5D70H

Crystal structure of mor03929, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
216
structure length
212
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSGISYSGSETYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGFGTDFWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of in vitro affinity maturation and functional evolution of a neutralizing anti-human GM-CSF antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Granulocyte-macrophage colony-stimulating factor
total genus 45
structure length 212
sequence length 216
ec nomenclature
pdb deposition date 2015-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d70H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d70H01
3V6FB 4EDWL 1IGIL 5HGAB 1GZPA 3E3QE 4PJCF 3BRGC 4JFEA 3EGSA 3SKMA 4QCIA 25C8H 3I50H 1D5ZA 2VXTL 1RZGA 3BSZH 3PWVB 2EDHA 1P1ZA 1CK0L 1ZS8B 1J88A 5CZVH 1V3JA 2ATPA 4PJCE 2F8XC 5C6TL 3RL2B 4M6MH 4JPIA 1ODAA 1I9RH 5ADOL 4XWGL 1UXSA 3N1GC 1ITCA 1DFBH 5SX4H 1N26A 2P7TA 2WANA 2HJLB 1VEPA 3KPRB 1UH4A 5LXGL 4KZEL 4NQCE 1WEJH 2XWTA 1U8PB 4HX1B 5F9OL 1D6VL 2EDQA 4PD4K 3HAEG 4NUGL 1IE5A 1KLGB 1S9VA 2OR9L 3H8NA 2ADGA 4R90L 5J9PA 4XNMA 3KPTA 5GGTA 4PRBB 2WBKA 4I0KA 3C60B 4GLRH 2X4OB 3AB0B 4LSPH 5DJXB 4YH6A 1LP9A 2W1NA 2R39A 1R3LB 1FO0L 2EDTA 1U8QA 3TPUA 3UTTB 2DQJL 1DL7H 4Y2OA 3WFDL 3RVUC 1HHIB 2EYSA 5IEHA 4JHBA 3LRSA 2V2TA 5GRVL 4UTAH 4Y5VC 3TH4T 4XMKH 4HK3J 2X09A 4NP4L 4PJIE 2R0LH 4ZNEE 5GS2D 1GPOH 1I85C 3GBNL 3K2MC 3MV8D 1RIVH 3PWNB 2DLFH 1OAZH 5CSBA 4HWBA 1J8HB 1KEGL 3DVNA 1KCRH 1U8KB 1G9NH 5C0BA 2VUOA 3FT4A 3OX8B 3T3PE 4EXPX 4MCZA 3MA7B 2QEJA 4ZO8A 4ISVA 2X41A 4K23L 5F7MC 1MFAL 4PJDA 4XGZB 2QQKL 1JZ3A 3V4PH 5C0AE 1FFRA 4Y0GA 3D0LB 4O2EA 1V3LA 5HHMB 2Z4QA 3RL1A 4GQ9H 1KIPA 1JGLH 1IT9H 3BQUA 3KR3H 1MHEA 3K8KA 3QIWC 4Y4FA 1I7UB 5FUZL 5CEZH 1ZA6B 3BVNA 4D0DA 3MGAA 4NJAL 1HXMA 4C4KO 4M43L 1PEWA 4XP6H 2XQYG 1TPXC 3QIUD 1DLFL 3VXNA 4NWUL 3LV3A 1HKLH 1G84A 1YA5A 4RIRB 4KPHH 4MA1C 4EOWL 3QUMH 1IC7H 5IB1A 3WIIH 3V8CA 2MTPA 3B9EA 3QZWG 3GBNH 2IH1A 1OTTC 2GSGA 2RHEA 3I84A 4OSUL 5DWUH 5K9KA 1MWAA 3OZ9L 4HG4K 5KAQF 4FXLA 3I6GB 3FQRA 5FDWB 3TVMD 2O5YH 4L1HA 1ZVYA 3G08A 2XRAH 1HDMB 2J8HA 3WXVL 5CEYA 1ZV5A 4P9MH 4FABL 1A7QH 4KK5D 5INDA 2YOCA 4W70A 2ATKA 3S8WA 3ARGC 5L2KD 4W6YB 3OKEB 3G5XB 3ZE2E 6FABH 3KPSB 4G6ML 1T89A 3TFKD 4U1HB 4Z95H 5HI4C 4L3CB 3R0MA 1NKOA 3HNSH 5E9DD 1JNNL 3F7VB 5L0QC 2P8MB 1A6WL 1MPAH 1Q94A 1B3JA 1KIUA 4GW1B 4CDGC 1HIMH 5FF6B 2DQDH 2AERT 3HE7A 1FL6B 2OZ4L 5FF6A 4OF5A 1LK2B 3L3OB 2IJ0C 4L3AA 2BVQB 4MB3A 5GRUL 1J05A 2XZQH 3QH3A 4S1DC 1KEMH 5E5UB 2DWDB 3M1BA 3BISA 3VMPA 5C0IA 1FVCA 2DQGH 4GRWH 5IVXE 4TSAL 1U8IA 2BVTA 1HN1A 1W0YT 2VDLH 1W8NA 3TIDA 4KJPD 2AJSH 3HZYA 2QQNL 3WV0A 4EZMA 2W9LA 1GZQB 4MMZC 1LNUB 1JGEB 1TLKA 4NKIL 2ZUYA 4LF3A 2VDNL 1OM3L 3K1KC 2FX7L 4WO4B 3OHXA 1KV3A 4V2BA 2VXSH 5E1HB 2HWZH 4XWOC 5I1HL 1YEJH 1BBDL 4XPTH 2DI9A 2NY4C 4ODUA 4MDJB 3FO1A 3EDDA 4PGBA 1VA9A 1UKSA 2EDJA 1E4XH 2AK4A 3LSOA 5CWSA 4X4YA 4M6OH 5E5MA 3O3AA 3TT1L 4MJ6A 3WFBH 5E5MB 4DGYL 2CXKA 4HPOH 1ORSB 5JORA 1NEZG 4NRXA 3SQOH 1SMAA 3NH7L 1Q72H 2IALA 4PB9H 4HH8A 2JIXA 1MF2H 4JR9H 4L9LB 3N1PC 3O2DL 4MSWA 2P8LA 5J89A 3O3DB 5DC4B 3BX7C 2P8LB 5IW1A 4F3FB 5HDOA 3T09A 5AWNH 2ZOKB 4ZUUB 4NC2B 3SDYL 5T1LB 4JG0L 4OCLC 3RWGA 3D3VA 4NQDB 4PP2B 4OCRL 1LDSA 2ICWJ 3TNMA 2VLJB 4B41A 1AXTH 4MNHB 1AFVH 5EA0H 3HC0B 5FO7A 2X40A 4MA7H 5DD1H 1U91B 3RGVB 2DM4A 1WBZA 2PO6D 5F70A 5FYKU 3L3KA 1ZS8A 2R56H 2WWMC 4GKSB 4YZFF 3NABH 2RCSH 1RZJL 3BKYH 4R3SA 3M07A 4EBQL 2Z35B 2J88H 2ZWLT 1L0YA 2HLFC 5A2LH 2VLME 2JE8A 5KSAD 4WIQA 3FQNA 4BH7B 3QDJD 4M6OL 3DETD 4ONOA 4ZFZA 2NTSP 5I1JH 1I8IB 4XAKE 3HPJB 1RZKH 3FMGL 2DKMA 5C3LD 1ES0A 3QAZC 1AJ7L 5FYKD 4XCEB 5EU4B 3HLAB 2HFGH 3RDTB 2F5BL 2YK1L 1ULVA 4TRPH 4UBDC 3MTRA 4PLJC 4U2ZA 4LRIA 1CFVL 2R23B 2LE9A 3CLEL 2YEZB 3K4DA 4AK1A 5JQ6L 5CSZA 1B0GA 4H0HB 5FYKH 4QOKA 4WY7H 2D4FA 1KT2B 3C5ZD 4NSKA 5IW6B 3P9MB 1U8QB 1T66C 1KCRL 5T1MA 4P2OD 4LSVL 5GGSA 3RWFA 1CQYA 4Y5YA 3MRKB 4KRLB 2QQKH 5EBGA 5F7HA 4PGCA 1I3UA 1R3KB 1ZEAH 5CJOH 1GOHA 3FB7B 4MJIB 5CP3A 4FQQA 1R3KA 2DQUH 3MRRB 1NSNL 1T1ZB 5H94A 5L2KE 3P77B 1D9KB 3P4MA 4LLQA 1BM3H 2W60B 1PQZA 1KNOB 1JI2A 1VGEH 4JRYA 4WW2A 4CVXB 2VC2H 2IBGA 5E9DE 4UNVA 5I15L 1KB5A 1D5MA 2A74B 25C8L 1E4WL 3H7LA 1JRHH 1KIPB 1A4KB 1V7NH 4K07A 4LGSB 3SDXB 3VGAC 3PIQA 3O2DA 2HT3D 4YDIH 4JO2L 2B0SH 1DQLH 1RUKH 3ME0A 4OKDA 5B4MD 5KANI 1H3WM 3DROA 1MFNA 2AJYL 3BWUC 2EXWD 4HJJH 4OFVA 4GG6F 3UO1H 2YA1A 3BE1H 3S35L 4RGOH 1C12B 2NY3D 1JFQH 1F8TH 4PJBB 3RY6A 3ARVA 4QHKJ 2O5YL 3BIKA 4OGAC 2ARJA 3MLWL 5DJ2B 4ZPTA 3WFEH 4X6CA 2UUDH 2AK1H 4NO5B 1A6VH 3B9KB 2J5LB 4HIIB 2DDQL 3LKOA 4J3SA 3NIGE 2HKHH 4HIJB 2ICCA 2N4IA 2P5EE 5TE7L 3D85A 4PTUA 4UIMB 1EBAA 3ZYJA 4JFDB 5FO8B 2WAHA 4HT1H 4XC1H 1AQKL 3RIFK 4F7MA 1MFCL 5J56B 1AGFB 1QFWI 2GAZA 4G6AC 1IGIH 4L8SB 3RWCA 1NCTA 2XXMB 2A77L 5JOFA 3CK0H 1DVFA 2MQCA 3VXPA 4HFWA 3H9ZA 4L8SA 4PJ9B 4QO1A 1SY6L 4EI5A 4PJ5B 2YC1B 1KFAH 2M8XA 4ODSL 4Z7UE 4PREA 2AGJL 3IDYC 4QCIB 2IADA 4OD1L 1ADQA 5CGYC 1NCWL 3HMXH 5CUSL 4JEGB 4QYOB 3WEXA 4TSAH 5DHXB 2VE6B 3SKUD 4I9WD 5TF0A 4V1DE 2SEBB 3D25B 2FLBT 4LKXB 4OZFG 1CS6A 2HJLA 1NGZA 4KQ3H 2A1WL 1AC6A 3TN0B 5GRYA 1XGRA 5IBLC 4G8FA 3EYQD 3KWWB 1S9XB 4L4TE 3H6JA 3O9WD 1FL6A 2EDDA 1KCKA 5D2NB 4D9LH 2XACC 4J4PA 4XTRC 4Z8FH 1RULH 5C0RL 3E6HB 3IU4L 1YEHL 2CIKA 1VADA 3PHOB 5HHPB 3GIZL 2V7HB 1MEXL 1GZQA 3D9AH 5HBBA 2EYRA 3KPSE 3MJ8B 4J2XA 1DE4B 2YUVA 1WWAX 1AXTL 1N64H 2P5WD 3B6SA 3S9DB 2VAJA 4LGRB 2VZOA 3VXUA 4XAKD 1V7ML 3T77B 3MC0A 4ZS7H 1TZGL 3NH7H 2WIIA 4AG4H 2HMIC 5EO1A 3IT8D 3X13B 2ZUVA 5F7EL 1QSEE 2E7BA 2CKBB 5D7JA 2C4FU 5L2JB 4CNIB 1UXWB 5C2UB 3OAUH 1WBXB 4PV9B 3MFGB 3VH8G 4LIQH 1U3HA 5I1KL 4H5SA 4IRJB 2DYPA 3O2VL 3RPKA 3HNTL 2J2ZA 3VXRA 5IV2B 3T65B 2AI0H 5CBEA 2OP4L 3BSZL 4UV7L 4I5BA 5C0AA 1JHLL 4L9DA 4WENB 3QRGH 3MNZA 2QR0A 4MNHA 4ZAKA 2VXTH 1JGLL 5ADOH 4JHAH 2AEQL 3RWGB 3C6LB 1I3RB 3T0XA 1QBBA 4ZAKC 1T2JA 5HPMA 2O5XH 1VFOA 3MV7D 3CDCA 5D7IE 1XIWC 5IJVA 3G6AA 5B38G 4XZUA 4JANA 3D0VA 5ID0A 3SDXE 4HF5L 4I18A 4LLYA 1J11A 3MUGA 2Q6WB 3O6FB 4G80A 4GG8A 4X99A 4U1JB 1AGDA 1LDPL 2NY6C 1TTGA 3G6JA 2GTZA 5T1LD 4S11A 3VFSA 2G9HA 4JFXA 5LXGH 2C3VA 2LU3A 3BP5A 3MV9A 1A1NA 4ODBD 2B1HL 3FONB 2VJXA 3S96B 2XZAH 1TMCB 4XH2B 2HVJA 2CR3A 3SCMB 4HXAL 4ZS7L 3L7EA 3C6LC 1VACA 3BKML 5EN2B 1MIEH 2R1WA 1CGWA 2PTUA 4X5WA 1UACH 3VWJC 2NYYC 1HDMA 4G9DB 2YPVL 4XBPB 4BUHA 4DKFH 3KPOA 1MCFA 4JGMA 2VR5A 1IEAA 4PRPD 1EXUB 4R4FL 1UVQA 4HDIA 4Q9RL 3RIFF 2ZOLB 2VXVL 4JDTH 1X44A 5I1AB 4Y5YB 5HI3D 4HMDA 3SO3C 43CAA 3SGJC 4BUGA 4LASH 2IQAA 4JHWL 4ELMB 1R3JB 1QNZH 3F7VA 2R8SL 2CR6A 5BV7C 1PZ5B 5TPWH 4Q9CA 2VERN 3GGWA 1KTRL 4FNLL 2D0HA 4HIEB 4CU8A 3EHBC 4KHXL 1HKLL 2MQ3A 3MCKA 3IFOA 4HXBH 4TULH 1F4AA 1DQJA 1VESA 2DWEB 1CXLA 5DO2D 4LSDA 3FT2A 3L3IA 1P5UA 1VEOA 1F8TL 2PXYA 5MERA 1S9KC 1CLYH 2FJHA 2NNAA 2VB5A 2X4RB 4I9WE 3O2WH 2F54D 2H26A 1KNOA 3BRFA 5IMLA 2BJMH 2X4RA 5JMRA 1J0ZA 2ZCKH 1CXKA 4XP6L 2H26B 2VABB 4RGND 1NCAL 3MV7A 2X89D 4IRZH 2VWEC 4X9FA 1S7SB 2Y7QB 4OM1H 2ICEB 5B39B 3TIDB 2IH3A 5C08E 1SY6H 4XMPH 4WI8A 1YNLL 3CX5J 3R8BB 1HXYA 5CHNA 5E6IB 3BH9A 1P7HL 2PO6B 3CMOL 4NYLB 1CLCA 1XR8A 4IRSD 1P7KB 4HUUB 4XNYH 2HJKA 1UGNA 2HTLD 4DN3L 1KJ2B 4UT9L 3CFBA 3GMPB 1IBGH 3MXVL 3QDGA 4R7NB 1KJVA 1QQDA 5T1DL 3LQAH 5E8DH 5I16A 1F90H 4XCYA 4E41A 2DBJA 3HPLA 2JIXB 3DIFA 5FK9B 3MO1B 5L9DH 3GHBL 2YKLL 3VWJD 3MJ9A 4OAWB 1CVRA 1EFQA 1YNKH 3NCYS 3VFWA 2CJUL 2OQJA 4D9RE 3QXAB 3IF1A 5GRUH 5HYJA 1A4JA 2VAAB 3DX6B 4MLSA 3GSWA 3U36A 3UPRB 1OAQH 3IU3A 3F6IA 4FFWD 3RI5F 4DFHA 5ITFA 1DUYA 5C0GB 5IROA 3TBTB 5I0DA 5DDHA 5BXFB 1JNNH 4N1EA 2BNQB 1J12A 2XI9A 2NY6D 3QAZB 4JFQA 3VXOA 4AH2B 3UYRH 5HGAA 5HVWA 3IXTB 4HAFA 3GSQA 2QLVB 5CLWA 4KK8C 3EFFB 1I3GH 2VNCA 4UT7H 4DN4L 5IMKA 2EDRA 5SX4I 1OP5H 2DLIA 2FJGB 3C08H 4UI2A 4XMPL 2PYED 1ZTXL 2ZJSH 5DMJB 4RNRB 3EDFA 3TCXA 5HHVL 3IVKB 1FG9C 3HE6D 3O9WB 1A21A 1A3QA 4X83A 4L3EA 3N1MC 4NN5B 4X7EC 4ZFOA 2VE6A 2EH8H 1BM3L 2F53E 1X5HA 4NKMB 3H7BA 5INCA 3PABA 3UAJC 1A9BA 1KJ3H 1GAFL 4YHML 1M7IB 2EKJA 4FFVD 4JG1L 1VPOH 3MV7E 2D03L 1I8IA 4HPOL 3ULVF 4PJ8C 4MXWL 3QI9C 1A6UH 3Q5OA 2H1PL 4C83B 3VFPA 3EOAA 1EO8H 4NC0B 3V4PL 4XHJD 4C83A 1U2CA 4KUZL 1QLRA 1N8ZB 2AV7A 3CFJB 3V6FA 5IMOA 3MGOB 3HZKB 3WKMH 3CFJA 3R1GH 1IC5H 4TUKH 3T77A 3V4VH 1FFNB 1GHFH 1IEBA 4EI6A 4GLRI 2A9NH 1OM3H 2NY3B 3SDAB 1XF5B 4ETQA 5DJZA 5I1CL 2CJUH 4OLEA 1CT8B 2CUMA 1MUJB 4N9GA 3WE6B 4HGWA 4J3WA 3V6OC 5F7UA 5DHVH 2EH7L 4PJEE 5FM5M 4I3GA 3SGKA 1KYOK 3O0RH 1D9KA 3GIVB 4NNYA 2Y5TA 4YBLC 5FOBB 3QFJA 3ZDYF 2OSLB 4YK4C 2E6PA 3B9KC 3IJHA 12E8H 5C0AB 4XPAH 3ILQC 2EEBA 1V3KA 2FX8L 3SOBL 5FKAA 3BQUC 3OKKB 4HF5H 1UJ3B 1FNSL 4GBXD 3VRJB 1S9YA 3TWCH 1G7QB 1QO3B 5FCUH 1TETH 2I27N 3EYQC 4RA3A 4X4ZA 2NPLX 4OI8A 3IDUA 3VXQB 5DR5L 4DTGL 4P2QA 2EIZA 4L8BB 3B9AA 5GGUA 3BPOC 1YQ2A 5MP6L 3V6ZA 3S3PA 3QJHB 2W0FB 5TDOB 1KJMA 1JZ7A 7FABL 2IMMA 5F1OB 3BZ4A 4S1QL 4LGPB 4JVPA 3NZHL 4Z7OF 5BVPL 4XNXH 2V2WB 1I7TA 2D9CA 2X4SA 4H8WH 4LCYA 1CDGA 1Z9MA 3D18B 5KSBF 3ARUA 1S7WA 2H32H 3OKMA 2FR4A 5BVJA 1ZT1A 5BOPA 5IB1B 4HZLB 3D39D 1UJ3C 1QP1A 3BHBA 1I1AB 2NQCA 2ED8A 5FUCE 3TA3D 1HK6A 1FFQA 3QIUA 3BIAX 5SV3A 5DUPL 3F5WB 8FABB 2VLLA 4K8RD 4XVTL 2ENSA 5K33A 4NRYB 2ZOLA 2BMKB 2Q7YB 5MI0C 4RAVA 4UQ2A 3TJEL 3BEVB 3VGHA 2R69H 5JZ7C 4EVNA 1EJOH 3JUZA 1FORH 2YRPA 2VMFA 5IB2B 1U8LB 3ZHKA 3OXRA 4D9RD 2R15A 5DD5H 3NCBB 3CFDB 1A22B 1Q9KB 5I1GH 5ALBL 5ESQB 1SVCP 3KYKL 3FTGB 5BZWB 4P4KD 2FDBP 4HUWA 2CRIA 4WHYG 1YEEH 3I75A 3V95A 4O5LL 3MNVA 1MRCL 3ARDA 43CAB 2PTVA 3O3BA 5C0BD 4N0UA 1JPTH 4H1LA 1L4IA 3PXHA 2EO9A 5EH1A 1PZ5A 5DGRA 3OKLA 3R4DA 3ZL4H 4X7SH 1XGRB 1IKNA 1EGJA 2HT3C 3JWDC 3KHOA 5MENE 3QG6B 3DYMA 1DLFH 1MWAB 4QHLA 2VL5B 2HJFA 2WWKT 4HLJA 4GG6A 1NPUA 4G6JH 1DQJB 2DWEA 4Q6IA 4LCIH 2CMRL 2YD2A 5BS0B 1W0WB 1U95A 5T5FL 2I07A 4MS8D 2BSED 2D7OA 4GAYB 3IDGB 4PG9B 3QDJE 4XPBH 2I26N 3B2UC 4LCWD 3BZFB 4H88H 1HCFX 1HYRC 3F58L 2R2HA 4WWID 4LSRL 5D7IB 3UTSD 4GT7A 4Z5RA 3RVWD 4APQD 2YPKB 1AXIB 1T1YA 1GGCL 1MRFH 3LS5L 1JWSB 1K3ZA 1DDHA 5EBWB 5JXEA 2IBZX 3BP6A 2XTJD 2J88L 4CNIA 1KENL 1JGDA 5DK2B 4MJ5B 1R5IB 1NUGA 1T5XB 2AV1A 3U79A 1NFKA 2UYLA 5DK0B 2YXMA 1AQKH 4LNVA 2V17L 4X98B 4Y5VB 1EMTH 5GS0C 4LLUB 1XMWA 3TT1H 1IARB 3CAFA 2EO1A 2VN7A 3MA7A 5D1XB 1EFXD 2HFEA 4PLJD 1IVLA 1QHOA 1E6OL 2YXFA 2F5AL 4JO1H 4EUPH 2GITA 2AXGB 4MX7A 1SJVA 4NN6B 4LP4A 4WO4D 2NY6B 1YEKL 1I8MB 5ISZA 1IGTA 4QXUH 4OUOA 3CSYB 4KKCD 4JN2B 2XOTA 5E8EA 3KS0H 1CIUA 2V5SA 1G6RA 4CU6A 3P4OA 4XBGB 5EUOA 3B9DA 5J1AA 1A7QL 4I0PA 4E41D 5KSAC 3L3DB 1MEXH 2VLRE 4JRYE 2HLFD 2P24A 1QFWH 4IIQB 2DQGL 3TF7C 3QRFM 3ULSA 3QWQB 5GGQL 1S7UB 3O3EA 3HC4L 3S98A 3MLRL 1IZJA 3OR6A 2ATPB 4RIRA 3MXVH 4FMKA 3GJFH 2ITDA 5J06A 1A9BB 1GGIH 3JZ7A 4J3VA 4B53A 1BFOA 5I17B 2IC2A 5GSRB 3EZJB 1K2DB 2FGWH 4FFZH 4LCCB 3N1QC 5HVHC 1GIGL 1HHHB 2YD9A 1P4IL 5F89A 1K2DA 5D7LB 2XA8L 1TPXB 3PE9A 4OD2A 4WI2A 5F8QC 5HY9B 3TBVB 4D9LL 2J8OA 4F58L 3HLAA 5EORH 4F8TA 5DC0A 3UTSB 5JDJA 5IF0B 2JJWA 2XQBL 1Q9WB 4AMKH 5F1NB 1FVEA 1JJUA 3ARZA 4OBRA 3BUYA 5E6ZA 1VACB 1YECH 1G7IA 3GHEL 3MACH 1OQXA 3EOBA 4JO4L 4KK6C 3BJ91 1S7VB 5KTEL 4WVRA 4NT6A 4PUBL 4PRNA 1RFDH 4MXQD 4ZD3H 3D39E 1UM5H 3QUXB 4LRNH 3BMWA 4K3DL 1CQKA 2BHZA 3P73A 1BVKA 2P49B 5I2IA 3D5OF 4XWOD 2ZZUT 5EC2B 3I6KB 4KKBC 1EH9A 3MJ7B 3BP7A 3VGAB 2YPLA 3O2VH 4CL7A 4QWWD 4OT1L 3GEWB 5KS9F 4R26L 3TESA 1ACYL 1VFUA 1H3PL 3FO0L 1PKQB 4LSQH 4RMWA 3IJSB 3CDGB 1JBJA 4HIEA 1Q9OB 4MA7L 5DD1L 2C9AA 3VFNA 2DQIH 4WI7A 3CX2A 5IOPA 3JV4A 4ORGB 1R24B 4PJCB 1J5OH 4GAGL 2P42B 4GMSL 4U1IA 5JA8B 4GBXA 5GGQH 3PWPB 1NQBA 1MJ7H 1N5YL 3LOWA 3Q6FB 4KMTH 2E9IA 5JR1L 2B4CH 3D3VE 2AXFA 4LDEB 4QTHB 1NAKH 4JRXE 3B5HA 2OCFD 5CGTA 5C8JA 5DYOA 2VLRB 3M17B 4YR6B 3IDNA 4OLWH 3DRQA 3O4OB 5SWSE 1JZ2A 1L7IL 1OW0C 1PG7W 1S5IL 3HZMB 3TJHC 2QV2A 3EO9L 3O81A 2PO6A 4X5XA 4UV4H 1G7HB 1AP2B 4OZFH 4CBPA 4NQSA 4LSQL 1DLHA 3BKJH 4GQPH 15C8L 4X6CB 2ADJB 4E0RA 5HI4D 3MNWB 2UZIL 2XYCA 1JNJA 5EFIB 1QBLH 5I16B 2LQRA 2B4CC 2LU7A 3LV3B 3DURB 3TP4A 1CGVA 1JCKA 3MLYL 1XGQA 1T1WB 4XCCH 3QDGB 4R7NA 4QXTA 4PRHD 4M7ZB 3X3GH 1T1WA 5TDNA 2QADC 1JYNA 1BZ9B 3MUZ1 1T1ZA 2HRLA 3U2SA 4XVJL 2AEWA 2HN7A 5FO9B 4J23A 4JVWA 4LSVH 2GSGB 3NVQA 4FQLL 3QDME 4APQA 2EDEA 1YZZA 5DRNA 2EC9T 1BECA 5E2UH 3OSKA 3TVMC 1IGCH 2AJXL 4JKPL 4DQOH 3DMMA 3LQMA 5J12C 1OTTD 2LV4A 1D5ZB 1JZ4A 5CSGA 2H6PA 1QR1A 2HT4C 3LB6C 1SJHB 5DA0B 5FKPA 4I2XA 4PBWD 4IRJC 2DQFA 4NKIH 4HUWB 3OJDA 4L8DB 3MUJA 3ZKND 1JGVH 4KU1A 4KRMB 1KTKE 5F7EH 2HVKB 4ZPTB 4L1DA 5D2LB 4DZBB 1N6QL 2ESVD 1YPZE 2QTEA 1IGFH 4Y16A 5E7FA 5C92A 3AS2A 1TCMA 2FX9H 1RJYA 4WCYH 1JHKL 1XH3A 3LEYL 4ZFGL 1RZKL 1A5FL 1VPOL 4LPCA 1LEKA 1XH3B 3CDFA 5IMMA 4PRBA 4OLXH 4K7PH 3M1BB 3DRTA 3NTCH 3VFVA 1I1YB 4IHOA 2VR9A 2OZ4H 5FHBL 2AJ3A 2P8PA 3TBYB 1P2CB 4LCWB 3RNKB 4IHOB 3NA4A 3FFCE 3MGOA 5D1QC 3CVHH 5ILTL 3GMOA 1IM3A 3FT3B 1EGJL 3S4SA 1PJ9A 3PWPE 1ZVSB 4LFHD 2B0SL 4M9PA 2FHCA 4NKOB 1DQLL 2R2HB 4DGVL 4ZYKA 5LAXB 4HSQA 4Y19D 3DYOA 4ONHB 3CXHJ 4KAQH 1XF5A 1N0XH 5E9DB 3VI4E 1BQHB 3WDJA 4YXLH 2BK8A 3CVIH 1GC1H 5HHOE 2VQ1A 2VDOL 4OZIB 1JPSL 4PJGB 1UZ6F 4KI5D 3FO1B 4PGBB 5GGSY 5IR1B 1JTOA 1NSNH 3FQTB 4HWZA 4X7SL 1MSPA 4ZUTB 4NZDA 2P48B 1VFAA 1ORSA 1RHFA 3J7HA 4JRYB 4YHLL 3RIAK 1MCDA 5GRZA 1IAIM 4DUXA 5I18L 3G6DH 3O4LE 5JIHA 2CIKB 4P23D 4ZS6D 2GY7B 2FH8A 4P3DB 1B6UA 3B2VH 5HHME 3UJIL 5IHBA 2PN5A 4AENA 4DN4H 3RHWF 5GZND 4MCZB 3OB0K 1N6VA 2AXGA 1AHWC 4NQXB 3DX9A 3DVGB 3QT2A 4NQDA 1F4WL 2RR3A 1AD0A 5CFHA 4G7VH 2YD3A 2PKDA 2W0FA 3L5HA 4LVNC 5TDOA 4JY4B 4AQOA 1I7RA 2VZUA 1GIGH 2IPKB 2DIAA 1ZA6A 3BVNB 5DI8B 3ZYOA 4JFHD 4JM2A 1UADC 5C70A 4YBLB 2PETA 4YHLH 2A9MH 3OQ3B 5D2LF 5BQ7A 2HG5B 1VHPA 4ELKA 1HHGB 5CEZE 3VFSB 1E0OB 4GKOA 1FNGB 3C2AL 3SE9H 1IRAY 3ZDYE 2JCCF 3D85B 5JHDE 2XG4A 4YDJA 4ENED 1FVDA 2V5YA 4O2FB 5KVGH 1N3NB 4YDJB 3U9UA 1ZHKA 4X7TA 1OPGL 3SO3B 1U36A 5DURB 1G1CA 5ISZD 3VG9B 2ED7A 1CU4H 4PYHA 4XNQB 3T0EB 4AIZB 1NBZB 1BGXH 3EYUL 2NW3B 4O9HL 1A0QL 4XCEA 5EU4A 4PJ5A 1ZMYA 4PJHF 4LSSL 5D96B 2GJ6E 4FQ2L 1NCBL 4H25B 2ICWB 3TIEB 2AS5M 1C5DA 1FH5H 1KPUB 5FGSA 3SKJL 4NT6B 1KT2A 3RVXC 5LGKA 2UY6A 3QDMD 2BXZA 3GMMB 3K4ZA 2QKIB 2CO6B 1TITA 3S88H 5JXAH 4HS8H 2LVEA 3FJTA 3U7WH 5IJVB 1KLFA 3BFOA 4L4TB 1MAJA 3SCMD 2OJZH 2OJEB 4DCQB 3WBDA 5E6ID 1HEZB 5DMKB 3MR9B 5KZCD 4FXGA 2NTFB 1HI6A 4OCXL 4PJGE 3IU4H 4Z7UB 4LARH 1OL0A 4FQQB 4O4YL 5EUOE 3VXSD 5MERB 1T04B 1JK8A 1KELH 3U83A 2AABH 5GHWH 2D7PA 3WSQL 2BRRL 2Z0BA 5F9DC 3AAZA 3GKZA 3LN5B 4JKKA 4PJXF 5HJ3A 1U93A 4PJGF 4LU5L 3WCYA 3QYCA 5HJ3B 2MNUA 1KF9B 3DRQB 5ETUB 4OIAA 1KCUH 1MREH 2F15A 1IQDB 1G6VK 3DHMA 3FQXB 4LLVA 3RWDB 4MWFB 2QQNH 4OM1L 4GKNA 3ZT5A 3DX8B 2MSPA 4Z5RB 3UJTH 2FCBA 4NNPL 2YD1A 2H8PB 1KFAL 1S5HB 2JB5H 1ONQB 2A6JB 3K8LA 1HSAA 4XI5C 3AB0C 2MHAA 3CFCL 3DGGA 1F4HA 5IKCA 2Y36H 2MCPL 2OBGA 4ODUB 1EERB 5CZKA 4G8GA 1HYSC 4YE4L 1CGXA 1A6TA 3HRZB 1JNHA 5FV1L 3B5GA 1ADQL 4BSJA 1XZ0B 4C55A 1K6QL 1PY9A 5D7KE 4JHWH 1P9MA 3VCLA 2FJHB 3QWRD 1XGTB 4O2CB 2YHGA 5C07B 4GUPA 5SWSB 3VD4A 4JFEB 5EU3B 2DQTL 4CRPA 3PNWA 5JXEC 4FXKB 3HC0A 3GSVA 1CG9B 5C2BL 2P24B 4IIQA 1DVFB 4ODHL 4WI6A 5L2KB 3VGEA 4RX4D 1MCKA 5KOVC 5GS2H 5GRWA 1MCOL 4JFQB 3VXOB 4PJ8B 5F9WC 3MOAL 2A73A 4PTTB 1WZKA 2CSPA 1KCSL 2F19L 2JF1A 5HHMD 4M6AA 3EFDL 3Q1SL 4W81A 4CADA 4NKMA 3GJFK 5FYKE 1TZIB 3RBGA 4YDVB 3Q5TA 5E08L 3MJ6A 4BQ8A 3U4BL 5I6XC 3KNBB 2KPNA 2EDFA 1PEZA 2C3VB 4OFKA 1IL1A 1ZWIB 2DL2A 5INCB 3MO1A 3QNYA 2H9GA 2GJJA 5F89B 4KRPC 2XFXA 1QBML 2YD6A 4D2NA 4QTIH 2VH5H 3V0WH 2C3WA 1MRDH 2HFFB 4Y4HB 3BPOB 2PTTB 4MD0A 2VDQL 2A1WH 1F4XL 1KN4L 2PTTA 3HA0A 3WDHA 3UYOD 3RBSA 3FRUB 5CEZD 2BHUA 3G5YB 4GRWB 4EDXB 4EN3A 3RNKA 3WJJC 2D7MA 2R1YB 4G43A 1AGCB 3P9MA 3DSFH 4HS6B 4MLIA 4XVUC 1YNKL 5BRZB 1TNNA 2XIDA 2XPGA 4RFOL 1B0GB 3VXUB 3O2WL 4KKNA 5EBLA 3VWKD 2YPLE 4F9PA 1P4LB 3X12B 2FGZA 5CP7A 2KL6A 3SO5A 3SDAA 1GOFA 4XC3H 1NJ9A 4Y16D 4LNRB 1G9NL 4KKLD 4I8DA 4LNRA 3QCVL 3FCTA 2FJFB 4JPKL 4DWHA 1JYXA 5E24E 1IKFH 3ZKQD 3Q3GB 4PGCB 3PL6C 3TZVD 4KK9D 5HPOA 2QSVA 5FYJE 1GGIL 3LKRA 3OJVC 4M93C 3VRLE 3SGJA 3OX8A 4JB9L 5BV7B 1S9YB 2J1KA 1JMXA 1KCSH 2F19H 4YHPA 4IRZL 1S78D 1WFTA 5DYOB 3H9HB 1DUZA 2E8YA 1WZLA 4AJ0A 5B22A 3W39B 4MA8L 3SDCC 4M1CD 5EOQH 1CLZH 1NFIB 2D7QA 5C0JA 2PF6A 1FH5L 4H1LG 2X4QA 1Q72L 5L8KB 1BIIA 1QLEH 3SE8L 2CLZB 2R29L 2CRMA 3MCLL 1G7HA 5CILH 4ODTH 3NPSC 1AR1D 3GRWL 4JDVB 1IC7L 3W81A 1PG7H 4TOYL 1EHLH 3WE6A 3X17A 3WNNA 3QJHA 5AWNL 2HTKD 4U1NB 5DURD 1XFPA 1UT9A 3MNWA 3O6LH 1ZSDB 3QEQD 4WWKD 1DQML 4DGIL 2C1OA 4U1LB 3EYFA 5D93B 5C09D 2QJDA 4QXGL 3FQRB 4MHHI 4KKAC 2J4WL 3MZGB 5CCKH 1D6EA 1OW0A 5KG9B 4NZUH 4V1DD 2FBJL 3F7YB 3N85L 3RVTD 3VXUD 1VSCA 2F9BT 3QZWA 1A9EB 4LRNL 4D9QE 2OL3L 3O6MH 5I0ZA 4RAVB 2XQBH 1O0VA 2RGSA 4GO6B 3QCTH 4LVHB 3UZQA 4G8EB 4NUJB 4L4TD 1UKTA 3QQ9D 3QHTC 1RMFL 3IETB 1BP3B 4EI5B 3QEGH 1KACB 5E2TH 5D7KD 5E2WL 1KCVL 2X1XR 4EUPG 3TO4C 1S7TB 1P9MC 2DQFB 3CC5A 1ZLUH 4YDLB 5CMAB 3A6CH 5A16A 4PFEA 2IQAB 2HFGL 2YWYA 1LK2A 2FB4H 4Q0XL 3EUUA 1TJGL 1I7TB 4PG2A 4E41E 4Q97A 4OM0L 5DUBB 1UM4L 5JTWA 5EWIL 4JRYD 2D0FA 3DV6A 3INUH 4H20L 4HZLA 4KQ4H 4R4BB 2Z8RA 3AAZB 3LN5A 5J6HA 1IGMH 1X7QB 4X6CF 2XWTB 1CDJA 1AGFA 4WDIA 2VZSA 1MLCB 2VN4A 3X3FH 3ULUC 2HP4A 5IVXB 5FGBA 1IC5L 3QIBD 4TUKL 4Q6IB 1JGEA 5AZEH 1EO7A 2CIIB 4ZMAT 1NDMB 1LP9B 3MLSL 4EVNB 5D1ZB 1HHKA 3MJ9L 3PQYB 3PWVA 4UOW0 4Y4HD 5JW4Q 4JJ5B 2J6EA 2KBGA 3UTQA 5HYEA 4DVRL 1RJZB 4ZFFA 2IAMC 1KYOJ 1CGTA 2AXJA 2HJKB 1A7BA 3I75B 4C54A 1J8HA 1XR9B 5ANMB 2DQUL 4XRCB 2YUZA 5ANMA 4NFDA 3MLVL 1WT5A 1RIUH 5DJYA 2XWJB 3KPNB 1C1EL 1IM9B 3NZHH 4UU9B 3VDAA 3WS3B 4G8GB 3QPQD 4KUCD 2J8UA 5ERWA 4PJDF 4NCDA 1RZIB 5EZIL 1OTSD 2R0WH 5AYQA 1BF8A 1T7XA 3ZE1E 1CWVA 1G6RB 3VXRB 5IV2A 2V7HA 3IKCB 4GAJL 2GUOB 4ESKA 2R9HC 2NXYD 4JHZA 1MCSA 2QSQA 3MLUH 4M8QB 2R4RL 3GSNL 3N9GH 1JMZA 4K71B 3D2UB 3FQUB 3PNWB 3CNKA 4I1NB 1P84J 3D2UA 3ULVC 4M7JH 5IEHB 1IT9L 4JM2B 4HJGA 5DF0A 3RZCC 2IG2L 1TDQA 1M1SA 5DI8A 2WIIB 6CGTA 4TN9A 1AGDB 4Q58C 5EU5B 3MGTB 2OK0H 3RKDC 5JIIA 4R4NC 1JHKH 3CU1A 3OR6B 5HGHA 1PW3A 3TN0D 1HZHL 5ABDE 4PJBF 4QRRE 3RU8L 4P23B 3EO1A 5SWSD 2CKNA 3TBVA 3TBSA 3QXTA 5JO5A 1TQBB 4ODVH 1OAUH 1BLNB 3LEVL 4PGDB 4PJHA 4XH2A 4U3CA 4LSTL 3HFML 1CFNB 3MRDA 1F5WA 1FDLL 1M7IA 4XNQA 1JF1A 1ZANL 4XT1C 5DZNA 4TNVK 1U8OB 4U2YA 4F7TB 1LWRA 2NW3A 1T0PB 1FFPA 2VDML 1IGTB 3F8UB 4F7CB 3MBXL 5EDXA 1HH6A 3MNZB 1GSMA 3WIFA 3QNZA 4PJ9D 3EOAB 3KLSA 1G1YA 1MCNA 4PRHE 2GQHA 1ZLSL 5CEYB 1RY7B 4KGLA 4XBEH 1F3JA 3KYMB 3KJ6H 4Y2DB 1XF3B 4QRPA 3MRHB 1NUNB 2F54E 2VDKL 4U1HA 3CX5K 1C08B 4GOSA 5CGMA 3O3BB 1WCBB 4Z0BL 4F33B 4FQCH 2C4XA 5EBLB 3FRPG 5L6YL 1QYGH 1QA9B 2P4AB 3H9SA 2W9EH 1P5VA 1N5AB 1S7QA 2EDOA 3CFKA 1CGUA 5LGJA 4TUOB 3AS0A 1QRND 4F2MA 1YMHB 4CKVX 4HXBL 1FAIL 3NA9H 4YBQD 5DVNA 1J8HE 3QQ3B 4IOIB 2ZG1A 5IW3A 2Y6SC 1QLFA 4ODTL 1BJ1H 1JGUH 1A6ZB 1D5BA 1K8DA 2ZG2A 4G7VL 1KXQE 3SEPA 5KBNC 1HINH 4Y4KD 3DROB 5FYJL 4FQXB 5ICXB 1DSFH 1H8NA 2B4CL 4TPRL 2AJSL 1YEHH 1INDL 1A3LL 3ARGA 3CH1A 1YJDH 1S9WB 3WLBB 5KVGL 1G7JB 4QGTA 4JFFB 1Z3GL 3RWEB 1EDQA 1ZANH 1UB5B 3MACL 3OHXB 3V5DB 1VKXA 1WAAA 5DD0H 1Q9LB 3ARBD 1KJ2A 2IALB 3GGWB 5IB5A 4NHUA 1VEMA 4X6DA 1PKQA 2AEPH 4J4PC 3TVMA 4E5XB 2Q8AH 1NLBL 4U6XA 3WXWH 1TJHL 1A8JH 3MRBB 4LFHG 1FVCB 4OLYL 3K46A 2AK4E 2F8OA 2YN3A 4XPGH 5BXFA 1RHHB 5HHOD 4HGKC 4YHZH 3RWIB 2IBZY 4PJXB 3LH2H 4YHNB 1XGTA 1B9ZA 1L0XA 1YEDA 3TT3L 4K94C 4I0PB 4YHNA 3K7UA 4TVSa 3H42H 5M7QA 4K7FB 3TNNB 3D3VB 3GNMH 3KPLB 4OCRH 4MAUL 2NY7L 5ESAB 3MV01 1CDCA 5IIEA 2M1KA 1JN6B 4PB9L 3S5LG 4NM8H 1IEHA 1G9MH 1I9EA 2DJ4A 5CINL 4Q6IC 1L6XA 1V5JA 4U1KA 5EULV 3UTTD 2ITCA 4QHMB 2X9YA 3THMH 2X4UB 1VFBA 1FC2D 2W92A 2EECA 4N0UB 2PCPB 4XNUL 1UA6H 3KYNA 1A2YA 3P9WB 4O4YH 5JUEL 3P9LB 4ODWB 1SBSL 5J9PB 1NMBL 3QXVA 3RGVC 5I66A 4KZDH 5TE6L 1Q9WA 2Z31B 4GXUM 1KLGA 5C3TA 4NKDA 1KIRB 3MOQA 3FRUA 4X9HA 3TEUA 4AY0A 2G60L 3PHOA 3QP3A 4UTBL 4HBCH 3PWLB 4P5TD 1I1FA 5FHBH 1G9ML 1JTTA 1K5NA 3QI9A 2VIRA 5DUML 4FZ8H 4WEMB 1SJEB 5CBAA 5FKPB 5GS1C 1LEGB 5I76A 2D7NA 1A7RH 4HXAH 4WFGD 3DI2B 3GNML 5GGVY 3I6KA 5C2BH 3P2TA 5F21B 1EAJA 3VWJB 2X9XA 4C56A 3CJJA 2FB4L 5F6HJ 5T1MB 1RIHH 1G7MA 5CP7B 2DRUA 5D4QA 4ZOBA 4YE4H 2X44D 4ZPVB 1NUDA 2C7UB 1KUMA 3MRKA 4Y4KC 4JZJC 4ZFFB 4KXZI 5EWIH 1BQLL 1IM9A 5F1IA 4MQ7B 1BD2B 1AY1H 4PJIF 2BZDA 5D8JH 2ADGB 3X11A 5J0BA 2ZNWA 3MLXH 1NANH 4UOW1 3UTOA 5FKAB 2Y6SD 4NNYB 3AUVA 4GRMB 2R4RH 1LVEA 5E8OA 4LLQB 3QUYB 3SQBA 3SDXA 4KVNL 3IKCA 5DVKA 4IS6A 4ISVB 5IESL 2HRPL 4JM4L 4F57H 2XV6B 2C3HA 3F62A 3QEGL 4YNYB 4D8PB 3FQWA 35C8H 2YD5A 1YMMB 4QRRB 3CZFB 1RJLA 3VXSE 3TV3H 1QRNE 4K3HA 5D7IF 3STLB 1T80A 3V7AG 3C6LA 1U6AL 4RGMC 3SKNB 1F4WH 2PYEB 1FN4A 3VXME 4K9EC 1J8HD 3HTLX 1EBPA 1MIML 4DAGL 1I7ZB 3AS1A 1NMBH 3BKCL 2AJUH 3O6FC 4LLDA 4XXCC 3WHXA 3MUGB 2Q6WA 1QBMH 4XVTH 5HTSA 3V52L 1NEZB 1CD9B 4P5TB 1BZ9A 4PJAB 5KN5B 5FO8A 5BV7H 4YDLC 3U4BH 2F53A 3K2UL 5IFAL 4KJWC 1U8OA 5E1AA 1FYHB 3T0AA 4ZXBB 1T20A 2DJUA 4ERSL 5C0CE 5KZCB 4QRTB 4UB0H 5EZOH 5EG6C 4YUEH 1MJ8L 5J3HD 1GOGA 4MB4A 2JIXD 3C09C 1ZGLA 3UTSA 4FQCL 4YXKL 4DKEH 4BSVB 4C56D 3HC3L 4R4ND 5INDB 4PGJA 5MEND 4P2QB 4G6KL 4KMQA 1JF5A 4X80H 5GS3A 1C08A 3HE6A 4AMKL 3EJZC 5JPMB 3VI3F 2FIRT 4WW2C 3JTTA 2Z91B 3SJVA 3HE6B 2AKRA 3KGRA 1FYTB 5JW5B 1Q94B 4JZNB 5JW5A 4HEME 3BN9C 5B3JE 5LGJB 2NXYC 1PSKH 3D18A 4FMFA 3O8XD 4LCWE 1LEIA 1TCRA 3N0PB 4NRZB 3TC9A 4GG6B 5FM4A 2ZUTA 3KJ4B 5BS0A 1BFTA 4KFZC 1OT1A 1X4ZA 2WQ8A 2EYRB 5KSBA 3HB3D 5HGDB 4ZUSB 4EQ2A 4UZGA 3IRZA 4WU5A 3NFPB 1P53A 3P0VH 4FQXA 5ICXA 5I8KL 2CDFA 3RTQA 4IMKC 1ZLSH 3GB7B 5C08A 3VW3L 2QHRH 3ZSTA 1WC7A 1XCTA 2YD4A 5C8JB 5ESVB 2ARJQ 5DHVB 3QDGD 1G7JA 1RUAH 3PGFL 3QG7L 1IAOA 1MHCA 1DDHB 1A7NH 1QACA 3ESVF 4JM2D 5AAMA 5CS7A 3TYGL 1P7KA 4HUUA 3UX9B 4ZQKA 5I8EA 4D0BA 2NXZD 3WNKA 1FGVH 3OB8A 3QPXL 3BH9B 3LIZL 1XGUA 4Y4HC 2AK4B 5CWSB 3HG1A 1ZLUK 2NY0D 4JO1L 2LFGA 4Z6AT 4PV9A 4P2RB 3ZYZA 4M00A 5TGBA 1U3JA 1PD6A 3RVVC 2YMXL 3FAXA 1DVFC 3VXTA 3X13A 4YGAB 3SGDI 4PRAB 4FTVB 2JJVA 3OKNA 3GFUA 2AEIT 2VLRD 4HWEH 3EYSH 2X89A 3D39B 1DTUA 3LMJL 1X4YA 4NRXB 5F7DB 5H2BA 1DFBL 4S0SD 5DJYB 1WIPA 2NX5A 3GSXA 1PX3A 1G9NC 4H5SB 4IRJA 4P46C 2EH7H 2I9LB 1S7RB 1UKQA 3U4EA 3C60A 4ZTOL 4YX2H 3QFDA 5ICZA 3RQ3A 5D9SB 2BNQA 3GSNA 4EUPA 4A6YL 2CLVB 5DDHB 1R3LA 3T08A 3RWDA 3HAEB 3MQIA 4HD9A 4KC3B 4KRPB 4OCSH 2DBLL 3HAEA 1Z9SA 4HJGB 3UTZB 2HLAB 3FN3A 1WF5A 1CD1A 4FZEH 3RDTD 2VISB 1B4JL 1RV6X 2ICES 4XP9H 5D71L 5ACMA 3V6OA 4R9HA 1NC2A 3SE4A 3BDYH 2EE2A 1CBVH 3V0AC 4WUKH 5IIEB 2IMNA 4Z7VB 3VWKA 5T5NG 5JQHC 3MFFA 2G2RB 5DSCA 4DGYH 2Q8AL 4MSWB 3S36H 3LVEA 4DZBA 1L7TL 5DK0A 4NNPH 2Q76B 2IBBA 5E2VH 4DVBA 1INEH 3EO0A 3CFEA 1MF2L 4JR9L 3RTQD 1J8KA 1XZ0A 1YYML 4PJHE 3QUMA 4YC2B 2DYPB 5DS8B 3CFCH 2GITB 2J6EL 3O41B 1UYWL 5CJ5A 5I1GL 1XIWB 4UNUA 5IWLC 4I5BB 2H2PC 4OT1H 3FN0L 5B8CC 1NCUA 2CRZA 2GJZA 3K0WA 1Z2KA 3RDTA 1MCBA 4F7EB 1HH6B 2CRYA 4WWKC 2ICWI 4XBGA 5EUOB 5I75B 2FO4A 3BYYA 2VLKD 5L2KA 5C09E 4NHCL 4PRIA 3BDXA 1DR9A 3MBED 1FE8H 5EU7C 1RFDL 3DSFL 1AR1C 1U41A 3FOMA 2BC4B 2W59A 3BGFB 5C0CD 4WFFE 1M7DB 3MRFA 4LPTA 1OT2A 1WCBA 1PVHA 4HFUH 2IF7A 3B9VA 4MQXC 4RGNE 4D9QD 4NQCA 3W9DA 1BVKB 1EK3A 3LKQA 4ZOCA 3EOTL 4MDIA 3SDCD 1MWAL 2V5RA 3P77A 2EDKA 3ZZ1A 2AXHA 4BZ1H 4CAGA 1S78C 3CCHA 1KIQA 4Z9KB 3TYFB 1IQWH 3GK8L 2GFBA 5DJ0B 4WW1A 1DUZB 1QG3A 1AHWA 4WW1B 4YXHH 3MUY1 4RWYL 3N9GL 5DJ6B 5HYSA 3SGKC 3DUSB 1HINL 4Y2DC 2YA2A 1RQ5A 2FWOB 1D5BB 3ARFC 3KXFB 3DXAD 4KKLC 2NR6D 1NC4D 1C16B 2ESVA 4OLWL 3KPQB 1BVLB 1D5IH 1KB9K 1IAIH 3MXWH 4PJBA 3NAAH 1FNSH 3HN3A 1S5IH 4HUNB 4I77H 1D9KD 5F7LB 4QHUA 1YYMH 4QRSB 2PR4H 3CH1B 1ZEAL 5CJOL 5HI5C 3L95A 2WUBL 4XXCA 2XNAB 4P59H 1BIIB 1BJ1J 2IPTL 3JWOH 4ZXBD 4BSWA 1R0AH 1J1XH 3RPIA 3EDKA 1RK0A 3EYOA 2PW1A 5T1DH 1HH9A 1ND0A 3L1OH 4NDMA 3VA6A 1JZ8A 3V5HB 3P11H 3OGCA 3QDJA 1DQMH 3LKRB 3UPRA 3WFZA 1MAMH 2A9ML 3BGMA 1JV5A 3L6FB 5AG8A 3ABZA 4UILH 1T5WB 1IGJA 4XB7A 2GJ6B 1UCTA 2BDNL 3CPLB 1YNLH 1NCDL 3PGCB 1AO7A 4HC1H 2R4SL 3MRJB 3LDBB 5I1DA 1MCPL 3V8OA 4ZO6A 1DUYB 4X4XB 1WZMA 5MENA 3PDGA 3RY5A 1MHHB 3QCTL 2L4OA 2DD8H 1WJ3A 4NJAH 2VRAA 1FZKA 3P11L 3QUXD 4Q2ZB 1RZKC 4HIXL 2VTFA 3ZL4L 4NO5A 4P46A 5GS1B 2EIEA 4X4YB 3GHBH 2E3VA 5IK3B 1KJVB 3PWPD 4KH2A 2Q3AA 3TLRA 1T0NB 2APWA 2YD7A 5A16B 4F7MB 3TN0A 1F00I 4OQ1A 5T3ZL 2W07A 2VL4A 2OQJB 4JQIH 2EZ0D 4OZGB 3P9LA 4NQEA 4NGHH 3ROLA 5A2KH 3HNSL 2OR8A 4OV5B 1WAAE 5IB3B 1ZTXH 5IEKB 1CF8H 3N06B 4J6RH 2Q87A 3JV6A 4X6DE 2K9UA 2F58L 2H1PH 2Q3ZA 4NZJA 1M71A 3QUYC 4N5ED 5KSBB 3STZA 5JW3L 4PY7B 4RZCB 2O93L 3T3MF 4ZQKB 5I8EB 3UTTA 1AKJB 5D70H 4V2CB 1W0VB 4XI5D 1GAFH 4GW4A 3O4LD 3CLFL 4K9EH 4X6DF 5EUKA 4KDWA 5A43C 5E70A 1J5OL 3RUGB 3KYOA 5D72H 5DT1H 2V17H 1T0MA 5ICYB 4N0YL 5D2LA 5FM8A 4YQXH 1MHPH 5SWZA 4MJ5A 1SEQL 5H2BB 5D1XC 1VADB 3DO3A 2YRZA 2JCCA 3MBEB 1BD2A 2VITA 3GMLB 5D7JC 4OZHA 3IDMA 4F3FA 1UQSA 2N7BA 1JNHB 3THML 3V6BR 4AL8H 4MVBC 4WFFD 1UQSB 3TA3B 3ECBB 2DL9A 3I6LE 1YEJL 4G5ZH 3WS3A 3ULVL 1T03H 3CSYA 2HFTA 3WIHL 2R0ZL 4OZFA 1LE9A 1A6PA 4OZFB 3PV6A 5I1LA 3LPFA 5IVZB 2EIZB 3U0TB 4ZAKB 4K3JL 1HXMB 1MJUH 3UPCA 5KSUB 1WBZB 2EDWA 5LJYH 1AIFA 1QZ1A 4NPYA 2O5ZH 1JHLH 4X0KA 5DGQA 4LHQB 1AIFB 4X7CC 2ED9A 2FBJH 3N85H 3CLEH 1E6JH 3RVXD 3FO2A 4HHAA 3VI4F 4DFIA 4TNVF 1WICA 1LK3L 3I02B 1P4IH 3IFLH 5KS9B 4XMLL 1HQ4A 4TSCL 4LLYB 4OTXL 2YN5A 3QEHA 5FGRA 2R2BB 4JZJA 3HPJA 5KSVB 4I18C 1IFHH 3QO1B 2X4SB 3MYJA 2HVJB 5EU6D 2BNRE 2DN7A 1FFPB 3QNYB 4KY1H 5BMFH 1X5KA 3HNVH 3U46B 4KDTC 3REVA 2RCSL 3E1F1 4Y7MA 4FZ8L 1NGPH 4G6FD 5C0BE 3BPCA 3NIFF 5K93A 4ZDHA 2ADIA 4QF1B 3HC3H 2OI9C 3VE0A 2UVEA 4M8QA 3G6AB 3S3JA 3DUHA 2OX5A 1JPST 4J3OC 3L9RB 1MIEL 3WSQH 2BP3A 1AGBB 1KTDA 4ONGH 4LU5H 2UY7A 5C0DA 3T0EC 4DEPB 3F7QA 4GKZA 4OZHE 1N5AA 1S7QB 3CFKB 5HHXH 2JJTC 2Y06L 3OPZL 1WVZA 3S96A 3R8QA 4RQQB 4P23A 3WUWG 5IGXH 2JKXA 4IMLA 3GSUA 3JTSB 1NGXB 5HD8C 5GZNC 2VZ3A 3S34H 3GSUB 4TUJB 2JB6B 3PV7A 4ZS6C 5HHQA 1EHXA 1QSEA 4NWTL 1T04A 1S8DA 2YPVH 3EDJA 5CZVL 3C8DA 4NKQB 3RX8A 2EDBA 1IAII 5F6IC 5CD5D 3MRMA 1O5DT 3Q0HA 4HUVA 4OFYA 1TETL 1AHWB 4PJ7B 4MQSB 1RZ8A 4ZUVB 1KCUL 32C2B 1R5VB 1A7NL 3RGHA 1UCBH 4FQJL 5DR5H 4DTGH 5IG7A 1V3MA 4U7KA 2I9TB 2EEDA 3JVGC 4DW2H 1TZHA 3RI5K 1OGTA 3T4YB 3WEXB 2ARJB 3HE7B 1VGEL 5D7SH 3W2DL 3WHE1 4HUKB 4XCCL 3VFMB 5F3HB 1DBJH 4MZ3A 4JO3L 4PJAE 4AEIH 2OL3A 1CXEA 3VFUA 4QXTB 3GMPA 3G5ZB 3JXAA 1B2WH 3OL2A 4MB5A 1FZOA 4HWEL 4NJ9H 4TSBL 4MX7B 1NC4A 1CZ8H 3BGMB 5HDQH 5J1TC 4IMKA 3OKNB 3OKDB 1A6AA 4UQ3A 5DRNB 5I71C 5DRZA 1HILB 3UP1A 1DBMH 1NBVL 4WRLA 1JWMB 1D6EB 5CZXD 4QXWA 3U36B 1AD9A 3U0WH 3L6FA 5KW9H 4UV7H 2YBRA 1HXYB 2OR9H 4L8SC 1JP5A 3ULSB 3CMOH 1K9TA 1T7VA 3ARTA 5EU3A 3VD3A 1RVFH 1H9VA 2KQNA 3QUZA 5E99L 1MRDL 2H32A 3KPLA 5DFVC 1RJCA 3I6LD 5KVEH 4NN6C 3DTXA 4PTTA 1HWHB 2YS4A 4ZSOB 2CO7B 2Y25A 1U8HA 3ZTJH 4NCC1 4RFNB 1SM3L 4P2OB 4JDZB 5I1IH 2NY2D 3PDOA 1INEL 4POZC 4EIZC 5IK3A 2DLEA 4Y5VA 3T4AB 4CUCA 2G5BB 3QDHA 3NACL 5FUZH 3BP4A 3VXMD 5C0GA 3WMSA 1KB5L 3QUMB 2VDKH 1RZFH 1I9RL 2XFXB 1T21B 2VLJA 1N0XL 4MNGA 4EQ3A 4AIXA 2LVCA 4MXVF 1FP5A 1FO0A 3UBXI 4CN4A 1C7TA 2QADD 1CDIA 4RZCA 5J11C 2XZCH 1MCRA 4HK0A 2ZSVB 3LZFL 5I76B 2FEDC 1UWGL 1ZVSA 3U0WL 3MRPB 3T0WA 3JWOC 4H1LH 3ZKXB 4F8QA 2CK0L 3X3FL 4F37K 5EU6E 4R4FH 1YN6B 4R97B 4S1RH 4YZFE 1QFOA 4X8JA 1N2RB 4EN3C 1UM6L 5IB4A 2IWGA 3RWFB 5FM5O 4QT5A 3T0DA 4WUUA 5DJDA 1BVZA 2IAMA 4NQCB 3W9DB 2COQA 2W0KA 4JCLA 4MQ7A 2YA0A 5BJTB 3MLPA 4PRDB 3KYOB 4OCXH 1ZGLP 3QJFB 1X5GA 4PRDA 1B88A 4HK3N 3O6KL 4BK4A 1U3HC 3MRLA 1OAKH 1PKOA 5FOBA 5TF1H 4HKXA 3OG6B 2VDOH 2GFBB 4GAFB 4NQTA 3Q6GH 4UMGA 5K9JH 1N8ZA 2AV7B 1UM6H 2AW2A 3BAEL 3EOYG 2APBA 3L7EB 4WTZG 5CSZB 2VLKB 1OB1B 2C4FT 1D5MB 3UJJH 3BIBX 1T7ZA 5DMGC 3U0PB 1N7MH 4DEPC 5FYJH 1OB1A 5SX5K 1MHEB 1MNUH 3KXFA 3QEQE 4QHNA 5HGBB 3LS4L 4TPRH 1L6ZA 1QSVA 2J8UE 3VFTA 3O3UN 2V7NA 2GHWB 5E00B 2JJSC 5CBAB 4O51A 1JUFA 1L7IH 5DXWA 4E42A 4QXGH 5GGVL 1IAKB 3ARWA 4QXUL 1KGCE 2A83A 4NQVB 5CINH 2FEEI 4DKAA 2OI9B 2OSLA 2BSSA 3MLTB 4NO2A 1IAMA 4WI4A 4Z0BH 1E6OH 3LKOB 1L9NA 3CSBA 1QEWB 1XGQB 2ZUUA 1FRGH 1QNZL 2R1XA 2R8SH 4U1LA 3MMEA 4OKVA 2GAZB 3AS3A 2CK0H 1PGRB 3B3IA 5BRZD 3OKOB 4N0CC 4U6HA 2M26A 4Z7WE 1QFHA 1T20B 4I3SL 4AM0A 4LLWB 4XP5H 3TCLA 1T89C 1QR1B 2NXYB 4HLZG 4UT6H 1P4BH 1OP3H 4NHCH 3ARPA 4N0UE 3D1MC 3V6ZB 1AKJD 4ODXA 3ULUE 5D93C 4ZD3L 4D0DB 5E8NA 3G6JF 4LPWA 3D6GA 4Z0XA 5E8NB 1CICD 1E28B 5GRJL 2ZCLL 3ZT6A 1MWAH 3MNVB 4FQLH 4P46B 1CTOA 2F74A 1NCCL 3MRHA 3FFCD 4HUXB 3FTGA 3IJYB 3OXSB 4XVJH 4Z7OE 4UIMA 1PY4A 1I75A 1KC5L 4IMLB 1I1AA 3TO2B 3SHSA 1CXIA 3L7FB 5D2NA 1MJJB 1HNGA 4PV8B 2QQLH 1A2YB 3GI9H 3NOIA 4FFYH 4Y19E 3FT2B 1N6QH 4GS7C 1JZ5A 5GPRA 2IQ9L 5SWQA 5LQBL 1LDPH 4RA0C 5BW7C 3L5XH 5IB3A 2APXA 2WV3A 2XTJB 4F2MB 1LQSR 2VAAA 4HPYL 4YHYC 1NC2D 4NQEB 3ROLB 1X7QA 2HAZA 5E5RB 5GS0D 4YGVA 5EPMA 3QDMA 3WNOA 4ZUVA 5EZLB 35C8L 3JSSA 5CHNB 2OZ4A 4AH2A 3S4SB 3MRQA 3RL2A 3BH8B 3IDYB 4JFFE 4JRXB 3MRQB 2WIMA 3M8OL 4HWBL 1XGUB 4HC1L 5CJQL 1FRGL 2QSTA 3MLVH 4RRPA 5EO0B 2XWBA 2AJVH 4POYA 3RVWC 4APQC 5JW4R 4GMSH 2VSCA 2M2DA 3K1DA 1WK0A 3F6LA 3B43A 5DMYA 1MLBB 3RY4A 3MZTA 4I3SH 2IPTH 4LHUG 1EIBA 3S36L 4UILL 3VFMA 5IGXL 3GJEB 1TNMA 3UC0L 3HRZA 4PRPA 4UU9A 2VL5A 1M6OB 3OB0H 2JCCB 3MBEA 3QUYA 2EH8L 4LLUA 3ROOB 2V9RA 3VG0L 4XXDB 5ISZB 5GXBB 4OLZH 4JFHE 1AD9B 1ROWA 2FD6L 3OV6A 4OD3L 5CILL 1U8NA 3HUJA 5FECB 1DJSA 1HQRA 1U3HD 2BSRB 2DLHA 4PBXA 1RHHA 1CG9A 4LP5A 5J6GB 4Y4FD 2CH8A 5F88A 1W72H 1GZPB 1M7XA 2IANE 5KSUA 5IMKB 4S2SB 2FJGA 1CF8L 3DECA 4NFCA 5AZ2H 1U9KA 1U8MA 5IT2H 4G9FD 1NAMA 3BP6B 3L3KB 1NGYA 4UB0L 3GMNA 4EN3D 1CICC 3CDYA 4P4KB 3S3SA 1UXWA 1MVUB 1QRNA 2MMXA 4HGWB 1NFDA 4ETYA 3D9AL 2FEDD 3HAEH 3QEQB 1XF4B 1BFOB 4XB8A 3ZDZE 1IGFL 4X7TB 3LRHA 2YSSA 1EA9C 1AGEA 2VC2L 3MRGB 2BHYA 1JF1B 1EMTL 3HR6A 2G2RA 3WNLA 3VXSB 4XGZA 2G9HB 3D39A 3QO1A 3IXAB 5E94A 3UC0H 5JO5B 2DB8A 3U48A 1J10A 4DN3H 2AVGA 5F96H 1YYLH 4HIHA 3IDXH 3U7YL 4PJDE 3RZCB 3QR2A 3UBXG 4Y8DC 5H37H 5BZDA 5CEZL 4L5FL 2BNRB 1OF2A 1BOYA 2ZSWA 5IQ7L 4OUUA 1WZ1L 1AGCA 2B7DT 2X4OA 1MI5D 5JOPD 4JQVC 2ZUQB 3KPOB 4Y5XB 2F54B 3E6FB 4HULB 5I1AA 4HZAA 1ZGLM 2R69L 2WBJA 5DFVD 2VDRL 1U92B 3RIAF 5IP4A 4ZNCD 1I85A 1T7YA 3CK0L 1GGUA 5DJ8B 1AGBA 1GGTA 1KTDB 2YK1H 3AROA 4WUUB 3RHWK 5DJ8A 4EI5D 3ARFB 1ZT7B 1FPTL 4FQ1L 4XC1L 3BT2L 1YN7B 1H3GA 3N1FC 2C1PA 4K7PY 4PGEB 2LTQB 4HKXB 4O02H 5IM7A 1HOCB 1MHPL 3L1OL 5DMGD 3ZTNL 4GBXC 5CZXC 2VXUL 3BQUD 3G08B 5L8JB 1U8IB 5L88H 3SBWC 1VFMA 2BCKB 3ILQD 5K9QG 3CUPA 5LCVL 2XTLA 3B9KD 5ETUA 1A3LH 1J9CT 3K80A 1N4XH 1S8DB 4J3TA 3GB7A 5C08B 3WXVH 1QLEL 1JPSH 4HS8L 1H5BB 2DICA 4OB5H 2VXQL 2JK5A 4GKNB 4PJFF 5BMFL 8CGTA 1J87A 3FQWB 3RZWA 4RGMB 1IGML 4H25A 3FQXA 4FHBD 4O58L 4OCSL 4UDTB 1OGTB 3IRPX 3CFIC 3T4YA 1NFIA 4D0CA 9CGTA 4M5ZL 5EOCH 4F7PA 5IG7B 3SKNA 1OGAA 4XPGL 4A6YH 1UWEL 1H3PH 2CLRB 3FB6B 3F12A 1NH6A 5FUOH 3ISWA 5A40E 2YMXH 3WS6A 3DURA 1PX4A 3CDGA 1WIUA 3KPMB 3PQYD 1Q1JH 4NDMB 1UB5A 2R2CA 1ZT1B 1NL0L 4HCRH 5CD5C 1W2KT 3MRNA 1HI6B 2B5IC 4ZO7A 1IM9D 3EYFB 1B6DA 1NDGA 3GMRA 3Q6FA 1NC4B 3QG6A 1CL7I 3DX6A 1IC1A 2CKBH 1N6UA 1S7SA 4KTDL 1YEDB 2IPUG 4DUVA 1BPVA 3I9GL 3M17A 3LEXA 4BM7A 3WFHB 5C0EA 3SKMB 2ORBL 2Z8VC 3W9EB 2Q7YA 2WUCL 1MH5B 1TVBB 4POZD 4YPJA 2I07B 3UAJD 3ZDXE 4P5MA 3SE3A 5DEZA 4Q2ZA 3T2NH 5DRXA 1YEFL 1J7VR 4M1DH 3QWOB 3SOBH 1WV7T 3D25A 4LKXA 3IJYA 3VWKB 3WJLC 1EEQA 3IS0X 3JTTB 4RMUA 1QBLL 1J0IA 5F9OH 1FQ9C 2F5BH 4MZ2A 4BKLB 4J1UB 1WEJL 4H20H 5F7NC 5L7XL 4XMKL 4BQ6A 4DJMA 3SJVE 4Z7WA 5ACLA 3P4LA 3BP4B 2OXHA 4FFWC 4IBLT 1T2XA 4JJHA 3V4UL 3V5HA 3MODL 1KLUB 4GRLC 1KENH 2WUBH 4S1QH 4P59L 1CICA 2ILLA 3S88L 2YPLD 5JXAL 1MCOH 4R8WH 1F4YH 1DQDH 2DLTA 4P4RA 2JJUA 2HFFA 2NXZB 4Y4HA 2ZSVA 1NCBH 2P1YA 2W38A 2D9QB 4PRIB 4J6RL 2YC1A 4YX2L 5MENB 1FSKB 5FYJD 4J8RA 1DP0A 5LAXA 2R1YA 1FGNH 4ETQB 5DUPH 2D2OA 1M05A 2FIKB 1EGJH 1S7UA 3O3EB 4R96B 3RA7L 4JRXA 5C09A 2FIKA 1LO2H 3W0WA 4BYHA 4R8WL 3LEYH 4XCFL 5GGTH 5C0BB 1KPVB 4XWGH 3X11B 4QHMA 4M3JA 3EDEA 4H8WL 1U58A 4N0FB 1DBKH 5T3XH 4YEEA 3VFGH 3CCHB 1LO5B 4FTVA 2XKSA 4OCNC 1FGNL 3RX5A 4KHTL 2A74A 4WEBL 3V0VA 3NMEA 4AT6A 3TBWA 3EZ8A 4LBEB 4UAOB 3P0GB 4H0IA 1BIHA 4PP1C 1XF2A 5HD8D 1TVDA 5E8OB 4QRRA 2PYFB 1B0RA 4AQ1B 1AH1A 3LS4H 3BKCH 3NIDE 4EN3B 1G7QA 1QO3A 4LVOB 3FL7A 5JQ6H 3CXDL 1C16A 1DQDL 2ZKHL 4LVEA 4MA1B 5KSAA 2W91A 1KJ2H 1MY5A 4XPFH 3MV8B 3T0ED 3WXWL 5KSAB 3NIDF 3VWJA 3VXUE 3FFCB 3RWJB 1LILA 3A67H 4KDVA 5DD0L 1YEEL 3MRGA 1OAUL 3LEVH 1JPFB 3PHSA 2DS4A 1JHTA 3HKFA 5L2JA 4JY5H 2NYYD 5DSCB 4KV5F 4JFDA 3KXFE 3DVNB 3K81A 3QEQA 1E4XI 3V6OE 1QBAA 1ZVHA 3GMLA 2R2EA 1WBYA 3B3IB 2MJWA 5EIIA 4IRSA 4Q9BA 3QZWB 4ORGA 1OWWA 3BWAB 3MMEB 5I1CH 3VFRA 5EBMB 5EZJB 2JCCE 3BWAA 2DQTH 4XNYL 5ANME 5MI0B 4UUJA 4YNYA 4D94A 5TDPA 4NQDE 2X05A 3AGVA 5TDPB 2KDGA 1LO3L 5DHYA 5F9AC 4Z7VF 1IZKA 1QFWL 3BPNC 3GO1L 3P73B 3SDCA 4ODXB 5F72S 5HPMB 1FYTA 1OAQL 3EYUH 5ESQA 3ALPA 4JY5L 2QL1A 3QUXC 4JFZH 4LCUB 2ARWA 5MEQA 1A7PL 3D0VB 4XVSL 1HOCA 5IFJB 4U1NA 2FL5B 1LEIB 2L7JA 3CLFH 3C8KA 4K9EL 4LOUD 1T2QH 1U42A 2I5YL 3SE3C 1FNFA 3HI6L 4YK4B 5HHXL 5C0IB 3GDBA 3DGCR 3QDGE 4LIQE 2VO5A 5D7LD 2ERJB 1E4XL 3MRRA 3WIIL 2Y06H 4Z7WF 3P4MB 4CJ0A 5H35A 3QPXH 4MGXA 4Z7QE 3IFPA 4PR5A 2BX5A 4ZUWB 5D72L 3C08L 2J12B 4NRYA 3P40A 3C5ZA 4LKCA 4KVCH 5F7WC 1A6ZA 1I3GL 5D1XD 5ESVA 3VRLF 5I8OL 4JO4H 2DKSA 1MFEL 3BZFA 4G9FA 3RJQB 4TNWK 2GCYB 3ARED 3RUGE 3KR3L 4G9FB 3EBAA 4JKPH 5HI5D 3F12B 3EJYD 4NM4L 3VFOB 2UWEA 5MEPB 1LE5A 3KPQA 4G3YH 2D31B 5TH2B 3I3EA 5EB9A 3SDDD 3VI3E 4OM0H 3VD7A 3RUGF 2WLYA 2NTFA 2NR6C 3O8XA 4JG1H 3BMVA 1BBJA 4X6DB 4X8XA 5HVGB 2ZCLH 4TSCH 5EIVA 1BBJB 1YY8A 2A6KA 4RQQA 4PRPB 1GXEA 1ACZA 1A6TB 3U1SL 5KVDL 3GI8H 1CYGA 1LO3H 1E6JL 3IFLL 4ONGL 5C0EB 2N1KA 2EZ0C 4RAUB 3WKML 15C8H 1A6AB 1UWXK 1QFUH 1JVKA 2C3XA 3LDBC 4JFDE 4TTGA 1ZLWK 3MJ9H 3MREB 4RFEA 1CL7H 3C09B 5EOQL 1AFVL 4QRRD 5EA0L 1I3RA 4MXWH 4M7LH 1B0WA 2H8PA 5J6GA 2VWEE 1TZGH 3ZTJG 3UPAA 3EGSB 4M48L 4MQXD 1VENA 4L4JA 1V7MH 4MD5B 1CGSH 1LD9B 4NWTH 1JN6A 2XT1B 5K9QI 4NZTL 5D6DC 4MCYB 4CADB 1MFBL 1OARH 4PJ5E 2EKSA 3MODH 2X70A 3MBEC 4OFPA 1JIBA 1XGPA 4X98A 1CTNA 1NL0H 2YSSB 2QQQA 3DNKA 4YBHA 2GW5A 3P4NB 1XF4A 4JPVH 1FYTE 2VLKE 4HV8B 1VFAB 1KN2L 4LCCA 2Z8WC 2X4TA 2PCPA 3BKJL 4DZ8B 1VDGA 1QFWM 4F7CA 5C1MB 4NZTH 5ADPL 5HYJB 3O4LB 3HZKA 5IF0A 3IDIB 3AY4A 3H9SD 3E0GA 4ZDHB 2AJVL 4OF7A 4J3XA 5D1QB 4N68A 1X4XA 3GZKA 2KH2B 4F9LA 1SJEA 4ZXBC 1REIA 2VDPL 3QNZB 1LMKA 2VIRB 1R5WA 4OGAD 3P30H 3X14B 1NBVH 1WCQA 5K59E 1A14H 1DBKL 4WGWB 1QD0A 5BRZE 3GRWA 2NY3C 1OTUC 1D9KC 4HCRL 5J4MA 2BOCB 2CDEB 3RU8H 4AIOA 5F1SA 5C71A 2WLZA 4P57B 4Q0XH 4U0RB 2GK2A 4GKSA 2N7AA 1Y6KR 3C60D 4HWUA 3MRFB 4JO3H 1I4FB 5D8JL 3JV5A 4GJTB 2YPLB 3RWHB 1FDLH 4JREC 5E56A 5D7JB 4Y2DD 5D7SL 1FZJB 1KIQB 4R0LB 5BJTA 2WMPA 2E27H 4WW2B 4CVXA 1DBJL 4HX1A 4IOIA 1QSEB 3CXDH 4KAQL 1FFOA 5F1NA 1SY6A 3W2DH 4LK4A 3VD5A 5DC9B 5CP3H 4TVPH 3PP3H 2PYFA 1ZAGA 2BCKA 5AZ2L 3PIQB 1IGYB 3QIBA 3PWPA 4HQQL 1UVQB 3TBWB 2ID5A 1QPXA 3K4AA 1DVFD 3QSKB 2QR0B 4B7LA 4QGYA 1I1RA 3FKUS 3KJ4C 2APTA 3KG5A 4QHUB 1AP2A 4OSUH 5DWUL 3T8XB 4LDLB 3HZMA 4JKWA 4GG6E 4Y2DA 3K2UH 3GKWH 4IJ3B 1FIGH 2AK4D 4NQVA 4I48A 5KS9E 1RSFA 4JM2C 5L7XH 2BVQA 1JHTB 5LVEA 5TPWL 1I7ZA 3PP4H 2HKHL 3UYPA 5F1KC 3FFCA 4PTUB 4R7DB 4B0MM 1ZHBA 3GSOA 1BQSA 3BHBB 4YDKH 4P5TA 4PJAA 5LWYH 2RB8A 2H2PD 4YPGB 4NHUB 4TOYH 1HILA 2W60A 4NOFA 2DYPD 4MD4B 4JFYA 3WD5L 4K3DH 3IJHB 3PGDB 1J0YA 4FQPA 4U1SA 3VJ6B 5JIKA 3MRJA 3L5JA 4QRTA 4FP8H 3QB7C 5DQJA 3RTQC 1FL3A 4L3EE 3KPRD 3SKOA 1ED3B 3WFHA 3VFRB 1Y6MR 3U46A 3UTTE 3UCRA 3MA9L 3NPZB 3IAQA 1BMGA 5HYJE 1YQVL 3ZE2F 3BN9D 4M6NH 5IQ7H 1RVFL 3EFFA 3BZEB 2CLZA 2A6DB 3HS0B 4S1SL 4WWKB 2ADJA 1URLA 2ATKB 4WEUD 5I75C 2WWMD 3KYAA 2E27L 5D5MB 4RWHA 1MOEA 4JQIL 5KJRH 5T3ZH 1CFSB 5MHSE 1YEGL 4JY6A 4MAYA 2EEAA 4X6EA 3ILPA 1HHJA 4K55A 5TDNB 1IBGL 2DQHH 2E9WA 4FOMA 4M5YL 3ULUH 5I71B 4RMVA 3KYNB 1CE6A 2DF3A 2IAND 5DZOA 4M7ZC 4LPYA 1LEKB 2XKNB 1FV1A 3O6KH 1MCWW 3L3HB 4G9FE 1RIVL 1B2WL 1LHZA 3WNMA 5IHZB 1YQVH 3BD4A 4OZHF 4WFGE 3RX7A 4I3RH 3HUJF 1MLCA 2NY7H 4PJ5D 5KSBE 5ALBH 1FO0B 4J12A 1CICB 3AREB 1F11B 1M71B 1YEGH 4OCMC 3OKYA 2Z31A 1MQKH 4OF0A 3LKSA 3QCUL 5J12B 4K8RL 2NX5D 4M7KH 4JFPA 4U6VL 3S34L 1YPZA 1RUKL 2EYSB 3B4NA 4HUVB 3IGAB 1D6VH 3GUTB 5C7XH 2Z92A 3Q6GL 2NY4D 1P1ZB 2GCYA 3TGXA 5I8KH 2NXZC 4GFTB 5FUCC 5JUEH 3FN0H 1DANU 1BQHA 1TQCC 4HT1L 1KG0A 5BO1H 5I1KH 2SEBA 5FCSH 1M4KA 2HH0L 5FUOL 4YHMH 5IR1A 2CKBL 4MDJA 5F44A 4P48A 4PJGA 5F6HI 2OL3B 4QRUA 4QEGA 5JOPE 2DDQH 1TJIL 2H41A 3W5NA 4PV8A 3W82A 2DQEL 5T1KD 1ES0B 3O2DH 4KQ3L 5D5MF 1BFSA 2H9GB 4DVRH 3M45A 1SM3H 5CBEB 1IAIL 4HFUL 1T4KB 5GGVH 4OAWA 3TH3T 4GH7B 2J8UB 5ERWB 1CGSL 3MREA 4NKDB 2DTMH 3DJ9A 5CUSH 3DX9B 4QOKB 3RRQA 5IEKA 2EDLA 1OD9A 2P5WA 4U0RC 4FZEL 4IS6B 3DXAA 3J8F7 3I3BA 3NCMA 5LGHL 3CU7A 2APFA 2ZKHH 3DXAB 5EORL 4LSSH 1NAMB 3TBTA 2YBRB 3HI1B 2A73B 1JUFB 3JUYA 4P3CL 4OTXH 2BNRD 3CZFA 5CLTA 3MV8A 5ID0B 3BZ4B 1FNEA 5GJSH 1P4LA 3X12A 4ZUTA 1WIOA 3TFKC 2AQ2A 2L0DA 3P4NA 2Y36L 3NN8B 3QEHB 5GSRA 1MIMH 3ARGD 3O9WA 4DAGH 5DRWB 3KPNA 4BELD 4Z7VA 5GZOC 3CH8A 3ETBF 3PWNA 4KK5C 3VXSA 1A1NB 1EV2E 4C56E 5E4EB 3QUKB 4UIKH 3T2OA 5FDWA 3LKPB 1FORL 1FZMA 1JE6A 2DD8L 1BLNA 2F53B 1GL4B 1ACYH 3IAPA 3KLAA 3RGVD 3WHE0 2FO1A 2X1QA 3OJ2C 3B83A 2XZZA 2J8UF 2BVPB 3D2UD 2IGFL 1MCQA 1NMCB 3TH2T 4PRHB 2GSIA 2X4PA 1YEIL 2Z9TA 3H9YA 4G43B 3NGBB 1I9JH 3H9HA 4UNTA 3TNMB 3PV6B 2GJZB 2Q20A 5IVZA 3U0TA 3QHFH 2B1AL 4NO0B 4KJYB 1ZHLB 2ZSWB 3K8MA 4UDUB 4NO3A 5EOTA 3OXRB 1S7XB 1SQ2N 2GYSA 1E28A 4XPAL 3O6FD 5E2UL 3G6DL 4NPYB 4PYGA 3AU1A 2DQJH 1F3DJ 1X5ZA 4M03A 3BJLA 4QLRA 2YRLA 2VKXA 1JNLL 5AUMA 4CVZB 3KPRE 3LKQB 2FJFA 1F45A 2ZG3A 4UTBH 3WUZA 4OQTA 1Q1JL 1X5XA 2WP3T 2OP4H 3I02A 5FAAA 5HYJD 1T2QL 1CFNA 2J5LC 4XCFH 5EU6A 2JTDA 4OQTL 4BQBA 2ZNXA 4K7PX 5IT2L 1A7OL 2R2BA 3H9SB 4JZJB 3PL6A 5DEFB 5HDBF 5LWYL 3QJFA 5SWZE 5F97E 5ID1B 1RU9L 3QHZH 3TYFA 2R56L 3C5SB 5AAWA 1KSRA 3L5IA 3WIFB 1H5BA 1QLFB 5MHSD 5CJ8A 2JK5B 3KPPB 5E08H 3ULUF 4IDLA 1FIGL 5CJXC 1SEBB 2DMKA 3OGOE 4XCNA 3JBG7 5DTFB 5HGDA 4WUUD 5IB2A 3ARBC 4G9DA 4MWFA 1IAOB 1H15A 1MHCB 4JZOA 3GMMA 1JPGA 3ARYA 3NIFE 3SJVD 4U05A 5AZEL 3VW3H 4OLVH 1YPZF 3SDYH 1EEYB 1OPGH 4PJIB 5AD0A 3BI9X 1Y18B 4HEPG 4DKFL 1NGWA 3CVHB 1MVFA 1H0DA 1FAKT 1S7TA 1I1CA 4O51B 4BA8A 4JB9H 3A6BH 3DGGB 3T8XA 3OJMB 1H0DB 4OLXL 4Z76B 3O45A 1VKXB 4EDWH 3RVUD 2IFFL 2FATH 1FBIL 1DN2A 3MROB 3W0WD 3FB7A 4M5YH 1RUQL 3EYOB 1GGBH 4UQ3B 2GY5A 4YJZL 1RZJC 5AYUH 4P5TC 3S5LB 4APQB 2B1AH 4JKMA 4NO0D 2I9LA 3WJLA 4JPKH 1WGOA 2E6QA 3OGCB 1K8DB 3DMMB 5TFSH 4GAYA 1XCQA 4NWUH 5IMLB 1ZLWH 4FXKA 4HIXH 5IVXA 4L5FH 3QCUH 4WV1C 3V4VL 1ZHNA 1WZ1H 1NBQA 3W9EA 1S9WA 1AO7B 2ORBH 3WLBA 1IC4H 3VA2C 1INDH 1ZOXA 1XT5A 2P5EA 3BEVA 4X5XB 1BJ8A 4PJFE 1RZGB 3AC0A 4U7MA 1FJ1B 5F96L 2E8ZA 1GGYA 1R5IA 3BIKB 2QSCL 4J1UA 1RJZA 4UAOC 4YHOL 3V5KA 1NC2B 4NQED 4CDHA 3LN4B 3G6JE 3G9AB 2OTWA 3CMGA 1PKQE 1NLBH 1KN2H 4N9OB 4QRPE 3IXAA 5E94B 2KZWA 1ETZB 4YWGH 1RUQH 4PJXA 1CR9H 1U8PA 5SX5H 1BZ7B 1FG2B 1PG7L 2NX5B 4YO0B 1TQCB 3E6HA 5DMIH 3UBXB 1CDUA 3JWNC 4X6CE 5HVFB 2R23A 3BXNB 1UWXH 1AI1H 3KLHC 4MA3A 4E9LA 2UWEF 3HE7D 4NKOA 4J4PD 1MH5A 1TVBA 2Y23A 4PY7A 3PWLA 4U1GB 1WWBX 3ALXA 5GZOD 1O7VA 4PREB 5HXMA 4MA8H 3KXFD 2DQEH 1X5FA 3EW3B 3IXTA 5DJZB 5TF1L 1U92A 5LKNA 1TZIA 3VXMA 4YWGL 4I2XB 3G5VB 4X99B 4JPIB 5GGRY 1SMOA 3NFNA 4YDKL 2DLGA 3WUWB 4RBPK 5EU5A 2BVOA 4I4WA 4XNUH 2IAMB 4OF6A 1GVIA 4I4WB 2FGWL 1T0MB 5ICYA 4OGYH 3DXAE 5I74B 5T33H 4XC3L 3C2AH 1MCIA 1RIHL 3C8HA 4U1IB 1OP3K 3LD8B 3EJJX 4DW2L 3QPQC 3V7MA 3T1FB 4M48H 4K71C 3MOBL 2P46B 1YC8A 4UTAL 4PUBH 2G75B 4M7LL 4S1SH 1RZ7H 3QA3B 4RMQA 1YMMA 1JF6A 2ESVB 3ZO0A 4HBQA 1LO0L 1F2XK 2BY3A 5D7LE 5IVOA 4P3WA 1DLHB 1FNEB 3NZ8B 4CU7A 4KTDH 5JIPA 4C59B 3DV4B 3MV9D 1Q0YL 4ZPVA 4YIQA 4LEXL 2FH6A 3FCTB 4M4PA 2BSSB 3MLTA 4NO2B 1PFCA 1CBVL 5A1AA 1GYAA 3QFJE 1QFPA 1WTLA 4HWZB 2NY2B 1S3KH 2OTPA 3WN5A 2FEEL 4RMSA 3GSNH 3ULUD 3T0EA 2PXYC 3QUKA 3MV7B 3BP5B 4YAQB 3SY0B 1QEWA 5GRJH 5E1AB 3T65A 2R2EB 1DANT 4FP8L 3I6GA 1SYSA 3B8SA 3BDYL 1NCCH 5KG9A 4W4OA 3FOLB 1F4YL 5KW9L 2PR4L 4HH9A 4Y4FB 2C3GA 4NQXA 3S35X 2IADB 2A2QT 5BZDB 4XP5L 1S7XA 1CFTA 1Q0XH 1QTYT 1KPUA 3EOBB 4UT6L 4OB5L 3FFDA 4HQQH 3QIWB 3RKDD 5JW4N 1S3KL 1MCCA 5EZOL 4LLMA 4HDIB 3QO0A 4X6BB 2WQRA 4JY6B 4JY4A 4HUXA 3ZKXC 1ZE3C 2B39A 5JPMA 3ULVD 3QQ9C 4BKLA 4HMEA 3HPLB 1ADQH 1NLDH 3GKWL 4UINH 3U2SB 4GW1A 4KZEH 1E27A 3PL6B 2R9HD 1D5XA 1A7PH 4M7LT 4MQTB 3ARFA 3DYPA 3JTSA 1KC5H 3SDDB 4R4BA 3RVTC 2MCPH 2R1XB 1XGYL 2K1MA 1Q9OA 4GSDL 2DQCL 1FIEA 2AJ3B 2P8PB 1OQOA 4G42A 3WL9A 4KV5E 4JE4B 4J7RA 3MJ8A 2GKIA 1UC6A 4H88L 3GSRB 5GS0H 1I9IH 1CL7L 4XPBL 1F6FB 1AKJA 4QY8A 2DKUA 4J8RB 5C7XL 4WU7B 5DLML 5D1ZA 4QRPD 4I0PD 4PJ7A 2EDNA 5DHYB 3HR5B 5C07D 4R96A 5GGRA 3DUUB 2BNQD 1Y0LB 4OIIL 4UDTA 1OAZL 2BRRH 4PJAF 1KB9J 1EEYA 1EPFA 3MBXH 4OZIA 1QVOA 1PSKL 4ELMF 1HWGB 1EEUA 3VFOA 3H9SE 1IMHC 5JHLL 4FFZL 1YY8B 2A6KB 4U1KB 2VITB 1FZOB 1R0AL 4YHIB 3DMMD 3MR9A 3G5ZA 1OAKL 2YZ1A 1LP9F 1R3HB 2X1OA 5L6YH 1MCWM 1CD0A 4ZFOL 2NZ9D 4OJFH 4WGVB 5FGCB 3OBAA 1J0HA 5CIPA