5D70H

Crystal structure of mor03929, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
216
structure length
212
Chain Sequence
b'QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSGISYSGSETYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGFGTDFWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granulocyte-macrophage colony-stimulating factor
publication title Molecular basis of in vitro affinity maturation and functional evolution of a neutralizing anti-human GM-CSF antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 212
sequence length 216
ec nomenclature
pdb deposition date 2015-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d70H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d70H01
2P42B 3EJYC 1F4WL 3K0WA 5FFLA 3ROLA 1NCDL 3ZL4H 4Z78B 2CUIA 3DPBA 1RZKH 1FZJA 1PX4A 3I9GL 4S1QH 2LAGB 3UTTE 4HZLA 5MEOA 2DTMH 3MRFB 5CINL 2YA0A 1UCBH 4F37K 5EU7C 1JWMB 5BZWA 2YKLH 4L5FL 1XR9A 5IQ7L 3Q6FB 4PUBH 3VH8B 2P44B 5DJ2B 3N9GH 4HF5H 1EVUA 1T03L 2DJ4A 4ELKA 3RVVC 2QADC 5L8LB 3H3KA 4XTRC 2LU4A 1EJOH 4UIKL 3V6ZB 3JV5A 2HG5A 4WY7H 4YHIB 1TTUA 1I1YA 3JWDL 5E8OA 1BM3L 3HG1E 3HMXL 2B7DT 2V7HA 3DVNA 3FFCE 1S8DB 2ZOLB 3C60C 1O5DT 4XCEB 4XP6L 2X4NB 3DGGA 3ZO0A 1H3PH 2ADGA 1DVFC 4M02A 3T1FA 2NY2C 2P5EB 4G8GA 5JMOC 1C1EL 2WWMC 1RIVL 4HIEB 3MA7A 1HHJB 5MEND 1CD1B 1CT8A 1LHZA 5LWYH 4QXGL 4PGEA 3HB3D 1UB5B 5HGBA 1DQLH 1MJ7H 5E94B 1OW0A 2WUCH 1MRFH 1X5IA 1KBGH 3BH8A 3BT2H 1QSFB 4X5LA 4PV9B 3LEXB 3PQYE 5M94B 3EO0A 3SCMC 2GEEA 3RUGA 5BRZE 1WTGT 2XFXB 1EVTC 4ZUVA 1H3XA 1CD0A 4N68A 5FECA 4HJ0C 4CW1B 2Z8VC 4PJAF 5BQ7A 4L8DB 3DX9B 5FKAB 2MQ3A 5DRNA 1X5ZA 1BJ1J 3RX5A 2BFVL 1QNZL 2PTTA 1A6TB 4Y1AB 5ESQB 4R4ND 1KCUL 2YEZA 5DT1H 4Z7UB 2C3VA 3QP3A 4G5ZL 3IXTA 1NCBL 1G7PB 4QCIA 3WS3A 5ANMB 2BSTB 2YHGA 1GH7A 1L9MA 5I2IA 4M7ZB 4QHLA 1EDQA 5F93C 4OLWH 3WS6A 3MFFA 4KTEL 2WP3O 5EBMB 3TT3L 1C8PA 3FKUS 1E6OH 4G3YL 2NY5C 4GXUM 3OPZH 1IGCH 3IU4L 5GRJH 4M9OA 3OQ3B 5HVWA 2EYTB 3DUUB 4U1HB 1WJ3A 2VB5A 1UM6H 3L3OB 5D72L 3M45A 5MEPA 3WNNA 4KZDH 1WV7T 1YNTB 5EO1A 5FO9A 4YHNB 3QEHA 5KG9A 2DQTH 1CTNA 3MLWH 3X14B 3M07A 4WWKC 1RURL 2NY4D 1CLOL 4HUVA 4H1LA 3GMQA 4OZ4A 3MZGB 4P0DA 4ZNCD 2R2HA 1IQDB 5I8OL 4UOW1 5EU4A 4PGBB 3ARDD 4FQIH 1MOEA 3P73B 1CGXA 2B4CL 4ESKA 4CMHB 2QQLL 2Z31D 1YUHB 3U46A 2OZ4A 4QRRD 5E24E 1IEBB 3L7FB 3BYYA 2W1NA 1UH2A 5EB9A 5FB8B 4NDMA 5C0BA 4UQ3A 1JWSB 3SGKC 3BEWA 3OAYH 4OM1H 1CR9L 3DX7B 1EAJA 5TH2A 3VH8G 2BHZA 1SYVA 3QH3B 3VFOA 3ZHDA 3HI1B 5I8KL 3QJFB 5IP4A 4JO3L 2L7UA 1NJ9B 3UCRA 2OXHA 1R5IA 4FQXA 1X9QA 4QOKA 2P8MA 4JRXB 1T04B 4E0RA 5H37G 1Q72L 1MCRA 1V3KA 2X1QA 2OJZH 5KZCD 1A1OB 3E2HC 3DROB 3RL1A 5C7XL 1XF2A 4MAYD 4KKAC 4TULL 1NSNL 2J8UE 3G04A 1T2JA 3MLYL 2AXFA 1B3JA 4PJGE 3UXFA 1KIRA 3LV3A 3TVMB 1P7KA 1NGQL 5KANI 2DWEB 3S35X 1J0KA 5HYJB 1UG9A 1FN4A 1J11A 2VDOL 3UDWC 2O5ZH 4QY8B 1RJZB 5I18H 2OTUA 1QFOA 2Y36H 3CC5B 3P30L 1CU4H 4QTHB 5A1AA 1MRCH 2MHAB 3O6LL 5JLZA 2J88L 4Y4KB 4KI5E 4UUJB 3PDOB 1T2XA 2HT2D 4NQDB 4MNGB 5E8DL 1BVKB 1JK8B 4W81A 1WBXA 5JZ7C 5B39B 3OJDA 1MY5A 1AXIB 1HOCA 4PJIE 3QUXA 2GK2A 1ORSB 2BMKB 1CLZL 4MXWL 5FF6B 3DETD 2IPUK 2V17L 5D2LB 1I3RA 1WT5A 4P59H 4RISL 5C0DA 3BN3B 2DLEA 5JHDD 5KSAA 3MA9L 1I8MB 3NCMA 4PJ5E 1EO5A 1KLFA 3L6FA 3NCJL 3FJTA 1ZE3C 3PHQA 1QACA 4LRIA 5EULV 1MUJB 2BVPA 4WUUE 3OKMA 1JF1A 5SWZE 5LJYH 1C5DA 3GSRB 3RI5F 2R2CA 3WHE1 1T83C 4LCWA 2JLLA 5C6TH 5FHAH 2GQHA 5B8CA 1PFCA 5ETUB 4WI6A 5CJXC 4IRSC 4PJXE 2R23A 3LH2H 2ENYA 1DBMH 4XB8A 3GHEH 3ISWA 4KKLD 3BI9X 2W0KA 1F8TL 1QFUL 2VDQL 4R3SA 3K8MA 3QDMB 4OM0L 5D9SB 4I9WE 4FQQA 5FUZL 5DRWA 3KS0J 2VQTA 4LF3A 3SDDC 4WFGD 3OXSA 4UQ2B 4KY1L 1QRKA 3IGAB 1JV5B 4I5BB 4WTZA 2E7HA 4YFLF 1BEYH 3VFUB 3T0AA 3BDYL 2J5LC 4F80A 1BBJB 4G80A 4F7MB 2IWGA 5T5FH 2VDPL 5C09B 4XPAH 1A1NA 2I27N 1RUAH 2VLJE 3LRGA 1I7RB 3GSOB 4NN5B 2HWZH 1J1XL 2H2SD 5EIIA 4I3RH 3SGEI 2VDLL 3SE9H 1FQ9C 4PJHF 5EU3B 1IEHA 2XKNA 5D70H 4UBDD 4J2XA 4RA3A 3HE7B 3W9DA 5F6IC 4F2MB 5EU5B 4TSBH 5FYKD 1R3HB 5F7NC 5C9JB 1VFBA 3IAQA 1O0VA 2N7BA 2ZNXA 1G7QB 1UT9A 5D1ZD 4X6CF 1N3NA 1V7NL 5I0ZA 3FL7A 5EBWA 5FOJA 5CHNA 3UTTA 2RBLA 1M71B 4NZTL 3PP4L 3SDYH 3WE6B 4D9RE 2QTEA 3SKMB 2VZUA 3THMH 4X9HA 3TEUA 5EU6D 4WGWB 3LKRB 1HZHL 4RMVA 1S7TA 5GSRB 5CCKH 2MQCA 3RNQA 4OB5H 2IMMA 1WBZA 5IB3B 1NBYB 2G5BB 2GJZB 5IESH 1KNOB 1N8ZB 3MSPA 2Q86A 3TJEL 1F58H 3H3PL 4LSQL 2AXGB 2C5DC 1IGML 5ENWA 3B2UD 3FN0L 1U8QA 1HDMA 5B39G 5J4MA 3NA9L 1U8PA 1JNNH 1G1CA 2B39A 3BW9A 2BHYA 1CDIA 2VDMH 4ZS6D 3IJSA 2QR0B 4TVPE 3QEGH 1I9IH 3DUSB 3RU8L 2PCPB 3CDGA 3JWOC 1VPOH 1RIHH 4E41D 1RZJL 1X5YA 3R1GH 5D7JD 2YPVL 4DN4H 4BFIB 3O9WC 2AXHA 4KGJA 2NY0D 1ZT7A 3ROLB 1UACL 4GRWH 3NTCH 5BRZA 1FZJB 5MEOB 3V2AR 3F62A 1J88A 4UT9H 1NDMA 1MIML 5I1HH 5GGVH 5BZWB 3CH8A 4P23D 3QG7H 4XNUH 4X6FA 2CGRH 4NFDA 1I85A 1PKQE 3VRLE 4H8WL 3EYVA 4ELKB 5B38A 3C8HA 1L0XA 1DUZA 1VGKA 1MCNA 3K8LA 1WITA 4B0MM 5HPMB 2YWYA 3CVIH 3GI9L 3KPTA 4G6KL 5DLMH 1G6VK 1TZIA 2HG5B 2I26N 4X7FC 2XTJC 3IVKA 5FKPA 3AFLA 3QZWA 4EDWH 2V7HB 3DVNB 1RUPH 1IQWL 1UVQA 1LP9F 3VG9B 1U3HC 3DGGB 3LIZL 1P9MC 2ADGB 1K8DA 3T1FB 4M1GL 3RX7A 2XXCB 4G8GB 4J1UA 2Q76A 3UYRH 5I76A 3MA7B 2ARWA 4N8VA 1CZ8H 3H7LA 2DI8A 1CT8B 3OF6D 3C5ZD 1IGFH 4JHBA 4PGEB 1PZ5A 1DBJL 2VLLA 3Q2CA 5HGBB 2MTPA 1EXUA 2RGSA 4P9HH 2E7BA 2FGWH 5DR5L 3BH8B 3KYKL 4P4RA 3QQ4A 1EO8L 3HI5H 3EO0B 3LQAL 1PG7W 5T33H 1UM5H 3RUGB 4XHJD 2C4XA 5F1OB 1JHKL 1FVDA 4FNLL 4ZUVB 4F7CA 5FECB 5BQ7B 4YDVA 5IFJA 3MXVL 4P46C 5DRNB 3QO0A 5FGCE 2HAZA 4ISVA 5HYIA 4G6FD 2PTTB 5GRZA 2IBGA 4ODTH 2YEZB 2I5YL 2V9QA 5J1TC 2C3VB 5DK2A 3O6FD 5INCA 3TLRA 3IXTB 2GJ6D 4QCIB 3WS3B 3GIZH 4U05A 3D48R 1CFVL 2X40A 1TQBC 2XYCA 4XXCA 5I2IB 3VFTA 5C0RL 4QHLB 5T1KD 2HT4D 3MFFB 3NBNA 3ZKQD 2J8UA 5D1XC 4YUEH 1DL7H 1YEIH 3ABZA 4I77H 4P2RD 3BUTA 3KXFE 4K9EL 1MJUL 4LCIL 3SO3C 2EKJA 4RA0C 2VLMD 5FK9A 4GMSH 1NFKA 2XY1A 5MEPB 3SJVE 2GJJA 2FIKA 4K94H 4PLJD 3C6LC 5C0CD 4ONHA 5EO1B 1FZKA 3B9DA 1GL4B 5FO9B 3QEHB 5KG9B 2EIBA 2OBGA 3TBVA 4HJJH 3IDJA 1T0NA 2XKUA 4YXHL 2OZ4L 1S7SA 4HUVB 4H1LB 2YR3A 3GMQB 2CXGA 4XMLH 1INDH 3ULUH 1A7QL 5JIIA 1UKQA 5EU4B 1CDBA 3CIQA 4NQEE 4TTDC 4RAUA 4XCFH 4HKZA 3EOTL 3MLTB 4ZUUA 3OKYA 4X6DF 4WHCA 3PWNA 3N1MC 3U46B 1PVHA 4CADA 1G6RH 5I9QC 1X5GA 2P48B 5L9DL 1CN4A 4O5LL 5DJAA 4NDMB 5IK3A 5C0BB 2FWOA 1NL0L 4UQ3B 2R39A 2R0KH 3BEWB 5JDSA 1CK0L 2OR8A 1RSFA 3TNNA 5JUEH 1SYVB 4PJ5A 3VFOB 4D3CH 2AABH 3NZHL 3V95A 1BLNA 1F4XL 2XWJA 1OARH 3C87A 1UWXK 1R5IB 4FQXB 4QOKB 2P8MB 4MGXA 4E0RB 3BQUD 4IOSD 4M43H 3F6LA 3JUZA 3SDXA 4YHKL 1EGJA 1XF2B 3RL1B 3O6KL 1UJ3C 3RVXD 3A6BH 4MZ3A 3VD3A 2JJTA 5EDXA 3G04B 3QIWD 5DURD 1BJMA 1E4KA 3HAEA 3LMJL 2AXFB 1KIRB 3ARBA 5CIPA 3LV3B 4PJXA 1P7KB 3M8OH 2WQ8A 1L6XA 5GS2D 5JW5A 1FZOA 1FN4B 1MNUL 5DJ6A 1K2DA 2J4WL 3I6LE 4KHTL 3TH4T 1JZ8A 1MRDL 1GPOH 5ERWA 5DJ0A 2ZSVA 4L3ED 4JEGB 4M1DL 4FMKA 3W82A 5DSCA 2MKLC 2ZOKB 1SVCP 1E27A 4HKBA 4Q0XH 4LLYA 1JGUH 5JLZB 3BZFA 2IALA 1DEDA 4HFUH 1O7SA 1B6UA 2AEPH 5FM5O 3ZE0F 1WBXB 4AIOA 3OJDB 3EW3B 2JJSA 4GW1B 1HOCB 1OP5K 2ZUVA 3QUXB 1TETL 3T2QA 4HS8H 1FCGA 4MJIA 4PLKC 1G84A 3U1SL 4RCAA 1I3RB 3KPPA 2VLJA 5K59E 2YRPA 1G7IA 3VXSB 5BV7H 5IFHH 1TPXB 5KSAB 4KVNH 4P2QE 3V4PH 4NFBA 3L6FB 2EZ0C 1YEFL 4IOFC 2YUWA 3U9PL 3PHQB 1TTGA 2MCPH 5DJCA 2R0LH 3L5XL 5M95B 1I9JL 2BVPB 3B9KC 3OKMB 1JF1B 2QSCL 3RVWD 5CFHA 1C5DB 3R0NA 4CN1A 1QSEB 4OUOA 1QLFA 2P5ED 2IAMC 4LCWB 3DO3A 3QA3A 3WHE0 3IDMA 5DZOA 4I48A 5DJYA 4DAGH 2MSPA 5C0IA 5KVFL 1FIGH 1N64H 3WLWC 5B8CB 3VGHA 1YEJL 4KAQH 3IFNH 4GRWE 3RKDD 2R23B 2Q6WA 1GGIH 1FAKT 3S37H 2E6QA 1FGNL 2X4OA 1GAFL 3DMMC 5F7LB 4DFHA 4R3SB 1WFNA 3E6HA 2OP4H 3QFJE 5AWNL 3CX5J 4FQQB 3AVEA 5DRWB 3HUJF 3FONA 4OZGE 4LF3B 1EHAA 2A0LC 3OXSB 4PRHD 4Y1AD 2NY6B 4ZPVA 5BVPH 2EEDA 5F9DC 1BQLL 2DM2A 1JTPA 4BFGA 4G80B 3QWRA 5T1DL 5D71H 5D2NA 5IROC 1B88A 1L6ZA 5C1MB 1X4ZA 3SBWC 5JXAL 5C0FA 3VI4F 1IBGL 3R0MA 2DKSA 5HHMB 3ZYOA 3BGFC 2RAMA 4KRMB 5EIIB 4PJCF 3T2NH 3H3BC 2AJVL 4U1IA 1DR9A 2VR4A 4Y0GA 5ISZA 4TSCH 2D03L 4DQOL 3W9DB 3PWLA 3HPLA 5TFSH 4F9PC 3KR3L 2UVFA 3CD4A 3V6FA 1A7PH 1VFBB 1TCMA 2WV3A 4F57H 4QRQA 1N3NB 1G9NC 5EBWB 3ZZ1A 4L1HA 4UT7L 5CHNB 4HIXH 4JKMA 1LILA 3B9AA 1J87A 1F42A 2FO4A 1IFHH 1SQ2N 2H1PH 4F8TA 2XWBB 2J2ZA 1MQKH 1U8JA 2XRAH 3V0VA 2XTJE 5EZOH 3CAFA 1E4XL 1MHPL 1T5WA 1T5XA 4XXDA 2EDJA 2BNQE 1ZVSA 2XZAH 1S7TB 3O4LD 4S1DC 5E1AA 4P2OA 5F89A 5FV1L 4KRLB 4XC3H 1KENL 3RNQB 2IG2L 3U48A 1JL8A 1WBZB 3AREC 5CKAA 3QJHA 2FH8A 2EE3A 2Q86B 1CDYA 2CIIA 1GRWA 1UH4A 1CICC 5KS9A 1XGRA 3JV4A 4U0RB 5HI5D 4J4PD 3BKYH 4NQTA 3ARFC 5ENWB 1RHHA 3UJTH 2EDWA 3V9FA 5FUOL 1U8QB 2G9HA 1A6VH 2FATL 1U8PB 4JRXD 3SGEH 3G6AB 4CDHA 5ALCH 3BW9B 4OCRL 3WXWL 3IJSB 5J6GA 1CL7L 2Y5EA 4OLVH 5F7DA 1QQDA 5IBTH 3CDGB 2R1WA 3CZFA 1ZEAL 3TVMD 2BVEA 4ONFH 5HYJD 3FZUC 4Q97A 1ND0A 1ZT7B 5T3ZD 3KJ4C 4M6ML 2DAVA 3F12A 5BRZB 5B4MC 1RMFL 1P7QB 4NCDA 1NDMB 2F8VA 2X6MA 3QBTB 4Y4KD 3I84A 4X6FB 2NXZB 1SYSA 3UX9B 4LASH 3EYVB 3PGFH 3QCUH 4X7CC 1DUZB 5T1LA 4NQUA 3BWAA 1VGKB 3T0XA 1J0YA 3LKPA 2ADJA 1TZIB 4P3CL 5BVJA 1VERA 3UTSE 3FOLB 2JB5H 3IVKB 4CVXA 1DP0A 5FKPB 5GGUA 3QZWB 4U1GB 4G7YL 3KXFA 4M61B 4DZBA 2R56H 3DSFL 4NUGL 3SDCC 1UVQB 3SOBL 1IAOA 4U2YA 4F33A 3QPQD 1K8DB 1I1AC 2E7MA 3VXMA 4J1UB 4LQFL 1NFDF 4Q6IA 2Q76B 2P1YA 1H8NA 1RUMH 4APQC 3HC4H 3TESA 5I76B 3WIIL 5F3HA 1PZ5B 3D3VD 3MPCA 2VLLB 4WO4C 1EXUB 1KCRL 4WI4A 2Y1VA 2FLRT 3PL6A 2IGFH 4O4YH 1WZ1H 4P4RB 4HEME 2A9NH 1HN1A 2VIRA 4LMQE 3KPSD 1ONQB 3KNBA 3V52L 1LK3L 3G08A 1FVDB 1OCWH 4F7CB 3EDDA 1T3FA 3QDMD 4NOBA 1YJDH 5LQBH 4OLEA 4YDVB 4IM8A 5IFJB 1PLGH 3ARTA 3QO0B 5L7XL 3SGDI 2FB4H 1MWAH 5F7YC 4ISVB 2X89A 4P5KA 5DK3A 5IV2A 3DBXA 2EIEA 5DK2B 2VRAA 1OAYH 5INCB 5IW6A 4CMMA 1WAAE 1SY6H 1I8IA 5I75B 5I15L 4E5XA 5CD3A 5C09D 3CMOL 5E2TL 4U7SA 4XMPL 5CJ8A 3VJ6A 4OCSL 3NIFF 5KVEH 3QDGD 1ZT1A 2J8UB 4LHUG 3O2VL 4N8CL 4PIRF 5HDLA 2YPLE 5E8EA 3BKMH 3PG2A 5FK9B 2A6IA 3QUML 3S35L 1YEGH 32C2A 5GXBB 3LEVH 3SGJC 2FIKB 5EOCL 4ONHB 5DD1H 3DECA 1KCLA 1FZKB 1ZHKA 2OCFD 3DV4A 4HWUA 3VRIA 3K1KC 3TN0A 3TBVB 3IDJB 5D96B 5GS0C 4Y5VA 5KOVC 1RJYB 3WFDH 1G9ML 4J3UA 1QSZA 4QHNA 3TO2A 4XPHH 4Z6AT 3QUMB 4NM8H 2HFGH 3ZTJH 4KK5D 5AZEL 4RAUB 1HH6A 4HUXA 4Y19A 3VFNA 4IEFB 4GLRH 1N59A 4HKZB 1OTTD 1GCFA 1I3GL 4WFEE 5MI0B 1A7OH 1HI6A 3PWNB 3RA7L 5FYJL 4Z5RA 4CADB 2QSTA 1F3RB 5DJAB 1FNEB 1S7XA 2EDNA 2VQUA 3QWOA 3RAJH 3RJDA 5IK3B 1G7MA 2FWOB 4P57A 1MFDL 3LB6D 3KLHC 5JDSB 2D9CA 1EGJL 3OGOE 2DBLH 3TNNB 2NYYC 4P2QA 3O4OB 4PJ5B 3BX7C 4LSUL 1QLEL 1N26A 2R15A 1BLNB 2XWJB 2FL5A 1RZKL 3NCCB 3OJVC 5D93C 3SDXB 2VOTA 1JRHI 4S1QL 4OFIA 2DTML 1UCBL 4NC2B 3CX5K 2YKLL 3HAEB 4PUBL 5CIPB 1S5HB 3N9GL 4HF5L 4PJXB 4M7LH 4KV5F 3FB5A 5JW5B 1FZOB 3NACH 4QXUL 5DJ6B 2NZIA 4MQTB 4C56A 3SO5A 5ERWB 5DJ0B 2ZSVB 2R4SH 1T89A 5HDQH 1EJOL 4EVNA 4LNRA 2ADFH 5CEZD 4YX2H 5DSCB 1MFCH 2GY7B 4WY7L 1E27B 4ETQA 4HKBB 4LLUA 4LLYB 2CRYA 2M2DA 1UXWA 3BZFB 4X6DE 4OZGA 3O45A 9CGTA 2IALB 4M7KH 5ITBH 1R3LA 1T1YA 1IC4H 2FNBA 1AO7A 2DM4A 3DI3B 4HS6A 2E6JA 5DVMA 4HXBH 1YMHA 1BWMA 2HP4A 1H3PL 1C5CH 4MJIB 4BK5A 3KPPB 2VLJB 3H9HA 2CRZA 5LWYL 1N0XH 1DBAH 1G7IB 3WFBH 3EDEA 1MJ7L 1DQLL 2WUCL 2ED9A 1MRFL 1KBGL 3LKOA 3BT2L 5EOQH 5T5NF 2OMNA 2J1KA 5DJCB 4Y4FA 3CDFA 4N0FA 4ETYA 1AY1H 4FQJH 5I1KH 1BVLA 1QLFB 3I75A 4G8GD 4RRPA 4G43A 3QA3B 3IDMB 4I48B 5DJYB 3WFZA 5C0IB 4X9IA 1EH9A 2YD9A 4FZEH 5DT1L 4GG6E 2Q6WB 4YFLI 3F7QA 2X4OB 4XC1H 4OLYL 5EOCJ 2AQ3A 2D7NA 3HB3C 3E6HB 3FB6A 3AROA 4MCYA 3ZE0E 4PJBA 4OLWL 1H8SA 5ID1B 1E6OL 3OBAA 4Y89A 3FONB 1IAMA 3AM8C 3OPZL 1KJMA 4JAMA 1IGCL 4WFFD 2ZG1A 4YBLB 4LQ1A 1JNHA 1XF3A 5GRJL 2EXWD 3U79A 4ZPVB 1F90H 1UM6L 2VXUH 4ZO6A 3GK8H 3QUZA 1YEDB 3SN6N 4KZDL 2FZ3A 4ODUA 3GSXB 5D2NB 1V05A 4AYFA 3MLWL 2DQTL 2R2EA 5FUCC 2YD6A 3AS0A 4KDTA 2ZCHH 4R4NC 5C0FB 4HPOH 3RVUC 1YNLH 1U3YA 1CGUA 4FQIL 3MUZ1 5IR1A 4NBYB 5ISZB 1IKFH 3PWLB 2RQ8A 4U33A 1WIUA 2WWKT 5EG6C 3V6FB 4EIGB 1QRNA 3FAWA 4QRQB 5J1AA 3S36H 1QFWI 4LVHC 5M7QA 2FO4B 4OM1L 3RJQB 3NIGE 3G6JF 4FXKA 1U8JB 1YEHH 1UZ6F 3V0VB 3L5WA 3ZHLA 3R06A 3HUJE 4PJ7F 1T5XB 1CF8H 4XXDB 1I3VA 2PYEA 1G6RA 1ZVSB 5E1AB 5A3ID 4I18C 4P2OB 5F89B 3ARXA 3T77A 4C58B 2OJZL 1CQYA 3JV6A 3ARDC 3QJHB 3I6KA 1FRGH 3UTSA 4NQXA 2CIIB 2EDLA 1WICA 2BY3A 2Z31C 5KS9B 3LRSA 1XGRB 3JV4B 1A4KA 1RK1A 2Y6SD 5L8KB 1RHHB 3MRCB 2G9HB 3VI4E 2DJUA 2AEQH 5DD6A 2MQ0A 3RTQC 3DOSA 5I18L 1T66C 4N8PA 4RDQF 2Y36L 4KZEH 1KCVL 4PD4J 2FSEA 1CU4L 1S9WA 2CK2A 3OHXA 1MRCL 5J6GB 4LPCA 1BIHA 1F97A 4WV1A 3UBXA 3UMTA 5F7DB 1QQDB 3NCYS 2R1WB 3CZFB 3BD3A 2HTLD 4JZOA 5C07E 2DS4A 3MV9E 3OKKA 3H8NA 5AZ2H 4U1LA 1WF5A 5KSBF 1ND0B 4MAYC 5TJWK 5BS0B 3F12B 4UI2A 2OR9H 4YJZL 1NGYA 3BIAX 4P59L 3W39A 1H3WM 1KF9B 5FGCB 5E6IC 2HFEA 5E4EB 1SYSB 3NMEA 5FYLH 4DUVA 3MLSH 5T1LB 3WNMA 3BWAB 1WAAA 1ERNA 4GMTH 1MCIA 3NPSB 3BHBA 3LKPB 3TA3C 1JJUA 5DD3H 2ADJB 1GOHA 5C6TL 5FHAL 3BPLC 5HYSA 3MUY1 5BVJB 4WUKH 3Q3GA 3VXSD 3DRQA 1FVEA 5KSAD 1U93A 4CVXB 5GGUB 1JFQH 1CDHA 3KXFB 3LH2L 4DZBB 1JZ3A 1DBML 1AJ7H 3JTSA 3GHEL 4F9LC 1TZGH 1KELH 2BC4A 2V7NA 1IAOB 3F5WA 4F33B 1I9RH 1XZ0A 1BFOA 1QSED 2APTA 3VXMB 4QRPA 4Q6IB 1X5FA 2MWCA 4D8PA 4ZDHA 5IHLB 1P69B 4JPIA 1W72H 1U6AH 3KWWA 4JQIH 5HPOA 3KPLA 1CGYA 4D94A 3PL6B 1BEYL 3ARVA 1YEEH 3BVNA 1LE9A 2VIRB 1ZTXH 5CGMA 3KNBB 3G08B 5T5FL 2Q1EA 4LGPB 4XPAL 4Y16A 3W11D 1RUAL 4K2UH 2HJLA 1OTSC 3OB8A 1T3FB 2FRGP 3TBYA 5FCUH 4EUPH 4HK3N 2HWZL 4UTBH 3LKSA 1D9KA 4I3RL 3NFPA 4KKLC 3SE9L 4P5KB 1MHHA 4J7RA 4LCUB 4JY5H 5D70L 3LD8C 5IV2B 2NY6D 1PG7X 2W0FA 3DBXB 1B4RA 4TSBL 3Q5TA 5IW6B 1MCKA 4U7MA 4CMMB 4Z8FH 3CU1A 3DTXA 2DM7A 4UAOC 3MFGB 1I8IB 1JE6A 5F7MC 4E5XB 5CD3B 4GRLC 4XPTH 3MV8A 3SDYL 3VJ6B 1VGEH 3G6DH 1ZT1B 5HHMD 1FFPA 1NFDE 2WBJA 3W5MA 3CLEH 5K9OA 4JZNA 5E8EB 3UEZA 1N7MH 1Z3GH 2A6IB 4WGVB 2PR4H 4KKCD 32C2B 3IFPA 5I71C 3BMVA 5CCKL 1RZGA 1ZHKB 3DV4B 4OB5L 4PG2C 4FTVA 2EEAA 3TN0B 3VRIB 4PJ8A 5I1CH 3QIUA 5IESL 2E27H 4Y5VB 4JY4A 2NX5D 1F58L 4QHNB 3HE6C 3TO2B 1IJ9A 2VN4A 3DVGA 2L7JA 1H3VA 5D1ZC 4FQCH 1HH6B 4HUXB 4Y19B 3VFNB 4TNWK 1BP3B 5J13B 1JNNL 4DKEH 3GBML 1HI6B 2WIMA 4GS7B 3B8YA 4ORZC 4Z5RB 3SEPA 2VDML 3SDAA 1S7XB 2DQDH 3QWOB 3QEGL 1I9IL 1G7MB 4P57B 5IB4A 3SQBA 2LAAA 3PABA 2Z92A 4L4JA 4JFDD 1YMMD 1RIHL 1CE1H 4PBXA 1G9EA 3R1GL 3DO7A 4YDLB 4W6XB 4DN4L 5C9KA 3QI9C 1KULA 4YNYA 3G9VA 3NIFE 4O58H 4BM7A 3NAAH 3QXDA 4L9DA 2FL5B 1NKOA 3NTCL 2DLGA 1AHWA 3O3BA 2XTLA 5FYKH 4UT9L 1K4CB 3B2UC 3OKEA 5MENE 2HVKA 5GGVL 5I1HL 3BP6B 3S88H 1D7FA 3QG7L 4XNUL 2CGRL 3LY6A 4BUGA 1MCOH 1MCWM 4KFZC 4GG6A 3EHBC 3FB5B 2MCG1 4ZS6C 4C56B 1K9TA 3CJJA 4EN3D 3MRQA 5BRZD 4EVNB 4LNRB 3CVIL 5DLML 4ETQB 4K71C 4LLUB 1P7QD 3K3QA 4OZGB 3O45B 1OOAA 1R3LB 1T1YB 4EDWL 1AO7B 1TDQA 3VFMA 1U8OA 2NXZD 1F00I 5E6ZA 1RUPL 1LQSR 4HS6B 3D0VA 1YMHB 4HPYH 3H0TA 3KHOA 1UXSA 2VSCA 3F7RA 5DVKA 3MRGA 3GMOA 4KMTH 3UYRL 1A8JH 3H9HB 1CZ8L 1IGFL 5SWSA 2QSVA 2YK1H 1KTKE 1C08A 3WO4C 4P9HL 4XP5H 1JRHH 1C16A 2EECA 2FGWL 3B8SA 5AD0A 3LKOB 3QDAA 4RMRA 1QBAA 1AGFA 1B2WH 1PGRB 3T1WA 4Y4FB 3HI5L 3MC0A 3STBA 1EPFA 4N0FB 3QNZA 1A9BA 5T33L 1UM5L 1ZS8A 1BVLB 3I75B 5J12C 4G43B 3LCYA 43C9A 5DUMH 3GM8A 3QQ3A 3RRQA 1DDHA 3KYOA 3IKKA 4MXQC 4ODTL 4BQ9A 1YYLH 3QXUA 3NVQA 2UWEA 4MD5A 1XF5A 5IFAH 2HJFA 2NZ9D 2HVJA 1PAMA 2Y07H 4YBQC 3GIZL 3EO1A 5IMMA 2J7LA 1ZGLM 1TITA 3FB6B 4MCYB 4PJBB 1MWAA 1NLDH 4Y2DD 5EUKA 1KJMB 4JAMB 3NIDE 4YUEL 1DL7L 1YEIL 4I77L 4XVTH 1JNHB 1D5MA 1KB5H 1XF3B 2P8LA 3V0AC 4BFEA 1BFVH 4H0IA 1OGAE 4XHJC 1SY6A 3GJFH 4GMSL 5E9DA 3QUZB 4K94L 2FZ3B 4ODUB 3D1MC 2O5YL 2YRZA 4Z77B 2R2EB 1WZLA 4HJJL 5D1QA 4N5ED 1INQA 3LQZA 4XMLL 1INDL 5KOMC 3ULUL 3O6FC 4YHLH 3QDHA 1SJXA 4HUUA 4OZIA 4X5WA 3CK0L 4IRJA 5IR1B 1JYXA 2K3TA 2SEBA 3MV9A 4ZOCA 4OF8A 1UA6H 3O0RH 2X4PA 4XCFL 4QHKJ 4NCC1 2ZUUA 1HYRC 1OY3B 2HT4C 3RDTA 1QRNB 3MRLB 5J1AB 1G6RL 3X11A 1N4XH 3E6FA 4W4OA 2W07A 4LVOC 4JN2A 2R0KL 1OSPH 4AMKH 4JFFD 1HCVA 1EEQA 4WEMB 5JUEL 4FXKB 4OZFB 4PLJC 5C08B 1S7QA 4D3CL 2AABL 4CUCA 1X7QA 4EI5A 4OFKA 1OARL 3S5LA 2PYEB 1G6RB 5LBSL 2VAJA 2J8OA 2OR7A 1J7VR 4M43L 3T77B 1Q9LA 2X7LA 4M5ZH 3JV6B 3ZKSD 1OVZA 4LAQH 2CJUH 3I6KB 4H0HB 3A6BL 4Z7UF 1WSST 1SEQL 5JHDE 3UTSB 4NQXB 1EFQA 3LRSB 5I30H 3L3KB 1A4KB 1RK1B 2NTSP 3FRPA 4L8SA 3CFIC 3M8OL 2OTPA 5GS3A 2CDEA 4ZAKA 5F1KC 2D31A 1T7WA 5DD6B 5ABDE 2VJXA 5FYJD 1GPOL 3MCG1 4GBXA 3VW3H 2YUVA 3REWA 4AEIH 5J57B 4R0LA 2PW2A 2FSEB 5H2BA 2DKUA 1S9WB 3OHXB 4G7VH 1BMGA 4Q0XL 3MLUH 1JGUL 4WV1B 3UBXB 5F44A 5I17A 3C2AH 2FEDD 1DFBH 3C08H 4D9LH 1H3UA 5C0EA 4HFUL 1J12A 3MBEA 1R0AH 3OAYK 4JZOB 3OV6A 3T2PA 2D7PA 2OJEA 4NHUA 3OKKB 3BQUC 2AEPL 5HI3D 4I4WA 5C0JA 1GYAA 4U1LB 2ZP0T 4K23H 4LVNB 3KYMA 1IL1A 1LDSA 3IJYA 3RVXC 3G6JE 4PJDF 4K8RH 1F6AA 1QSVA 3PNWA 4HS8L 4PJ7E 1NGYB 4NKOA 3T8XA 3BFOA 3T4YA 5BV7L 1MF2H 4X8XA 3W39B 3FHAA 5IFHL 4KVNL 2WBWB 4WFGE 4JZJA 2HFEB 4RGNB 3V4PL 4NRYA 3OXRA 2XT1B 1MSPA 2MCPL 2R0LL 5C86A 3LSOA 5JIHA 3U7WH 4LARH 1HIMH 3BZDA 2G2RA 3BHBB 1JYVA 2F9BT 5BV7B 5A2FA 4MJID 5I19H 4IDLA 4DAGL 4JQVC 1N64L 3Q3GB 2VXQL 3DRQB 4HT1L 1FVEB 4KAQL 1U93B 4M1CD 1ZLSH 3IFNL 2F74A 3X3FH 3QR2A 1GGIL 4M93B 5FYKE 3QPXH 3S37L 1B90A 2V7NB 1F6FB 3WFEH 2BZDA 3F5WB 4NBXB 1BFOB 3MUJA 4K3JH 5GS2H 2B1HH 4QHUA 5ICXA 4QRPB 2OP4L 4D8PB 3GO1H 5IVXE 1BX2A 4JPIB 1HYSD 1QPXA 3KWWB 1FFNA 4R7DA 2YXFA 2ESVA 5EU6E 4AIZA 5I6XB 5BVPL 4K7PX 3JWDC 3BVNB 1LE9B 5IWLA 4LLMA 3QCTH 2HKFH 4WHYH 1KV3A 4Y16B 2HJLB 5H37H 3TBYB 2VUOA 3O11A 3LKSB 3MUHL 1D9KB 3NFPB 3T2NL 4OZFG 1MHHB 4O2CA 2VL4A 4TSCL 2W0FB 2ICCA 3QEUA 5TFSL 4C4KT 2JJWA 5D2LF 3ZT6A 1A7PL 4M3KB 3WJLA 4F57L 5EZJA 1EFXA 3DTXB 3PV7A 4XRCA 4GSDL 2XOTA 5F71A 3MV8B 4HIXL 2IQAA 5MENA 4PRID 1NQBA 2ICEA 1IFHL 2H1PL 2O5XH 3UTOA 1X44A 1FFPB 2VDNH 3BD4A 2WBJB 1MQKL 2XRAL 1GXEA 5EZOL 5ISZD 1MCBA 5CJQH 2X09A 4M7ZC 4ZS7H 2XZAL 3IFPB 1J0IA 4UNVA 1AGDB 4DGYH 5GRWA 1RZGB 3NGBB 4XC3L 4FTVB 2HYMA 2NLJA 3RWCA 3QIUB 1ZK9A 3U6RB 4M7JH 5CSZA 3RL2A 4J12A 4JY4B 3BKYL 4UV4H 3DVGB 3UJTL 4HWNA 3F6IA 1A6VL 2V2TB 1FYHB 5CSGA 3QO1A 5ALCL 3B9VA 3QFDA 5DEFB 4OGXH 3SDAB 2FJGA 4Z7WA 4OLVL 2P46B 5IB4B 3PABB 4XNZB 5IBTL 2Z92B 5CEXA 4JM2D 4CMHC 4M6AA 2I9TA 2P43B 5IW1A 4ONFL 1DQDH 5DVLA 4YNYB 2CR3A 3CSBA 3QXDB 1AXSA 3IS1X 4QRSA 4PY7A 4ZG1A 1AHWB 2HA1A 4X99A 3O3BB 4TTGA 1IRAY 1KJ2H 1WIPA 2B4CC 5HI5C 2WUBH 4J4PC 3L3HA 4OGZA 3OKEB 2NMSA 2DIAA 5I1DA 3MRJA 4FFZH 1HK6A 1OHQA 4LASL 4JKWA 4GG6B 1UWXH 3PGFL 2NY1B 3QCUL 2P5WA 5BS0D 2W0LA 1I75A 5EFIA 4PGCA 3MRQB 4TRPL 2IF7A 2VABA 3TVMC 1IARB 4X4ZA 1CLOH 1DLFH 3ZDYE 2DQFA 2JB5L 2A38A 4LLQB 1U8OB 4JCLA 2R56L 4QEGA 1OGAA 4JDVA 3BDXA 4YXKH 3D0VB 2ZZUT 2GJ6E 1IM3A 5DUBA 1BECA 5T1LD 1MJJA 3H0TB 1UXSB 3U7YH 3MRGB 5CAYB 1RUML 4X6BA 3GMOB 2I07A 4GG8A 4PB0H 1E6JH 4J3WA 3GSVA 4U3CA 5SWSB 1Z9SA 3BPNB 3D87B 1C08B 4P2RE 4KMLB 2Q7NA 1OGTA 1C16B 4O4YL 5AD0B 2IGFL 1AIFA 4KJYA 2VLME 1AGFB 4XBGA 1WZ1L 2A9NL 1OP5H 4BH7B 3QNZB 1A9BB 5C0CE 2WLZA 3C8KA 4ZFOA 3CFJA 1ZS8B 5BOZG 4MQ7B 4LLVA 1OCWL 3VXMD 1W72A 5T3ZH 43C9B 4NJ9H 1IGTA 5LQBL 1DBKH 4WI7A 2X9XA 1PLGL 1Q9KA 3QQ3B 5JOEA 2FB4L 5J56B 1MWAL 5E0QA 1ITBB 1IGIH 4Z7NF 2GSGA 1OAYL 2UWEB 1XF5B 4MD5B 2HJFB 1VENA 2HVJB 1D5ZA 1RAMA 1SY6L 2FGZA 5C3TA 4DN3L 35C8L 5F8QC 3EO1B 3GFUA 1MWAB 4HKXB 3CVHH 2EDXA 1A2YA 5KVEL 5EUKB 5E2UL 4PRPA 5HY9A 1D5MB 2P8LB 3A6CH 3BKML 3PXHA 4YE4H 5E9DB 1YEGL 3DHJA 3LEVL 3IAPA 1DLHA 3O2WH 5DD1L 3I3BA 4HG4J 2JF1A 4G8EA 1BOGA 1SBSH 4PTTA 4I8DA 1XAUA 5D1QB 2EO1A 2ITCA 3DJ9A 2ERJC 1INQB 3QNYA 3WFDL 1T0MA 3LQZB 2H3NA 3GMLA 3CH1A 5E2WH 2XQBH 4HUUB 4XPHL 4OZIB 4NM8L 4Z18A 2HFGL 3OSKA 4X5WB 4IRJB 2SEBB 5IEKA 1P6FA 3IAGC 3W2DH 1QPPA 2X4PB 1ZGLA 1EEYB 3I6LD 3RDTB 4L3EE 1T2QH 4NN5C 1A7OL 1VDGA 3G5YB 3MNVA 4RMQA 4NQCA 4ODSH 5GS1A 3VXPA 4LBEB 1J5OH 3RAJL 1FNSH 2APBA 4KRNA 4JN2B 3HE7C 1LK2A 4JKPH 2DBLL 2R0ZH 4KJPC 2WWKO 3RUGF 1S7QB 3HTLX 3JZ7A 4RGMB 1QVOA 4EI5B 4Y19D 1AQKH 3OMZA 3S5LB 2NXYB 3EGSA 3OTTA 4HWEL 4K07A 1N5YL 4NSKA 1Q94A 3GMPA 1Q9LB 2X7LB 3WDJA 1CI5A 1CVRA 3EYFA 4Q9RH 3DNKA 4WHTA 4KK5C 5DYOA 1V3LA 25C8H 3BZ4A 1PQZA 1OTTC 2BY1A 4L8SB 5KAQG 1MCDA 3MOQA 3WSQH 4ZAKB 3NACL 2D31B 3B3IA 3BDYH 5HDQL 5EH1A 2R4SL 4GBXB 3PDDA 4HJGA 3LB6C 4ODWA 4KRPB 2P5EE 2FBJL 2I60H 4R0LB 3KLDA 2ADFL 2PW2B 4YX2L 2LU3A 3T0EA 1MFCL 3AGVA 5IVXA 3RY4A 3A6OA 5I17B 4K7FA 4M7KL 5ITBL 3ARSA 5C0EB 1IC4L 3MBEB 1H15A 1MELA 3VFSA 3WN5A 2OJEB 4NHUB 4ORGB 1WBYB 3MRPA 3IRZA 4Y5XA 4I4WB 5EU6A 2EE9A 4HXBL 3KYMB 1IL1B 4C56D 3IJYB 4FFYH 5DQ9A 1F6AB 1C5CL 1P2CA 4MA7L 3S8WA 3PNWB 2JIXD 3IDGA 4YFEA 4DW2H 1CTOA 1MAMH 4UNTA 3T8XB 5FDWA 5F1SA 5DHVH 3T4YB 1BAFH 1EAPA 1N0XL 1DBAL 2WAHA 2V9TA 3BP5A 3WFBL 4JZJB 1K5NA 2DB8A 4PRHE 1AO7D 4Y1AE 4NRYB 1S7RA 4LEOA 3OXRB 5EOQL 2QHRH 4Z7UE 4OGAD 2YD8A 4NYLA 5KN5A 3LSOB 4JVUA 1AY1L 4FQJL 2C3HA 5ANME 1A47A 5I1KL 2G2RB 4PTUA 1RZJC 1YY8A 2D0FA 1FDLH 1JZ6A 5DI8A 2GSIA 3ELAT 1AD0A 3RIFK 1LMKA 4AQ1B 5AAMA 2X1XR 1EHNA 3TJEH 4V1DB 4LK4A 4FZEL 5D7JA 2F74B 3ARRA 3I6GA 3F58H 5IEHA 2F53A 3FN0H 3QUYD 4D0DA 3EYQD 4Y4FD 4EDXA 3J7HA 4B41A 4XC1L 3TFKD 2P7TA 3NA9H 1BF2A 3U30B 4H8WC 4QHUB 5ICXB 1ZLVK 1BX2B 5CEZH 4P23A 2NNAA 3VG9C 4TVSa 4KDWA 3MMEA 5F7EH 2Q8AL 4Z7VA 1FFNB 4NO5A 4R7DB 5J11B 1F90L 1EJ6A 2VXUL 2ESVB 4AIZB 1FYTD 2J6EH 3GK8L 3TBSA 3O4LE 4LLMB 1UACH 1I9EA 5JXED 3JVGA 3EAKA 4HK0B 4MJ4A 3UJIH 2ZCHL 4GRMA 1OW0C 4HPOL 1KB5A 5JPNA 3QXAA 1YNLL 3O11B 1CQKA 4CRPA 3GJFA 1YC7A 4AQOA 3FQTA 4O2CB 3TYGH 1IKFL 1GOFA 4FXGA 1OSZA 3RVTD 3P9MA 3QUZD 5EZJB 4JPWH 5EUOA 3S36L 1FFOA 1EFXB 5DRXA 4XRCB 3OGCB 3SE4A 2IPTH 4LOUD 2EXWC 1SHMA 2YOCA 2IQAB 3LQAC 5MENB 3C5ZA 3C2SA 2ICEB 3WFCH 3CSYB 1KIQA 1NH6A 1YEHL 2ATPA 2KPNA 3DYMA 5HYJE 1CF8L 4JGUA 2JJUA 5T3ZE 2UYLB 3WS6C 1QRND 5DDHA 3ULUD 5LGKA 2NLJB 3I50H 4POZD 3RWCB 1SJVA 5TQ2H 1FRGL 4MNHA 5CSZB 3RL2B 1NAKH 2E8ZA 1ZSDA 4MQXD 4UV7H 1ZHLA 5C08D 1A3LH 2CD0A 3DLQR 3P77A 4MNGE 4TUJA 3X3GH 1F4HA 4Z76A 2HMID 3GGWA 2ZCKH 2AEQL 3SE8H 2M8XA 2PYED 1KPRA 4D2NA 4J6RH 3QO1B 1DJSA 4TNVF 4KZEL 1JF6A 2F19L 4K9EC 3QFDB 4GH7B 5T1KA 1WZMA 2FJGB 4Z7WB 4KJWD 3EOYG 5CEXB 2Q7YA 4PJEA 4BSWA 1NMBH 1OP9A 1QA9A 2EDFA 4ODBD 1FNAA 4UILH 4RMWA 5A3IC 1GGCH 4XVUC 2I9TB 4ODHH 5IW1B 5AZ2L 2YD4A 4BZ2H 5CZXD 3ETBF 1AXSB 2ZSWA 3TNMA 4R6UA 4PY7B 1U58A 1DQJA 2XZQH 4X99B 3ZTNH 4LPUA 2OR9L 2Y6SC 2NY4B 3L3HB 5ADPH 2UVEA 3IDYB 2E9WA 3D3VE 4MHHI 3T0BA 5I1DB 4FQXC 3MRJB 5FYLL 4KK8C 4EBQH 2A73A 3MLSL 2HKHL 3KPSE 2P5WB 1XGQA 1MY7A 3VA6A 4GMTL 4PGCB 4UINH 1Z0MA 2D9QB 4HG4K 3QDME 2HTLC 4YBHA 5FM8A 2VABB 4WUKL 1W0YT 2DD8H 2R1YA 4A2LA 3MGOA 4RGND 1JFQL 5C0GA 5D8JH 5HTSA 2VKXA 1AJ7L 1OGAB 4JDVB 1HHKA 1TZGL 1KELL 1HXMA 4F7EA 5JPMA 5LAXA 1I9RL 1IM3B 5DUBB 1MJJB 1ROWA 5GZNC 4LPWA 1VCAA 3VFWB 3ARUA 5C09E 1DBBH 1XGTA 4X6BB 4FZ8H 5DMJB 4ZFOL 5KZCB 4GG8B 3GSVB 4OD3H 4X4ME 5C2BH 1U8MA 1W72L 1U6AL 3QDGE 1MHEB 2EIZA 3QIWA 4P5TA 4JQIL 2PTUA 4NUJA 4KQ3H 1OGTB 3QUXC 1AIFB 4KJYB 2DYPA 4OCXH 4XBGB 1YEEL 3GUTA 1FFQA 1ZTXL 1N5AA 1WT5C 1C7TA 3C8KB 4ZFOB 4HDIB 4L3EA 3CFJB 1LO5A 4L8BA 4OV6F 5DK0A 1TPXC 4LLVB 5KSAC 4K2UL 1W72B 4QRPD 1HKLH 1KFAH 1RULH 5E99H 1IGTB 3E2HB 5FCUL 3ULSA 4LSRH 4UTBL 4LRIC 1CDCA 3AMLA 2NR6D 2DL9A 2HJKA 3TH2T 4PS4H 3ZE2F 1IAKB 3MV7A 1BZ9A 3HN3A 1IVLA 1TVDA 4OGYH 5GRVK 4Z8FL 1D5ZB 1Y18A 2JELH 4DKFH 4NO3A 1QR1A 1AKJA 4M03A 4WFED 2X9WA 4EUPB 5B8CC 4Y16D 3K81A 4XPTL 4EKXA 2X4UA 4HKJA 1EZVX 1A2YB 1VGEL 1AR2A 3G6DL 5I74B 1D9KD 3K74B 4PRPB 3E8UH 3MYZA 3CLEL 4JG0H 1YY9D 3HLAA 1N7ML 1F5WA 1Z3GL 2PR4L 5DZNA 3W11C 2YN3A 1DLHB 1I8LA 5DEGA 4XWOD 1OL0A 2ED7A 4G8EB 3MRIA 3GSNH 1OQXA 1IC5H 4PTTB 4RFNB 3VFVA 5I1CL 2ITCB 1EHLH 3BJLA 2NY6C 3MV8D 3QNYB 1T0MB 4HXAH 1TJGH 3CH1B 3E3QE 3EJJX 4HHAA 5EBLA 1T1ZB 2W9DH 4FQCL 5IEKB 4YDJA 3VU2A 3UC0H 5BXFA 3T04D 2CUMA 1ZGLB 2QBWA 5GGSY 5I16A 4PB9H 2F54A 4DKEL 1OD7A 3QAZB 5CEZE 3MNVB 4NQCB 4FTVD 5GS1B 3VXPB 1CYGA 1DQMH 2DQDL 3QIUD 3RPKA 1T6WA 2IANA 3RZWA 5D7KD 1LK2B 4KKCC 1CE1L 4M4PA 2BVUA 4U1SA 4LLWA 1TQCB 4PRHA 1QVOB 4DUWA 2MJWA 3NFSH 3NAAL 3EGSB 1ZANH 3B4NA 4NSKB 1HNGA 5HHNA 1G7PA 1Q94B 3GB7A 4GAJH 3GMPB 5FYKL 4GO6B 2BSED 3EYFB 4WHTB 1NCTA 2AV1B 5DYOB 3S88L 3BZ4B 1JPFB 1J05A 1PQZB 3TYFA 4G6AD 3GIVA 1MCOL 3LDBB 1CXIA 2FX9H 3DUUA 4U1HA 5CJBA 4PRAA 1L0YA 1T7VA 1BQUA 3L5IA 3KLSA 1KJ2A 3B3IB 4HJGB 4X7SH 4ODWB 3LHPH 2J8UF 4YHOH 4G8GE 4TSAH 3T0EB 1OLZA 2CLRA 5FCSH 2R1XA 4U0RC 5IVXB 3BPOC 3QG6A 4K7FB 5JHLH 3T09A 1H15B 2Y5TA 1AFVH 3VFSB 3WN5B 2G75A 3MYJA 3MRPB 4Y5XB 5EU6B 1KLUA 3P0GB 4G8IA 3O4LA 4HPYL 2NQCA 5DQ9B 1J0JA 1FSKB 1P2CB 2PKDA 3RUGE 5HSFA 1P84K 3PHSA 3IDGB 4IDJH 4KMTL 3L7FA 4RMSA 4RAVA 3MJGX 2C4FU 5FDWB 1PJ9A 3S3JA 1RZ7H 1EAPB 2YK1L 2QHLA 4RBPK 3BP5B 4WFFE 3Q1SH 1K5NB 4XP5L 1JRHL 1S7RB 4LEOB 6CGTA 3RNKB 3D85A 1B2WL 3ARWA 4NYLB 5KN5B 1GGBH 4C54A 5EO9A 3RWHA 1YY8B 5DI8B 2GSIB 4EUPG 4MZ2A 2NXZC 1AD0B 5LKNA 1I85C 5DUML 4XNXH 1DSFH 5SWSD 5HD8C 1N6QH 1F4YH 3I6GB 5IBUG 5IEHB 1YYLL 4U1JA 3D9AH 2F53B 3SDXF 4C55A 4DFIA 4DVBA 5IFAL 1CFQA 4D0DB 4EDXB 2NY0B 2P7TB 2Y07L 5SV3A 1FGVH 2XY2A 1U91A 4JDTH 5GGSA 1BREA 4PJXF 1OPGH 4XZUA 1NLDL 4U1GC 4PY8I 5JOPD 2AW2A 3VFGH 4Y4KA 4P23B 2NNAB 3RBGA 5I1AA 3MMEB 4Z7VB 1KB5L 3QRGH 4NO5B 1BFVL 1JHLH 4MNGA 4ZSOA 4QYOA 4ERSH 3S96A 3I2CH 3IU3A 3TBSB 1P1ZA 2FJFB 5SX4I 3CVHA 5FF6A 4GRMB 1JF5A 1E4WH 3IXAA 2GIYA 4MS8D 1KB5B 4WU5A 5JPNB 3QXAB 4YHLL 4ZTPH 1R6VA 2NZ9C 3GJFB 4WI3A 1SM3H 3E0GA 3FQTB 3UO1H 2VLRA 1UA6L 1OSZB 3O0RL 5E9DD 4NZRH 3P9MB 1XR8B 5EUOB 4JANB 3HZKA 5I73B 1FFOB 5JQ6H 5DRXB 4RAHA 2IC2A 4HQQH 2EDTA 5EZLA 5D1QD 1N4XL 4MDJA 1OSPL 3C5ZB 4AMKL 1ZA3A 1HEZA 3K80A 4C4KO 1SBBA 3D3VA 3FFDA 2ATPB 4IRJD 2YUZA 1KACB 3HC0A 5L2KA 2IQ9H 5I75C 4XXCC 4OF6A 3EO9H 3KPSA 2IEPA 3RDTD 2D3VA 3MRNA 4M5ZL 4R4BB 2AJUH 5DDHB 3QISA 4LAQL 2CJUL 5D6DA 3OX8A 1ZSDB 5I30L 1ZHLB 4G6FB 1V8HA 4Z76B 3P77B 4TUJB 3V7AG 4OV5A 3W5NA 4PJHB 2X42A 3GGWB 4EI5D 1CD8A 1KB9J 2NXYD 3HPJA 5D96C 1KPRB 3VW3L 4AEIL 1KPUA 2Z8WC 4H5SA 2EC8A 3BN9D 4PYHA 4FFVC 2VWEC 3U2SA 4P2CG 1MVFA 1PDKA 3H9SA 4XP9H 3C08L 3C2AL 1DFBL 4X4MA 3VXSE 2Q7YB 1K3IA 4PJEB 3QDGA 4BSWB 4D9LL 4JFZL 2N7AA 3W0WA 1QA9B 1R0AL 2X1WL 3QQNA 5DMGC 4KTDH 4ZAKD 1G9MC 4K23L 4LP5A 4KVCH 3MRRA 1C5BH 5JMRA 2ZSWB 4K8RL 3TNMB 4P3WA 1QSEE 4GBXD 1U58B 4KRPD 1DQJB 4WENB 1KLGA 1GZPA 1T1WA 3TBWA 5JNYA 1X5HA 3O4OC 1MF2L 5A40E 3CFDA 4HMDA 4W70A 4OTXH 2ZPKH 3MBED 4GAGH 1J1OH 5JA8B 1R5VA 4YDKH 3HRZA 2F5BH 1NPUA 2A73B 3U7WL 1XGQB 1JGVH 1HIML 5CP7A 5JW3H 2JJTC 4TUOA 2FEDC 5DHVA 3C6LB 4TOYH 1E4KC 4JHZA 3GMNA 1YDPA 3ARBC 5ALBH 5I19L 3VRLF 4BSVA 2B8OT 3TP4A 1RZKC 4X4YA 1ZLSL 4DGIH 4ZFZA 2Y7QA 1FNGA 3QRFM 1VFMA 1OQOA 3X3FL 4DGVH 5C0GB 4F15B 3QPXL 1HHKB 1HXMB 3WFEL 3VXRA 4F7EB 5JPMB 5LAXB 4K3JL 5KS9F 3OAUH 2A9MH 1XGTB 3GO1L 5D5ME 1U8MB 5HHME 2EIZB 3QIWB 5FXCH 4P5TB 4V1DD 1FV1A 5CKGA 2JJSC 4NUJB 1PSKH 3ZKND 1Y6KR 4LSUH 2DYPB 4PP2A 2WK2A 3GUTB 1X5JA 2BNRE 2LABA 1N5AB 2HKFL 3QCTL 4L3EB 1LO5B 2IJ0C 4L8BB 5DK0B 1PY9A 5H35A 4NZDA 4HW6A 3ULSB 2P24A 2NX5E 1LD9A 4U6VH 2BHUA 4G9FD 4Q6YA 2J6EA 1PYWA 2HJKB 4KK9C 1L9NA 4N90D 2ESVD 5CSBA 3MV7B 1BZ9B 1P4LA 1RD6A 1Y18B 4QXUH 4YIQA 2HFFA 2HLFD 2ADIA 4NO3B 1QR1B 4ZUWA 1AKJB 1KJVA 1HYSC 1M05A 1U92A 5HPMA 4YHMH 1OAUH 2X4UB 3WIFB 5A2LH 4HKJB 4KI1A 4J8RB 4PP1D 4JFDE 1YMME 2O5XL 5C0AD 4XCYA 2VDNL 1TNNA 1AR1C 1A22B 1QD0A 3HLAB 4TYUA 1MFBH 1S7VB 5CJQL 4ZS7L 1FG9C 3QCVH 2VZOA 4M5YH 4UB0H 4DGYL 1IE5A 2QADD 2LQRA 5DEGB 2OL3H 4JG1H 3GHBH 2B5IB 1EFXD 4AL8H 2LVEA 3MRIB 3IKCA 3VFVB 4YBLC 4M7JL 1LVEA 4JVPA 4HHAB 4NZUL 1QHOA 3N06B 4UV4L 5EBLB 1BF8A 5D2NC 3N0PB 4LSDA 2LE9A 1X6NA 3C09B 4YDJB 5BXFB 4R90H 5I16B 2F54B 5DQDH 5FHBH 2FHCA 4OGXL 2NY2D 3ZE2E 4H0GA 4XNYH 2IANB 4FG6D 1RJCA 3DXAE 3EIFA 2G60H 4U1SB 4LLWB 4PRHB 3HZVA 4M62H 1DQDL 2EDBA 4AENA 2DOCA 3B2VH 3DWTA 5HHNB 3GB7B 4P9MH 3VXNA 4OLYH 2C3XA 1KJ2L 2WUBL 3RFZC 3ULVH 1JGLH 5K9QI 3VXTA 4RWYH 1J05B 1WGOA 3TYFB 4WW2A 1DE4A 3FHQA 4FFZL 3AS1A 2X10A 3GIVB 5KSVA 2K9UA 4P2OC 3VMOA 4YWGH 4PRAB 1JMZA 4M6OH 2XG5A 2YD2A 4X7TA 1KJ2B 3GMRA 4LSTH 5ADOH 2BDNH 2Y06H 4OLUH 1RV6X 2LTQC 4LKCA 2CLRB 2R1XB 2YXMA 1WZKA 3MODH 1WC7A 1DLFL 4D9QE 3QG6B 5HGHA 1UEYA 1J0HA 1MCPH 2Y5TB 2G75B 3MYJB 3CSPA 3ROOA 4L29A 4YXKL 1KLUB 4MJ2A 3P4MA 4G8IB 2P5WD 3O4LB 3MLTA 1FNHA 3U7YL 2KDGA 1TZHA 3BKJH 4XCCH 1SJHA 4H25A 4PB0L 2GKIA 1E6JL 4RAVB 3V5HA 3P9LA 5FYLD 2APWA 4KJQC 1S9VA 3JBG7 4P2YA 3BPCA 1Y6MR 1BWWA 3AU1A 3T3ME 4Q9QH 1KXTB 4BFBD 1J0ZA 3D85B 3VXQA 1OGAD 4WHYG 5EO9B 1MH5A 3K2MC 3RWHB 5K59F 2BXYA 1X4YA 4QF1A 5F9WB 4Y5YA 1A3RH 1QO3A 5T3ZL 4NJ9L 4EI6A 5E4EC 3WHXA 4S2SA 1DBKL 1A6AB 2NTFA 3ZKMD 2BRRH 1IAII 4LLAA 5GGTH 4Y4HA 1IGIL 4XAKE 3NPSC 4U1JB 4DVBB 1CFQB 3WJJA 4BJLA 2GUOA 1INEH 5D7SH 1KB9K 2HTKC 3V6BR 3PWUA 1WLHA 1J9CT 1U91B 5GGSB 1FH5H 1KCVH 2DTSA 4XZUB 2ZOKA 4GRWF 3CVHL 4JFFE 4O9HH 4KKAD 2VWEE 3ARGA 5I1AB 3VCLA 3A6CL 4XVJH 4R97B 4ZSOB 4QXTA 4QYOB 4YE4L 4ZO8A 3S96B 2FECL 3IU3B 4Q6IC 5FV2A 1ZWIA 3O2WL 1P1ZB 5GSVA 3SKJH 4GW1A 4OZGF 3CVHB 4PBVC 1SBSL 1NCWH 2VO5A 3IXAB 5FYKU 4WU5B 3PL6C 4OFYD 2VE6A 5E2WL 3VXSA 1W0WA 2XQBL 4FQHA 3AUVA 4PRPD 3VI3E 4AY0A 2OQJA 5C92A 1R3IH 2VLRB 3MOBH 3IJHA 3W2DL 4RQQA 5HGGS 1DZBA 3GSNA 3O6MH 5FYJE 1T2QL 3H42H 4LSSH 3TIDB 3HZKB 1QSEA 4ODSL 5LCVH 4Z7OE 3SDXE 3VD5A 3N50A 5EZLB 1J5OL 4U6YA 1FNSL 3X12A 4MDJB 1D6EA 1ZA3B 1HEZB 4JKPL 4YHPA 3V0WH 2R0ZL 3D3VB 3FFDB 4MYWB 4X9BA 5INDA 1A6PA 3RI5K 4HC1H 4S0SD 3IDNB 5EORH 3HC0B 5L2KB 5DRZB 1MCFA 1AQKL 5J3HD 3DV6A 2OK0H 2H2PD 2GCYA 3GJFK 5BJTA 1ACYH 3KPSB 3TIEA 3KPOB 3MRNB 3NCBB 2VZVA 4M6NH 4XAWH 2JJVA 3SE3A 2BP3A 4NQCD 4Q9RL 4AM0A 5T3XH 25C8L 1QBBA 3OX8B 5SX4H 2EDRA 3WSQL 4BYHA 5TQ0H 4OV5B 3TN0C 4PJBF 2JE8A 4K3EH 4WI8A 3HPJB 4IS6A 1HE7A 1KPUB 1Q8MA 4Y5VC 2I60L 4H5SB 4MQSB 4CAGA 2PO6A 3IYLW 3PV6B 1MAKA 3U2SB 4MJIE 4MB4A 2G5RA 1LO2H 4K3GA 5D5MA 3H9SB 3QDGB 4RFOH 3W0WB 5J13C 3ZKXB 4NRZA 1UCTA 2WZPD 3F7YA 1VA9A 2R8SH 4GS7C 4TUKH 2DQGH 2KZ1B 4FFYL 3MRRB 2BNRA 3LN9A 1U8NA 3ZYZA 1T7YA 1KLGB 1GZPB 2YUXA 1T1WB 2D2OA 3T0ED 4DW2L 3TBWB 5JNYB 1MAML 3JWNC 4YDLC 1BAFL 2ZNWA 3CFDB 2NX5A 5GIRA 4PREA 3PDGA 2XWBA 1R5VB 2QHRL 3ULUF 1IEAA 2YD3A 3DYOA 4HWZA 3HRZB 5CEYA 5SV4A 4HZAA 1Y6NR 1CBVH 5CP7B 4EOWH 1M6OB 1FDLL 4TUOB 5DHVB 2AEWA 3GMNB 1YDPB 3ZT7A 2Y23A 4CVUA 3UZVB 4BSVB 5E03A 4PGDA 1I7UA 1M7IA 5KVGH 1BFSA 4JFDA 4X4YB 1YMMA 4L9LA 4U1MA 4LHUA 4ZFZB 2Y7QB 1FNGB 5MP6H 3F58L 1T89C 4Z9KB 4GT7A 2M26A 3FRUB 3PWPA 3VXRB 4ZXBA 1EMTH 15C8H 3GM0A 5TPWH 5D2NE 3G6AA 3U0TA 3AB0B 3GBMH 4PV8A 2CK0H 1QYGH 4ELMA 4OF7A 3VGAB 1ODAA 4PRIE 5CEZL 1ZGLP 4OGAC 4NKQB 4HK3J 5F7EL 3MRDA 1FV1B 1VACA 3AS3A 5IB5A 5ISZE 1LEKA 2VZ1A 2F53D 2J6EL 3FT2B 4PP2B 4L8CA 5E56A 4EN3A 5IJKA 1CLYH 1MLBA 3RPIA 3UJIL 5H35B 3MR9B 4JCMA 3SKNA 4JFXA 4NIKB 1P7QA 3SKUD 2P24B 3RQ3A 1LD9B 4CN4A 4Y4FC 1AGBA 1EIBA 3I02A 3TFKC 3DXAA 1B0WA 3EUUA 1PYWB 3TYGL 4YZFE 5H94A 4JJ5A 1JPSH 1P4LB 1XMWA 4YIQB 2HFFB 2FH6A 1P4IH 4JPWL 2ADIB 4OSUH 2YZ1A 4ZUWB 3S3SA 1KJVB 4P9HC 1M05B 1U92B 4QGYA 2IPTL 1YQVL 4JQXA 3RZCA 2AVGA 2PTVA 2J3SA 3WFCL 1K85A 2YN5A 3FOLA 2ZUYA 5KS9E 4ZNEA 4XCYB 4XP1H 1WAAF 3CFEA 4ZD3H 2XWTA 3FB7B 4MA1B 4M61A 2GW5A 2AS5M 1MQ8A 5BW7A 1KYOK 4AEFA 2XICA 3IKCB 1FLTX 3I50L 3C9NA 5TQ2L 1X3DA 1NUFA 4LGSB 1NAKL 3X17A 3ARYA 4KKNA 5DMIH 4UV7L 5E6YA 1ZA6A 4X80H 3QUZC 4C83A 1A3LL 3X3GL 1CGSH 1FZMA 1LEGA 2FX8H 2ZCKL 3WV0A 4UNUA 3SE8L 4OCWH 4LOUC 4J6RL 4KDTC 5BS0E 2I25N 2DWDA 1NBZA 1ONQA 1ZLWH 5BO1H 4UT6L 4U0QB 3AAZB 5HDBE 4K94C 4GUPB 4Y2DA 5TDPA 1NMBL 4UILL 4JPKH 1GGCL 3HZVB 3MRBA 4ODHL 4BZ2L 1GC1H 1MHCA 3ULUC 4AENB 1TXKA 3FO9B 4POZC 4S1SH 4CVZA 4UMGA 4JO1H 3VXNB 2XZQL 3ZTNL 4MQXC 2Q8BH 3VXTB 1XH3A 5ADPL 5LGHH 2IBZX 2HMIC 4WW2B 1DE4B 1KC5H 1FC2D 5KSVB 4KUCD 4EBQL 4X7TB 2CSPA 3GMRB 2R69H 4N1CA 4UINL 1JN6A 2FX7H 4LKCB 3VXME 2O5YH 1BD2A 3GJEA 4NM4H 2ZUQC 2Z8RA 3IDIA 2DD8L 1WC7B 3P9WB 2VR9A 1RJYA 1A4JA 5HGHB 4JFFA 4LCCA 3GKZA 2HN7A 3QUMA 3WUWB 1U2HA 5A16B 5D8JL 3CK0H 4KKBC 4G8FA 5IJVA 3OR7A 4K8RD 4JFHD 4L29B 3ROOB 2AI0H 3BEVA 4OZFH 1U8HA 3P4MB 1AP2A 2EH7H 3BO8B 1DQQA 1ZMYA 4QTIH 4WVRA 2ILLA 4M9PA 4WV1C 4DTGH 1M7DA 1TZHB 5GPRA 3C6LD 1DBBL 1Z5LA 4FZ8L 1SJHB 2B0SH 4H25B 3ZYIA 3V5HB 5F7UA 1FNEA 3KG5A 4F7PB 3P9LB 4OD3L 3WFHA 2KUTA 5C2BL 1BZ7A 4LVHB 5B22A 1S9VB 4LVNC 3BPCB 1IM9D 3OR6A 3AU1B 4KQ3L 2EE6A 3KLAA 3VXQB 4OCXL 2PF6A 2WBKA 4PRDA 3WD5H 1GGYA 1MH5B 4XPFH 2QQNL 5LBSH 3ZYJA 1QG3A 4QF1B 4Y5YB 2XNAA 1QO3B 1HKLL 1KFAL 1RULL 4EI6B 3CU7A 5E99L 3WHXB 4S2SB 2NTFB 3HZYA 3NH7H 4LSRL 5TF1H 5CILH 1SEQH 4P5TD 4OIBA 4Y4HB 1IKNA 1S5HA 2RCSH 1FE8H 2P8PA 3RHWF 4PS4L 5JR1H 4X0KA 1RK0A 2DYPD 5BV7C 4OGYL 4S0TD 2JELL 4LIQH 4DKFL 2GUOB 1BHGA 2KKQA 4XBEH 3RTQB 3PWUB 5GZOD 3CZJA 4I3SH 4BK4A 1A1MA 3MNZA 4GG6F 5DQJA 4M93C 5DGQA 3ARGB 3E8UL 4Y2OA 3VCLB 4JG0L 3WKNA 5IMLA 2D7TH 4DEPB 2YD1A 4QXTB 4Y19E 5BCAA 3LPWA 3MV7D 1KTDA 3K2UH 2BOBA 1ZWIB 4X4XA 5GSVB 1AKJD 3GSNL 2BOCA 1ZLVH 3RIAF 1A7NH 1IC5L 2VXVH 2GY5A 1A5FH 2NR6C 1EHLL 4HXAL 3ARPA 3ALWA 1TJGL 1NMCB 1X5XA 5I6XC 2VE6B 3ALXA 1W0WB 4FQHB 4JO2H 2W9DL 2OQJB 3OKNA 4BQ6A 2BSRA 2OL3A 3IJHB 4MA3A 4Y16C 1IAIH 1B6DA 2EE2A 4RQQB 3UC0L 3V8OA 3GSNB 3RBSA 4PB9L 4OQTH 1ZHNA 5KBNC 5FOBA 4AEHH 3ZSSA 5C0ND 2ICWI 1D9KC 3GI8H 5A2JH 5C70A 3HHRB 1DQML 1NC2A 5CZKA 1MLCB 3MJ9H 4U6YB 4KTYA 4ZFFA 3X12B 4OUUA 5DWUH 1D6EB 4YHPB 3STZA 2VXQH 3D39B 4HT1H 3B6SA 4H88H 5INDB 2QQQA 3NFSL 3DV6B 4C56E 2GCYB 1ZANL 5BJTB 1JYWA 3ZDXE 3TIEB 2F54D 2GYSA 4GAJL 4I1NB 4OLZH 3NIGF 4X7EC 4X5XA 1NEZG 3N1PC 1JNLH 1JCKA 2WBJC 5DTFA 2XA3A 2IAMD 4AM0B 3J8F7 3RWGA 5ID1A 2UWEF 2IAND 1Z2KA 4CVWA 1UQSA 3L9RA 4HGMA 1UEMA 1AO7E 1WUNT 3WUWG 3AXLB 3AY4A 2FX9L 2CPCA 4LLDA 3GSUA 3NGBC 2PN5A 4JFED 4PJ8C 4PG9A 2EXYC 2VDKH 2COQA 3QIUC 2VKWA 1YEDA 4IS6B 4X7SL 3C8DA 3LHPL 5GISH 4WI2A 3GSXA 4YHOL 3RWFA 5IT2H 1A9EA 2PO6B 4TSAL 4HUMB 2JCCE 5TE4H 1JPGA 3P2TA 4S1RH 5D5MB 1YECH 1YZZA 4N9OB 5JHLL 4PRIA 1GIGH 1FNLA 3WNLA 4JRYD 1AFVL 4NRZB 3F7YB 3BP7B 4E9LA 1KT2A 2JKXA 4LL9A 3SDAC 1RZ8A 2BNRB 3LEYH 4HAGA 2IBZY 1U8NB 2NW3A 2X41A 4LPTA 1BQHG 1VEPA 4ODVH 4OZIF 1JTOA 4IDJL 4G6AC 4GSDH 4UAOB 1XIWA 1M1SA 1DCLA 1RZ7L 3GBNH 1Z0NA 3KPMA 2UZIH 2NX5B 1RY7B 2Z91A 3Q1SL 5GIRB 4PREB 1AGEA 2P45B 1ZXQA 1AHWC 1IEAB 4NT6A 4YGVA 4HWZB 1FYTE 5CEYB 3ZE1F 1GGBL 5F7HA 1LGVA 2EDYA 1HKFA 4WI9A 4OZHE 4KPHH 3MNWA 2QV2A 2UY6A 1JI1A 4U49A 4PLNC 5CUSH 4PJBE 4XNXL 1OTUD 4M3JA 4PGDB 1I7UB 1DSFL 1M7IB 2H26A 4JFDB 4JM2A 4LHQB 1YMMB 1N6QL 2NY1C 4L9LB 1D5IH 4U1MB 1NCNA 4LHUB 4JFPA 5F1IA 3M17A 1F4YL 2H45A 3HE6B 4NGHH 3D9AL 3NA4A 3D85D 3MRCA 1EBAA 3PWPB 4ZXBB 4YO0A 5C8JA 5T5NG 1FGVL 3RX8A 3D5OF 3U0TB 4IMKA 4JDTL 2IFGA 4PV8B 3U0WH 1OPGL 4ELMB 5GGTA 3ARED 3VFGL 1I1FA 4UOJA 1UB6A 3MRDB 1PEWA 1VACB 2ZJSH 3QRGL 1JHLL 1CICD 5IB5B 1MCCA 3QHFH 4ERSL 1LEKB 3I2CL 4ONGH 4H26A 3ZSTA 1S9XA 5E7FA 3QI9B 3QWQB 1IAIM 5GGRB 2B2XH 4L8CB 1QRNE 5BS0A 4EN3B 1UZ8A 1VFUA 1MLBB 3RPIB 3ULUE 3BPNC 3UTPD 3EDJA 4Y88A 3B43A 4A2MA 4I2XA 1UKTA 2YD5A 3K46A 5E00A 3SKNB 4JFXB 2APFA 3V79C 1E4WL 4YLQT 3HCVA 5HHXH 4ZTPL 1AGBB 3I02B 1SM3L 3DXAB 5K9JH 2GK0A 1D5XA 5C08E 1MI5A 3UO1L 5H94B 2RFXA 4JJ5B 4O2EA 4NZRL 2PYEE 3GDBA 3FZUD 2F58H 4L1DA 5DA0B 5JQ6L 3L5HA 1F11A 3FQRA 5F97E 4TRPH 4HQQL 4N0YL 5TDOB 4QT5A 3RZCB 1FL5B 1NGZA 5I1JH 5HGAA 3VD9A 2PETA 3DHMA 4NNPH 3CFEB 5LGJA 2XXMB 4WJ5A 2XWTB 4OD1H 1KXQE 1YJDC 4KH2A 2IQ9L 2VLRD 3UP1A 3WNOA 3ET9F 3EO9L 3BZEA 2P47B 4MS8C 5E5MA 2AJUL 1A6UH 2V5MA 5IGXH 3C9NB 4X98A 1JZ7A 4CGTA 1VB9A 4HC1A 1ZA6B 1K6QH 4C83B 4LIQE 3IRPX 1FZMB 1LEGB 5L2KD 5D1QC 3VGBA 5GGVY 1ED3A 5JTWA 2DWDB 1NBZB 4R9HA 5DHXB 4IRJC 4XP9L 2E5EA 2VXSL 4Y2DB 5TDPB 1R5WA 4J3TA 2EICA 3O41A 4RGNE 3RDTC 4XP4H 4LCUA 5IOPA 5F9AC 4WO4D 3MRBB 1NMAH 2DMBA 4KTDL 4CKVX 1MHCB 1A02N 3V4UH 4KVCL 1C5BL 4R2GB 4CVZB 1EX0A 4W4OC 3EYUH 1AH1A 1ZVHA 4DN3H 35C8H 4PPTA 4WFHD 1HSBA 4POUB 4ALAH 5HHOD 1XH3B 1T4KA 3H9SD 1YPZE 4HSQA 4EI5C 4OTXL 2ZPKL 2NXYC 4JN1H 2EEBA 3W0WD 4GAGL 5E2UH 1J1OL 4TN9A 5SX5K 4YDKL 2F5BL 1HHGA 3BN9C 3V6OA 3S37X 4YC2B 3U4BH 4NJAH 5JW4N 3ZMRA 1T21A 4MVBD 1JGVL 5F1NA 5JW3L 1JN6B 2IFFH 3GKWH 4TOYL 4FQPA 4QRPE 1BD2B 2MKWA 3GJEB 4P4KA 5ALBL 4MX7A 4L8SC 3CUPA 4PJFE 3IDIB 5SWQA 2FD6H 4NN7B 1A4JB 4ZAKC 4JFFB 4LCCB 4DGIL 4DGVL 2EDDA 1NLBH 2HN7B 4GBXC 3GSWB 4KRPC 4G8FB 5IJVB 3OR7B 4HBCH 4R0LC 4N1EA 3BEVB 2EDOA 1U8HB 1AP2B 2QJDA 1DQQB 3L95A 1M7DB 3EFFA 4R7NA 3OAUL 2A9ML 4PFEA 2W38A 2AEIT 1Z5LB 3MBEC 3R8QA 3BP4A 3BESR 4OCYH 3WFHB 1FORH 3S4SG 1BZ7B 1CD9B 2AJSH 2KH2B 3CDYA 3OR6B 1Q1JH 1PSKL 3KLAB 1VHPA 3RWDA 3KYNA 4XX1E 4PRDB 4Z7WF 3VXRD 4MA8H 4HWEH 5D7IE 1N5YH 2XNAB 4OF0A 4JZJC 1URLA 3HZYB 3MV8E 1K4CA 3CX2A 2HRLA 4RBPH 1KEMH 4NN6B 3BP6A 4U6VL 4XB7A 2E3VA 1Q9OA 3KLHD 1W8OA 4JLRA 2OI9B 2P8PB 3O3AA 2NYYD 4LRNH 3VG0H 5IHZB 4X0KB 1RK0B 5J8OA 4WI5A 3OJ2C 3MJ8A 1KGCD 1SEBA 3S3PA 1ULVA 1PY4A 4JFYA 2JIXA 4FTVE 1OAUL 4YHML 2FBJH 3RY6A 4RNRB 5GQBA 3GMMA 1A1MB 3FQNA 3MNZB 4OF3A 3ZKNC 5DQJB 2Q87A 5E08H 5D7KE 5TGBA 4ZUSA 1MFBL 4I0CC 5IMLB 3U30C 2XN9A 1RUKH 3KPQA 1DEEA 1KTDB 2PUQT 2BOBB 3QCVL 4X8JA 4X4XB 1U9KA 4M5YL 4UB0L 2OL3L 1QTYT 4JG1L 3GHBL 4MA7H 4AL8L 2BOCB 3NIDF 3B5TA 1S5IH 4CBPA 2JCCA 4LHJB 3ALPA 3WDHA 5D7LA 5J11C 3BIKA 1IT9L 4F37F 5IWLC 2HLFC 5DUPH 3OKNB 7CGTA 1Q0YH 1GJIA 1IMHC 2YS4A 2BSRB 2OL3B 4MA3B 3QUYA 1J8HA 4R90L 4HMCA 5DQDL 1ZHNB 2H9GA 4PP1C 5FHBL 5FOBB 2VAAA 1NC2B 4ZFFB 4XNYL 1G7LA 4OUUB 4GFTB 4BQ8A 5L2JA 3DX8A 4Z0BH 3STZB 5A2IH 2G60L 3B6SB 2YMXH 3WJLC 4M62L 1DN2A 3NOIA 5CJ5A 1WWBX 1FYTA 3L7EA 3QUKA 4PRNA 3B2VL 4P9ML 1LNUA 1KIPA 4OZHA 3WLBA 5JXEA 4X5XB 43CAA 5AYUH 2BJML 5EA0H 3ULVL 2CUHA 1JGLL 1H8OA 2ZUWA 3INUL 5DTFB 1A64A 2Q3AA 4RWYL 3RWGB 3V7MA 1UQSB 3L9RB 4DOHB 1RI8A 3D2UD 5HI4D 2Q8AH 4KU1A 3TZVA 1MFAH 4LLDB 3GSUB 4YWGL 4M6OL 4HIHA 2YA1A 5DO2D 3F8UB 4PG9B 4RX4A 3TJHD 2BERA 4LSTL 3ZDZE 1OF2A 5ADOL 2BDNL 2Y06L 4OLUL 4FS0A 1QEWA 3RWFB 1DUYA 1A9EB 4FG6C 4Z77A 2OSLB 5BOPA 3MODL 1JPGB 4YQXH 5CD5D 3UJJH 1DANU 5SWSE 4PRIB 2VH5H 3C5SA 1EV2E 4MSWA 1MCPL 2VISA 2BY0A 1H3TA 3L3IA 4U3HA 1KT2B 2EKSA 1OAQH 4BSJA 3K4AA 4ZTOH 1RZ8B 2NW3B 2YC1A 4O51A 3BKJL 5DFTA 3MRLA 4XCCL 5HHQA 4NHCH 4LSPH 1XIWB 3HR6A 5JOPE 3WNPA 4MJ6A 4JGJA 3T65A 4NO0A 3KPMB 1JP5A 2Z91B 3V5DA 5F21B 3RVUD 4Q9QL 1AGEB 1CXKA 4HULB 4OZFA 2BRQA 5C08A 5GJSL 4NT6B 4YGVB 4MHHG 1HQ4A 1MFNA 2UWEE 4OQ1A 3CXHJ 4ZQKA 3N1QC 4KC3B 4PGJA 2NY4C 3WKMH 4BA8A 4N0UA 2Y72A 3IDYC 1G7HA 5GRUH 4WTWA 5LXGH 3MNWB 1A3RL 1VFOA 4LKXA 5F8RC 2WANA 2BRRL 4HFWA 2QEJA 2EC9U 4TVPH 2H26B 4JM2B 1YYMH 3TT1L 5F1IB 1T80A 4JFPB 5GGTL 3L3KA 3M17B 4JVWA 5E9DE 3BMWA 4PJ9A 4MLSA 3UBXI 4YO0B 1INEL 5C8JB 5D7SL 4CJ1A 4ZOAA 4PJDB 2F19H 2V5YA 1FH5L 2YD7A 4EIZC 1HH9A 4KK6D 2DDQH 4O9HL 1I1FB 1UYWH 1UB6B 4LMQI 4BZYA 4OZIE 4MD4A 4Y4HD 5K93A 4I3GA 3I3DA 4XVJL 5IB2A 4Z95H 4H26B 3BH9A 1S9XB 2NY5H 5F7KC 5IVXF 2FEEL 3SKJL 3ZKMC 4DJMA 3FN3A 1Y0LA 1UZ8B 3K8KA 3RTQD 1W0VA 4NKIH 1T66D 1NCWL 2VZTA 2VDRH 4JPVH 3ZE1E 4I2XB 5E00B 5E1HB 3VRJA 3U9UA 4FOMA 3HCVB 1H5BA 5DGRA 2DQHH 3ARGD 1VFAA 4Q9CA 2GK0B 1D5XB 4LU5H 5E8PA 1R3IL 1MI5B 1U2CA 2RFXB 3MOBL 4O2EB 3O6ML 6FABH 3UTZA 2KL6A 3H42L 2HKHH 4LSSL 1XFPA 3B5HA 5LCVL 1F11B 3FQRB 3HNVH 1OM3H 4HBQA 4YHZH 1Z9OA 2ARJA 3DVFA 4EZMA 4DKDC 2HT2C 1L7TH 2FHBA 4QT5B 1P4BH 5CZVH 1YPZA 3V0WL 1NGZB 3TM6A 5HGAB 5LGJB 5E6ID 4IMLA 2Y25A 4WJ5B 3LN5A 4B7IA 4HC1L 5EORL 4OQTA 1JMXA 2R9HD 2OK0L 3LS4H 3DETC 1ACYL 3BZEB 4M6NL 3MJ9A 4XAWL 2CMRH 5E5MB 2W92A 5I74C 4Y8AA 3VXOA 2HT3D 5T3XL 1S7WA 3TA3D 4PJFA 4X98B 3CGTA 3OZ9L 3D39D 2XKSA 5B3JE 5TQ0L 4K3EL 4RFNC 4JM4H 1ED3B 4JGMA 3BGAA 4HGKC 4LGRB 4Z7VF 1JVKA 1B0GA 1LO2L 4R4FH 1R5WB 5J3HC 4RFOL 4MNQB 1JHTA 4RSVA 3O41B 2H2PC 1I3UA 4JR9H 5IOPB 4I13B 3QAZC 2R8SL 4TUKL 2DQGL 3VWJA 5GS1C 1F2XK 1YN6A 2O61A 5D7IA 5J7CC 2PO6D 5E2VH 1HSBB 1FAIH 3O8XA 3H7BA 1TQCC 5ICZA 3CDCA 5CBAB 1OTSD 1T4KB 3S7GA 4V1DE 2ENSA 5EUOF 1NUDA 5HVGB 1HHGB 2VLKA 4IBLT 1F45A 1CBVL 1T21B 2BNRD 5F1NB 4EOWL 3LPFA 3VA2C 1AGDA 3TGXA 3TH3T 2H2SC 2NW2A 1I1CA 3G5XA 4FN0A 4P4KB 5HVHB 3O3UN 3FB8A 3LDBC 3CUPB 4MX7B 5I1EH 5SWQB 1JWUA 3U6RA 4GKZA 1BPVA 4UBDC 4GRLD 5KVGL 2ERJB 4G9FE 2APXA 4ZYKA 1KIUA 1ZHBA 1WIOA 1I7ZA 1CFSA 4RMUA 5MP6L 3VWKA 4N90E 2ESVE 3TO4A 3T0EC 4MMZC 2V2TA 1EMTL 3RGVA 3SGDH 15C8L 3L1OH 3L95B 5ITFA 5TPWL 3ZDYF 4YHYB 1MCQA 3EFFB 1L4IA 4R7NB 4Z0XA 2ZG2A 2CK0L 5DEFA 1QYGL 1QZ1A 5DFWH 3WN5C 3BP4B 5JORA 4Y5XC 5C0AE 2K1MA 4YAQA 5EU7E 5FGSA 4LHUD 3HE6D 4HCRH 1FSKC 1L7IH 1HHIA 5J06A 1ES0A 1ZKAA 2W9EH 3RWDB 2LV4A 3KYNB 2IBBA 3PWPD 4ZXBD 3L3JA 1LE5A 4UDUA 2YPKA 4J3VA 1MFEH 4PJEF 4A6YH 1CLYL 3S36X 1WQVT 4WNQA 4KUCF 2BVQA 2AK4D 1BIIA 1Q9OB 1U36A 4JLRB 3KPRB 2VC2H 1E4JA 3CXDH 2W9LA 2VMFA 2FDBP 3O3AB 2BNUA 4PY8J 1A0QH 3VGFA 1JPSL 3QI9D 3MJ8B 1M4KA 1PEZA 1SEBB 1P4IL 4OSUL 1RHFA 4JFYB 2JIXB 3HR5A 2XI9A 3FO2A 3GMMB 3JSSA 1CFNA 3FQNB 5D7JC 4UTAH 3HG1A 1ACZA 5DFVD 4XP1L 2NY0C 4LLQA 3DXAD 4ZD3L 3FFCA 5TGBB 4ZUSB 1F6LL 2XN9B 4G42A 3KPQB 1DEEB 3FT4A 2QLVB 4X8JB 3EHBD 5IBLD 2FJHA 2MFNA 3ECBA 2BSSA 4P23C 3CPLB 2C4FT 5HHVH 1J10A 4GXVH 2JCCB 4M8QA 4Z7WE 5D7LB 3BIKB 5HGDA 3RZCD 4Q74A 5DMIL 4X80L 3L3GA 4MLIA 1CGSL 3DX6A 4PBWD 2AJXH 3PQYA 2FX8L 2VUYA 3JVGC 1F2QA 5K33A 3QUYB 1J8HB 4OCWL 4NBZB 4BH7A 3CXHK 5BO1L 2H9GB 1MEXH 4HZLB 5JW4R 1A14H 3QIBA 2VAAB 4MQ7A 4NKDA 4LNVA 2CLZA 4MB5A 1FO0H 1XR9B 1G7LB 5L2JB 3DX8B 4X9FA 4D9QD 1PW3A 1S9YA 4JPKL 3OKDA 1VADA 1GC1L 2M1KA 5I73C 3HC3H 1FYTB