5D70H

Crystal structure of mor03929, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
216
structure length
212
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSGISYSGSETYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGFGTDFWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of in vitro affinity maturation and functional evolution of a neutralizing anti-human GM-CSF antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Granulocyte-macrophage colony-stimulating factor
total genus 45
structure length 212
sequence length 216
ec nomenclature
pdb deposition date 2015-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d70H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d70H01
5GPRA 1MJUL 4E5XA 4HUXA 4ZDHB 2BXZA 2MOVA 5CWSA 4B7LA 5F6IB 4APQD 1F11A 1CR9L 2XNAA 5HGDB 3UYRL 3OXSB 1JRHH 4HKBA 1TETH 1DL7H 1TJHH 4Z7NF 3SDYH 1P2CA 4XPBH 1ZHBA 4IIQC 5CIPB 5AG9A 3TVMB 1G9NL 1YC7A 2Z4QB 3MLXL 3LKOA 1BAFH 3VG0H 5BOZG 2HG5A 1RVFH 5DA4A 2BVYA 3O41B 2R15A 1PYWA 1IT9H 4RFNB 1BBDH 3L3KB 4G6MH 4OGYL 1G7MA 2N7BA 1K4DB 3FHAA 4D0CA 2C5DC 5D7IB 4MA3B 2V7NA 1JFQH 1I3RB 1AQDB 5D5MB 4N0UA 3BZ4A 3ULUL 1UJTA 3MR9A 5JXAH 4R4BB 8FABB 1HSBB 2VOTA 5SWZE 4YDIL 5HPMB 2AJVL 1LEGB 2DJUA 3FTGB 2E27L 3HRZB 1DE4A 1WAAF 1BBDL 1KCSH 3EYUL 3EYOA 2V7HB 4Q2ZA 3DETD 4UINH 1UM6L 5EPMB 2QHLA 3C87A 1G6VK 5I0ZA 4ZD3H 5CGYD 4XAWH 1NMAL 5BZDA 5HYQA 2C4FT 4U1GB 1OY3B 1YMMA 2GJJA 4ODVH 3D9AH 1RI8A 3O8XB 3QDGB 4M1CC 5HPOA 1I9JH 5IVXE 2WINA 5FK9A 1A6WL 4KY1H 5CEXA 4LCIL 1AC6A 4XH2A 5FGSA 3BZEA 1EAPB 3BPOC 8CGTA 1F6AB 3G9VA 4WJ5B 4QRRD 3VCLB 2DKMA 1MAJA 1NGZB 1UEYA 2VKXA 1U95B 2BRRL 4NZJA 2XACC 1J1OH 1OAQL 3LSOB 4GLRI 4XI5C 5JHDD 3VFNA 2AV1B 4R7NA 1EH9A 4JO1L 3MRGA 1N6UA 4G8GA 4R97B 1WT5C 3VGHA 2I60H 3WUWA 5IHBA 4J6RH 2I5YL 3GMPA 1HH6B 4R2GB 4RFOH 1MFAH 1R24B 2KKQA 1UCBL 3C09C 2P47B 4M3KB 5CJOL 1G7IA 2ESVE 1F6LL 2W60A 5I19L 1KN4L 1PAMA 4FTVA 3UEZA 2J8UA 4Z7VF 3X11B 1HXYB 3PWUB 3GKWL 5J13B 3DGGB 4X6BA 4V2BA 4KTDL 4RISH 4W4OC 4PJ9C 5D70L 4AG4H 4L8BA 1WIPA 1Q38A 5C08B 2ZWLT 4OD3H 4NQCA 5C0AE 4DGVH 5ICXB 1NFDB 5I1CL 4MAUH 3S34L 1T5XA 4L8DB 2X09A 5ISZA 4RFEB 5FHBL 4F37F 4OF3A 3QI9B 5AUMB 3ULUF 5E6YA 2GIYA 1NUFA 1KN4H 3QULA 1NGWB 3HC4L 5GRWA 4Y88A 3HNVH 4JFXB 2R39A 4YNYB 5GIRB 4MNGE 1V3JA 2IBGA 3MJ9L 3U9PL 1FH5L 5I1HL 4LEXL 4TTGA 1HIML 3SY0B 3VA2C 4KROC 4M6OL 3OG4B 4Y4FA 1S7TA 4QHNA 4HH9B 5J57B 1UJ3A 1RJLA 2VR4A 1BJ1J 5EBLB 3JWDL 1EJ6A 1U8MB 1GOFA 5F9AC 4P2YA 1WIUA 1ZMYA 3ARFB 2GTWB 1DQML 2P24B 2ZKHH 4NBXB 3EOBA 4Y16B 5TE7L 1NDGB 3BKMH 2IADB 1JNLL 4G8IA 3UPRA 2V5RA 1A9EA 3ALPA 3QNXA 5F93C 5ISZD 1ZTXL 4JB9H 1R0AL 5FGBC 4JANB 2FWOB 1A21A 2SEBB 4KZDL 1XGYL 1QR1B 1MWAA 4Y1AB 4WHYG 2CKBB 4XPAH 4M6OH 1CLZH 3WNNA 1RZJL 4OIIH 4DVRH 1ZHLB 2VZSA 1H3WM 3BPNC 4E42B 2X4QA 4MVBD 2J7LA 4MWFB 3D0VA 1YJDH 2GJ6D 2NXZB 3G08B 3QT2A 4GAYA 3U7YH 2W9DH 1YY9C 3O4OB 1IAIM 4AT6B 4MQSB 1NC2B 2VLJB 5FXCH 3RY6C 1PEZA 4JG0H 1OGAB 2QTEA 1BQSA 4NQXA 3AREB 4E0RA 4KMTH 4RRPG 2NZIA 4TUKL 1MCWM 4I2XB 2OYPA 1VFMA 4JRXD 1BJMA 2ZUSA 3HTLX 4WU5B 2NCMA 3HFMH 1TVBA 1B4RA 5DLML 4RRPA 4IHOB 2BHYA 5IR1B 1A7PH 3QXAB 1OTUC 4ZNEA 4K7FB 4N90D 1HI6B 4PRPD 5C08A 5LBSL 2BC4A 2DM4A 4PJ7B 3P4OA 3U0WH 1DBJH 1YY9D 3P4NB 5DMIH 4GBXB 5A2KH 5CCKL 1F3DJ 3MNWB 1MJ8H 5FGRA 2VE6A 1LMKA 4N9OB 3O4LB 4M6ML 4EDXA 1UB6A 4IRZH 4U0RC 3BQUA 1S7VA 3QI9D 3GMMB 3IJSB 5I71C 3MV11 3QUXC 1VFBA 5JHLH 4LHUA 2APBA 4X4YA 4OZHB 1NCDL 3I3EA 1P6FA 4M7ZB 2QSVA 5FM5O 1MVFA 2R0ZL 3OJDA 3ELAT 1KC5L 3RUGE 1JTPA 1MCPL 4V2CB 1EFQA 1W0YT 3Q1SH 4IRJD 1K4CB 4O2CB 5D7JB 3D9AL 4CGTA 4PJBA 1OTTC 1A2YA 2UWEA 2FX8L 5IB5B 2F8OA 1DBAH 3SN6N 4FRWA 1MHCB 1YYMH 3HUJE 5BVJA 2MPAH 5BV7L 4TVSa 1A5FH 1MIEH 1UH2A 3HAEB 5IM7A 1SEQL 3ALXA 4LKCB 5EH1A 1LEKB 3D25A 1YEIH 1GC1C 4PRIA 4NNYA 3L3OA 5TE4L 4Q9BA 2YPVL 2I24N 5FKAA 2Z9TA 1IZKA 1GHFH 3PWPD 5D1QD 1ZT4A 1QSZA 1SYVB 2WBJB 2Q76A 3H8NA 1J8HD 1DBAL 5FB8A 1TIUA 5HGAA 1FNEB 4XBEL 2MPAL 5BV7H 3AS0A 3MNZA 5DVOA 1P5VA 2OJEA 1DSFH 1HYRC 3OR7B 5ANME 1LDPL 3KYOA 4P9HC 3MLYH 4YDLB 1JTTA 5CJ8A 2CLZA 3LMJH 5TE4H 3RPIB 1FZKA 1Y6NR 2WBWB 4QTHA 5GS1B 4JFYB 1WWCA 1KEML 4CUCA 4EUPH 3TYFB 3SKNA 2LFGA 5HYFA 4WCYL 2J4WH 1NAMA 4AEHH 5LGHH 1BD2A 3O4LD 3C60A 1DANT 2A77H 2IQAA 5CP7A 5ALBH 4ODHL 3SDAC 1S78C 2GHWB 3VXQB 4RNRB 1OARH 1R5IB 4G9DB 2LV4A 3K4DA 5B8CC 2CQVA 2XQBH 3PXHA 3IDXL 4M93B 4NGHL 2P7TB 1KXQE 1S7UB 1HWGB 5LAXB 2R9HC 5J1AA 3T77A 2WWMD 4GAJH 9CGTA 2ZCLL 3SKUD 3UXFA 3D69B 2ATPA 3SQOL 5T1KA 3L3JB 3EHBD 1JGEA 2EDRA 5DURB 1S7QB 3E6FA 4TULH 4OZFH 1PQZA 2X1QA 2ED9A 1YDPB 3IFPA 3L1OH 4PRPA 5E5MB 2BVEA 3EO9H 2DTML 5C0CB 2HT3C 3PABB 1X5ZA 2AABL 3NVQA 1CLZL 1DLFL 5B4MD 4GMSL 2C1PB 2MJWA 3GSNL 4J6RL 5LCVL 2FH6A 3F58H 4LVHB 5EU4B 1MFAL 1WITA 1L9MA 4YDJA 3MUHL 1BZ9B 2NNAB 5TDNA 3L95B 3KPOA 1NUDA 2V2TB 2DQIL 2A6IB 4I3SL 2YD5A 3MJGX 3CXHK 4QY8A 4BYHA 4Z5RA 1Z2KA 4LCWD 4ZXBD 5CZVL 3K8LA 4DGVL 1RK0B 3ZYIA 4OBRA 4L29B 2YN5A 5CINH 4G43B 2EIBA 3OGCA 5HJ3B 3RZCC 1RZJC 5C0RH 2UYLB 5DF0A 5FHAH 1HXMB 3LKQA 4PGEB 5HY9A 1K4CA 4O2CA 4ZFOB 3S97C 1YPZB 2AK4A 1DBJL 5DMIL 1E6JH 2HKFH 4GRLB 1DBMH 3QNYA 1F90L 3MRPA 1TJIL 2NY1B 4WNQA 5A43C 4G6KH 3ZT7A 1HIMH 1HDMB 5BO1H 4GG8B 2V7NB 5E9DB 5KN5B 4YHIA 4HQQL 3QO0A 3MBEA 4YE4H 3QDGE 5EU6A 4KJWD 3CSYA 1YEHL 4OZFG 4DUVA 3ETBF 2HVJB 4LLDA 4UOW1 4RMUA 4WW2A 1B0RB 3IF1A 5EC2A 5BMFL 1J8HA 1DBKL 4K7FA 3KWWA 3BP5A 3QXWA 2C9AA 4P2RE 1SYVA 3RDTC 2BNRD 1QVOA 3L5IA 1CZ8L 4LCCA 4F80A 4C55A 3PNWB 1NC2A 3RBSA 1JWUB 1ZA3A 2B8OT 2BSRB 3MLUL 1U8NB 1QQDB 4Z7OF 3OGOE 3LKPB 4Y4FD 5DD0L 5TDPA 2XKNA 5CKGA 5KW9L 4FFVD 3AS1A 2YD1A 4HBQA 4R96B 3HAEG 2VITB 5D2NA 4Z0BH 1A02N 1T1XA 5IBLC 3WJLA 5L2KD 4Y5XC 4NFBA 3MUJA 2WM0A 3S35H 2YK1H 4XVUC 1FNGA 4G8GB 3PWVA 4L8SB 5KVDH 4ZPVB 4BFIB 5LBSH 1IEBA 2R4SL 3GHEL 3MCKB 1C8PA 5I8OL 4S11A 1P53A 4Y16A 3IS1X 2F19L 2X4UB 1HOCB 2FNBA 4LHUB 2UYLA 3MA9H 3RZCD 1P4BL 2H9GA 3QWRD 1FRGL 1T89C 4ZTPH 2XTJB 2VE6B 4Y5XA 3UPCA 4GRLD 4P59L 3CSPA 1TNMA 2E9IA 5JOEA 4Z6AT 4ODHH 1CE6A 5I1GL 2VL5A 3QNZA 3RPIA 5E5UB 1MWAH 1YUHB 1QEWB 3O6FB 1MPAH 5EZLA 4RAHA 3JXAA 1E4WL 1G7JA 1MFNA 4L1DA 3CXDL 2P46B 4OLYL 3MRFB 2W9LA 5C0EA 4JHWL 5DXWA 5H37H 3HMWH 1RD6A 1SEBA 5F3HA 3RVUD 1QFUL 1M7DB 3BUYB 5IMMA 3VH8G 4DJMA 4M61A 1UM6H 1GGYA 1UM5L 4O51A 1EV2E 2W59A 3VXRD 1TQBC 3OTTA 4NQCD 1O7VA 5AEAA 1J12A 4TVPL 3WFCL 1TLKA 3CFJA 4OZ4A 3ZYJA 1CXLA 4I13B 1E28B 4M8QB 5EU7C 3TZVD 4RA0C 2YPVH 3DNKA 1XF1A 4NPYA 3BYTA 1FO0A 3MRHB 3OL2A 2WWMC 4X8JA 3SDCD 3L3HB 4KRLB 4G8EB 1A6WH 4KY1L 3EYSL 4XMPH 3LS5L 4I2XE 4ZQKA 1N0LA 2VB5A 4NBZB 4ODTL 4JVPA 1YNTB 4BSWB 2DQGL 5AWNL 2I9LA 1IC7L 1QLEL 4XPHL 2PR4L 35C8L 1S78D 4ELKB 2H26B 2HT4C 5JOPD 4PJXE 1B0GB 1JF5A 1B6DA 3QCVL 2NX5B 3CD4A 1RUPL 4O2FA 2F53A 4LOUC 4FQ1L 2A6IA 4TSAL 2J4WL 3ESVF 4Z0XB 1KTKE 4YHYC 4YDJB 4L4TE 5F44A 4ELME 4PJ8D 5HI4C 1OAKH 2UVFA 2WUCH 3OBAA 5GGUA 3DX6B 3W9DB 3O45A 1T0MA 3DOSA 3OZ9L 5J89A 4RWHA 1S8DA 5FDWB 3TBYA 3OKLA 5SWSE 3QYCA 1KPVB 3UTOA 1KTDA 1G7HB 2XN9E 3HC4H 5CD5D 4R7DB 5F1IB 4OM1L 3KVQA 2OP4L 3RVWC 1FYTA 2O5YL 2YKLH 3TCLA 3L3GB 4PGEA 3NCYP 5HY9B 5L9DH 1GH7A 1NAKL 2Q87A 2R8SL 2PTVA 1WGOA 3MREB 3D18B 4F7CA 4K3HA 4QXWA 1IKFL 3TEUA 2DWEB 1TZGH 2EKSB 2ITDB 5E2WH 4ELMA 5CGMA 4PJBB 2GQHA 2EE2A 1CE1L 5IOPB 1F4YL 2FHFA 3T3PE 1WC7B 2BXYA 3G04A 4E41E 1H3PH 2FATH 1AXIB 5IW6A 3T0DA 1CGTA 1PX4A 4DN4L 1Q1JL 1T4KB 2PXYC 4Z7VA 3L95A 3IFNL 2ICES 3VE0B 3W2DH 4L9LA 5ISZE 4ZFFB 1JUFA 4CMHC 1LGVA 4P3DB 1JCKA 4FQIH 5DQ9A 4CN6A 3O11B 3DVNB 5GRJL 2F53E 2PXYD 4NQVA 1ACZA 5EWIL 4ZSOA 5GSVB 4YEFA 4ETYA 4C83B 1UA6H 4G43A 3QHFH 1IGIL 5FO9A 3DHJA 4XP9H 4EVNB 2CGRL 1UVQB 2IPKB 3DTXA 5GGUB 3WUWG 1D5IH 4PD4K 3OPZL 3V8OA 4FXKA 3LKRA 1GL4B 4P46D 4PV8B 1OD7A 2WUBL 1DN0B 1EK3A 4X7SL 3SDAD 3PDOA 3TT3H 1TETL 4P4RB 1KELL 4C56E 1I3GL 5E8DL 5B3JE 2FR4B 4LCWA 4ZXBA 4M7JL 1RZ8A 2FD6L 4QRPA 3GSRA 1P84J 5IQ9B 3I6LE 3HZKB 3GK8H 4MA8L 2XWTB 5HHMD 2QSTA 1QBML 1M05B 4N90E 3MYZA 4POUB 2XFXA 4U6XA 4M7KH 2DLFH 4G7VH 1HOCA 2AK4D 2OBGA 4HD9A 4PTUA 2AXGA 1K8IA 3WJJC 2X4OB 1EO5A 4WU7A 5E8PB 4PREA 4JJHA 1PW3A 5I17B 4JFDE 4FABH 3OKOA 4M7JH 1I7ZA 3KR3L 4M6AA 1WJ3A 1OP3K 3RWEB 1MCSA 4GW4B 3VWJA 5F9WC 4NKOA 4H0GA 3SGDH 4LOUD 4Z0BL 3U82B 2JK5A 5CAYB 3L7EA 3CC5B 4ZO7A 1YN6A 2VC2H 4IRSB 1MCCA 3H0TA 4KROD 5F9JB 4OGAD 4OF7A 1U8LA 4W81A 1A7BA 4FQCL 3WCYA 3ZSTA 2G2RA 3L5WA 4XP1H 1OTTD 2X7LB 5A16B 1IGFL 1CN4A 1CXHA 3OXRA 4GRWH 5D96C 2UUDK 3RRQA 3BISA 3V4VL 2XZZA 4KHTL 3GJFA 4NDMB 4U1JA 1KPVA 4BUGA 1RJZA 3V5HB 3VXMB 2R2HB 3U1SH 3CFKB 4ODXA 1QA9A 4HK0B 2DBLL 4PJ9D 5CEZD 4HUUA 4P57A 3JWOH 4M9OA 2HMID 2DICA 1BQLL 3BZ4B 1AGEB 1G1CA 1W2KT 2EYRA 1CFVL 4DKDC 1SJXA 4H8WH 2DMCA 4X7TB 4N1EA 4QRTA 3STBA 3MRCA 5E8NB 3MRPB 2X4OA 5E8PA 3WHXB 4QNPE 1URLA 5IHUL 4HC1L 2OR9L 4P2RA 1KIRB 3O45B 2YSSB 4ZPTB 4GRLC 5GGSA 4PJIA 1U42A 1AD0A 2HFFA 4GRMA 4JZNA 5J11C 4OAWA 3NFNB 2R8SH 4OQTH 3DXAD 4XH2B 3ZTJH 1ZANL 2KPNA 4KKBD 4OD3L 3TBVA 4ENEC 3LS5H 4MAUL 1UJ3C 3QJFB 1NCNA 2PO6D 2X89A 1K3IA 4PJDE 5EBMA 2A9NL 1DCLA 3C9NB 3PIQB 4MCZA 1A6PA 2X42A 1HK6A 1JMXA 4OQTA 3RVXC 5JUEH 1RJLB 5EBLA 1J8HB 4YK4B 1RZGA 3JV4B 4D0BA 3ABZA 4L4VD 4YGVA 4R0LB 4HV8A 2MSPA 3VXTA 4FQXB 3O9WD 3BP6A 4S1QH 4OQTL 4N0RA 4R26H 2VZOA 3HNTH 3IETA 1U8QA 5T3ZD 3QUMB 4KUZH 8FABA 1R6VA 4XAKD 2FECL 3VMPA 1VADB 1MCNA 5H94B 1PEWA 3MX0A 2V2WA 3S4SB 2ATPB 1JUFB 4LSPL 2MQ3A 1P4IH 5SWSB 1VGEL 3WKML 3RX7A 4RGOL 4U1NA 4HIEA 4UMGA 5DVLA 5ENWB 4KRNA 5T1LD 3QRFM 4X7SH 5IF0B 3LKOB 4UOJA 1IAKA 2D4FA 5GIRA 4YHOH 1ROWA 4HWNA 4QCIB 3TVMA 4ELMF 4OFYD 4L9DA 2UZIL 5KSVB 5A2FA 4N9GB 1F3JA 4NO2B 4CMMA 5IVXB 3MJ8B 4Z5RB 2DLFL 2JJSC 5F1IA 3OAYK 1IKFH 1QEWA 4NZDA 3BHBB 1QP1A 3QUYB 1TVHB 4Y4HD 3TESA 1IC4H 4DAGH 3HB3D 2BVTA 1RUMH 1J8KA 3VCLA 1INQA 3PWPA 1BREA 4OLVH 5AYUH 1RUKL 1EO8L 3WEXB 2DAVA 3OJVC 2BOBB 4NN5B 2GFBB 2X4TA 4XNYH 5DJCA 3O3EA 3RFZC 5L6YL 1BOYA 1I8LC 1V7ML 1JYWA 2EXWD 5MP6L 3EZJB 1QRNA 2DKSA 3SJVA 2IEPA 4AH2A 3DMMC 4QHLA 4QOKE 1M6OA 1SY6A 3MROA 3FT3A 1T5XB 1K2DB 4MX7B 4OLVL 4U33A 4XTRC 5T5NF 2OI9B 2RGSA 4WFHE 3NCYS 4LVNC 1CD0A 3IXAB 4XPTH 3B9DA 4PB0L 3LKSB 5E99H 4JFOA 1JZ2A 4HW6A 5MEPB 1Z9OA 4PP1D 4POZD 4L3EE 5GJTL 3V0WL 4ZUWA 5M7QA 2DYPA 1S7RB 3HZYA 1WQVT 3L7EB 4OZIE 5HGBB 2R1YB 4QGTA 4KXZH 3KS0J 4S1RH 2RCSL 1GXEA 2WANA 5D7SL 4PJCE 2FIRT 4DGIH 4TRPL 5LQBH 1XGTA 2BSTB 4U1HA 4MNGB 4U1JB 2AK1L 3PDOB 3QUML 4NZTL 1L7IH 3HZVA 3H9SB 3HCVB 3OKKB 4MA1B 4YPJA 1HXMA 3LKQB 3QUZC 2PYEB 3BDYL 1CR9H 4UT6H 4ODSH 3FQNB 4P59H 4JPVL 3KHOA 3TIEA 4N0FB 4RGND 4OLUH 2WMPA 1FGVL 2E8ZA 4U31A 4ZSOB 4XCYB 1QHOA 2AK1H 3BHBA 2XZCL 2Y06L 2DM2A 2EO9A 3U0PA 1LILA 2GK0B 5CZXD 4JR9L 4WGWB 3VG0L 4R7DA 2Z92A 3SJVE 1QFUH 2H41A 3MBEC 3ZDXF 2R2BA 4PLKC 4NC0B 1ETZB 4LDEB 1I1FA 2K9UA 3TBYB 4LRNL 4WEBH 4MAYA 1QFHA 1SY6H 3Q6GL 1RZKC 4DUXA 1CFSB 3VGDA 4AM0A 4OLXH 3F7RA 4PB9H 3D0LB 3AB0C 2ARJA 2XZCH 4OFKA 3AM8C 3C8KB 2N7AA 4JPIA 3T65B 3BE1L 1N59B 3WXVL 1QLRB 3NPSC 4D9QE 5ID0B 3U1SL 5KS9E 4YXKL 1QSEE 3GSVA 5JO5A 4KZEH 4S2SA 1KCSL 5CMAB 3JWOL 3KYOB 4LARL 2EYTB 3NABH 1WBXA 3JV6A 3T2PA 5B3NA 3MV9B 3RIFK 1EHAA 5DZLA 2P5WE 2E7MA 4FMKA 5K9KA 5CJQL 5HGAB 3SKJH 1S9WB 3S37H 5JORA 3WKMH 1ZVSB 5CSGA 4NWUL 4XC3L 4MNHA 1RZGB 3JV4A 4JVWA 4OZHE 3GMQA 1ZWIB 5DO2D 5F7EL 4P2CG 1ZVHA 3OKEB 4U1IA 1AXTL 5HHXL 4DZBB 4ALAH 5C0AD 1UACL 4RGMB 1CFNA 4NQVB 2DLHA 3L3DB 1LP9F 5IW1A 2JELH 4UDUB 5C0FA 3T2QA 3O2DH 1VHPA 3BJLA 1PYWB 1NC4D 2WUCL 2JJUA 2PO6C 3CCHB 3S37L 3V4PL 5DMKA 1N0XH 2P4AB 4F9PC 2GJ6A 5HHPB 3F5WA 4L4TD 3EO0B 3SE3C 5MI0B 3ZDXE 1N6QH 4JPWH 4OCRH 1T7WA 3IDMA 4P23B 3TBWA 1LO4H 2Q6WB 3QDJA 2DLEA 5CSZB 1TZIA 2JELL 2W60B 5E9DA 1HSAA 5D93C 3HC0B 4Y5YB 2VRAA 1U36A 2X89D 4ZYKB 1I9RL 1RIUL 4P4KD 3C60C 2FX9H 3N1PC 4OD1H 2COQA 3B4NA 2XN9D 3KXFD 1FNLA 4JDZA 5F7DA 3QO1B 2XWJA 4JRYD 5ACLA 4KUZL 4I9WE 1KLGA 4OCRL 1RY7B 1JNHA 1NCUA 3P77A 5KSAD 2GTZB 1LO0H 1CGSL 4R2GC 2MCG1 1MVUB 2MQCA 3X12A 2J8UE 1H3PL 4KAQL 1Q1JH 2IH3A 4H1LH 3FJTA 2ADFL 3H6JA 1RIUH 3IRPX 1K6QL 4P2QA 3RP1A 4AIZA 5CGTA 1CF8H 4G5ZH 4AH2B 3R0NA 1MFCL 2PW1B 3BP4B 3BJ91 3I75B 3GRWL 3P3YA 3T4AB 4EOWL 4NUGL 4LKCA 5E08H 2J5LC 5HTSA 1H3GA 5GRJH 5DJCB 4O4YL 2Z91A 5KVGL 4PRID 3SDYL 3RWDA 3TA3B 1JIBA 3MACL 3RTQB 4KK5C 1Q9LB 3QXTA 4CVXB 1HINL 4NQEB 5JMRA 2ADGA 3TO4B 2BDNL 3RGVC 3TO2A 3M1BB 3BKJL 2G9HB 2YZ1A 4MHHI 4HPYL 4PTTB 4WWKB 5DMKB 5CSBA 2VIRA 4RMSA 5K9JH 1FCCA 5D96B 2NXYC 5DYOB 1QRNE 3GSOB 5JNYA 1OSPL 1I8KA 2YD9A 4L9LB 5J56B 5SX4I 2E9BA 4XHJC 3V6ZA 1YMME 1ZOXA 5GHWL 3RGVB 3TZVA 1O5DT 5GGQH 5IVXA 1GJIA 3HPLB 5JPNB 1AE6L 1G6RB 1WUNT 4WI7A 4HXAL 3HI6L 4LLQB 4FS0A 5LGJB 4OI9A 3VMOA 3EYQD 4NC2B 5DS8A 5E8OB 4ZNCD 1R3LB 3X13A 3TN0B 4EI5B 1I75A 4B7IA 3DBXA 3VFMB 1KLGB 1RIVL 6FABL 2R56H 3QUXA 3PP4H 1T83A 3O0RL 3UTPD 1I3VA 5HVHC 3MRQB 2BNRA 2DQCL 2JB5L 3U0TB 4HWBA 2FR4A 3G5YA 3VJ6B 4B5EA 3WIHL 4OV5A 4N0CD 3MJ9A 1PX3A 5HHVL 5FECB 1OSZB 2PW1A 3THMH 1ZWIA 4OCXH 2Z35A 4R4NC 3G6AB 3UCRA 3VFUB 1BD2D 3EOBB 3AREC 3O4LA 4QLRA 2CJUL 5T1KD 3G5VB 1KN2L 5FYKE 5C2BH 2ZNXA 3OX8B 4AIOA 1H5BB 4N1HB 3ARXA 5GGVL 3WLBB 3C08L 4TRPH 3HRZA 3V5DB 1NQBA 2DL9A 5IESH 4HKXB 5DQ9B 4C59B 4TVPH 3R1GL 2AJ3A 1N26A 4O58L 3RAJL 1A3RL 3L9RA 1C5CH 3BGFC 4FQXC 4MD4A 3NIGF 4ZAKC 1NBQA 4JPIB 4LPVA 1V5JA 4YWGL 3WE6A 2QKIA 4OCSL 1FIGH 5DRXB 1P7QA 1BM3H 1OGAD 1IL1B 1YYML 2GYSA 2HG5B 2XICA 4OLUL 4PJ7E 4X9HA 3F12A 5AWNH 1FZJB 2FB4H 5SWZB 2XZQL 5HJ3A 5D1XD 4BSWA 4X9FA 2APTA 3K1DA 4X6FB 1JPST 4U6YB 4RX4A 1REIA 5GRUL 3UTQA 1G7LA 3EDEA 4JZOB 2V17H 3UAJC 4GUPA 2R69H 1YEFH 3D3VA 3GI8H 2G75B 1GHFL 4LLQA 4LAJH 4WI4A 4EIGB 3WXWL 5HDBF 3CX5J 4L8CA 4GW5B 2IMMA 2DMBA 2RFXB 5DJYB 3IJSA 4I4WA 1UCTA 1NFDA 1YPZA 3REVA 1RK1B 2V7HA 3ALWA 1BOGB 5AG8A 5TGBA 3N1MC 1II4E 3FB5A 3CFBA 4X6EB 4X9GA 3HE7C 3EFFB 4PRAA 3CCHA 3LPFA 3V0AC 4X0KA 3CDFA 4NQDB 3WXWH 2RAMA 2ARJQ 3UMTA 1QNZL 3CUPA 5IFHH 4XP4H 4PJHE 5BS0D 3ARRA 2O93L 2EDDA 4YO0A 3QUKA 5DMJB 1FSKB 3VXSA 5KTEH 4B41A 4RWYH 1YEKH 2PW2A 3ZL4L 1JPFA 4GAGL 4WHDA 4TQEH 1FG9C 4R3SA 1KCUL 5DRWB 3VMNA 1TDQA 2B1AL 4K23H 1A6UL 5C1MB 3TJEL 4KI5D 1DVFD 3QAZB 4L4VE 5FO8B 2QL1A 2BVPB 1RQ5A 2V9TA 4NM8L 4PRHD 2H32H 3VFGL 2IAMC 4LKXA 3FT3B 5CP3A 1MFBH 5I66B 1IKNC 5D5MA 1OWRM 3GSUA 3L3JA 4DN4H 3PWLA 3MRDB 1WC7A 3BWAB 1C5BL 4R8WL 5F8RC 2GEEA 3W2DL 4CDHA 4IRJC 2C3HA 4OZHF 1KJVB 4K07A 3TJEH 5D2LF 1QR4A 1CQKA 3H7BA 3H2WA 4Q2ZB 2VIRB 4JN1L 3F5WB 5T1DH 1CFQA 1HQRB 5DT1L 1MI5E 2B5IC 3IDGA 3CZFB 3VXUE 1B88A 1MFBL 4FTVE 3KAAA 5FDYA 3CFDB 2CGRH 4PJAB 5DMYA 3IFOB 2UWEE 2HAZA 3G5ZA 3H42L 3H9SA 5ADPH 3WL9B 5I2IA 2BERA 5EIIB 2F5AH 4BH8B 3CVHA 2BVQB 4ZO8A 4YR6A 1LO0L 1I3GH 5C6PB 3O9WB 3NA9L 4ODBD 1W72B 1I1YB 5KSUA 3W0WA 1J5OH 3NH7L 4X6EA 3E0GA 1CICC 1T5WA 4PJXB 1KB5L 2GTZA 4HKJA 1KENL 3FN3A 4OD2A 1BIIB 2FJFB 4OCLC 1CL7H 4YBQD 5JHDA 4HXBL 3VE0A 3B9KD 1P2CB 1Q9KA 3RHWK 3D3VD 5C71A 4NHUA 5HYJA 1KJ3L 5E2VH 3FQUB 2C4XA 3SKOB 1FLTX 5JTWA 5L0QB 4XPTL 3QUMA 3V95A 4J3OC 4U1MB 4RFNC 5L7XL 4HK3J 2I9LB 3EYVB 3M8OH 2VABB 5HXMA 4NRYB 3KPRD 3P73B 3IXTA 3QEQE 1QACA 2XV6B 4OFVA 3NTCH 3TJHC 4X4ZA 2WK2A 4ZS6D 5F7LB 3S6CA 4L3ED 2XYCA 1WFUA 4PY7B 3QPXL 1FCGA 4X4ME 3TYGL 1OTSD 3MBXH 4EDWL 2DM7A 3B8YA 1N64L 3MGOB 1NDMA 5I1JL 3QUYD 1IGFH 1FBIH 5L2KE 4JFEE 3HPLA 1E4XI 3QQNA 4AIXA 5E9DE 2P8MB 1DEEB 2ZOLA 5BW7A 4PJEF 2H2PD 3MLRH 4X5XB 4UV7H 4DKFL 4Z18A 1JJUA 2ICWB 2B0SL 3BOVA 3ARFA 4PIRF 4LAQH 3NBNA 2R23B 3JVGC 4CKVX 5K9QG 5FF6B 4L3CB 4PUBL 2AV7A 5LKNA 2P45B 4KJQC 3BPCA 3O8XC 1F4WL 3PWNA 4MYWB 3AU1A 3ULUH 1LO2L 1LP9B 3KHQA 4L8CB 5IB1A 3GSXB 2FX7H 3ULUD 4BM7A 3LY6A 4UDTB 1CDJA 4UV7L 3WV0A 3GIZH 1DQJB 1AH1A 2P44B 3H3PL 1NJ9B 5INDB 1R5VB 4WO4C 4KTYA 4MQTB 3AMLA 4L4TA 4WTZG 1FN4A 3NIDE 1VPOL 2VLJA 1T66D 4CU8A 4N5EC 4GAGH 5MHSD 3CH1B 4JREC 3IAGC 1L6ZA 3GSWB 4KTEL 4ODVL 1I4FA 3P4NA 3MROB 1A4KA 4LF3A 1P7QB 3O6KH 1I1AA 4K8RC 1BQHB 4JDZB 1AHWC 4TNWF 4U7MA 1PZ5A 1XGUA 1YQVH 1NMBH 4NQCE 1A8JH 4CVUA 5LWYL 3OKNA 5DGRA 3VRIA 4HHAB 4JREB 4CL7A 3X14B 3VXOA 3UDWA 4J4PA 3T4YA 1OAQH 5JUEL 1MLBB 4M1CD 1WAAA 1V3MA 5CJQH 3SKJL 3ULVF 5GS3A 4OZGF 4ORZC 4EUPB 1TJGH 4OLZL 4MQXC 3WSQL 1TQCB 1C5DA 4R0LA 4W6WB 4NCDA 2PCPA 1JK8B 1NMBL 3DETC 2YBRB 5TJWK 4HCRL 5JOPE 4JCLA 3O2DL 5EBGA 4FQQA 4Q58C 4XPHH 2HRPL 3V5KB 2X4PB 4I0PC 5D1QB 2YA0A 2QADC 4NN6C 1ULVA 3PDGA 3NGBC 4P9HH 4LFHD 2BY1A 5TQ2L 1KSRA 2QLVB 2W0KA 5FM8A 5KG9A 3DURA 5IB5A 2HFEA 2NX5A 4PJIB 1ODAA 2FZ3B 2Z93A 1A9BB 2R1WA 2A74B 2FIKA 4XPFL 3FRUB 4H26A 3NGBB 4H20H 4YHOL 3S5LA 4X7EC 4FHBD 5DDHB 1PLGL 1KPRB 3LS4L 4EN3D 3K2UH 3CFEA 4P9HL 1AD9A 1E0OB 2OL3B 4MCYB 1CZ8H 1HQ4A 1HH6A 3GMMA 1EUUA 1JPSH 2YPKA 2V2WB 3S4SA 3T04D 1BGXL 2DN7A 2IH1B 3KXFE 1J9CT 4WFGD 4M8QA 2HYMA 3CU7A 5ILTH 3PL6A 3O2VL 3DUUA 1ZS8A 2W0FA 3D39E 2OJEB 4LRIC 1RPQA 4YHYB 4H20L 4Y4KA 1ZTXH 4QEGA 2P8LB 4M02A 3LH2L 3JTTB 4P5TA 3CXHJ 3DV6B 4A6YA 2VDNH 4Y2DA 5DEGA 1CF8L 1EJOH 4UV4H 1OLZA 4XZUA 2GJ6E 1QPPA 1MEXH 2BSRA 3VI3E 1VDGA 1TVBB 4PJDA 5TDOA 4LU5H 1MCRA 2IGFH 3T4YB 4NNYB 1U41A 2DKUA 3GI9H 3T1FA 1BGXH 4E41D 2HTLD 3UBXB 3KDMB 4ZFZA 3ZYZA 2CDGB 1CE1H 4ELMB 4MNHB 3HAEA 4UAOC 1S3KL 5EBWA 4IJ3B 4OAWB 2A2QT 1TPXB 2HFGH 2DIJA 2GY5A 2H2SD 2KUTA 2QHRH 4J23A 2CKBA 4ONOA 4ZAKB 4DKFH 3GHBL 4PR5B 5L8LB 3AS2A 4OCYL 5ABDE 4OLEA 4JO3H 4GG8A 2C3WA 5DRXA 4GMTH 2OTPA 3RX5A 2EDFA 5GGRY 2F58H 4YDVB 3W0WE 2AJUL 2JJTA 5ICYB 2FEEL 4JRYB 4XBGB 1H8OA 4OCWH 4K3JL 3QH3A 1EZVX 3EO1B 1KBGL 1D5IL 4EEEA 3EW3B 2IBZX 2WNGA 2IFGA 1RIVH 4PJXA 3MRLA 1A47A 5HYIA 4PJBE 1MUJA 1Q9WA 1X4YA 3VXNA 4FFYH 3KJ4B 3ECBB 1YEDA 4ZS7L 1NFDF 2Z92B 1HI6A 4I77H 3UTTD 3FO1A 4LLYA 3LCYA 2E6PA 4M62L 4I48A 1QBMH 3B9KA 4I2XA 1RMFL 4H25B 2AK4E 4B0MM 1CFTB 3IU3A 4N8CL 1KBGH 3RTQD 3VRLF 3O6LH 1U8OA 3CFBB 2J2ZA 3QIWC 1GZQB 4HWBL 4O02L 1U8PA 2CLRB 4PBVC 3PF2A 1QLEH 3UTSB 1KULA 4JRXB 1NFIB 3K2MC 4AENA 3E1F1 5D1ZD 5GS1C 1MI5B 1INQB 1A6ZB 1U93A 3RWEA 4FFZH 4UT9H 3VG9B 4F7MA 4U1HB 1C7SA 3BE1H 1BWWA 1CG9A 5F7HA 3IFLL 1CTNA 5CHNB 3RHWF 3GSUB 3ULVD 1D5XA 1PG7X 2AJZB 1S7WA 2EDYA 5J6GA 3VFRB 4OTXH 3BEWB 3MPCA 1LP9E 5B8CB 4PRNB 1YPZF 3SDDD 2Y07H 1ZGLP 2CIIB 1QFWM 4LIQH 4OJFH 3U30C 4NT6B 4TUOA 5I1LB 3B9EA 2D7PA 3D1MC 2I25N 1R3HB 4KKCC 2YD7A 2R69L 2MCPH 3LHPH 3MJ7A 5BS0A 2OSLA 3IFLH 5EN2B 2FEDC 3GJFB 5IROC 3KPLA 2DI8A 1AXTH 1T22B 4LLMB 5T5FL 1SVZA 3BT2H 5EOTB 3GIVA 1PJ9A 3U4AA 4Z8FL 4Z9KB 4MQ7A 3WFEL 2CMRH 4F15B 1L7TL 1IC5H 4K7PH 4R4FL 1EXUB 5DZOA 3MZGB 1XR8A 1X6LA 4DUWA 3F7PC 1S8DB 5FDWA 3QEQA 3OKDB 4DWHA 4QRUB 5C9JA 5FA4B 3ARDC 4JJ5A 3LOWA 3AVEA 5C07D 1V8HA 2VLKE 1TVHA 4NKOB 2ERJC 4GS7B 3LD8B 5FCUH 4HMEA 3ARDB 4YFDB 3MXWH 2D0FA 5HYEA 2ILLA 1S9XB 1TJGL 1KCUH 1KJ2B 4ZYKA 1EEUA 4GS7C 3S8WA 4KKAC 1Z9SA 4HS8L 3GKWH 1WISA 4OCMC 2EZ0D 4IMLA 1CGWA 4APQC 4P9MH 3CVHH 3CVIH 5D71H 2AV1A 4FQ2H 4R7NB 1OCWH 2NY6C 4P5MB 4YQXH 2ZUTA 4CJ1A 4O5LL 5CFHA 3VFGH 1FJ1B 3GB7A 3KPMB 2DWEA 3BUYA 3N85H 4Y1AA 4KHXH 3ULSB 1JWUA 1ZA3B 1RFDL 1EHLH 4PS4H 5IHZB 2DQDL 1RZKH 3NCMA 4MXVF 3QIUC 4ERSH 3MRFA 5ANMB 3ARVA 3BFOA 5CEZL 5GRXG 4BFIA 1MFCH 1EVTC 5J11B 1ZGLA 1HEZA 5C92A 1AIFB 3BMWA 2BY0A 4YZFF 4O4YH 5CGYC 4XPFH 4WWKA 3MLTB 5EPMA 1JYNA 3A6BL 2W9EH 4OV6F 3DURB 5DD1H 3QRGL 3PV7A 3RDTB 1MRDH 4GG6B 5DQDH 1I85C 2NX5D 2BNRE 5KJRH 4IMKA 4XB7A 5EG6C 3WKNA 4MJ5B 3MOBL 1VGEH 3QXAA 5T33L 3VXUD 5D1ZA 3MYJB 1OSPH 32C2B 4YDVA 5ESQA 3KPOB 4N0UB 1F97A 3LN4A 1P84K 5KANG 5T3XE 5I1AB 1FG2B 4Q6IC 2KH2B 5TE6H 2DTSA 5KANI 1JHKH 2IPTL 4F58H 1DBBL 2CDEA 3FFCD 3K46A 3E3QC 3QDHA 2VH5L 4FQPA 3VFMA 2GUOA 4I3RH 1JNHB 2JF1A 4DQOH 2EKSA 1NBZB 2I07B 3ARFD 4JKPL 4LSDA 2VNCA 4GKOA 4KK6D 2NY3D 3H9HA 3RWCA 2BVOA 3O6ML 2ZUYA 4A6YH 1BJ8A 5EC1B 4HWEL 1TMCB 1A7QH 3QUYA 4DZ8B 3BN9D 4P46A 3QEHB 4QF1A 5IV2A 4BZ1L 3MXVL 3T3PF 4WNQB 5DLMH 1E6OL 1GCFA 3L6FA 1G0YR 3QDJB 1UB5B 3OKOB 4YX2H 5ANMA 2WZPD 4D3CH 4FFZL 3SBWA 1OTSC 3F6LA 1GGBL 5E03A 3RBGA 4JY6B 3SDDA 1VEOA 2UWEF 3BVNB 2FJFA 5DUBA 4Y4KD 3RL1B 2VLJD 1FNSL 4NWTH 4AK1A 1FVDB 1BVLB 3P9MA 1NGPL 4FFVC 4K55A 2IF7A 4Y2DD 4QHNB 3W39B 3MBXL 1E4XL 2GCYA 1HYSC 5JW5B 2XZAH 4M5YL 2W91A 4WI6A 5INCB 2R2HA 2EICA 4XWGL 1WVZA 4GOSA 2NYYC 2PTTA 1C5CL 1XIWA 1FRGH 1TQCC 2IALA 2D7OA 3RDTD 1CGXA 3UZVB 1KIQB 1M7IB 3VXRE 5I15L 4L8BB 1MJJA 4HCRA 2Q76B 2X4NA 3GMLA 4S0TD 4LHJB 3X11A 4XMKL 4C83A 2B4CH 4LVNB 4BQBA 3OR6B 3RUGA 4JN2A 1IQDB 2VERN 3SGKC 1CL7I 1T0NA 3UTSE 4HIHA 3OAYH 5F9OH 5JQHC 1M1SA 1FNGB 3BAEL 3VWJB 25C8H 4DZ8A 3RI5K 2VDRL 1UM5H 2ID5A 4QF1B 5IV2B 2EDBA 3L3IB 5D7JD 1A6ZA 1OHQA 2Q6WA 1MREL 4Y5VA 5IMLA 1TZHB 2LTQB 5E4EC 3WFCH 3TPUA 1QKZL 4ZOEA 3NZ8A 2HMIC 3VXQA 5DD6A 2BX5A 2Y6SC 2QKIB 1R3JA 2P5WD 4MJIB 4RMVA 5KSBF 2L0DA 3EYSH 4QXUL 4LHQB 2XPGA 1U8KA 4PJEE 3ARBC 1NANH 4P4KA 3L9RB 4HWZB 3U6RA 3BPNB 2V5YA 3O6FA 1LEIA 4LSPH 4G8GE 3NCFB 4LLVA 2NXZC 3K80A 2FGWL 2WBJD 4RAVA 4G6ML 5D6CB 2DB8A 1KIPA 4EDXB 1VGKA 4ERSL 5CEZH 3QIWA 5DUPH 1MFDL 1I1RA 4K71B 4W4NA 4Y2DB 2CRYA 1NCAH 2IAND 2HP4A 1FL3A 4WW1A 4JLRB 5EZIL 4FP8H 3IFPB 1CS6A 1WFOA 2CR6A 3S96B 1I7RB 3FQXB 1UXSA 2XQBL 2OTWB 4X5WB 4X9BA 3IDXH 3DHMA 1XR8B 4NGHH 5DRNB 5HYJE 4XPGH 2EYTA 2I9TA 3CDGB 1JPTL 2P43B 3MCLL 1HEZB 3PQYD 3WHE0 3MRKB 1W0WA 2EEBA 4GW5A 2FHBA 3HMXA 2VUYA 4H0HB 5IHZA 1FP5A 1VENA 5JMOC 2ZSVB 3IDGB 3VGAC 3HHRB 1A14H 3C6LA 4HF5H 4OT1L 2EKJA 5E24E 5HHOE 2VZVA 3HMXL 4XP5L 4Y19D 5GQBA 4H1LG 4R90H 1DLFH 3WLWC 2C7UA 4WUUA 2NW2A 3KPSE 5AD0B 4L1HA 4G6FB 1KJ2A 3CZJA 3F12B 5JW3H 2Y36H 2D7QA 1NAKH 5GS0C 3V4PH 1RZFH 4HKBB 1J1OL 5F71A 4DGYL 5JXEA 4F33B 4JQVA 5H35B 3BKYL 3UJTH 5CZVH 3ARGB 5J8OA 5DUML 5E94B 4JZJA 3MV9E 4JZJC 3C5SA 4LNVA 5EO0B 2F74A 1U92B 4MJIA 3T0AA 2NYYD 5DJZB 4X6CA 2HVJA 4RFOL 1I1CA 2VL4A 4J3TA 1VFUA 1U8PB 2J6EL 2CKBL 5K33A 2AJYL 1U8JB 1SJHB 2BOCB 4FG6D 1KYOK 1CLOL 3SE8H 3VFUA 4OFYA 1XR9A 1IQWL 1QPXA 1DBML 1U8OB 5TQ0H 3FQUA 3GZKA 2NY0C 3OAZH 4I5BB 4P4RA 2YUWA 4Q7DA 3X3FL 1KPUB 5CEYB 4Y4KC 4BFBD 5DD1L 2NR6C 4ACPA 5TPWH 1WZKA 5KJRL 1S7RA 1E4JA 5EIQA 1FVEA 1B2WL 1I3UA 1H15A 2MHAB 3QFDA 2ADFH 4R2GD 1K6QH 5F7NC 1S7TB 4EQ2A 3FL7A 1MJUH 3KLAB 3VG9C 4L3AA 3ZT6A 2PKDA 5ESVA 4WI2A 1MRFL 3OB0H 3QZWB 3MJ9H 3P0YL 1DANU 3RVVC 1PY9A 4M43H 4WDIA 1SM3H 4YO0B 4HFWA 1ADQH 3BEWA 3EJZD 2P8PB 2AJUH 1VADA 3OV6A 5I30H 3Q3GA 4DCQB 1V05A 4QOKB 4K7PX 4MMZC 1CQYA 3BD5A 4IDJH 5HI3C 1YNLH 4U6VH 3QI9C 1WZ1L 1UKQA 5DFVD 3W11C 4GAYB 1AKJB 1U8LB 5FYLE 5IKCA 2DYPD 2H32A 1FAKT 2DD8H 4HH8A 5C0BD 4S10A 4DVRL 3C5ZB 3MV8A 1UXWB 2AEIT 5EO1A 4HT1H 3D69A 5IFJB 5T3XH 3VFTB 4WU5A 3O6FD 3E6HA 1PZUB 3DIFB 3NFPB 1AGFB 4Y2OA 3DO3A 5GGSY 4CMMB 5L2JB 4HAGA 4KK8C 2IH3B 2I26N 1XF3A 1QUNA 4TUKH 2OL3L 2ERJB 1EEQA 2NY2D 3UDWC 4M7LT 1D5ZA 3MV8E 4K94C 3ZE0E 4AJ0A 1DVFA 3ZMRA 1V3LA 1NL0L 5HHNA 1NBYA 4JE4B 1M7XA 2XI9A 2XWBB 3TPUB 2AEQL 4OBSA 1D5MA 2H3NB 2V5MA 4WV1A 1MHPH 1HH9A 4KMQA 1NCWH 5D6DA 3WFHB 3QPQC 5F7EH 4YFLF 1J1XH 1MJ8L 4M6MH 4C58B 4Y7MA 2QQKL 1XIWB 1HHHB 3RZCB 3VFPB 1QSVA 3SJVB 4FFWC 1IQDA 2VZ3A 1JP5A 4I18B 2M1KA 4DOHB 3EDDA 2ATKA 3UX9B 1U95A 4LNRB 1INDH 2X4TB 3DPBA 3K7UA 1FGNL 5JIPA 1EIBA 1OT2A 1XIWC 1ZHNA 3GMLB 1JZ3A 2NY1C 3IYLW 1KIPB 2Q8BL 3BAEH 1R5VA 4I18C 5EO0A 2GK0A 5T5FH 3ZE2F 5D7IE 3H9SD 2BNQA 1U8NA 2DS4A 2QQKH 4GBXC 5DTFB 5F7MC 3JVGA 1MELA 5EIIA 4KK6C 1LDSA 4E41A 4U2YA 5LJYH 2GW5A 3QUXB 5FAAA 3WS6C 1OAZH 4ODUB 4DK3A 4NO0D 2BRQA 2XPGB 4G3YH 4YBQC 1FZMA 1AQKH 4PJGB 4JM2B 4LDOB 3SBWC 1BX2B 5CJXA 1VFOA 4KRPD 5EU6B 1C16A 4C57C 1OB1A 5DR5L 4NKMB 4G6AD 2Z31D 4RIRA 5D8JH 2VZUA 4AYFA 4I0PD 2IWGA 4Y16D 3T3MF 1D9KD 1F13A 4F7CB 3HE6D 1WEJH 5D7JC 1KACB 3GBNL 4YH6A 4TNWK 5T3ZE 2UY7A 2I27N 3HNVL 1HH9B 3A6OA 5HYJB 4JM4H 1CK0L 1CLOH 4JY4A 2V2XB 3F7YA 4QXGH 3X3GH 1IQWH 3LB6D 3CX2A 3ZKQD 3U9PH 4IBLT 4LEXH 5CJBA 5H2BB 2VXTH 4UT7H 3T0ED 5LGKA 5FO7B 1GPOH 3P2TA 1T03H 3U7AA 1HINH 1A0QH 1IAOA 1RZKL 1DQMH 2ZKHL 5EO9A 1D7FA 3KPNB 1GYAA 4RMTA 3V9FA 5D1ZC 3VFRA 3UBXA 2A6DB 4YGVB 2LE9A 4UDTA 2R2BB 3X3GL 4LSRH 4QKXB 4AIZB 5GHWH 4DEPB 1C08A 1CD8A 1S7XA 2IGFL 4NKQB 3MRHA 1FAIL 2NW3B 1K9TA 1AY1L 1OAUL 1B0WA 1XH3A 3LB6C 2AXJA 4MJ4A 5C0JB 3CFJB 3KWWB 4OZ4B 3MLSH 4PRPB 5E5MA 1MHEB 3FONB 3WD5L 5C08E 5HD8C 1MLBA 5ITBL 4ELKA 3U48A 2EZ0C 4P5TD 4XNUL 4CW1A 3RWGB 5EUKB 4PJHB 1AIFA 4FTVD 4NRZB 4WEUD 1AD9B 2OL3A 4MCYA 5C7XH 3VXOB 4EQ3A 1Q0XH 4FG6C 1G7MB 2K7PA 2CLVB 1T7ZA 3WS3B 3CLFL 1YMHB 4JM2D 4OIBA 4HFWB 3MOAH 5JDJA 1TQBB 5JORB 4PTUB 1JMZA 2BSSA 3KJ6H 1ZA6A 2DWDA 3ECBA 3HG1D 1AGDB 2ZUWA 4WY7H 4U6XB 1F2XK 1YECL 4H5SA 4YHPB 5DJDB 4IOIA 4UBDC 1ZXQA 2OMBA 4NC1E 1IKNA 1FFPB 4GT7A 4BK4A 4PFEA 3SDXB 1H15B 3QFDB 4M4PA 5INDA 5C86A 7CGTA 3ZKND 2LABA 1S9YB 5CS7A 3SCMD 2IAMA 1PFCA 1Q8MA 4D3CL 4HZLA 5DHYA 1RMFH 3SE9H 2OX5A 5FEBA 4NOFA 4HIJB 3F7VA 5SX5K 3W9DA 1BZQK 1GAFH 4UQ3B 2Z0BA 1UVQA 3D3VE 4HKXA 5B4MC 4RGNE 1UKTA 5IG7B 4Z7VE 1I7TA 3NCCB 4M7KL 2RCSH 1UZ6F 1X5AA 2FX8H 5D7SH 1KYOJ 3QPQD 5HHOB 4HQQH 2VLJE 4U3XA 5FFLA 5IJVB 2P5EB 3ARGA 1OAXL 1CBVH 5TDPB 4WENB 4M1GL 4Z0XA 3OG6B 5IROA 5DK2A 4LSQL 5CLTA 5JPMA 3QWRA 5ICYA 1YEIL 3L3OB 2ARWA 1GAFL 1BBJA 1Y6MR 4WI9A 2C3VB 3FCTA 4UIKL 1G0DA 5EB9A 2XN9A 3LPGA 1FV1B 4JPVH 5CHNA 4DVBB 4PLJD 4UTAH 1R5WA 1MCKA 4MD5A 4UB0L 1N4XL 5E9DD 4DN3L 3TH4T 1T21A 4JDVA 4P5TB 3BP7A 2UVEA 1W8NA 2VITA 1KG0A 3T0EC 2WQ8A 4LPWA 3HZVB 4G3YL 3VGBA 2GT9B 1NGYA 4X8JB 2CRZA 3LHPL 4KKAD 5KW9H 2VN4A 3NCJL 4QTHB 5GS1A 3MLPA 2N4IA 3PWJB 5DFVC 3B8SA 4S1DC 1D9KC 4Z95L 5IB4B 3RY5A 2CRMA 4G8FA 4PJCF 4AEHL 3QFJE 3G6DL 5C0DB 2AEQH 3PG2A 3QIBD 1JRHI 4JRXA 5IUSA 4XXDA 1J1PH 2DQTH 4Y4FB 3BH8B 3SCMB 3V0VA 5L8JB 4P48A 4CADA 1AGBA 4EXPX 1JPFB 1P4BH 3ARGC 4GAFB 1YUHA 1HKFA 2PO6B 4HFUH 1A0QL 1YZZA 4JZJB 1PDKA 1CIUA 4Z77A 3U0PB 5C09E 3U0TA 4FQHB 3C5ZA 1MLCB 5EU3A 4LIQE 3GRWA 3C8KA 3FHQA 1WF5A 4JHZA 1H3VA 1IBGH 3VH8A 3VWKB 4K2UH 4J3XA 1F8TL 3WNMA 4NT6A 4QHKJ 5ACMA 3KYAA 3L1OL 4HZAA 3CVHL 4FXLA 4KUCF 1HHGB 1P7KA 2YPLE 4YXLH 2CDFA 1QFWI 3QFJA 4OQ1A 4CDGC 3G08A 3T2NL 1IEAB 3LVEA 5D5MF 2HVKA 3CMGA 4JKWA 1OAZL 5I1DA 4M7LH 2X41A 4G8EA 4QY8B 1WAAE 2XRAL 3A67H 2AJ3B 4C4KT 1F8TH 5SWZD 1WV7T 4WHYH 4MXQC 3SOBH 3W9EB 2VXSH 3VFVB 2NMSA 3DBXB 2O5ZH 2W9EL 3HNTL 1YN7B 3HZMB 1HHJA 1MRDL 1L0XA 3CLFH 4WW2F 4YHKH 1QO3B 5KSAC 3INUH 3D39D 2FLBT 2XWTA 4Z7WF 3MO1A 5KSBE 2DQGH 5ICZB 3D2UB 3MRRA 4XT1C 1ZEAH 1J7VR 4NDMA 1HNGA 5F9WB 3TA3C 3TBSB 1P4IL 1TJIH 3RTQC 5K9OA 2ADIB 3D5OF 1FZOB 2Z91B 2DF3A 3RUGF 4KJYA 4IRSC 4ZOAA 1OP9A 1GPOL 3JZ7A 2O5ZL 4KH2A 1I1AB 1ZLWK 2DMKA 15C8H 1UH3A 3WLBA 5I1EL 2H9GB 5ICXA 5M95B 3WIFB 1YMMD 2YD2A 3D0VB 3QXDB 3EZ8A 1MHHB 1IEHA 4WFFD 4K9EH 4PJAE 2YPKB 5BRZD 3BKCL 2YMXL 1X5HA 3S36X 1G6RA 1AQDA 1QRNB 5HD8D 2C26A 4Q74A 4XNQB 1N64H 1Q94B 3PGDB 1JZ8A 4PBXA 4UI2A 2CK0L 4M6NH 3QNXB 4NQSA 5I1DB 3WD5H 3GMOB 5EUOE 2ICEB 3W0WD 3KPPB 5C0GA 1D6VL 3OAUH 3MMEA 3UTPE 2ZUVA 4NYLB 3QA3B 1BVKA 1IEAA 5FYJL 2EO1A 3FMGH 4D8PB 1NFDE 1PGRB 1FC1A 3P4OB 2F15A 4NRYA 4KJPD 3WE6B 4ZOBA 1RZJH 4NZRH 4OIIL 2B2XL 3R0MA 4TOYL 2EXYC 2CDGA 5IGXH 1ZHBB 4OI8A 2HTLC 2VXUH 5FA3A 5KVDL 5C09B 3HLAA 3N9GL 3QDGA 5CILH 5FYKD 2HFGL 5CIPH 3RL2A 4PJEA 2V6HA 1YNLL 4KVCL 5DJAA 5JA9A 2F19H 1WZ1H 4Y0GA 5JNYB 1VEPA 4PB0H 3GIZL 3WFBH 2PO6A 3QQ4B 3IDNA 4CRPA 2PYED 3OX8A 4YBHA 5E99L 3BO8A 2Y72A 3IFNH 3QIBA 4OKVB 2Q8AH 1J05A 2YD8A 5J6HA 3KPRA 3M1BA 3RWHA 3U9UB 5B38B 3BGFB 3MLTA 4PJ7A 3O3BA 4K3JH 4NP4H 1KFAL 3S98A 1P7HL 2IBBA 4IHOA 1UKSA 4M48L 3R8QA 4NQED 3OF6A 4NKIL 3TO4D 2GKIA 3CXDH 5TF0A 4U0RB 4OLYH 1A6TA 1ZT1B 1FVCA 5I2IB 5C6TH 4ONGH 1EBAA 1JNNL 1S5IH 2BNRB 3TH3T 3WDJA 3DXAE 3TFKC 3TN0A 4EI5A 5C3LD 4P5MA 3BQUB 3PDDA 3GSQB 2DI7A 4OGYH 4NP4L 4ONHB 4D0BB 3QA3A 5F3BA 5JZ7D 3FFDA 5GRVL 5JA8B 5E56A 3O6LL 3TVMD 1WBXB 3JV6B 2AW2A 2BSSB 2DBJA 2Y06H 1J1XL 3E6HB 5DRZB 2DL2A 3GBMH 2ZSWB 3O8XA 1M71B 4FQHA 2QQNL 3ARZA 4PJ5D 5IT2L 1DVFC 3UBXI 4G7VL 1N4XH 4DN3H 5MERA 4Y4HA 3OKMB 5I66A 3FOLA 3I9GL 1I7RA 3FQXA 3WFZA 2X4NB 5TQ2H 5MEQB 2AV7B 1CYGA 1FL6B 3K0WA 5CWSB 2DQHL 1Z0MA 4Z7QF 1JI2A 5I75B 3QCVH 1YEGL 4UQ3A 3S3SA 2R29H 4OTXL 4NJAL 5T1KB 3Q5YA 4HBCH 4HJJL 1P9MA 3ROOA 4U6TA 5C0FB 2X2YA 3C5JB 4XBPB 3MUZ1 3MGOA 3UZQA 5KVEL 4RMWA 5EUOB 1NH6A 1AGBB 1DUZB 1OAKL 3WL9A 3KYMB 2Y6SD 4YDLC 4HULB 1OF2B 3VXSE 5AD0A 3MJ7B 3S5LB 4LGPB 3CH1A 4C4KO 4P57B 5JIHA 3K74B 3OHXB 3WN5A 1R3KB 3VXUA 2A74A 1SYSB 2F8XC 1FIEA 2IQAB 5CP7B 4DK6A 2B7DT 3GBNH 2M8XA 3IVKB 3VFVA 2E3VA 5CJOH 4XNXH 1M6OB 5CMAA 5ESAB 3EGSA 5I19H 1UC6A 4Z76B 3TF7C 2FGZA 3QEHA 4AEIL 4MA7H 4FXGA 3LRGA 2VDML 4LLWA 3UO1L 5GS0L 1RHHA 2W0PA 4UTBH 1Q0YL 3VXRB 1UENA 4AG4L 1B90A 3BPLB 3BI9X 4U2ZA 1MIMH 4EBQL 4PYGA 2NY5C 5DUMH 3T2NH 5AYQA 4JPWL 1JGVH 1F00I 2J8OA 4M61B 3SDCB 3HR5B 3KGRA 1P7KB 1YC8A 1JVKA 3A6CL 1FL6A 4YJZL 2NX5E 1DQQB 4PJ5B 3TA3A 1YDPA 1SEBB 5F3HB 1M7DA 4HIJA 1VESA 5DC4B 5TQ0L 3SDCC 4O9HL 1CCZA 2VXSL 3PGFL 4OGAC 3RVTD 4BQ8A 1DUYB 3IGAB 2X1XR 4Q9QH 3M07A 5JW5A 3FQWB 5D2LE 5IJVA 4NQDD 1FO0L 1B2WH 4JQVC 3DROB 4FFWD 4QRPE 5DD6B 1NANI 5JXEC 1VCAA 1UWEL 4OF8A 3RNQB 4O00A 4PLKD 4HK3N 1F58L 5ENWA 1H0DB 5BVPH 3BZFA 3H7BB 1ZK9A 3BSZL 3CFEB 3VFWA 5L0QC 3WIIL 3TVMC 4HIIA 2XN9B 5IEHB 5B21A 1AO7D 3A6BH 1OP5K 3RVXD 2JJWA 2X40A 3IAQA 5JR1H 4PG2A 4QT5B 5IFAL 3S9DB 2J1KA 4S0SD 1MHHA 3QSKB 3T0EB 1XR9B 4AQ1B 1XF2B 4MJ5A 4NKMA 3QIUB 1ZVYA 2ZSWA 1V7NH 3MNWA 4LPUA 3TN0D 4EI5D 3FT2B 3S96A 4KMTL 1AJ7L 1YA5A 2D3VA 1I1FB 4M1DH 5GSRA 5CKAA 3UTZA 3BRDA 2P5WA 4U6HA 3DLQR 4PJ8A 4KKCD 5E6IC 4MZ3A 5E00B 4RMQA 4PJFE 4DQOL 3U6RB 3KDMA 1NCBH 1FPTH 2VSCA 4I0CC 5C9KA 3HC3H 1OP3H 4EUPG 5FKPB 1V7NL 3EOTH 1UYWH 3K3QA 2UZIH 3OKLB 2WSKA 3HPJA 5E6IB 5GRZA 1MAKA 4HIXH 1X5KA 4JFQA 4P2QE 4EUPA 4KU1A 4JFED 1B0RA 3IF1B 3FKUS 4IOIB 5D1XC 1QBLL 4RBPK 2O5XH 3JTSA 4PJ7F 1A1NA 3BUTA 2YSSA 4ZPTA 4JLRA 5BV7C 3TH2T 5F3BB 3PXJA 4XTRD 1IC4L 4DAGL 3MV9A 4K94L 4NO5B 5GS2D 1RZIB 4P3CH 5GRYA 1EA9C 4FA8A 1UZ8B 4OF0A 4P0DA 4XP1L 2FWOA 4N0UE 3Q1SL 4DFIA 3QNZB 1MWAB 3C9NA 5J1SC 4LCYA 3P9LB 3O3DA 1EEYA 1U3JA 5SWQB 3DX7B 3QIWD 1NDGA 4HG4J 2VAAB 2CDFB 1BF8A 2OTWA 4X5WA 4GUPB 5DRNA 5MHSE 2CK2A 3IKCB 2FO4B 1XFPA 1F11B 1T2JA 5IVXF 1YNKH 5GZND 2Q1EA 2OTUA 3KXFA 4X6CE 3PV6A 2XY2A 3LZFL 2X4RB 1CFBA 3ILQC 5FM5M 1X7QA 3OB8A 1IRAY 4NNPH 3LV3B 4L8SA 4LVEA 2A83B 3MMEB 4JFDB 3C5JA 5C6TL 3IJYA 4ONFH 3QDAA 5GJTH 1AC0A 1G9ML 3Q0HA 1I9JL 4X80L 5IVOA 1JRHL 3S36L 1FZOA 2BNQB 3HC0A 1WBYB 3C6LD 4PP2A 3MXWL 1FFOA 2B4CL 3DYMA 4G8GD 1KCRH 1NGQH 2NTFB 1INEH 5LQBL 2JE8A 5D7LA 5E2UH 1ZSDB 5HDQH 3QFJD 5GS0H 1D6EA 3TBTB 4JKMA 4JHWH 2VISB 3K4ZA 3EYQC 3DUSB 3VD9A 1I3RA 1G9MH 3PWJA 1MREH 5KAQG 1AFVL 1T04B 3O11A 4UOW0 5DJ2A 4U4BA 3CLEL 1F3JB 1M71A 3QWOA 4KROB 3GMPB 3S4SG 4JFEB 4OLZH 2R4RH 3PGDA 1Q94A 3VXME 2JTDA 1I4FB 3T0BA 1WBZA 5HDQL 2VWEE 3LN9A 5D72H 3RNKB 2AXGB 1WWWX 3FT4A 3FO9A 3VWJC 2N1KA 5EO9B 1ZHNB 2WBKA 1IM3A 2K1MA 5D7LD 3DRTB 4NJAH 4YDIH 4D0DB 5ESVB 1XF2A 1J0JA 2M2DA 5DJ6B 2OR7A 2VXQH 2YPLD 1KIQA 2VR5A 3TZVC 5SWQA 3SY0A 2DQJL 3L5XL 3B83A 5KTEL 2VLLA 4RCAA 5JO5B 4H8WC 2Y5TA 2J6EA 4WFGE 3MRIA 2LAGB 2QSCL 1FORL 3RGVA 3TZVB 1FAIH 4FNLL 2FH8A 3KYKH 3V4UL 1G7QB 1I8IB 1QSEA 1UT9A 3REWB 4GMSH 4XVJH 4X4MA 2VH5H 3W82A 4HUUB 3BO8B 3SGEH 1CU4H 1TVDA 1K85A 3FTGA 2ZP0T 3DSFH 5KBNC 5IB2A 4PJEB 1JYXA 4Y19E 2M26A 3ARED 4R4ND 2O61B 1T1WB 4UAOB 1BEYL 4ZPVA 3KPSD 1A7QL 3WMSA 2EDXA 1TITA 1I85A 3AB0B 1JGLH 4PGBA 3ARQA 4BZ1H 4R90L 4FZEH 1HHKA 4LSUH 1VACA 2X5PA 4AT6A 2ADJA 4XGZA 1GGIL 5KVFL 3O2WH 1S7SA 1OQXA 1OGAA 5EO1B 3ZLQC 3NPSB 1NCBL 4UV4L 4JZOA 3AUVA 2HTKD 5D9SB 3FQNA 4Z78B 4GRMB 4JZNB 3MREA 3MV9D 5KOMC 2VJXA 3TT1H 3QIUA 5D70H 2CKNA 3BKYH 3UJTL 3H42H 5C8JA 4BKLB 2EIDA 5JPNA 1KB9J 12E8L 1F45A 2KQMA 3QWQB 4ZUVB 2HN7A 5FYLH 1L0YA 1IE5A 4FZEL 2NY5H 2J88L 4POZC 4ETQA 3HI1A 1BFVH 3RKDC 2BZDA 1F4YH 3FB6B 4F9PA 4LBEB 5DWUL 2ITDA 3LQZB 4OD1L 1ZS8B 2UY6A 1PG7W 2W0FB 4PJAF 3WIIH 4D94A 4ODXB 3UTTE 3MLVH 4Q9RL 4ZTOL 1TJHL 5CBAA 4ZOCA 5DFTA 1NCDH 1RULL 4YR6B 3MRIB 4XVSH 4I18A 3NA4A 3GJFH 5EOTA 1CGSH 2XXMB 1CFTA 3IU3B 4KKLD 4DW2H 2VDPH 3G6AA 2VYRE 4DVBA 1BZ7B 4J8RB 1FFNA 1CDHA 4YC2B 4S1SH 3SE4A 5IBTL 1YYLH 1QO3A 1UEMA 1RVFL 1ADQA 4EI6B 3MLVL 3H9YA 5E00A 2WUBH 3B5HA 3AGVA 2W38A 1IM9B 2EEDA 3C60B 4I77L 2D7TH 2EE9A 2R2CA 3VD4A 3TIEB 4KFZC 1RULH 4PLOB 1KFAH 4Q9CA 3IJHA 4XBPA 2OXHA 3VW3L 4KJQD 4WV1C 3VFSB 2D2OA 4IOFC 4NKIH 1NAML 4YHMH 4HIXL 5AAMA 4AY0A 3BXNB 5IBTH 5AZ2L 1RZ7H 1P69B 1X7QB 2SEBA 5I8KL 1OB1B 3IDYC 5JIKA 4PRPE 3VRLE 4PJHA 2OS7A 4J12A 4QRRB 5BCAA 4PY8J 3F8UB 2BVPA 4FABL 1NCCL 1CXIA 1FN4B 4M93C 5T3XL 3RZWA 2R2EB 3I85A 4KPHL 3T08A 5JQ6L 4HXAH 5E1HB 3VW3H 2APXA 4NHCL 2FJGA 4GKZB 5IK3B 2FCBA 1ONQA 3SKNB 2JIXB 3MQIA 4D9LH 3TJHD 3HMWL 5KZCB 4A2LA 2W07A 2IALB 4PRDB 1T3FB 4JDTL 3MCLH 3CSGA 5FUOL 4ZUSB 4LARH 2NLJB 5E2JA 4JGUA 1U93B 2DQJH 1JK8A 2PCPB 3L5XH 3QI9A 3LZFH 5K9QI 4QCIA 1G0XA 1S9WA 4K2UL 1SBSH 1ES0A 1Z5LB 3QG6A 4XNZB 5C0CD 3SKMA 1LO3L 5T3ZL 1ZT4B 3B9KC 1A7OL 4XXCA 3BVNA 1MVUA 2XTJE 3O6KL 4UILH 4ENED 2CSPA 1BQUA 3RL2B 2CMRL 5DJ8B 5C2BL 1QFWH 2ZCLH 1CU4L 2AVGA 1HZHL 1KCRL 1GVIA 1RZFL 5DEFA 2NY6B 1PBYA 4P3WA 5EU5B 4RGNB 2HLFD 1KCLA 1RIHH 3AY4C 1RU9H 4XNMB 3B3IA 2RBLA 1MI5D 1L6XA 1BEYH 2XT1B 1J8HE 1GC1H 3RI5F 4MB4A 1A3RH 3TLRA 3BD3A 3RWCB 3D85A 3O3EB 3KPMA 2P5EE 2VLRA 3Q2CA 2Z93B 4UILL 1T6VN 2YUVA 4LLAA 4YIQB 1M4KA 3DMMA 5JW4R 3I3BA 3RJDA 5MEOA 2OR9H 2CKBH 4PV9B 2EDTA 4MD0A 1NBZA 4NHUB 1BVZA 2A6KA 3DGCR 3MV7D 2DQIH 3MGTB 3PE9A 4CN4A 3ULUC 5D72L 1VACB 3MLYL 3LAFA 3QWOB 5B39G 2KBGA 1MF2H 1WCBB 4PJDF 5TFSL 3NFSL 3V6OC 4U1SA 2APWA 2YA1A 2P48B 1CI5A 1T1WA 1G84A 1DEDA 5CINL 4XI5D 2DI9A 2A9NH 2I5YH 1LD9B 1P1ZB 3DUUB 5J1TC 4OIAA 5LGHL 5HVGB 4AMKH 1F4XH 4E9LA 2P8LA 1ZLVH 1IGYA 2YEZA 1ES0B 1Z5LA 2PN5A 1G1YA 3EJJX 2QSCH 1C1EL 4HUMB 3REWA 1N5YL 3OKKA 4WFEE 2P8MA 4UT7L 5GRVK 4F37K 4OV5B 3G6JE 1IILE 4KGLA 5I1CH 3QRGH 1OSZA 5KVGH 2IANB 3KPRE 2D31A 3FRUA 1QNZH 2GITB 4H26B 3AXLA 3T65A 5EOCL 4JG1L 4WUUB 1WZMA 3OAUL 4ZNEE 1F58H 3IDJB 3GBLA 2OZ4A 4NQUA 4P99A 3FFCE 1HE7A 1QHPA 1YNTA 3OGCB 4PJHF 4WW1B 5TE6L 3A0OA 4F7PA 1S7SB 1QQDA 3RNKA 1VFAB 4QNPF 4YBLB 5C08D 1GGIH 4TOYH 1A7PL 3VD3A 5D6CA 3MLSL 4C56A 4GRWB 5K59E 1EMTL 3RWFB 43C9B 3HI6H 3LQAC 4JG1H 4XP9L 4J2XA 4YBLC 3OXSA 1UZ6E 4LHUD 2YA2A 4DFHA 5L88L 4NKDB 4M1DL 5IMMB 2WQRA 4KI5F 1AGEA 2J8UB 3U7WH 3MZTA 3O6FC 1P1ZA 1EFXA 4OSUH 4TPRH 4ZUTA 3KG5A 3RA7H 1NCCH 1I9EA 4YHIB 1YY8B 4PRHB 1FFOB 1XF3B 5F6HJ 2B4CC 3S37X 2Y4SA 3LN4B 3EDKA 1A22B 3WHXA 2Z35B 1QVOB 2XQYK 1F90H 5ISZB 1EGJL 5H37G 3QDGD 1CGYA 4MNGA 5C3TA 4Z7UB 2H8PB 5ETUA 5DD5L 3ZTNH 1KN2H 1CE6B 5HI3D 2D0GA 3UTZB 3SDXA 1FQ9C 2QADD 3LKNB 1EGJA 2E6JA 3RY4A 2Z8SA 2ZUUA 1NAMB 4QGYA 4CVWA 4GSDL 1AHWA 1VSCA 1U3HC 3EBAA 5D1QC 5F7DB 1AO7B 4OFIA 2PYFA 3R1GH 1YYLL 2LVCA 3IS0X 5I15H 4P3DA 3C8DA 4LSSL 4K9EC 4Z7OE 5EZJB 3UYRH 3QCTL 1QZ1A 3PWVB 5JHLL 2P7TA 4WUUD 5E4IA 5ITFB 3ZHKA 5I6XB 3EJYD 5IW6B 3UJJH 1OAXH 1CBVL 5FV1L 4HWBH 4YEEA 3BZFB 3LEVH 3RWGA 3QCUH 4U3CA 2AEPL 1H9VA 1FYHB 1ORQB 4GSDH 5B38A 2HFTA 3MV8B 3MUGA 3P9MB 1KUMA 2DQHH 3MFGB 4TTDC 1S7QA 3E6FB 4LGSB 3FCTB 3SDXE 4NRXB 4LBEA 2QV2A 5D8JL 4QOKD 4CVXA 2HJLA 3S36H 3TWCL 2ZUQC 3NTCL 2PNDA 3GIVB 3QIBC 1MFEL 2IANE 1BZ9A 3GJFK 1NGQL 3PWNB 3TYGH 3QDJE 1A5FL 1MIEL 3IDIA 3GHEH 1AD0B 4LIQL 4OJFL 3MC0A 1FBIL 1MY5A 3DV6A 3GSQA 2OQJB 3I2CH 1LEGA 4MLSA 4IIQB 3BH9B 2H6PB 2VSDA 3MLRL 1MCWW 4FQ1H 4TSAH 1RUAL 5EULV 4NO3A 1S7WB 5C09A 1V3KA 4HIHB 1HHHA 1X4XA 3FO0H 1UM4L 2DLTA 4IJ3C 5DK0B 2BFVH 2BNUA 2OXGA 1FH5H 5I1HH 4TQEL 4MNQB 1EVUA 3VFSA 2G5BB 1Y18A 2JKXA 2VTFA 5LCVH 3F6IA 2BJML 2ARJB 2BSED 4HFUL 2CUMA 3OZ9H 4NUJA 4MJ2A 3SKMB 4BFEA 2CUHA 1D5ZB 5D7LE 1PKOA 4BQCA 4YHNA 4NQSB 5EOCH 3BGMA 3HUJF 5BRZA 3FO0L 4JB9L 1OARL 3MOQA 4LMQI 4H88L 5LG1A 3IGAA 2H1PH 4JO4L 4IMKC 4MA3A 4JO1H 5HSFA 2MQ0A 1LEIB 4FNLH 3L3GA 4NZUH 1CICA 4MQXD 4UDUA 3KJ4C 4ORGB 4HUXB 4ZDHA 1MI5A 3MUGB 5CBAB 2FL5A 1C7TA 2Y36L 1KLUB 4TVPD 1NGXB 5IKCB 2DQFB 5M94B 1RFDH 4H0IA 2XRAH 4XB8A 2D03L 3B2UD 4XMLL 35C8H 3HA0A 4LNRA 1K5NB 2PXYA 4WO4B 2X4QB 4MWFA 4TSBL 5CIPA 5ALCH 3KLHD 5J6GB 2DTMH 4OGZA 4FQJL 4JANA 4RDQF 2YWZA 4PREB 3V7AG 5EUKA 3VXRA 4YGAB 3E8UL 2CPCA 1RSFA 2VXVL 5IEHA 2P42B 2YD6A 3Q5OA 3T1WA 4ZODA 1XGQB 4APQA 3E2HC 3KNBA 5D93B 4HKZB 2HJKB 2DLGA 4R97C 5BJTB 5BS0B 1XGRA 1A9BA 1AR2A 2R1WB 3HB3C 1MCFA 2NY3B 2NZ9D 1U8MA 4HMDA 1DUZA 3OPZH 1KJMB 4JJ5B 2H26A 1RZ8B 3CX5K 1UQSB 1NEZB 3VH8B 3CFCL 4JEGB 2XOTA 1EO7A 5C0RL 4TUJB 1QLFB 3ARDA 1JHKL 4OZIA 3FQRA 2YHGA 4HJGB 3GK8L 4G6FD 4MA8H 4OZFA 4I3RL 1YY8A 3C6SA 3DO7A 3C5ZC 4NQDA 4GRWE 3ZDYF 3MJ6A 1RZIA 2H2PC 3O6MH 4X6BB 1U92A 1YPZE 1ADQL 3R06B 3EDJA 5H2BA 2PYEE 3CFCH 1U3HD 3GMRA 4P2OB 4Y4HB 4K94H 3KPSB 3CAFA 2OLDA 3KR3H 1I7UB 1MQKH 2ENSA 4HX1A 2NXYB 2A6DA 3X14A 1GGBH 2X1OA 2KQNA 1DLHB 3QJHA 3V0WH 4Y1AD 3D2UD 3MRRB 1TCRB 3LSOA 1J0ZA 1D9KA 1Z3GL 3RVUC 4OSUL 3FO2B 4TPRL 1IAKB 3F62A 2IPUG 4P2RB 1R5IA 4XPBL 5GSRB 1NSNL 1FFPA 4WUKH 4TN9A 3BIKA 1RK1A 1OPGH 4JDVB 1MWAL 1T7VA 5IB4A 4RGNC 1NC2D 4PJBF 5FGCB 3AXLB 1G7IB 4WWKD 5DVKA 5KN5A 4C56D 2HH0L 2YUZA 4APQB 1KGCE 2D7MA 3PP4L 5I1AA 3AMKA 1Q72H 4WCYH 4XRCA 4M03A 3V79C 1OGTA 4JO3L 1HKLL 4NQEE 2R0ZH 1HHIB 5IJKC 4BKLA 1T0MB 3D85D 3FRPG 1INEL 3I02B 4FQXA 1QRND 1LD9A 1Q9WB 4M48H 1DDHA 4GBXD 4BZYA 4U1KB 3TV3L 2A6JA 4Y89A 4XVUD 4UIMB 4PJ8C 1C12A 4QRSA 1W72A 3W0WB 2FL5B 2G5RA 4RAUA 5F1NA 3B9VA 2BHZA 3MTRA 2G2RB 4QT5A 1IMHC 3DX9A 4LVOC 3K1KC 3BESR 3P11H 1SEQH 1T89A 4PJ8B 5I71B 3L5HA 1KCVH 2A1WL 1TTUA 1U9KA 3H0TB 5F9JA 4TULL 5IBLD 4J1UB 3DMMD 3EO9L 3GEWB 2IPUK 1FFQA 1N7ML 1I9IL 3VXSD 1H8SA 2HFFB 4B50A 4QTIL 4MSWA 5C0AB 4Q6IB 3KNBB 3VWJD 3INUL 4HX1B 4O02H 3FQWA 3ZE2E 3HKFA 2FHCA 2CDEB 3MFFA 3MRNA 3B2VL 3FOMA 4RSVA 2V5SA 1DQLH 4BZ2L 3QISA 1XCQB 3LRSA 5DUPL 1T04A 1ORSA 1KB5B 2IG2H 1PKQB 3BW9A 1N7MH 4HWUA 3TBWB 4FP8L 4XMPL 4UNUA 4MDJA 1MJJB 3RKDD 2C4FU 5FHAL 1AGCA 1IGJA 3P0GB 1GIGH 3IU4H 5HYSA 3BH9A 4MD5B 4OZFB 4HKJB 5IIEB 1CK0H 1UWGL 3FT4B 1G7JB 5IR1A 4RAVB 5TF1H 1Z0NA 5EUOA 5CZXC 4HZLB 1VGKB 2VDLH 2AXFA 4PRHA 4MQ7B 5A16A 4OLWL 2OCFD 4RGOH 4MB3A 4PLNC 4D0CB 1JPGB 2WIMA 4PRBB 1T03L 4E41B 1A64A 1B4JH 3PL6C 4JFDA 3AROA 4NRXA 2F9BT 3QNYB 1YEHH 4PY7A 3QEUB 2LAAA 4JFHD 3FONA 3IU4L 1FL5A 4MD0B 1XAUA 4JY6A 5D7IF 3SDDB 3QUZD 2NY4C 5I76A 3KPTA 1EJOL 1KCKA 3HI1B 3KLDA 3L3IA 4NZRL 5C0IA 3B2UC 4XCNB 1Z9LA 3SDAB 4HUVB 2C1OA 3QAZC 5LVEA 3C2AL 3GSVB 1X5JA 4NO2A 5FIEA 3WN5C 2C3VA 1GOGA 4LCYB 1FZKB 4BELD 1VA9A 4JO2H 4N8VA 4XP6L 5FYJE 1BFVL 3MLUH 5KOVC 1PG7H 5D4QA 4NPYB 3PWLB 4G9FA 2C7UB 1T20A 3CPLB 2X44D 4XWOC 5C0AA 5IWLA 1KG0B 1XGYH 4LKXB 1F6AA 1QFPA 4UNVA 5D7JA 2BNUB 4ODWA 3F65A 3LKPA 1R5WB 3E8UH 4QRPD 3S35L 4PGJA 1N2RA 2YK1L 1LO5B 3IKCA 3ULVH 1OF2A 5E7FA 2R0LL 4XVSL 2XA8L 3KJ6L 1MLCA 2WWKT 3B6SB 2A9MH 1JHTB 1OD9A 1MY7A 3GO1L 4NM4L 3QB7C 2FATL 4YHNB 4HS3B 4IRSD 3WS6A 1N3NB 3O2DA 3NIDF 3O3BB 2A83A 4L4VB 1LE9A 3ROLA 4CU6A 1BFTA 4P2QD 5C0CA 1EEZA 4JQIL 4PGDA 2ZUQB 4YUEH 3SHSA 5J6HB 4UU9B 4KXZI 1N8ZA 5IFAH 1H8NA 3NA9H 4LPXA 5C0DA 3MBEB 4OF6A 2DQUH 3RJQB 4X5XA 3CVHB 2CO7B 3GO1H 4NM4H 1NAMH 1WSST 1JF1A 3LRHA 3QEGL 4QRRA 4IOSD 2BSTA 4N8CH 3V52H 5I73C 3PL6D 3L3KA 2HT2C 1AJ7H 4MVBC 4XVTL 4W70A 5MEND 2VC2L 1TZIB 3FB8A 4WO4A 2H6PA 1FE8H 3FRPA 4MXWH 4U6HB 5DRZA 1ZLVK 1KELH 3O41A 2FRGP 3P11L 3VI4F 1ITBB 2DD8L 1A1OA 3PHOA 3D18A 5JQ6H 1I8MA 4KGJA 3BWUC 4LSVH 2VABA 3EOTL 5D1QA 1U3HA 5HGHB 1U8IA 4LFHG 1A7RH 4KHTH 4LSSH 4YZFE 4Y19A 4XVTH 3VGAB 4X99B 2YBRA 5IW1B 3P0VL 1EX0A 3RKPA 4WUKL 3D39A 3QCUL 5FUOH 1AKJD 3WNOA 4MXVE 3P9WB 4BA8A 3Q6GH 5KVEH 4XZUB 5I8OH 4OLXL 1X3DA 3EYOB 5I1JH 3JSSA 1LK2B 2PETA 1F3RB 4OZIF 4WW2B 5EC2B 1I8IA 5T3ZH 4U1GC 4MS8D 4QRQA 4F7TB 4NYLA 2MCPL 3PQYE 1OGTB 3SGEI 4PGCA 4UQ2A 1KV3A 3NFPA 1XCTB 2APFA 4JFZH 1HHIA 3MCG1 2VDQH 5IHUH 2KDGA 5BV7B 2BMKB 1XCQA 4XBEH 5J12B 2Y9RT 1HZHH 2JB6B 4S1RL 1U8HB 5SV3A 3V6OE 2XZQH 1KPRA 4Y5XB 1EPFA 3QUXD 5TF1L 4P23C 2DQTL 5DHVA 2CH8A 2R2EA 3LEXB 2F5BH 2Q7YA 3HS0B 2OJZL 3BP7B 3BDYH 3HAEH 1RUAH 4G9FB 5IWLC 1TZHA 4Z7WE 4Y4KB 1PKQA 1LNUA 1KLFA 4Y8DC 3Q3GB 5E6ID 4B53A 4DCQA 3X13B 1P4LA 3FO2A 3VFPA 2BCKA 1XGQA 4OM1H 4XNQA 3JBG7 3G5XB 3ZYOA 1CDCA 4FQQB 1JTOA 4G80A 3DUSA 1AHWB 2L7UA 1XF5B 2CLRA 5IBUB 2W1NA 3VXMD 4LRNH 2CD0A 4LSTH 3DYPA 3UTSA 4HUNB 4X98B 4WIQA 3HR5A 4XWOD 3C2SA 2AKRB 2ZJSH 5BVPL 4HJGA 5C0JA 5L2JA 1Q9OB 3RY6A 3SOBL 1T0PB 5DO2C 4P46B 1ZAGA 5FGCE 1WFNA 4QXGL 3MFFB 3MRNB 5C0BA 2K3TA 4G42B 5JR1L 3T77B 5J1AB 2VXTL 3V6OA 1MUJB 2B1HL 1MCDA 3BKML 4NBYB 3JV0A 1X5LA 3P77B 2P24A 4I0PB 1UFUA 1HHGA 7FABL 3DVNA 5FGBA 5GGRA 3HS0A 2Q7YB 4HG4K 1IL1A 3C6LB 1HSBA 4FQJH 1MH5A 3KYKL 5DJXB 1AGFA 1T80A 2FYYA 3TT3L 1IJ9A 2Q86A 3OKMA 4HIIB 2CR3A 1O0VA 5E8DH 2PUQT 5JLZB 5FYKH 2F54D 4ZQKB 1OAUH 3C6LC 2IPTH 4JFFE 3QQ9C 3N1GC 2ZCKH 5BRZE 5T5NG 1I8KB 1CT8A 4OD2B 1KNOB 2BDNH 3ES6A 4EIZC 4KJWC 4K3GA 4D2NA 5FO9B 1KXTB 1BQHG 2BVOB 1IAII 4ZMAT 1JI1A 3ILPA 3EDFA 4X8XA 4PTTA 3STZA 1BX2A 2BC4B 5E94A 3HFML 5EFIB 3WNPA 4O2EA 1HHKB 1BJ1H 4XP5H 4XXCC 4EJ1C 4QOKA 3DI3B 2P49B 1AE6H 2XXCB 3HE7A 5F1NB 1CFNB 1DQJA 4YX2L 3U0WL 5IQ7H 3RU8H 5IJKA 2UUDH 4JRYE 2F54A 2Y23A 3ZE1F 5L2KB 2IFFL 3IKKA 1SJEA 2IQ9L 4U1LB 4U1KA 4PJIE 1U8QB 1XZ0A 2ITCA 3V7MA 3KLHC 4YDKL 1FYTD 2WV3A 5DA0B 2R56L 3O3UN 2NY5L 5I16B 3GSWA 2GCYB 3PWPE 2ICWJ 3QR2A 4Z7WB 5I74B 1NCTA 2R0WL 1HXYA 1KC5H 4U7SA 2EDNA 2ICEA 4KVCH 4LLWB 3LEXA 3MRDA 4X6DE 3CJJA 1L7IL 3OAZK 1RUQL 2RIKA