYB 2COQA 3WLWD 3S88L 2R4RL 1QQDA 3CMOL 4MXVF 4PJGA 4JN1H 3QA3B 1CLOH 2X4OB 1P7QB 5HVHC 3EYSH 2WIMA 4QHMB 4KI5C 1BQLH 3T09A 3BEWA 4JQIL 4ODTL 1QFUH 2YN3A 2EKSB 1CFTA 4E41A 4IJ3C 4NQED 4GAYA 2HJLA 1NLDL 1Q9OB 4APQA 3DX9B 3VXSB 3VWJC 2AKRA 1NAMH 1KCUL 3WFBL 3IDUA 3U7YH 5HI4D 2H3NB 1IRAY 5AYUH 5IEHB 3HFMH 5C0FA 4ODHL 5M94B 5J4MA 2H2PC 5JPNA 4FQJH 4QXTA 5EUKA 4N1CA 3PABB 5GGUB 1FDLH 4NQEA 1NBYB 1WC7A 4YHZL 1G7IA 5HHNB 4OLUH 2GHWB 1NCAH 5GGUA 1JPGB 1AP2A 5KZCB 2WWMC 4NIKB 1NEZA 1HQRB 4QKXB 4J12A 2CDEB 3GIZL 4M1GL 3QXDA 4PJ5A 5ADOH 3O3BA 1U42A 4ZFZB 2FJFA 2VABB 1S7TA 4GAJL 3VRLF 1A6UL 1DJSA 5C8JB 4DN4L 4WO4A 5H8DA 1OGAB 4LSQH 4KPHH 1QYGH 1W0YT 4QT5B 4QXWA 3BP7A 3G6DH 1MRCL 3MJ7B 5C07D 1OLZA 2DQEL 3QNZB 3ARPA 4XTRD 1A3QA 3CSBA 2HKFL 1HHHA 5JZ7D 4L8SC 4MNQD 3BQUC 4KPHL 4FRWA 4U1JB 5EO9A 5ID0A 4PGBA 4TPRH 2F5AL 3EZ8A 3TO4C 3ARFC 2QSTA 5EBMA 1T1WB 4Y7MA 4KJPC 4MAUH 4EN3C 3GIVB 1I8KB 3D39E 3QHZL 4OZIB 3WNPA 4YWGH 1JZ3A 3E1F1 3BD3A 4C55A 3SGJA 3MBEC 4LIQL 3ES6A 1IEAB 3O0RL 4MXWH 4NHCH 3FFCB 2HFTA 4J3XA 1PZ5B 4FQXC 2X89A 2X4QB 1CXHA 4NKOB 4ZUVB 1JFQL 4Q2ZA 1P4LB 5F9DC 3TV3L 3ZE2F 1G1CA 1JYNA 1NC4A 4BJLA 2DIAA 2HH0L 4HD9A 1G9NH 3QHTC 2FGWL 3D3VA 3TWCH 3QUZC 5EO0A 5F9WC 1YEGH 4CGTA 5CLWA 3FT3B 5BS0E 2N7BA 3OWEA 1IILE 15C8L 4CUCA 1GC1C 5D70L 5F7YC 1NGYA 2JJWA 3ZKXB 3W5MA 1WK0A 1P4IL 4XVJL 4NGHH 1JMZA 3MJ9L 4LMQE 3UTQA 4HH9B 1PYWA 2OR8A 3FB8B 4JM2D 1IKFH 2EC8A 3HE7C 1L6ZA 5DHVH 2XN9E 4E0RA 4TSAH 5I1JL 1TNNA 4H8WH 3QIWB 4Y5VA 4IDLA 5C0DA 4HWZA 3FFDB 2E9IA 4R7DA 4XCEB 1PY4A 1JPSH 4LLAA 2BRRL 4H1LH 2HVKA 3O41A 4O2CB 5C0EA 1JI2A 4JG0L 5T3ZL 2R8SH 5FM4A 2HT2C 1U3HC 3ZE0E 2NY1C 4O2CA 3UTOA 3HB3D 5D70H 1LNUB 2LTQB 1KB9J 4JO1L 4WFFE 4XC1H 1WBXA 3DRQA 3JWDL 3VJ6B 2DQCH 3QULB 2HTLD 1T03L 3TCXA 1A7QH 3MOAH 1L6XA 4D9LH 4R9HA 3ARFA 5DRWA 3DSFH 3IT8D 1NCBL 3C09C 1CIUA 1S9XB 3ARFB 3ZDZE 5BQ7A 2BCKB 2NW2B 3AREC 4NNPH 4H1LB 1RJYA 1VKXB 4Y4KA 3SGJC 2EDYA 4YHZH 3NVQA 2Q8AL 4JZNA 1YMHB 1WVZA 5KW9H 4S0SD 3FONA 2I25N 1UYWH 2NZ9C 3PJSA 4JDZB 1NLBH 1U8QB 2F8VA 5I74B 4ONHB 4CMHB 3BRFA 5K33A 2Q7NA 4UQ2A 3C9NA 4NWTL 3RY6C 5FYLL 4HJGA 1Y6MR 3K8KA 3CX2A 4X0KA 1U3ZA 3LSOA 1FQ9C 2BFVH 1T83A 4QHKJ 5E2VL 4IIQA 5CUSH 3EYOB 1HNFA 1XFPA 5GGRY 4RMUA 1CLOL 1NMAH 1KPVA 3SKMA 5FO7A 4OZHB 3V5HA 3DGGA 2EDEA 3RWCA 3GJFB 5GIRB 4OIBA 3BD4A 4AG4L 5JPNB 1XGUA 3S8WA 4O2FB 3QXWA 4XVTH 4OZHE 2EO1A 4KUZH 5CP7A 1UKTA 5DDHB 4LOUD 3I84A 4P5MA 5F7DB 3VWKD 3NFSL 5DR5H 4P23B 4OGXL 1NEZB 4OF5A 3L5WA 5DJ6A 2KBGA 2NY5H 1S7QB 3PWNB 3O8XD 1EUTA 3KPLA 2I07A 3QPXH 4JY6B 5HI5C 5I8CB 3P11L 3QFJB 4JVPA 1NC2D 3JV4B 1VFAA 2ICEB 4YHKL 3RWIB 3WJJC 4MA7L 1K8IB 1MJJB 2ITDA 5JXAH 1MFNA 3EOYG 3S4SB 4ETYA 2AEIT 4TSAL 5I1JH 3VD9A 5DHVA 4UV4H 1MAML 5EU7E 4OQ1A 5DFTA 1GGTA 1JHKH 4FMKA 5JR1L 5JXAL 2AQ3A 4F9PA 5J13C 4GW4B 4E5XB 3KHQA 2IMMA 4WU5B 1G7HB 4L29B 4PGDA 5C0AB 3NN8B 3MLUH 4X6CE 3FRPA 5D6DC 3KS0J 1OAYL 1FZKA 4I3RL 3STLA 2BSTB 4GSDH 4TNWF 3UYOD 1DZBA 4XBGB 3HAEA 1LD9A 1MPAL 4K07A 4WUUE 5IFAL 1XIWA 5D1XB 4MA3B 3WXVL 1X4XA 3DROA 3QWOB 1EVUA 2WBJD 3S36X 1JP5A 2ZCKH 4MZ2A 3G04B 3PGDB 4Z7UF 2BXYA 2LVCA 1PLGL 4Q2ZB 1YEFL 5BVJB 3RI5F 3HZMB 3AM8C 4OZIA 3D1MC 4Z77B 3WN5C 3RNQB 1I3UA 3V4PH 4GS7C 1VEOA 3J7HA 5DMIL 3CUPB 1M05A 4C56A 1BIIA 2NY1D 4LL9A 4Z8FH 5J3HC 4PGZA 5EIVA 4LSTH 4M4RA 3T0VA 3LS5H 4PTTB 5C9KA 5E6YA 1A4JA 4P3WA 1MCNA 2FH8A 2YBRB 4QRSB 5JLZA 3QJFB 4ELMA 5C6WH 4WV1A 3VG9B 5E1HB 4PR5A 3UTTB 1NC4B 5J6GB 4I0PA 3KPQB 1OLLA 3IXAA 1Z2KA 5H35B 3BPNC 2H1PL 2AK1L 3EHBD 2VLKA 1XZ0B 4OCYH 4X98B 1BPVA 5AAWA 2MPAL 3QRGH 3QUYC 3GHEL 3O2WL 4JPVH 5TDOA 3WHXB 5FYKD 2VNCA 3TF7C 1LE5B 1J9CT 1DE4A 3K8MA 1HHGA 1CLZL 4R4ND 2VMFA 1N5YH 3IVKA 1QRNB 4K71C 3KYNA 5AZEL 2X41A 1CCZA 4RRPG 1JK8B 3GBNH 3KYOB 3LMJL 5GPRA 1SJXA 4H88L 5K9KA 5AZ2L 2ZKHH 2G9HB 5CD3B 5C9JB 5IB1A 4IDJL 3R06A 1FO0A 4BFBD 5AUMB 2X4SA 3QZWA 1MEXL 1JGEA 4ZFGL 1GH7A 2H6PA 2NW3A 3MTRA 4KFZC 1URLA 1OGAE 1Q38A 5KSVB 1A7QL 2ENYA 4FOMA 3KLSA 4K3DL 3REVB 3VJ6A 3AU1B 1IC4L 1UA6H 3L95A 5FO9B 2VLJD 4TTGA 1KJ3L 3GMPA 2X4UA 3EOTH 4WFFD 1AGEA 2PXYC 1UJTA 4M00A 1YPZB 1XF4A 1S3KL 4KTYA 5JHDD 3RWFB 4F8QA 3T77B 3G6JE 1AKJD 1BVZA 3QNXA 4NYLA 1S7SA 3E8UH 5J1AB 2VLJA 4JRXA 1XH3A 1RV6X 5D5MA 2CKBL 4NN5B 4X7SL 4FTVD 1REIA 5LVEA 3DV6B 4F7CA 1K3IA 1P5UA 3MLZL 1YEGL 3NAAL 4WENB 3RVVC 3DMMD 3GSOA 1N59B 4J3OC 4XPHL 2JKXA 4PRIA 3VXPA 1RU9H 4N8VB 5T1LB 1JWMB 1NGWB 4PRNA 3MLYL 4KRPB 4OQTH 3RTQB 1KCSL 3P4OA 3OKLB 2ADJB 4R7NB 1SEBB 2GTZB 4ZS6D 4ZAKB 3GSNB 3UTQB 2IEPA 1W72H 4XPFL 1ZT1B 5EORH 1CFVL 3ECBB 4HC1H 5ALCH 4PRID 2D9CA 5HHNA 4DUVA 4WI4A 3CSYB 1MCOH 3TN0C 3X17A 2Q1EA 3VWJA 5I1HL 3B6SB 1D5BA 1IEBB 3CZJA 4OLUL 3S37X 3OAZH 3HS0A 1I9IH 2V2WA 3PF2A 5LXGL 5JORB 1DQTA 5DQDH 3MLXH 4BQ9A 1T2XA 4HK3J 5HYQB 1KPUB 2AJVL 5TQ0L 4L4VD 4XVSH 2Z8RA 5SWZD 3VFPA 5EZIH 5JDSB 2DQIL 1MVFA 2EYTA 2O5ZL 2CSPA 2WINA 3VWJD 4LPUA 4NQDA 4BK4A 1DLFH 4M61B 3GMOA 1R5VA 2EH7H 4OCLC 4DKDC 3IDIB 1NBQA 5GRVK 4XBPA 3SGDH 1PG7X 1U8IA 1QA9A 3IDIA 4WU5A 5B3JE 1ZLUK 4HZLA 4X6CF 1I8LC 3GM8A 3A67H 3EIFA 5JQ6L 2OS7A 3GZKA 1IZJA 3MRRB 4WO4C 4DKEH 1H8SA 5FF6B 3GRWA 4OTXL 1NDGA 1MI5E 1LO3L 4WFED 4JFDA 1ZGLP 1L7TH 3EYQD 4UIMB 4PJAF 3EJYC 5TH2A 1XGRB 3BQUA 1CGSL 2W91A 4XVSL 2VLRD 1PLGH 1CQKA 1F4YL 4UNUA 3ZKMD 5EWIH 5FM5O 3SE4C 2QADD 2SEBB 4JFZH 3DTXA 3VFOB 3MLVH 3TLRA 5SWSB 5EOQH 3LS5L 5HGDB 5GGSY 3BGFB 3BO8B 1BJ8A 4XGZB 1MCBA 3E6HB 2GQHA 4L4VE 3O3UN 2AJ3B 3MOBH 1DUZB 1HWHB 1F4HA 3AS0A 3I3EA 3HZKA 3SCMD 3IGAA 4WDIB 5KVGL 3O4LB 5DZLA 5CP7B 3AB0B 1F13A 1FJ1A 3RWDB 1WV7T 1CE1L 1UVQA 4PJGE 1MCEA 4I9WD 3ARGD 1WZLA 4LAJH 3P77A 4WFHD 4XAWL 2NY3D 1NAML 5HHVL 4F33A 4AMKH 4HUNB 1QO3A 2JIXD 4HBQA 4F57L 1DN0B 5FKPA 1OAQH 4MX7A 4GUPA 2VDKH 1WICA 5BRZA 3MJGX 4O9HH 3H9SA 1KEGH 5KVGH 3BIKB 3NH7H 1OP5K 2GSGB 3PV7A 3SJVE 2GFBA 5AZEH 4OD1L 1H3WM 5IESH 4PG9B 4UZGA 1GPOL 1NFDE 3VXUE 5E6IB 3VU2A 2JIXB 1NH6A 2ZP0T 4UQ3A 1E4XL 1Q9KA 3MRLA 3FOMA 4K94L 5BOPA 1U8KB 3CSGA 2R0LH 1F8TL 3ULUH 5DGQA 1GHFH 2BXZA 1Q9KB 2CLVA 2J8UF 3RL2B 5IB1B 1NUNB 1ADQH 1FO0B 5D1XA 1RJCA 2BVPB 4KK8C 4Z7WE 5IV2A 1ACYH 2XZAL 2ADFL 2GY5A 4Y5YB 3AC0A 2JK5A 4QRUB 5DUML 1Y6NR 3BKMH 1S7SB 3GHBL 5J1AA 2HLFD 4JQVA 5C2BL 4X4XA 1I7ZB 3A67L 4M7KH 3AU1A 5FAAA 4QRUA 1JPTH 1ETZA 1T4KA 2ZJSL 3ARED 2C3GA 3EOTL 3L3IB 3INUH 1TZGH 1YZZA 5FCSH 5E7FA 4ZO6A 4F80A 2FEEI 4RMQA 2Y7QB 4XB8A 3N85L 4LHUB 5D7JD 1RZKL 1EIBA 5BZDB 1I9IL 3ROOA 3C9NB 5F7MC 1H3XA 2YD7A 1U36A 4QRRB 2VQTA 5I2IA 2IAND 3W9EA 3U0WL 3MXWH 4MNGE 4JDTL 2ITCB 4KVNL 3U1SL 1VGEH 2OP4L 3HNVH 4NO0B 4HIIA 5L2JB 3ALXA 2A73B 4RSVA 4JFXB 3T1WA 2APVA 5IF0A 3O45A 5ICZA 2MCG1 6CGTA 3BZ4B 1UWEH 1I85A 1MCKA 3QO1B 2VO5A 4HWNA 3HFML 3G5VA 3ROLA 3WJLA 3QCTL 5DO2C 3GMMA 4AENA 2XKSA 1U6AH 2BMKA 3ZHLA 1G9EA 1F5WA 4WHCA 1IGCL 3IFOB 43C9B 4PJBB 5GRJL 2ZOLA 4X98A 5LCVH 3EDEA 3UTPE 5GZOD 1CFVH 2VAJA 1MAKA 3ILQC 3UAJD 1TFHA 4AM0A 1LO2H 1KTDA 4E42A 2QQKL 4U1NA 4JZJB 2LU7A 3M1BA 4BSWB 3F58L 3PV6A 4NQVA 4M61A 4OCRL 1MHPH 3VD5A 3OXSA 3MRDA 3IU3A 4LSRL 4GKSB 5IKCB 2VKWA 3FB5B 4BFIB 1AH1A 3V6ZA 4OCXL 4ZSOB 4PRIE 4OCRH 1VENA 1X5AA 2J12B 5HGAB 3VGAB 5L0QB 3CFDB 1HH9B 5GS1A 3V6ZB 4WWKD 2UVEA 2AK4B 1MLCB 4IMLB 1ZK9A 2LFGA 3PWPD 5LAXA 3WKML 2PYED 3ARGC 2UWEA 1IL1B 2ICCA 3HG1D 3JWDC 3ULVD 5F7HA 1DQML 2JLLA 1DTUA 3DBXA 4MNGA 1TZIA 4K7PY 4ODXB 3BWAB 3BZFB 3NMEA 5L8LB 4HBCL 3PWJA 1OW0A 5FHAL 1DQJA 4K7PX 3HC3H 5KSUA 1MY7A 3U0PB 2UWEF 1CN4A 3FN0H 3HZVA 5DUPH 4XZUB 3MRRA 4OFKA 2PYEB 2DM7A 2DL2A 3HZVB 5ACLA 4HF5H 1I1YA 4X7TA 1FNSL 1UWGH 2GSIB 3VXQA 3CFKB 4MMZC 3OJVC 1INDL 1FJ1B 3RWDA 2GJ6B 1Q9LB 4RA0C 2CDGB 4JB9L 3MNZA 4PRHA 2ZZUT 4XCCH 4XCYB 3MUGB 5CIPH 3FRUA 1HH6A 1JJUA 3G5YB 4NWUH 5TF1H 3S36L 4F7PB 25C8H 1V3MA 3IDMB 4J1UA 4OZFG 5ALBH 3WN5A 5JDJA 3F12B 3HZKB 3MYZA 3P4OB 4OZFH 3L5HA 2BNRD 4GW1B 1YN7A 3CK0L 3O6KH 2X70B 3LRHA 2BDNL 1D9KB 2FYYB 1F2QA 5HTSA 3RKDD 3ES6B 2VIRB 2G5BA 3HLAB 3L5XL 1WISA 1NKOA 1XAUA 4C4KO 4HQQL 5FV2A 3VFSB 1K5NB 4B7LA 3KYKH 3QNYB 4IM8A 3LZFH 5DVNA 1HDMB 2BNRA 1NQBA 2I9TA 1G9MH 1QQDB 1LK2A 4EQ2A 5J0BA 1KCVL 2QSCL 4FZEL 3Q3GB 4FXGB 5FECB 1RZ7H 3HAEG 5D1ZB 5IVXF 2DQIH 2NYYD 5FYLH 2OTUB 3MROA 4X9GA 4NOFA 3RGVA 1BMGA 2RJMA 1L0YA 4GUPB 3BP6B 3ZKQD 2X1QA 4DCQA 5C71A 1JV5B 4NQDB 4P57A 1KJVA 4LQ1A 5C70A 4D0BA 4GMTH 3DLQR 1SVZA 4OCSL 3VXUB 1RZFH 3IU4L 4XC3H 5SX5H 5JA8B 1U9KA 1N3NA 3CJJA 3FO2A 4OLZL 4F15C 3SOBL 2E7LC 4RISL 1G6RA 4PRBA 2FEEL 3TYGH 3BP4A 3DXAB 1MIML 5DK3A 2VL4A 1FVCA 4PJFB 3FOMB 1PEZA 1N8ZA 5I19L 5K9QG 4YDIH 3D5OF 1IGIL 1B0WA 2NQCA 5EIIA 2VR9A 4KQ4H 3LEYH 3DO7B 3MYJB 4FQ1L 3UEZA 1UYWL 3JXAA 1OCWL 5BRZE 5CFHA 1AGDB 1I3GH 1T0NB 4KXZH 4HBCH 1IQDA 2OJEB 3QEHB 3DSNA 4WNQA 1OPGH 2AJUH 2H8PA 2H9GA 3CDGA 1JNNL 3F7YA 2OR7A 3MOBL 4Z18A 3UBXB 1NUGA 1N64L 2BRRH 1Q9WB 4Y5XA 4H1LA 3U4EB 2KKQA 1D5XA 3OL2A 4XVUD 1EEZB 4XPHH 2DLFH 5CEZD 2A2QT 4LEXH 3CFEA 4HCRL 2PW2A 2QHLA 4U1HB 4K9EC 1CE1H 3V52H 2EDHA 1I7RA 4PJ9B 4M6OH 3SDCA 3IJHB 4Y8AA 3OAYH 4LGPB 3SO5A 2ZG3A 3N1QC 4HUUA 2HT2D 5DR5L 2I26N 5C0GA 2NCMA 2BHUA 2YMXH 3OKEA 1OP5H 5J06A 1T7ZA 3OF6A 4B0MM 2V5SA 4P4RB 1LO5B 1RUMH 5JQ6H 5L7XH 4D94A 3NCJH 4QOKB 4LGSB 1J8KA 1KN4H 4NP4L 3MNWB 2VH5L 3OHXB 4M9OA 5EUOB 4P5MB 1FFOB 2ADGB 2HFEB 4PJAE 5JHLL 1CGSH 1PZ5A 3JUZA 1YY9D 4GG6B 3SE9H 3V4UL 5GS1B 35C8L 3OF6D 2GJ6E 2HT4C 4BSVA 4E41D 5HVWA 1MJ7L 2VXUL 4F37K 5DUBA 3DX8B 4K3EH 5E08H 2V2WB 3RNQA 3EW3B 5BMFH 3F58H 5DS8A 3DRTB 2VXSH 1QSFE 4LHUG 2NZ9D 4QTIH 4CJ0A 2CUHA 2Z8VC 4NO3A 4ODUA 5TDNA 1HZHL 5HHOB 4UQ3B 3QDMA 3GBNL 2DQFA 2E27H 2DQGL 3U9UA 5JPMB 3MUZ1 2X5PA 5ADPH 2IC2A 2VXTH 4YEEA 5F1NB 1X5YA 2Z31C 4D0DA 5JPMA 3BGAA 2E27L 3TJEL 1NC2B 4UIKL 5FUCC 1UJ3B 3LAFA 3UYPA 5H94B 1BQSA 1JPTL 2ZJSH 3TVMA 5F6HJ 2X9WA 4HUXA 5D7LB 5FF6A 5C08A 2GUOB 5L9DL 3SDDB 1PQZA 3FFCE 4R90L 4P9HL 3AS3A 1J8HA 4HGWA 2XXMB 5C07A 1FZOB 2V2XB 4WEUD 2OZ4A 2XZQH 1RSFA 3CMGA 3MCKA 4NUGH 4HV8B 3X13A 2IBZY 4JY5H 3S3JA 4MCYA 2WBKA 4AL8L 2DN7A 1CD8A 2VDOL 3KHOA 3O6FB 2QQLL 3BO8A 3UTSE 4EZMA 1D5IL 2EXYC 4YPGB 4G9FB 1JGLL 4MAYC 1S7TB 3K46A 4CVWA 4Z7VF 3FO0H 2JF1A 4JHBA 4MZ3A 3SJVD 1MELA 5AD0B 2PR4H 2CR3A 5IVXE 3RKPA 4C56B 2YWYA 1JTPA 1EEYB 1OAUL 1QSFA 4GFTB 5K9OB 1IE5A 3ARYA 2HJKB 4JY4A 4RFEB 2PO6B 2E7CA 4N5EC 3RVWC 3VW3H 4TNVF 1U8PA 5IFJA 1TPXC 1ACZA 3H2WA 4YDLB 3W5NA 1RVFH 1NAMA 1CI5A 5BVJA 3MJ8A 4KMTL 4WGWB 3ULUC 4NBYB 1RUPH 2NTFA 1ZSDA 1YEHL 4YHYC 2G75A 4Q6IB 5ANME 4GXVL 1YC7A 4Y2DA 5CZVH 4HEPG 2YC1A 3MFGB 3T2PA 3MRQA 3G08A 3V7AE 4U6HB 2FX9H 4KVCL 4I3SH 5I18H 3NCCB 3DO3A 3FCTB 3SE8L 5HGAA 4WHYG 5IVZB 1QLEH 5I8OH 1B6DA 4Y2DD 3PWUA 4OKDA 4QHNA 3MCLH 4OGAD 4K3GA 3LEXA 4NQDE 3HR5B 5B38G 4U1GB 1WIPA 1QRNA 1V8HA 3BD5A 2FBOJ 1J0ZA 3SDYH 2MQCA 1A3RL 2ED8A 2IBZX 4KKLD 5HHQA 4LKCA 5EPMB 1OAXL 2CLVB 3F6LA 4P3CL 1HIMH 4XP6H 2P5EA 1TNMA 2VDRH 3VXOB 3WHXA 3BH8A 1JE6A 2NXZD 2XG5A 2DIJA 2VL5A 5DD1L 5I1EL 3OJMB 2ARJQ 4XH2A 4L1DA 1BZ9A 2VYRE 1E6OH 4NC0B 3VRIB 1FLRH 1QRND 5DI8B 3HE6C 3RU8H 2DDQL 5L8JB 3K8LA 1FHGA 1NAKL 3W2DL 4WTZA 3TFKC 5KSBA 4LCWD 2OSLA 3PABA 4JFHE 1HSAB 1LO3H 3BAEL 5LWYH 3VI3E 3WO3B 2BOCB 4JPKL 5BVPL 1GIGH 4WW1B 2A9NL 4H0GA 4Z8FL 4ZO7A 1S9YA 4PY8J 4XRCB 5CD3A 3S9DB 3H8NA 3MFFB 2NR6D 2HFGH 5IVXA 4KZDH 1DL7L 1UEYA 3MV8B 3O3BB 3SO3C 4PJCF 4U1SB 3PHOA 2ATPA 3NPZB 1U92B 3TPUB 1RIHH 1MNUL 1R5VB 5C0JA 2QSVA 3TO4D 1U58B 3DVIA 4XAKE 2Y6SD 3QO0B 3MV9A 4YQXL 2WUBL 1XMWA 4NDMA 4U1KB 1M4KA 3AAZB 4TULH 1K9TA 1Y0LB 1RJLA 2BHZA 1AO7E 1S7XA 1KPRB 2XTJD 5SWSD 5IT2L 4ODHH 1FDLL 1A8JH 1EV2E 3TO4A 2YD1A 2P8PA 1H0DB 3RPKA 4EI5A 1QSZA 1B6UA 1F3DH 4JZNB 4D0CA 5BMFL 2VAAB 2C1PB 3EO0B 3QEUA 4JO4H 1J5OH 5H2BA 3FMGH 4Y1AA 4JVWA 2C1PA 3EO0A 4KY1H 4U49A 4J6RL 4DCQB 1C12A 4WWKC 5DD3H 3T0EB 4HPOL 5DRXB 4KAQH 4KDTA 5BS0A 3UJJL 5D2LF 4Z7VB 1F6AB 3W82A 3TIDA 2BX5A 1EJ6A 1CXEA 5I30L 3O8XA 3LKSA 4G8FA 2NY6B 2EIBA 1IL1A 1JWUB 2MQ3A 3VFNB 3REWB 1Q0YL 4JFYB 1H9VA 3OKKA 2ZWLT 4XC1L 5FHAH 3ALWA 5A2IH 4I4WB 3VG9C 1RUML 3QIBC 5L7XL 5JDSA 2AXJA 5EZOH 5EB9A 1MWAL 3TIEB 3B9KC 4YAQB 5FGCE 3IJSB 4XP9L 3UC0H 3HE6A 2YKLL 1XF2B 3FQXA 4XP6L 3WFDL 4Z9KB 3A0OA 5DC9B 3FRPG 1IM9A 5DD6A 4XMLL 4EDXB 1ZVSB 3PGCA 5M7QA 1JRHH 4RFOL 1OAQL 2M8XA 3E8UL 3BXNA 1T20A 4JFFE 2EH8L 2ZOKA 2C7UA 2W65B 4U1LA 4QNPF 1X5FA 4HDIB 1MCQA 4PJIB 5B22A 1D3CA 3WEXA 3SE8H 5C0BB 1IM9D 2VUYA 3V9FA 3V0AC 3BFOA 2XWBA 5AZ2H 3FFCD 3VI4E 3D69B 3TBTB 3GSXB 2XFXB 3T4YB 5E4IA 3BN9C 1S8DB 2MTPA 5HYSG 2RFXB 4H20L 3QIUC 4L29A 4PGDB 4QXGH 3TNMB 4RGMB 5FCUL 1K8DA 1G9NL 5L2KD 5JO5A 1FVDA 1QEWA 4BA8A 5B39G 1OOAA 3EDKA 3VXTA 5FGRA 2FYYA 4XB7A 5F1SA 2WUCL 3P0YL 4J3WA 4L8BA 4M6MH 5EBLB 4LSSL 5DVMA 1OP3K 1C5BH 4M03A 1SBSL 2EYSB 5I1CL 4X4XB 5TPWL 5HGGS 3RWFA 4DJMA 2X4PB 3JUYA 1I9JL 1C1EL 1FL6B 2JJSA 1XR8B 4RWHA 5T3ZH 2R8SL 2YD3A 3WIFB 3RGVB 2QQQA 5AYQA 4JG1L 4I0PD 5D71H 4AT6A 4NZTL 3SGEH 1K4DB 4V1DA 5GJSH 1ED3B 3V6FA 3G6DL 5FKPB 2VDML 4NN5C 1JGLH 1CD0A 2Y5TB 4MB4A 5EN2B 4C58B 2H2SC 5MENB 4QRQA 5BO1H 5HHPB 4EOWH 3VXUA 4JEGB 3ARVA 1U0QA 2VLLA 5CSZA 4LSSH 3I9GH 4RNRB 4Y4HC 2VDQH 1XR9B 3BSZH 3P2TA 3CXHJ 4K7FB 4MQTB 2VXQH 1EHXA 4JO2L 4Y5VB 2WW8A 3BYTA 3T2OA 3OKMB 4R90H 2HMIC 3IXAB 4XNXH 4L3CA 1NGQL 2OTWB 1IGYA 2FO1A 1FL5A 2R29L 5BXFB 1T1ZA 2F54B 2ZSWB 5SV4A 1J88A 4PJ8C 5C0EB 4LVOC 2OTWA 1PG7W 2JJUA 4XI5D 3MRNA 3LKOA 1H15A 1UGNA 3BN3B 2LAAA 2C4FU 3K7UA 2VDKL 4ORZC 4ZO9A 1F6LL 5CEXB 3PHOB 1GGCH 3HHRB 1HN1A 4S2SA 1I8IA 4NQCE 4ZFOB 1BQLL 2YOCA 1ZT7A 4YDVB 1A6VH 5GXBB 1S7RB 4XNQA 2EIEA 4OJFL 1QRNE 4UT7H 5EU3A 5DMKA 2R69L 1PSKH 3TJHD 1Q72L 4MSWB 5GRWA 2X1PA 4Z7NE 4MDJB 4OQTL 5HXMA 3LPFA 3U7YL 3VH8A 1J11A 1FFQA 4CVUA 1HXYB 2UUDH 5GS0L 5CILL 3OG4B 5FA4A 4HG4K 4A6YL 3B2UC 2GKIA 1A7PL 3QUYB 4Q6IC 5IWLC 4NM4H 1CDIA 4YFLF 4Z0BH 4IRSC 5TDPB 1WBZA 2BCKA 2NW2A 1P84J 5MI0B 5I9QC 2AJZB 3BDYL 5C0CA 1MCLA 1W8NA 2Z93B 4JRXD 5HI5D 5F3BA 5TH2B 4P4KD 1AI1H 5A2FA 1YN6B 4HW6A 1RHHA 1FO0H 1YYLH 3WFEL 3G5VB 3ROLB 4LARL 4P23D 3QPXL 4U1GC 3DTXB 5TE4L 3D85B 1LVEA 1OT2A 1AGEB 2EDXA 1J1OH 3WCYA 2P49B 2XKUA 4NQEE 3T3PE 3ET9F 3OPZL 3V52L 3V5KA 1A1OB 3OXRB 3D9AL 1WWWX 3I50L 1KXVC 3RWGA 4JLRA 1FCCA 5EOQL 1G9ML 2GIYA 3H42H 4LFHD 3SDAA 5EUOF 5A16A 2VB5A 5KTEH 3MODH 1JGVL 5B8CC 2CKBB 4MJ2A 3MGOB 2F54E 3RNKB 4P23A 4UILH 2O5YH 2HH0H 3VA6A 4IRJD 3RIAF 1OSZB 4EKXA 4L8CB 2HLAA 1ES0B 12E8H 4NQCA 4FQLL 3CXDL 2IH3A 4M3JA 3NFSH 4OAWB 4XMKH 4FNLL 3VE0A 2PETA 1MLCA 4PRAB 1D9KA 2EDWA 2Q8AH 3ILPA 4OM1H 1R24B 2FIKA 4XMKL 5I73C 3KNBB 1UADC 5H35A 1SBSH 3D25B 1JYWA 1BFOB 1BQHA 1OGAD 5F1KC 2FEDC 4X9HA 4K3JH 3IJSA 4YBQC 4X6DE 5HDLA 2L4OA 1H5BC 2IGFH 3I75A 1MF2L 1KCVH 2Z4QB 5E5MA 5CSGA 4HS6A 2E6PA 2HTKC 2AXGA 2YA1A 4R0LC 3HUJB 5D6CB 3BW9A 5MP6H 1INEH 3MROB 2J8UB 4P9HC 3BGMB 1KLGB 2O93L 2BC4B 1OGAA 2M26A 2ICWJ 2QHRH 3D3VE 1NCTA 5IFHH 5CBEB 1H5BB 2D31B 4UV7L 4YHLH 3RDTC 5SX4I 5EZLB 3T2NL 1S9VB 4YHOH 3MRKA 5GZNC 1PG7H 1EEYA 5HYJB 4IRSA 3WFHA 5JZ7C 3GSXA 1MY5A 4NDMB 2A74B 1R3HB 3C5ZA 2L7JA 3FRUB 5BZWB 1EX0A 5MEPB 5TE7L 1RUQH 3S5LA 2DKMA 5ABDE 4YIQA 3EDDA 3G6JA 3LN5B 4MAYA 4ZAKC 3FN3A 2AGJL 2JCCE 3NA9H 5BJTA 1Y6KR 4I0KA 3IDGB 3CDFA 2YC1B 4ENEC 3NH7L 1F45A 3HC0A 1FNSH 3C5ZD 5BJTB 1CK0H 2WWKT 5IESL 3MA9H 4JGMA 1MUJB 4X4YB 2O61A 3N1PC 5JUEL 2YA2A 4KKBD 1LEKB 4YNYA 2IBGA 3T0XA 1JNHA 4MAYD 3WE6B 4HH9A 4JHAH 2QR0B 4OGZA 3SKJH 5ICZB 1FV1B 4QHUA 1YEIL 1WAAE 3VFOA 4B53A 5BV7H 3F5WB 4WI2A 3P4LA 1EMTL 3PQYA 1YPZF 5FOBA 4ONFH 3LEXB 4IHOA 4XAWH 3WFZA 4XX1E 1DQMH 5E8OA 3UROR 2Z92A 5FCUH 1N59A 5F9AC 4UAOC 5IUSA 4KRPC 4NPYA 4HJ0D 5E2WL 3CVIH 4TSCL 1KB5A 1S5IH 3L3DA 1BD2B 4MQXD 3QUXA 3PQYD 1SJEA 1OAKH 4L3AA 3DUSB 3MRFB 5GGQL 1ZT1A 3BYYA 4GG6F 1GGCL 4RAUB 3L3KB 1ZA6B 1IGFH 1SMOA 2CIKA 2A77L 3KPSD 4NFCA 2NY2C 2W65A 1UZ8B 3R06B 4WHYH 3MMEB 3TN0A 3QXAA 4X83A 5K9KB 4NUGL 4OBSA 2W07A 1F4YH 4I5BB 2APXA 5ITFB 3SY0A 4U7MA 4Y4FA 4KJQD 1I8IB 3D69A 3TBTA 4LAQL 1E4JA 3KLAA 4M02A 5DJAA 5E8NA 1A0QH 5JIKA 1JUFA 3FQUB 2AJZA 2EDOA 3KPSA 3ULVE 2NR6C 2UYLA 3PIQB 3HCVA 3EJJX 3SDXF 1FP5A 1KTKE 3H9ZA 2DWDB 4N90E 1JIBA 2F5AH 3DX6A 4BKLB 4UI2A 3GSQA 3GSVA 3T3MF 5I6XB 2D4DA 3VDAA 1IGIH 3V7MA 5ESQA 3L5XH 1A21A 1S9XA 5BQ7B 1N5AB 3RUGF 3NA4A 1ZKAA 2BVUA 3VGGA 2B39A 4GRMA 4P2QB 2VLJE 4M1DH 3T1FA 4U4BA 4YGVB 2VQUA 1G0DA 4OLEA 3IFNH 2D7TL 1W72A 4CADB 3RDTD 4JFDB 2DMKA 1MCSA 1ADQA 2MKLC 3GMLA 2GT9A 4W4OC 3IFNL 1HK6A 3L3HB 2OK0H 3GB7B 4K3EL 5DEFB 5E08L 4U7KA 3UDWC 1B0RA 2A6DB 5F7EL 1OM3L 2ADJA 4R7NA 4ELME 3RZWA 1OAYH 3KYMB 4G9FA 2P5WB 5MEQA 4GS7B 5A2JH 4D9QD 5GQBA 5I8OL 4FTVB 1N4XH 1MFAL 1UC6A 3O6LL 4CVXB 2HFFA 4HGMA 4K7FA 4WJ5B 1WT5A 1KCSH 4LBEB 3RWJB 3MRJA 1X4ZA 4KI5E 4XXCA 3DOSA 3RX7A 4KRMB 1ORSB 3ESUF 3TIEA 4KDTC 1K5NA 5HHXL 1BVKA 2VH5H 4BSVB 5EZOL 1WTLA 4NCC1 3HNSL 1WBYA 2WLZA 2W59A 1IC5L 5GJTL 1QFPA 5IVOA 3S35L 3QDJD 4NO5B 4QCIA 4WI7A 2ITDB 3WFDH 4MJIB 2APWA 3PL6D 4XCCL 5EOTB 4G6AD 5HD8D 4XBPB 3IAQA 4DKFL 3ZDYE 4AEIL 4AEHH 2A77H 3U9UB 1KG0B 3QUMH 4ZUTA 5SWSE 4K7PH 1KIQA 2JCCF 3FO0L 2HT4D 2YS4A 2AXGB 1KG0A 4XWGL 2BVOB 1F3DJ 3LKRA 1MHEB 1SEQH 3QDGD 1RMFL 4YIQB 2IAMB 5D93C 4U0QB 1BF8A 5DSCA 4Q9CA 5HHOE 5HYIA 2BJMH 4WCYL 1TPXB 3B5TA 3NIDE 5ISZD 4QRPA 1WBZB 4XVUC 4OI7A 4XTRC 4Y89A 1NDGB 4IOFC 1SM3H 4M8QB 1R0AH 3EFFB 2UV3A 5KVEL 4L9LC 4Q9BA 1ZT4A 3H9HA 3QDGA 5E99L 4JM2F 3QWOA 1QHOA 2CKNA 5E8DL 2YD4A 4YQXH 1TCRB 5B38B 3ARGB 2XZCL 2DLIA 4LIQE 1GZPA 4GLRI 3ZKND 3GK8H 2DI9A 5E7BA 3ULUE 4HIXL 1BZ7B 1EEZA 4NKIH 3RL1B 5B39A 4ZFOL 3VDBA 3FZUD 4XGZA 2J8HA 1HSBA 2DI7A 4M93B 1S9YB 4UDUB 3CLFH 1RZ8B 4JDTH 3U1SH 1MHPL 3RWEA 5KS9A 1KJMB 2OK0L 5I2IB 3O6ML 3MUY1 1BBJB 4M1CC 2YSSA 2VITB 2EDJA 3MOAL 3Q1SL 4MLSA 4MB3A 4WIQA 2BY3A 1MNUH 4XXCC 1PG7L 4KTDH 2EXYD 1NGXB 3SPVB 4OFVA 2X10A 3U4BL 4JRYD 5F1OB 1CU4H 1IGCH 4KTDL 2D0HA 1HWGB 4LCCB 5L9DH 1RIVH 2G9HA 4XNYH 5TQ2H 3KPRD 1ADQL 2A0LD 1NLBL 4MX7B 1CG9A 2PKDA 4AL8H 2I9LB 1BFVH 2WBJC 2AI0H 2Z4QA 4GOSA 4HFWB 4F58L 3ALPA 3GIZH 4M1GH 1WF5A 5KSVA 3RPIA 4NJ9H 2MQ0A 4KKNA 4QLRA 5K9JH 3D9AH 1PKOA 5FYJU 3VXMA 3MV8E 3BH9B 5GRUH 5FECA 3U6RB 2AJVH 3RL2A 3VD3A 3LQAL 1QZ1A 1ONQB 3OKNA 1BJ1J 4JB9H 4U0RC 4WFGD 4BZYA 1KULA 1YPZA 1YQ2A 1UEMA 4G8FB 1B2WH 3E6FA 1RK1A 4LLDB 3VXMD 3L3OA 1O7SA 4PY8I 1HILA 3DPBA 1Q8MA 4POZC 5KSAD 4QXTB 5IHUL 1RK1B 3LOWA 3FT2B 4NQUA 3PL6C 3B43A 4JGJA 1FAKT 1RUPL 3IDYB 3L95B 4R4FL 4PJ9C 1N8ZB 4R2GB 4X7FC 4PRPA 1YN6A 3I6KA 3HMXA 4Y19A 3VD7A 2DQHL 2IBBA 3EYVA 1AR1D 5CZVL 3FN0L 4N8VA 3MRCB 1HEZB 1IM9B 5DRWB 1T80A 2BZDA 4WHTA 1TJIL 1G7MB 1MAMH 3KPNA 4G7VL 5C0NC 4F7TB 2P5WA 4Q7DA 3R1GH 1KJ2B 1XGPB 2ATKB 1KPRA 1X5GA 5JOFA 4NCDA 4N0CD 1WUNT 4MWFB 3LQZA 4PRPD 4JFPB 1I1YB 1EGJA 3MRJB 1HHHB 3I3DA 3GMMB 4MWFA 1Y18A 4YO0B 1WFUA 3H6JA 5F7DA 1JZ4A 2P47B 1J12A 2CDGA 4PRHB 3BEVB 4FQIH 3B8SA 5TE6H 1DBKH 3MRGA 1EEUA 5IB3A 4HJJH 4OCMC 1J1XH 3B2VL 4MS8C 1BVLB 3RRQA 3VCLB 4YBLB 3TNMA 3IFOA 43C9A 2PCPB 3GSUA 1ITBB 4CVZB 4HKBA 1M6OB 4XP4H 2V6HA 2VUOA 4WJ5A 5EC2A 1MREH 4U3CA 1A47A 1E28A 1IAMA 3TT3H 1F97A 3UJIH 4D0CB 1DBAH 4FQCH 2PYFA 3L3JB 1YECH 4KKCC 4N9GB 4L4VB 4MJID 3GMNB 5HYSB 1G9MC 1ZA6A 1IAIH 1RIVL 4MD5A 1RUAH 3SDXB 5MEND 1XCQB 3HA0A 5CJQL 4GKNA 1S7QA 4ALAH 2CRYA 5E2UL 1G0XA 4APQD 2NZIA 1T1YB 3B8YA 3IF1B 3JV4A 4EDXA 3FQTB 4J2XA 4MJIA 2EO9A 1INEL 1TTUA 3TVMD 4KHTH 5GRUL 4LKCB 4X80H 4Z7UB 4G8GE 2A0LC 5EU7C 4K94C 3ARWA 1CR9L 3WO4B 1D5MA 1HHKA 3V2AR 2J3SA 4N0FA 5JXEC 4FQQA 2NLJB 2P7TB 4Z7OF 1G7JB 2WK2A 3LDBB 3PWLA 4HMDA 5AWNL 3RA7H 1JMXA 4G5ZL 2DIBA 4OF7A 5SV3A 2AJYH 1U91A 3PWVA 4PJ5D 2N7AA 3GHEH 4OLXL 3BHBA 3LZFL 4OFDA 2IWGA 3NZHH 3TVMB 3S88H 2ZSWA 1N2RA 1NAKH 4YHPA 3ZSSA 2AK1H 1I75A 5DXWA 1M71A 2B4CH 3B9KD 3V4PL 1O7VA 4QY8B 5ICYA 3WD5L 4W70A 4WW2B 4LARH 3HMWL 1QNZH 3QH3B 4AIZB 4RQQA 3VFMA 2QR0A 1E4XH 2OZ4H 2IADB 1NGXA 3SPVA 5DEZA 3W11C 2K7QA 5C6PB 3QULA 3LV3A 1QHPA 3CLFL 4MJ6B 1OAXH 5A43C 4PJHF 3WFCH 5J3HD 3B9KB 3K80A 1PEWA 3MACL 3TBWA 1KJMA 4A6YH 1UM4H 2C9AA 3BIKA 3GDBA 1TVDA 1WCQA 2RB8A 4ZQKA 1LK2B 4PYHA 5EU6E 3SDCC 3WDJA 5GZND 2RBLA 4OB5H 3GSNH 4NKMA 4YDIL 1U8MA 4LK4A 4Z7VE 3OKEB 3ARDD 4LHQB 4HHAA 4NKMB 3MC0A 4PJ7B 2JCCA 5IB2A 1LP9A 4KDWA 5FYLE 1I3GL 1VEPA 3WJJA 1KLFA 4KK9C 4WHDA 1CFTB 1A7OL 3Q2CA 1EMTH 1UZ8A 5E95B 5IMMB 4A6YA 5C0DB 3MLSL 1U3HB 2R9HD 4U6HA 3ARDA 1JHLL 4A6YB 3MV9E 4I3GA 4CRPA 2EYRB 4ZG1A 3EJZD 4JM2B 4YXLH 3EOAA 3U2SB 1OD9A 1UM4L 3P0VL 4S1DC 1JWSB 1FE8H 4HJ0C 4ZFOA 3HCVB 4B41A 4PBXA 1QLRB 5FOJA 2XKNB 3QDMB 1Z0MA 3HPLB 1HOCA 2XY1A 4QYOB 3GMPB 2DTMH 1AE6H 2ED9A 2R0ZH 3HE7B 4GH7B 3BMWA 4MJ5A 5EIIB 4UUJB 3CFBB 5IHBA 3U46A 1Z5LA 4OCYL 2AKRB 3O2DA 4EVNB 5EBWA 4KKCD 2ATKA 4G5ZH 4GJTB 1L0XA 4DOHE 1HHIA 2WWMD 2YN5A 5CCKH 4KK8D 1OAZL 2NW3B 5E94B 4KQ3H 3D25A 4OF3A 5EH1A 1ZT7B 1IGJB 4LSRH 1DFBH 4JAMB 1A7NH 4LVHB 4NSKA 4NZUL 4Y19B 1IGJA 2JJSC 3IRPX 4H1LG 3DUUB 5HYFA 1KXQE 4HS6B 3HI5H 5HI4C 1WFNA 2PXYD 3MCKB 4JHZA 2P24A 3ARFD 2DJUA 4CNIB 4ZNEE 1JF1A 3MJ6A 1XGPA 4AM0B 5JW3H 2H32H 1FZKB 3RBSA 3STLB 3X3FL 4KHTL 4OLZH 3UXFA 3KPSE 1I1AA 1UB5A 4WEBL 1F58H 2APFA 3WNLA 1CR9H 4JR9H 5GSRB 2CK0L 5IBUB 5EO1B 3MRDB 4ZDHB 2PXYA 1VFOA 1CL7L 3BPOC 4KRLB 4MD5B 4EN3B 2ZG2A 1A3RH 3SO3B 3ZTNL 4ELKA 4Z7QF 1ES0A 1I1AD 5E8DH 3RY5A 2EIDA 2PO6A 3WSQL 2NXYC 5DC0A 1JZ8A 3LN9A 3SE9L 1NCCH 4TYUA 3ZDXF 3JTTB 5HGBB 1FL3B 5A16B 4ZNCD 1OTUC 2BNQB 2DQDL 1NBVH 1VCAA 3K2UL 4KVCH 4M6AA 2B0SH 5IMLB 1OSZA 1T2QL 4HIHB 3NGBB 2MCPH 1U95B 1LILA 4LRIC 2R2BA 5LKNA 4M6OL 4U1IB 5IW6B 3UTTE 4G9FE 4RNRA 2F19H 2N1KA 1CLYL 3CH1B 5DRNA 3QBTB 3GGWB 2ZUTA 4PJDB 3MXVH 1G7HA 4PJEF 2H3NA 3LHPH 2NX5B 2GI7A 3HZYA 1A22B 1ROWA 3VRLE 5DD0H 5BXFA 3PDDA 2V7HB 4M6NL 5C08B 3UTSD 2IQAB 4TOYL 3LRSA 1IEHA 1BFSA 1AXTL 3KPPB 3NA9L 3DJ9A 1L7TL 4WRLA 5CD5D 1FLTX 4BZ1L 4G8GD 4UOW0 1QA9B 3BKJH 5DLMH 4G6KL 4WU7A 5CAYB 1KEGL 1NMAL 3LMJH 5DMGD 4X7TB 1TTGA 1M7DB 1CDUA 5KVDL 3T2QA 1GOHA 2FEDD 5INCA 3GIVA 2PTVA 1F4WL 5E8EB 3QHFL 4M7LH 4WW1A 1DLFL 4PV8B 1JGEB 5JOPE 4R3SB 4KY1L 3WHE1 1AIFA 1R3HA 1KCRH 4JZJC 2XXCB 3TA3C 2W0PA 5EO9B 5ID0B 1QSFB 3E2HB 3FHQA 4TPRL 1IT9L 5T3ZD 2H32A 4XT1C 4XNXL 3DVNA 4QNPE 2C4FT 1KCKA 5H37G 5C0CB 2M2DA 4GBXA 4UOJA 3JSSA 4JKWA 1OSPH 2EDFA 3FN9A 5C0JB 2VN4A 4N0UB 4FZEH 3P4MA 3T4AA 4OIAA 1TXKA 4N1HB 1BFVL 2PYFB 4R0LA 5EOCH 4C56D 3FHAA 2IMNA 3VXRE 5FA3B 1N26A 3UYRL 1FNGA 4OD3H 2CGRH 4K8RH 1RK0A 2E7LA 2J8OA 2VDMH 1G0YR 1DFBL 5GGTA 4JN1L 2R1WB 5EULV 5DVLA 5C2BH 3C5JA 4MCZA 3N1MC 4W6XB 4ZAKD 2Y36H 3SN6N 3I3BA 2B1HH 2LVEA 1A5FL 1PX3A 4UV7H 1BBDL 1QLRA 1ND0B 1HHGB 3PWPE 4J6RH 3OAUL 5F7FA 4QHKI 4KK5C 3KLHC 1A0QL 1TDQA 1UH2A 4ENED 3OJDB 2Y36L 1IC7L 1A3LH 4YHLL 4IOIB 2ENSA 5KBNC 3NCFB 4R6UA 1ED3A 3R8QA 1EFXA 5FYLD 3RTQA 4NZRL 4KKBC 2P7TA 5C3LD 4ZAKA 1AE6L 2R0ZL 3MMEA 2WV3A 3BP4B 3UYRH 4GRLB 4UIKH 1KJ2L 2OSLB 1R3JA 2X6MA 2BVQB 4RX4A 2Y1VA 1DBML 1JUFB 2WUBH 1G7LA 5CWSA 3DURB 3PL6B 3W9DB 5E9DD 4P2OA 3ZKXC 3I75B 4PTUB 4LRNL 3INUL 4OZGF 4KROD 5DFVC 4LEXL 1U8LB 5E99H 1AC6A 3FQXB 3QUKB 2NXZB 3KPNB 4LCIH 5IBTL 4PS4H 3UBXA 1KIRB 3HI6L 4JKPH 3AXLA 4X7CC 3BKJL 4XHJD 1NLDH 1T04A 3EYUL 3SBWC 1WFTA 4DKFH 1CD1B 4LF3A 3MLYH 1F42A 5DK2A 3S4SA 5HVGB 3OR6B 4FQIL 4BH7A 3PGFL 3V5DB 1T89A 4UNTA 1CD1A 4LF3B 4N8VG 3T04D 5AG9A 5CGMA 5IVNA 4AIXA 5CIPB 3MLPA 4XPFH 5IW3A 3WEXB 5F88B 1G6VK 4I2XA 3UTPD 3RWHB 5FKAA 1NCDH 2GCYB 4Z7OE 5MEPA 4F9PC 2YPLD 1CXIA 1UM6L 2NY4B 3IDXH 3U0TB 1EHLH 1G9NC 4C83B 5HYEA 3HZMA 5D6DA 3T1FB 1IKNA 5A1AA 1CFNA 2BSTA 1MWAH 1IGTA 3QUXC 4FTVA 3M1BB 4NRXA 1IAKB 1ZLWK 3TO4B 2PTUA 1D6EA 1UA6L 1AY1L 2GAZB 1LMKA 4PJCA 2EICA 1U8QA 1FPTH 5F9OL 1NGQH 5J1SC 1CIDA 4G8IA 1W2KT 4PJBA 3S98A 1JGUL 2AQ2A 3TV3H 1RQ5A 1UH4A 1VA9A 5C7XH 1F3JB 5C0ND 1QACA 1LO4L 1WBYB 2JJVA 1DQLL 4CW1B 4DN4H 4PRHE 2D7MA 4I77L 4HZAA 5E5UB 1A6VL 2MFNA 1GOFA 5AWNH 3WIHH 1K4DA 5GGSA 5INDA 5JIHA 5IOPB 4ODXA 3MLWL 3S5LG 4GKSA 5IKCA 2XA8L 3U82B 1UENA 4HV8A 2AJSH 5C0BD 4ZUTB 3VXRB 2HMID 4UT9L 2UUDK 1T7WA 5DQJA 4RWYL 5ALBL 1S7UB 3RZCB 3MRHB 4I0PC 3QB7C 5JW5A 4JY6A 4LSUH 1LP9E 4AK1A 1YNTA 5ELIA 5E03A 3VXQB 2XV6B 5C0BA 3ILPB 1JTOA 2B1AH 2GJ6A 2GJZB 3IETA 5F8QC 4NC2B 2IAMC 5D93B 2C7UB 3DUUA 4U1LB 5JHDE 4RGOH 1QR1B 4LFHG 4XHQA 5KN5B 4AQOA 5FK9B 3C60B 3H7BB 4M5ZL 1TCRA 4H26A 1MCPL 4RZCA 4JFFD 2H2SD 2FHCA 1UWXH 5FK9A 1PW3A 1XGYH 4DGVL 2G5RA 5GJSL 3O3EA 4P4KC 2B5IC 3VXTB 2IG2L 1UB5B 4JG1H 1WBXB 4QHLA 5DJZB 4K9EL 1ZXQA 4IEFB 1KTRL 1TVBB 1T1XA 4WDIA 3TVMC 5CS7A 4OM0H 3HAEB 5DD1H 5D7SH 2DL9A 1KGCD 3QCVL 4O58L 1EGJH 1HILB 1SJHB 1DBKL 4UMGA 1BAFH 5EC1B 1NCDL 1FSKC 1HDMA 3PUCA 4MCZB 2MJWA 4KROC 4LEOB 2DRUA 2WAHA 1U8JA 4PRPB 2CH8A 4QTHA 2Z93A 3EOBA 1UWGL 2P8MA 3L3HA 4QRRA 4X5XB 4PG2A 4LCIL 2D2OA 2IJ0C 4Z7UE 4NQTA 3AS1A 1JWMA 3T0DA 1NFKA 1CGXA 1CVRA 3ISWA 1FNHA 2CRZA 5T1LD 3VMPA 2GK2A 5FUZH 1PJ9A 4NT6B 1AQDB 3GSWA 3QUXD 4NNYB 4K55A 1FV1A 2IH1B 4QHUB 2MHAB 3SGKA 2VZSA 1NFDB 1JN6B 1RY7B 5FGBA 4GG6E 3C8DA 2ZNWA 4LPXA 4R7DB 3IDNB 2C4XA 3RP1A 3SKOB 3D18A 1LDPL 5E8OB 4J3SA 5T1LA 2IQAA 3SGDI 3ARDC 3P11H 5I8KL 4ISVA 5C09B 1ZV5A 3H9SD 1TQBB 2VRAA 4PJEE 1M6OA 2I9LA 4TQEL 5ERWB 2DD8L 1E27B 4JFQA 3C6LD 4XBEL 5D2NA 4Z78A 1H3UA 1MJ8H 3MRNB 2AV1A 3ZT7A 3MX0A 3V6OC 4F7EB 2Q3AA 1O5DT 2K7PA 5JNYA 4F58H 4NJAL 5T1DL 2EZ0C 2OXHA 2J88H 3TEUA 5DQ9A 4NJ9L 1ETZB 5K9JL 1XGQA 3JWOH 5DHVB 1XCQA 5IEKB 3W81A 4NQEB 4NZJA 5D2NE 1F4XL 4OUOA 5DWUH 2AJXL 4HT1L 5GGRA 2QQLH 4NKDB 4ODVH 5I1IL 4FFYH 1S7XB 2X4UB 3GUTA 1A3LL 2F74A 1G6RH 3UPRA 4GW4A 4E5XA 2DM4A 2XRAL 4U2YA 1LE9A 2R9HC 4M5ZH 1CFNB 1MEXH 4QWWC 4ZFGH 3KJ6H 2ZUWA 1A6UH 5I9QB 3AREB 3QXTA 4Y5YC 3MR9A 2MNUA 1NKRA 25C8L 2BP3A 3MREB 1CT8B 6FABH 3QEUB 4XBEH 5IB4A 3AREA 4PJXB 3L7EA 4NHUA 3P0GB 1HI6A 5F88A 1XIWB 1ZLVK 4HMEA 5J9PA 3H9SE 3F7QA 3P0YH 2Y6SC 1RURL 5HYJA 3BDBA 1RZKC 4X99B 5DURB 1C5BL 5DC4B 4M1CD 2GK0B 2YEZA 3OV6A 2V17H 4PLKC 4U6XB 3E6HA 1GGIH 1MF2H 4J7RA 1VADA 1EJOH 4YHPB 3P30H 4NCC2 3MGOA 1INDH 2QADC 5E2UH 4Z5RB 1P5VA 3QEQD 4OKVA 1AGFB 4GRWB 2NY6D 4PJEA 3TH2T 1P6AB 2PW1B 4MNQB 4ODWA 1DQLH 3ZO0A 4J4PA 4QTIL 3WXWH 3KWWA 3KPMA 4EUPB 3DI3B 1ZHNB 2ICES 5LGJB 1QBLL 1WJ3A 2HN7B 4GG6A 3VXSA 5DJ2A 4U1IA 1PY9A 1CF8H 1CXFA 3QEQA 2A9ML 4PRAA 2LABA 2E3VA 4DZBB 3VG0H 2HFGL 4LCUA 4OFYA 3QIBD 4U3HA 3IFLH 2MMXA 4P46D 1OP3H 3TT1H 3L5JA 5ETUA 3ZKMC 2G2RB 3IETB 2H26B 4AEFA 1I1FA 4P3DA 5IIEB 1I8MA 1UACH 1H8OA 4LRIA 2LU4A 5I1GH 4PJHA 4PP2A 2EYTB 2GFBB 2PTTA