5D70L

Crystal structure of mor03929, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
207
structure length
197
Chain Sequence
DIELTQPPSVSVAPGQTARISCSGDSIGKKYAYWYQQKPGQAPVLVERFSGSNSGNTATLTISGTQAEDEADYYCSSWDSTGLVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granulocyte-macrophage colony-stimulating factor
publication title Molecular basis of in vitro affinity maturation and functional evolution of a neutralizing anti-human GM-CSF antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 50
structure length 197
sequence length 207
ec nomenclature
pdb deposition date 2015-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d70L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d70L01
1MRDL 4EI5B 2Y72A 5T3XH 1A6UH 1D5XA 1RZGB 3BO8B 1FNSH 1GL4B 4GW1B 3FQTB 4M9OA 2UY7A 3DTXB 4PP1D 5GGSB 2XACC 3RU8H 4S1SH 2DTML 1NFDA 3F12B 3QIUC 2XZQH 3NFNB 4NWTL 3HPJB 4JN2A 5DRNB 5EBWA 4AEHH 4JHWH 2APTA 3KYAA 1Z9OA 1N7ML 1N59A 1RURH 4P4KD 2M1KA 1QP1A 3OGCA 5IF0A 1P69B 1WT5C 3V5KB 1BGXH 2UZYB 4ELMF 1LWRA 4M7ZC 5DMGC 4EOWH 1T03H 4Q9RL 1BIIA 4QHNB 1Q94A 2EIZA 2YK1L 2I07A 1TENA 4KK9D 5GZND 1IGIH 4JO3H 1J0YA 3EFDH 4K3GA 3RBGA 1MAJA 3MSPA 5I6XC 2PUQT 2G2RA 4TSAH 4ZMAT 2IQ9L 4E42A 4QHUB 4G9FA 4K23H 3IT8D 5DJ0B 1DVFD 2XTJB 3TT1L 1TITA 3SJVB 1UEYA 3WFCL 2Y7QA 4LBEA 4PYGA 1S9WA 4MNQD 4ZS6C 2BC4B 1PLGH 2GT9A 5K33A 5LQBH 1HEZA 1CBVL 2EDLA 1A0QL 1MIMH 4G8IB 4F7MB 1MFBH 2ERJB 2W60B 2ZP0T 1H8SA 3VXUE 4XGZB 1W0WB 4BQ6A 4OLVH 4JFEE 2UWEA 2R8SL 3PP4L 4DFHA 5J13B 1WC7A 1JNNH 2KH2B 3IJHA 3WUZA 1OP3H 4XHJC 3HRZA 3QDMD 3C5SB 3PGFH 1D9KB 3VFVB 2EC8A 4HHAA 1U8LA 2A6IA 5EZIH 3MJ9A 5T3ZH 3S36H 5DD3H 3W9EA 1CGVA 2OL3B 1BOGB 5CEXB 3JWNC 5J11B 2VH5H 1E27A 3NIFE 1IC4H 1KG0A 4YPJA 5MEQA 3GNML 1CE1H 2HLFD 3SEPA 1CF8L 2FB4L 5FHAH 5C8JA 4G7VH 3E3QC 4ZUVB 4PJBB 3BH8A 4X5XA 5FXCH 3G6AA 1PKQE 1R0AL 1QSFA 1G9MH 1XT5A 2CLZB 2NXZB 2V2TB 2XZAL 1TJIH 3EKCA 1VADA 5I73B 1AGBA 5DJXB 2CRIA 3LPGA 4LEOA 1U6AL 3GSQA 3B9KC 5EH1A 3MV8E 4HKJB 2NNAA 1WK0A 2EIDA 2DDQH 3ESVF 1A9BA 4YBLB 1A3LH 3ZKND 3MROB 1C5CL 1SVZA 3D39A 4UDTB 3WV0A 2NY4C 2VDNL 2AXGA 1CDHA 4XMLL 4YWGL 3MRKB 5D7LD 1DUYA 5JIIA 3RTQB 3OZ9H 3P4OA 1GXEA 2AJYL 4M7KH 3FRUB 4WTXA 1I1FA 1CLZH 4O4YH 4JFDE 4WV1A 4FQXD 1H3WM 5CD3A 1C5DA 3VG9B 3C6SA 4OIIL 4XP6H 3MZGB 4DAGL 5DJYB 3P11L 3EYQD 4PJIF 5DK3A 1JPTH 1TIUA 1IM9D 3F5WB 3U7WL 4ZO7A 1F97A 2NY0C 3CCHA 5D1QB 4Y5VA 3G08B 2Y6SD 3AAZB 5EPMA 1MPAL 3QO0B 4FXKB 2VXVH 2QSCH 1JFQH 3O0RH 1K4CB 5IWLC 2QQLL 2VUYA 3VFOB 4OFYD 1AR2A 4M7LH 1JGLH 2AABH 3QYCA 2Q8AH 1NSNL 4DFIA 4J4PD 5C92A 4HZLB 4RMUA 3UAJD 3HE6A 5A2KH 3PQYE 1KJ3H 25C8L 4CVXB 4XMKL 4LF3A 3OF6D 4E5XA 4APQB 1PY4A 1IAKA 3L3DA 4GG8A 4NHCH 4UAOB 4PJ8C 2KZ1B 1DQQB 1FO0L 4HCRA 2WW8A 3HZVB 4I0PC 3CXHK 4QRRB 1WAAF 2BOBA 4XP1L 3C8DA 3V7MA 1OGAE 2N7AA 3O2VH 2R1WB 1IQDA 3IB4A 1YA5A 2A1WL 1HKFA 5M94B 1UACH 4MJ2A 2X6MA 3MOBH 2IQAB 1FFOB 1HHHA 1S9VA 3VXQA 1B0WA 3I84A 3SE8H 5CILL 3JTSB 3RUGB 4DVBA 1U8PA 2NY1D 4P46B 5C0CE 4ORGB 3SBWA 4Y4FB 4O58L 1G7IB 3TZVA 4PJCF 2D9CA 2W59A 1T1ZA 1NFIA 4ZQKA 1FNEB 1OW0C 4NM4L 1CT8A 2VZUA 3NCMA 4GRWH 2C1PA 5E00A 5ICXA 3S37L 4DW2H 2OTUB 4GXUN 4R7DA 2MWCA 2IFGA 5HHNB 3SDCB 3MRIA 3DVFA 3KHQA 2LV4A 3WIFA 1JNJA 5DFVC 4FFWC 1BQLH 4NO5B 4ZFGL 4B5EA 4HJJH 3QCVL 4OFDA 1FORH 1G1YA 4WHCA 3UZEA 4MA3B 1LMKA 2QQKH 4NFDA 4PV8A 4J8RB 4P49A 2ZSWB 5IQ7H 3ZZ1A 5F9OH 1NCAL 2NX5D 5D1ZD 5IROA 5EO9B 4CADA 1DE4B 4PYHA 4JY4B 5GPRA 2FL5A 3DX9B 5C0AD 1N3NA 5LGKA 2CIKA 4OF5A 1XGRA 3GMLA 1U92B 5CZKA 2HRPH 1J7VR 1TVBA 4LHQB 4Y1AB 1LVEA 4OZHF 3QJHA 3WJLC 4M7JL 3DIFA 3IXTA 3ULVC 1NAML 3QXDB 3ULVL 3DGGB 4OD2B 3U0WL 5TDPB 4KI5C 5HGBA 5HYSG 4W6WB 2ITDB 4PG9B 3IFOA 2UUDK 3OX8A 3P0YL 1WCBB 5D72H 1CD0A 1FBIL 3R06A 4OQTA 4IOSD 4MQ7A 4K7PL 5TQ0H 3VGBA 4KRPB 3TYGH 5JOEA 2AI0H 1HIMH 1HILA 1JWUB 1MVUA 1KCKA 4N0YL 1EBAA 3KPOA 2OCFD 4C56E 4WI9A 4H5SB 1XZ0A 4H1LB 2YMXL 3TCLB 2UVEA 3BD3A 2GUOB 3RPIB 1F4XL 1ZHKB 1EEZB 1DCLA 3ES6B 3UO1L 3LAFA 3X3GL 1V3LA 1U2CA 1DBML 5INDA 4DUWA 2Q7NA 3QFJE 4X9FA 4P99A 4RA0C 5D96C 5IIEB 4PGBA 1T5XB 5BZDB 3G04A 3LHPH 2X70B 4ZS6D 3G5ZB 4YHKH 4EI5A 4J3WA 4NQVA 3VD4A 1RZGA 3JTTB 1LP9F 4F37K 1S8DB 3NABH 4GW1A 3FQTA 1VFBB 4XWOD 2XY2A 4NJ9L 3DTXA 3WDJA 5JPNB 5GGSA 5TE7L 4KI1A 2I25N 3F12A 5DLML 3NFNA 1JTPA 3HPJA 5DS8B 5ETUB 4NNPL 1ACYL 2BSED 5DRNA 3PHOA 3RWGB 3DXAE 2FR4B 4DQOL 2GJ6D 4IDJL 4XHJD 4P3CH 4XHQA 5J1TC 4X6CE 2VLRE 3MO1B 4YHPB 1UM6L 2F58L 1A2YB 3TFKC 2ATPB 2R9HC 2EH8L 1EO8H 2VXSH 5I8CB 2IG2H 4HFWA 3D9AH 4QCIB 1N6QH 1VFUA 3IRPX 4M43H 3GSUB 2PF6A 4QHUA 1QVOB 4QOKD 4OGAC 3KLDA 2VSCA 4WUUE 3QRGL 5KSBE 4MNGE 3SJVA 2XG5A 3VGAB 1WITA 3OKEB 3DUSA 4FFVC 1I1CA 1JK8B 1K8DB 5HGDB 3S97C 1P4LB 4KZEH 4U1JB 2BC4A 1EEYB 3Q6GL 5JUEH 3B9KD 2VABB 4EEEA 1MHCB 1JMZA 2HP4A 4G8IA 4F7MA 1JV5B 2CMRH 2W60A 4M1GL 1HINH 1TPXC 1W0WA 3LZFH 5DC9B 4DTGH 2NY4D 4PJ5A 4LPXA 4X8XA 4XCFH 4M5YL 5DURD 3V6FB 3BDYL 1NJ9B 1J1XL 1KIQB 1TVHB 3C5SA 3GIZL 4MA1C 1D9KA 1FH5H 2A9NL 3O11B 2FLRT 3VFVA 2D7QA 2YN5A 4F15C 2NY3C 5I15L 2MSPA 2R1XB 3CX5J 5KSAD 5D6CA 1S7WB 3JV6B 2OL3A 1BOGA 5L2KB 3MRPB 5DRWB 5GRJL 1RUQH 2NY0D 1RZ7H 3EOTL 4N5UA 5F72S 1EHLL 1CR9H 4I3GA 1YYML 4ZUVA 5JIHA 4PJBA 1QQDB 1FC1A 3C5JB 3IKKA 2VDKL 1CZ8L 5BVPL 4YHYC 2CLZA 2V2TA 2W9DL 1BBDH 4PJ7F 4YBHA 3I6KB 1I9JL 4JFQB 3LS4H 4RIRB 1EHAA 1CICC 5DJXA 5T5FH 2FO1A 4WTZA 1BQHA 5HHOD 5BVJB 3LH2H 1N4XH 2V5RA 3R1GL 3O3EB 3HMXA 1EV2E 4L5FL 4NO2B 4MAUH 4YHOL 3MROA 2AEWA 4UDTA 4I0PD 3BRFA 4NUGH 3RPKA 2DB8A 4D0BB 1OTTD 5F7EH 1IBGL 2YPVH 1J8HE 1OGTB 3RTQA 4FQJH 3VFSB 5MHSD 2R0KL 3FRUA 3TC9A 1SMOA 1UYWH 1ZGLM 3MV11 6FABL 5CIPB 2IBBA 4OIBA 1J0ZA 5DJYA 1B9ZA 1U8JA 1EGJL 5HHME 3AU1B 3EZJB 3F5WA 2DKUA 4K07A 5D1QA 3IDMB 1S7RB 3EUUA 2F8XC 3G08A 3AAZA 5KVEL 4HUXB 1MQKH 5EU7E 4FXKA 1K4CA 4RNRB 4LQFH 1UCBH 4NQEE 3VFOA 1X5FA 2APBA 1NCTA 1MH5B 1AGEB 4HFUH 3I9GH 4HZLA 4XC3L 5DFVD 4FFWD 1T1XB 4HUKB 4JFHE 4CVXA 4CU8A 4APQA 3PXJA 3DSNA 4LPVA 4TVPE 4L8SC 3REWB 1DQQA 4QRRA 3IU4L 3U9PH 2CXKA 4WO4C 4ZUWB 2R1WA 3JWOC 3S88H 1FNFA 2DIJA 2BSRB 4U4BA 5IJKA 4YXHH 2APFA 4MHHI 2IQAA 1FFOA 2AJXH 1YPZB 3BKYL 1HH6B 4GRLB 4Z5RB 3JTSA 2BNQE 3RUGA 5F7NC 3LQZB 3ULVD 4XPBH 4P46A 4ORGA 4Y4FA 1G7IA 1E0OB 5EBGA 3NAAH 3OJDB 1FNEA 5IMKB 4LKXB 2DMBA 3TIDB 4AL8L 1P9MC 2E7BA 3D6GA 4PRPB 2OTUA 3F58L 1EO5A 3SDCA 2FJGB 5HHNA 3QUYB 3UYPA 2R2HB 1MCCA 3GMPB 4NO5A 3TGXA 1F11B 3UJJL 5D2NC 1HK6A 3GO1H 2OK0H 2DAVA 1CDJA 1F4YH 3BWAB 4Z7WB 4MA3A 4J8RA 4PB0H 5D7JB 2ZSWA 3T65B 4ZTOH 4UIKH 4X4XB 3SKMB 3DMMB 5EO9A 3WXVL 3RVVC 1WZKA 4GXVL 1DE4A 1S7SB 3GB7A 4TSCH 4JY4A 5AYQA 4BSWA 1KEMH 3JVGC 4PGEB 2DYPB 3IXAB 3M17B 5EOQL 4ZOBA 5C0IB 1U92A 3FB7B 4OD3H 3NCEB 5DUBB 4X8JB 4Y1AA 1FYTD 2YUWA 3H9HB 4EN3C 5B4MC 5CHNB 2IAMB 1IGFH 3QXDA 1T2QL 4GBXB 3DGGA 4OD2A 4PREB 1BREA 5TDPA 4W81A 2ITDA 2J8UB 2HJFB 3MLUH 3N1FC 1WCBA 4BFGA 2IBGA 2CSPA 3ZKQD 4KK6C 4F9PC 5KANG 3B6SB 4P23B 4Y8AA 4ODVH 4OJFL 1JWUA 2H2PC 3ZKMC 3O6KL 3QDJB 4ZUUB 43CAB 3GMQB 1NUNB 1QACA 5AZ2L 3ZHKA 2R9HD 2GIYA 4RMVA 3M1BB 3CGTA 2ESVE 4ZSOB 2DQCL 1IM3A 4H1LA 4NQSB 3TCLA 2GUOA 3RPIA 1NGQH 2V6HA 3TN0C 2PW2B 2R15A 1ZHKA 1EEZA 3QP3A 3ES6A 4XNZC 4PP2B 4R2GB 5SX5K 3UJIH 5MEOB 1U95B 2R0WH 4GMSL 1ZANH 2XOTA 5HDBF 3TLRA 4X7FC 5M7QA 5IIEA 1A6VH 1T5XA 5BZDA 1NL0L 4KTDH 1VPOL 2HAZA 2X70A 1J8KA 1G6RH 4X5WB 2F8VA 5I1AB 1RJZB 3JTTA 4HC1H 3AVEA 3MJ9L 4UQ3A 4ENED 4NZJA 1VFBA 5JPNA 5TF1L 2OS7A 4QTIH 4P2RB 1T2JA 1B90A 4YC2B 5DS8A 5IVNA 1U91B 1NCNA 3RWGA 4Z7UF 2XWTB 5HSFA 2VL5B 2FR4A 4YDKL 1F3DH 3X17A 4Z78A 5SWSA 3MO1A 3VWKB 4XCCL 4YHPA 1NGYA 3DI3B 3GM0A 2ATPA 4J6RL 3X11B 5DJCA 2CLRB 5I8CA 1A6WH 2V5TA 4X7CC 4KRNA 1PKQB 4QCIA 1CFBA 3VA6A 1OY3B 1PG7W 4BSJA 3GSUA 4M6OH 4CVZB 5JMOC 3GSOB 3MJ6A 4OCXH 1QVOA 3P73B 3OAZH 3OPZL 2DLHA 4PGJA 2A77H 4L4VD 4JG1H 1YZZA 3EO0B 2VXTH 3H9SE 1OVZA 4X7SH 4Z7QE 5C0BD 4LCCB 2KUTA 2XNAB 1JK8A 1K8DA 5DD5L 2AJUL 1HDMB 1JGEB 5ACMA 3H0TB 1P4LA 1CICD 1JTOA 1LE5B 1EEYA 1GPOH 2DBLH 2V7NB 3LEXB 3JSSA 4HWBH 4ZS7H 3WFEH 1FIGH 3U4EB 2VABA 3NCJL 4P2CG 1AC6A 5IBLD 1B0GB 1RZFH 1JV5A 1A7BA 1L0QA 3GHBL 5GXBB 2VDOH 1EUUA 5HVWA 4Y5VC 5KVGH 2NY5H 4LHUG 4JCMA 3L95B 1T7ZA 1FPTH 2WQ8A 1UADC 4IM8A 5D2LF 3V6FA 3QUZB 4JGMA 1KEGH 4GG6F 1NJ9A 2VAAB 2VLKD 1KIQA 1TVHA 2LU7A 1N5YL 4LFHD 4D9LL 5A16B 1BZQK 2HT4D 5I71C 2EDHA 4NQDB 3PWVA 4I9WD 5BS0A 3HE6C 4L4TD 3QEUB 1LO4H 2ZPKL 3QFDB 1S7WA 3HAEB 4Z95L 3JV6A 1A3RL 2C4FU 5L2KA 1TZGL 3MRPA 1ODAA 5DRWA 2FH8A 2DIBA 4MB3A 3IKCB 3HI5H 1YMMB 4PJAF 2VNCA 2OXHA 1QQDA 4HCRL 5TDNB 3C5JA 4LDOB 1T7YA 2CXGA 4JDTL 2PYEE 1OF2B 4QF1B 4PJ9B 1X4ZA 2AV7B 2OR7A 3I6KA 5HVFB 3ZDXF 3EDJA 2BVYA 2CO6B 4JFQA 1A47A 2H26B 4RIRA 1KJMB 4NN7B 4NKDB 2IWGA 1TTGA 4QGTA 3HNSL 5BVJA 1AO7B 1RIUL 4YO0A 2XQBH 1OAQL 4FA8A 4YQXL 5LGHL 2PETA 1HOCB 1UWXH 3O3EA 4LGSB 1OGAB 4TNWK 4NO2A 4ZFZA 3ZE0F 2P7TB 3OAYK 4WW2A 4KGJA 1MFAH 1Z2KA 5C7XL 3RY6A 3UXFA 4ZD3L 4K7FB 4D0BA 4TQEH 1DTUA 4I3SL 1A7PH 1OGTA 3VXRD 4Q0XL 3VFSA 4HV8B 2NY2C 1GHFL 1JGUH 5EA0L 4GRMB 4PG2A 3I50L 3HCVB 5CIPA 5E2TL 5C0CB 5F1IB 3HR5B 4D0CB 1NAKH 1CGXA 4MMZC 5FOJA 3I2CH 2N7BA 4JFXA 2AK1H 4WFED 2X1WL 2X42A 3IDMA 1S7RA 3SQOH 3OV6A 4TPRH 5CP7A 4HUXA 5IT2L 1K3IA 3C09C 5E99H 4K94C 3QPXL 4RNRA 1IGJB 4GH7B 1CVRA 4BFBD 3AB0C 3NPZB 3T3MF 1WFTA 2HT2C 1U8HB 3QEGL 5JOFB 4NUJB 3RWJB 1BFTA 3I75B 1MH5A 1AGEA 2IFFL 1BF2A 2WV3A 3KYKH 4KQ3L 4LSRL 1T1XA 4NKOA 4FXGB 1VFAB 1QNZL 3PG2A 1M71A 2BSSB 3ARWA 3REWA 2PYFB 2XICA 2OP4H 4LPTA 3BGAA 3LD8C 4ZUWA 2X9YA 2R2CA 1KSRA 2BSRA 3O8XB 5CCKL 3X14B 4OQTL 3BKMH 5F89B 3IFLH 2O61B 2RIKA 3CFEB 1ZLSL 1YPZA 1HH6A 2J8HA 4GRLA 4Z5RA 2X05A 5B3JF 3S4SB 3TA3B 5B4MD 5EFIB 4XT1C 2XWJB 4O2EB 3TV3H 4DK6A 5IMOB 4MJ6B 3MACL 3D25A 1EBPA 5KTEH 1W0VB 3OJDA 4DGVL 2DQJH 5GSRB 4OCWH 4OLWH 5IMKA 1GOGA 4G9FD 3VXNB 4PRPA 5ESVB 4C56B 3C08L 1B4JH 2FJGA 2ILLA 3QUYA 2ITCB 3N85L 4O02L 1NDMB 3ZKMD 2R2HA 2Q3AA 3GMPA 1BIHA 1F11A 4U6TA 2X4RB 4EI5C 1OARL 4HJGB 3VH8B 5T33H 4J1UB 1DSFH 5DD0H 3BWAA 4Z7WA 2Q86B 4EQ2A 5D7JA 4S10A 3T65A 1KCRH 1RFDH 1PX4A 2CK0L 4X4XA 2H9GB 3CZJA 4XP5L 4N5EC 1J12A 4PJDF 3DMMA 4G6KH 1S7SA 1I9RH 4PGEA 4GLRI 2DYPA 3IXAA 4P9MH 1R3LB 5C0IA 3FB7A 3LQAC 4U0RC 5DUBA 1W2KT 2YOCA 4X8JA 3QNZB 3MLYL 1X5HA 3UBXB 4OF7A 5CHNA 3L3GB 1F58L 4NQUA 5J0BA 1DQDH 3SKJH 4GBXA 4PREA 5C6TL 1V7MH 2WIMA 1EXUA 4X6CB 2EEDA 4YBQC 2OR9H 2HJFA 4ISVB 1A3QA 4LVNB 4AEIH 5DUML 15C8H 4Y2OA 2B1HL 1QSFD 3T2NL 3JV5A 2MTPA 2XTJC 3B6SA 4P23A 1T0NA 3SCMB 1U8QB 4P2QE 4ZUUA 3QDJA 43CAA 3GMQA 4OCNC 5IW6B 2ADGB 3M1BA 4XPGL 4WVRA 1RU9L 5FUCC 4ZSOA 1BAFH 3ZYZA 4NQSA 4NN5B 5EZJB 1OAUH 2Z92B 4WUUB 4WY7H 1LE9B 3FN0L 1FN4B 1PKOA 2ERJC 3NFSH 3O3BA 2OLDA 1KN4H 4DKFL 3D39D 3B3IA 4WFGD 1LO2H 5FF6A 2CJUH 5FFLA 3AS3A 4PP2A 2F74B 3MBXH 5IB4B 5MEOA 2EDRA 1U95A 5I1EH 5H35B 3MRLB 2DM2A 2DL9A 1WIOA 1XGYH 4AMKL 1V8HA 1Y18B 4X5WA 5I1AA 1GC1C 1RJZA 1OD7A 3DSFL 1P7QB 1IZKA 5FGSA 1OSZA 3HC3L 1XH3B 5J11C 4ZFOB 4AYFA 2OL3L 5JIPA 3U1SH 1HSAB 4AM0B 4P2RA 1P1ZB 3RNKB 3QAZC 2Q8BH 1A5FL 5DEFB 1QYGH 1U91A 2XWTA 2VL5A 4YXKH 5E2UL 4LSPL 2NXZC 1CQYA 1A6PA 1WF5A 5I73C 2DI9A 3TPKA 3VWKA 4NGHL 3ABZA 3ARTA 3HE6D 2A83B 4FQCH 3X11A 1TTUA 1ZXQA 4GW4A 2GQHA 2CLRA 4GAYA 4LVOB 1PKQA 2EYRB 3HZKB 1QLRB 4U1MB 3VFWB 4YBLC 3HMXL 4JQIH 4CJ0A 4CVZA 3GSOA 3P73A 2L7JA 4KAQH 1NCBH 1FG9C 1X5GA 4OF3A 3RTQC 4KKBC 1BD2B 4QO1A 3EO0A 5K9OB 1KV3A 1A6UL 4LCCA 2XNAA 1FNSL 4JDZB 1Q8MA 1HDMA 3QWRA 1JGEA 3H0TA 4MJIE 1G7PB 1UJTA 1LE5A 2ARJQ 5I74B 5C0GB 2V7NA 4LNVA 3LEXA 3RU8L 4S1SL 1AFVL 4YFLF 4NYLB 3U4EA 2DQUH 2XZQL 1TQBB 2GCYA 1B0GA 1WAAE 1J8HB 5DJ6B 4JHWL 4Z7VE 5D1QC 4XMPH 3ARGA 3AM8A 3TZVD 3L95A 1BGXL 3K46A 1WFNA 4MA7H 3QUZA 3GBMH 4U05A 5CKAA 2VAAA 2NY2D 5CSZB 1C7TA 3GMMB 5A16A 4OM1L 2ZUTA 3CLEH 4QHLB 1P4IH 4NQDA 2JCCB 1F6FB 4JO3L 3QEUA 3EFDL 3QFDA 5GGQH 3EO9L 5IB3B 1URLA 4TSAL 3HA0A 1O7VA 3MCLH 4KROB 1D6VH 4PJCE 4APQC 3ZTNL 1KYOK 4K23L 4NQEB 4UAOC 3DO3A 1KACB 3IKCA 1NUGA 3TT3L 1YMMA 1OLLA 4HKZB 4Y5YB 1J1PH 1JWMA 5TDNA 5I0ZA 1OPGH 3ZT7A 3F6LA 3PQYA 4MJ5B 1LO3H 4JREB 4QF1A 5LQBL 4PJ9A 2AV7A 2DOCA 1UM5H 5IJKC 4RWYL 1MIML 2H26A 1KJMA 4NKDA 4OCSH 2CGRH 2DLEA 4Y4HB 1AO7A 1FYHB 4KUCD 1E28B 4QHKI 1HOCA 4PB9H 1OGAA 3I3BA 3QIWB 1F4WH 2P7TA 1JZ2A 4P46C 5A2LH 4Y4FC 5DJAB 3PGFL 3K80A 1UG9A 4HBQA 3KS0J 2NZ9C 4HC1A 4K3EH 5EZIL 1FSKC 3S36L 3SY0A 5DD3L 4HV8A 2B39A 1EVUA 4P48A 4GRMA 5KVDL 1DL7L 1I1YA 3HCVA 2H8PB 4OZHE 5C0CA 1IC4L 5F1IA 3HR5A 1F2QA 4D0CA 1CE1L 5FHAL 2OTWB 2O93L 1N6UA 1RVFH 4JDVB 4Z6AT 1A9EA 1P5VA 4RMTA 1JYNA 4OLZH 1S7QB 3MGOB 1G9ML 1WZLA 4X80H 5L7XL 4NRYB 1TJIL 1JE6A 1IGJA 3RIAK 3U7AA 2VZ1A 4PGDB 2MKLC 3RIFK 2OXGA 3KR3H 1U8HA 5JOFA 4IOIB 4NUJA 3RWJA 3I75A 3FCTA 4F7TB 4JE4B 4WHYG 5DJDB 5FYJH 4G8FB 5C3LD 3I6LD 4K3JL 4EI5D 1VFAA 1LDSA 4KKCC 4N9OB 2YD6A 1FZOB 1T21B 1XGPB 3OZ9L 4PJHF 3NACH 2PYFA 5DVLA 4QRPE 3FZUD 5GQBA 1AD0B 4JKMA 1CLZL 4N5ED 1EFXB 1VEMA 2DQGH 3O8XA 5I8KH 3X14A 4B7LA 2X7LB 4G7YH 4IMLB 2X4SB 1JPTL 4S1DC 4OUOA 3CFEA 3MJ8B 4FMKA 5ADOH 2VWEC 3TA3A 3ARDB 3F7PC 4XTRC 3NBNA 5EFIA 1AP2A 2VXVL 1DLFL 2QSCL 3O0RL 2XWJA 4O2EA 5IMOA 5F70A 5C9JB 3WFHB 4GKSA 4M7LL 3FAWA 4MJ6A 3D69B 1JGLL 3PHQB 4YBQD 4U2ZA 3U30C 3CH8A 3S8WA 2EXWC 5GSRA 1M1SA 3VXNA 1KJ3L 2X4PB 2ESVB 5ESVA 4C56A 2XTJD 2DKMA 2DQFB 2G5BB 2J7LA 3SJVD 5L6YH 3L5IA 1N2RA 2YKLH 2ITCA 3CUPB 3WNKA 1RJLB 4LCUB 3AS2A 4UT9H 1NDMA 3RX5A 4NHCL 1PSKH 4X7DC 3SE9L 3U82B 4K3HA 2X4RA 4HJGA 3BZFA 3VH8A 3HZYB 4J1UA 3C60B 4BYHA 3OQ3B 3PP3H 3NIDF 3V4VL 3DNKA 3O2VL 4U1LB 2Q86A 3QFJA 4PY8J 3BPLB 1UACL 2H9GA 1FIEA 4YUEH 4PJ5D 3CXHJ 1JWSB 1I7UB 5HD8C 5DMYA 5IFAH 3SE8L 5LGJB 4LARH 1D9KD 5CZXC 2E27H 3K3QA 4Y88A 1R3LA 1PBYA 1C5BH 4KK5C 3VFMB 3DURB 1IAIM 1WFOA 1KFAH 3QNZA 1GOHA 1VEPA 3UBXA 3L3GA 1TJGH 3PWPE 4GQPH 5CGTA 2EDWA 1I8KB 1GVIA 2DMKA 5K9KB 3QHZH 4X6CA 4DW2L 3FQRB 3OG4B 4ISVA 1GGTA 3C5ZB 5D70L 2YSSB 4NCDA 1BQLL 5A1AA 2NXZD 4HJJL 4KDTA 3VGAC 1QO3B 2P5WB 4CN1A 3SCMA 4ACPA 1U8QA 3U4BH 1OWRM 4PJEF 3KPQB 5IW6A 3UTTE 5IQ7L 5FAAA 4MXQC 5F9OL 3IDGB 1H5BC 5EZJA 2Z92A 4WUUA 1LE9A 1FN4A 5EU4B 1T22B 3H9SB 4MNGA 5HYFA 4P5TB 1ZTXH 1OHQA 2NR6D 4Q2ZB 3OSKA 1MHPH 4PJ7E 4LVHB 2HWZH 2F74A 2E9JA 5IB4A 5JA9A 4JRXE 1MAMH 3BIAX 2HRPL 4LCIH 3RTQD 4KKBD 3D85B 4IMKA 5ALBH 4LASH 2PO6B 5H35A 3MRLA 1Z3GH 2B1AH 1XIWB 1MI5E 3V4PL 1Y18A 1QBMH 2WZPD 5BO1H 1P7QA 3L3HB 5TH2B 3LSOA 2V5SA 4M48H 4ZFOA 5D72L 1X6LA 3FFCE 1FFRA 3NTCH 2E8ZA 4HPYH 1HSAA 3VMPA 5D1QD 4AM0A 1QEWB 3ULSB 4BA8A 2I60L 3RNKA 2YRPA 3TYGL 5C86A 4UTBL 2AI0L 1HIML 5DEFA 1ITCA 3ZTJH 3Q1SL 2GW5A 4N0CD 2A6JB 4DN3H 1RK1B 2OSLB 4OGYH 5K59F 3QDAA 4PPTA 1F2XK 1BJ1J 3FFDB 2F8OA 5E5MB 4PJGF 2ED8A 2DLFH 3MOAH 5HI4C 4LCYB 4CU6A 4APQD 1VESA 2RQ8A 1QLRA 3HZKA 4U1MA 3ZT5A 4EUPG 1OT2A 2IADB 1XF3B 4HJ0D 2MPAL 4UILH 1MQ8A 2BOCB 4QRRD 3G5YB 4RBPK 1LDPH 4YHKL 2PNDA 2VDLH 1BD2A 4PLKC 5K9OA 4JDZA 3NABL 3RVWC 1J87A 4UV4L 1G7PA 3EBAA 1R3KB 5JOPD 2FEEL 3WS3B 4NYLA 3GSWB 3VI3E 2VZVA 2BDNH 3ZO0A 2CRMA 1JTTA 1J8HA 5DJ6A 1U8KB 2GTWB 5DT1H 4P46D 4Y4FD 1JPFB 4P3CL 3QBTB 1D6EB 3DI2B 3FOLA 2NZ9D 5B22A 4PTTB 3GMMA 1T6WA 2DQHH 5DVNA 2D31B 2IG2L 2VZOA 4LPUA 4QHLA 3D9AL 1AKJB 3SDCD 1N6QL 3BT2H 3NPSB 3SDAB 4M43L 5GHWH 5IB3A 3NZ8B 5CP3H 1BFVH 2BVTA 2DL2A 4X7TA 3TO4B 1A14L 4RX4A 4NQEA 1FGNH 3I3DA 3MUY1 1CXIA 4Y5YA 1YNLH 4KZEL 3V7AE 2J2ZA 4MJ5A 4ZOAA 5JUEL 5HPMB 4OZFG 4HDIB 4C58B 1T6VN 2R0ZH 1HI6B 4PY8I 3OJVC 4XAKE 1ZLWH 4Y4HA 4HMCA 4Y1AD 1XAUA 4DTGL 5CGMA 4KKCD 1LEGB 4GRLC 1ZGLP 4ZFFB 4CKVX 5I2IB 2HYMA 3QIWA 4TRPL 2B4CH 4XCFL 4G3YL 3K1DA 4LLWB 1A7NL 5DJAA 3L3OB 1OTUC 1PYWA 1DANT 4S1RL 1FH5L 2V2XA 2VE6B 3AY4C 4GLRH 4OLYH 5IEKB 1A1OB 4LSSH 1RZJH 3FB6B 4YLQT 2CKNA 1M05B 2BNQA 1YQ2A 3BESR 1S3KL 4GOSA 3SO5A 1OP5K 4RFOH 4KRPD 4S1DD 1LEKB 3QUYC 1RUQL 4D9RE 1L7IH 1RZ7L 3RVTD 5IUSA 4LSVH 1T0MB 1CR9L 5FCUH 2EO9A 4Q9CA 4MVBD 4XTRD 2XZZA 3BUYB 4G8GE 1JGDB 1M7IB 1ZA3A 5BMFL 1S7QA 3MGOA 3VRLF 1RUAL 4ELMB 4NRYA 5D7JC 1BBDL 4U6XB 1YEJH 2EXWD 1AHWB 4GRWF 2X40A 4PGDA 5FK9B 4IOIA 3H8NA 5DJDA 4P59H 4MAUL 5BJTB 4G8FA 3MXVL 3GK8L 5J6GB 1CG9B 4RA3A 2K3TA 1Q1JH 4WHTB 3EFFB 3H9ZA 4Z0BH 5DTFA 2GK2A 1FZOA 1T21A 1XGPA 2IAMC 4FQJL 4JO4L 1AD0A 2PCPB 2YD7A 4QGYA 5C1MB 8CGTA 3FMGL 3T0XA 5H8DA 4L4JA 3GBNH 3LV3B 1EFXA 4KI5F 4OT1H 4DOHE 1S7VB 3HB3D 3V5DB 2X7LA 2VLME 2DJSA 4IMLA 2X4SA 5CZXD 5D1XB 5SWSD 4P23C 1DP0A 4KK5D 1CLYH 8FABB 3LN4B 4JB9L 1MCRA 4OGXH 2AW2A 3M45A 4J3UA 3ARDA 4ODTL 1FNAA 1MQKL 5LJYH 1GYAA 2GSGB 5C9JA 3WFHA 5GRYA 3D69A 2XQYG 4Z7UE 4UV7H 3PHQA 3BYTA 2AAVA 2A2QT 5DHYB 4P2QB 3FO1B 2NY6B 1CD9B 4LK4A 4R2GC 5DQDL 4LLVB 4HMDA 1IEHA 2X4PA 2ESVA 2DQFA 2G5BA 2VDML 1WBYB 2X5PA 3CUPA 1RJLA 4LCUA 2EYSA 2EDDA 4QXGH 1WBXB 4WWKA 1EJOH 4P2OC 1H15B 4MXQD 3G6DH 3HZYA 3C60A 4OSUL 5GS0H 4Z8FH 3U9PL 3J7HA 4U1LA 43C9B 3S88L 5ISZB 5IK3B 4YXHL 5F3BB 4YC2C 3VXME 2F19H 4I13B 1JWSA 1I7UA 2AJXL 3SKNB 3OHXB 5IMMB 1ETZB 5DI8B 2RCSH 4WW2F 4ZAKB 5LGJA 1UC6A 1QSEE 4KJPC 3AGVA 2G60H 4K9EC 3WUWG 1GSMA 2CDEB 4HIEB 3VWKC 4LSUL 1LQSR 3VFMA 3DURA 3U7YH 4FXLA 3EYVB 5FDWB 2ZG2A 4NIKB 1AI1H 5L2KD 3NAAL 4ONGH 3U46B 5K9KA 5D2LE 5KJRL 1KELH 3FQRA 3QPQD 3C5ZA 1QBLH 3QWQB 5CEZD 1CE6A 1JCKA 4PJIB 1XF2A 2YSSA 3LKRA 4WEBH 4PRHE 4KZDL 5EC2B 1KIPA 5DJ2B 2Y23A 1ZOXA 3GO1L 1V3MA 3BVNB 4Q9BA 1QO3A 2OK0L 3R0MA 4LCCC 4MZ3A 1CVSC 4JZJA 5HDOA 4PB0L 3KPQA 1QOKA 4PJXF 2EIBA 4UIKL 3GDBA 3IDGA 3CLFH 5EOCJ 3PUCA 4TSCL 1FG2B 1WTGT 3P9MB 5EU4A 1KEML 3H9SA 3W11C 4P5TA 4WJ5B 3PWUB 4PJFE 4Q2ZA 3S5LB 4XB8A 3AM8C 4MJIB 1YQVH 2WUBL 4N8VG 4CBPA 4TYUA 4OD3L 3QUZC 2CK2A 3D85A 1B2WH 4PLKD 3DARA 3OB0H 3DRQB 2PO6A 2ZOKA 4LAQH 3RVWD 2JJWA 4G6FB 4OI8A 1XIWA 4JKLA 1IGFL 3NZHL 4X6DF 3L3HA 2IGFL 1T7XA 5DK0B 7CGTA 5TH2A 3MLUL 1DEDA 3UTSE 2VDPL 1FDLH 3SDXF 1QEWA 3ULSA 1QFWH 1X6NA 3GZKA 4ODVL 1GJIA 3QG6B 2A6JA 1B4RA 1RK1A 2L4OA 4PJCB 2HKHH 1A7QH 2OSLA 4FZEH 2QKIB 3P4MB 1A1MA 3FFDA 4NN7C 3AC0A 5E5MA 3W0WB 1NGQL 35C8H 3PJSB 1ADQH 4KMTL 4Y4KB 4XCNB 1T5WB 3PNWB 4LCYA 4CW1A 5I1KH 5IW3A 1E4XI 2PYEA 1XF3A 2R0WL 3GFUA 5DA0B 1KJVB 3LKQA 1H3GA 3LDBB 3MRMB 1ZANL 2BOCA 5GZOC 3G5YA 5DF0A 1A6VL 3MA7B 4N0UE 4KTDL 4UNUA 1KXTB 4FTVE 4HC1L 5D8JL 2C3HA 2NLJB 4OTXH 3CFBB 1LO0H 3ZDZF 1CL7I 2EEBA 1MLBB 3WS3A 4U3HA 4ETQB 2BERA 3GSWA 4GRLD 4N90E 2V2WB 4XBPB 1U8KA 1K9TA 3DHMA 2GTWA 5HTSA 2J4WL 5FYKE 1JPFA 2KPNA 1OTUD 5C0RH 2HH0H 3B8SA 4OZHB 1D6EA 4C59B 4KWUA 1VFOA 4PRPD 4PTTA 3BJLA 3NVQA 4POZC 2J6EH 4HWEL 2D31A 4XVSH 1A6WL 1OM3H 1AKJA 5B3JE 3QUYD 5D5MF 3SDAA 2VXUH 2VXQH 4I3RL 4M6OL 3NZ8A 3K4ZA 4M5ZH 4X6BB 3Q5TA 5JQ6H 1VKXB 3TO4A 3E0GA 1TVDA 1BWWA 2A77L 5D7JD 1A4KB 4IJ3C 4MGXA 5SX4I 3DMMD 4O00A 3V6OE 1J11A 3TP4A 1GPOL 3MFFB 3ZT6A 5HPMA 4ZS7L 1BBJB 4RRPG 3O8XC 1J18A 4HDIA 2WNGA 3WN5B 1HI6A 2DYPD 3W9DB 1RZFL 5KVGL 1LEGA 3RGVB 4HSQA 5LCVH 1FPTL 3TA3C 5I2IA 4AY0A 1KEGL 4PJDE 2P42B 3BFOA 3DOSA 4GBXD 3L3OA 4LLWA 4QOKB 3FO9B 5JDSB 5DJ8B 1LP9B 5IEKA 2FHCA 3FB6A 1LO4L 1SBSH 2DQIH 2QEJA 3IRZA 4BUGA 5IQ9B 2APXA 3EJYD 2EZ0D 4HXAH 5DQJB 5E8NB 1RJYB 4P23D 3O45B 1LEKA 3QDJD 4LPCA 1T0MA 3RI5F 2PTTA 2NY7H 4O2FB 4NC1C 4UZGA 1M7IA 2P1YA 3V9FA 5IHUH 4O9HL 1JNLH 4ELMA 4OLEA 1X5KA 4KRMB 4NZRH 4U6XA 5DURB 1ND0B 5ITBH 2VZTA 1AHWA 4R2GD 2H6PB 4MWFB 2CUIA 5FK9A 1B3JA 4HT1H 1FVDB 2XQBL 2HN7B 4KPHH 4NDMB 3WE6B 2W9EH 1UQSB 3IVKB 3KYNA 2FDBP 5DDHB 1SM3L 1MFAL 2F5BH 3DUUB 3DYPA 5E2VH 4WHTA 3VXSE 3EFFA 3QHFH 1TXKA 3RL1B 4TQEL 3K1KC 2AEIT 2PCPA 4P2RD 1JGUL 2X9XA 2BY3A 3WFBH 5BZWB 4LVNC 3LV3A 1NAKL 2E7MA 3KPPA 4XPTH 1S7VA 3V5DA 3KS0H 3I2CL 1KB9K 1OAKL 4FP8H 4KJPD 5C2BL 4KDTC 2AK1L 5D1XA 4KTEL 1CFVH 3JXAA 1KCVH 3VWKD 1T83A 3L1OH 5HGAA 8FABA 3LN4A 4TPRL 1FO0B 5E99L 2IPUG 1XF4B 4NN5C 2GSGA 2FECI 3GSVB 1UH4A 5DHYA 4P2QA 2LAGB 3BUTA 3FO1A 3OG6B 5FM8A 3KYKL 5CP3A 3GI8L 4LLVA 2JJTC 3UTQB 1WWBX 1Q9LB 1WBYA 3QWRD 4M4PA 1DBBL 1WBXA 3EGSB 3F7YB 3GJFB 1IARB 3CD4A 2CLVB 1H15A 3IFNH 4DWHA 1BPVA 4PJ7B 2OP4L 1RI8A 43C9A 4D3CH 3VFGH 3QWOB 3PXHA 3QQ4B 5ISZA 5IK3A 4R90H 4ZFOL 1XEDA 4KJYB 3MLSH 2ID5A 4GAGH 3ARGD 2ADJA 5EBLB 5F3BA 3IFLL 4WU5A 1YN7B 4RMWA 5IMMA 3SKNA 3OHXA 3QUZD 5DI8A 3QDME 4ZAKA 2YD2A 2CDEA 4XPAH 3FFCB 4HIEA 4NQDD 3TV3L 4OZIF 2DN7A 1ZVHA 5LXGH 5FDWA 2ICWI 5FB8B 3ZTJG 1I3RB 2RR3A 1JI1A 1T3FB 5KTEL 1ZHBB 4LVOC 3ZYOA 3OKMB 1MNUH 2DQJL 4BH7B 4OLWL 4FFYL 5E94B 3TBVB 3MODH 4H25B 3U46A 1RQ5A 1MFEH 2MNUA 1I3GH 5MENE 5FUZH 3ZYJA 1B6DA 1YMMD 1B4JL 5IW1B 2V9RA 4PJIA 4WWID 5EB9A 2HFFB 4XP4H 3BYYA 1WV7T 3PQYD 5EC2A 5DJ2A 5L8JB 1Q72H 4PJ9D 3BVNA 2BVUA 1DSFL 1RZKC 1TFHA 3ARVA 5DZOA 4CMMB 4EBQH 1RZKL 3G5XB 5IGXH 5I74C 5HY9B 2E8YA 4XP9H 1KCRL 1AO7D 2FX8H 4YR6B 4HUUB 4W6XB 3QIBB 4OCYH 1Z9MA 3U2SB 1TQBC 5FECB 4G6KL 1OGAD 1FG2A 1N64H 1I9RL 3P9MA 1MCKA 2FGWH 2VDRH 4WJ5A 3PWUA 3FT2B 3BKJL 3S5LA 1QG3A 5IR1B 1EUTA 4MJIA 4P9ML 3SKUD 4NZUH 4JKWA 4QEGA 4Q58C 4X6FB 1NBVH 3O6FC 3MYJB 3DRQA 1I9IL 5F1KC 1WAAA 1IGML 5C0CD 5I16B 4NFBA 1Y6KR 5A43C 1V7ML 4HIIB 5DK0A 3MA9H 3QZWG 3VGGA 4JZNB 1JJUA 5E24E 4HK3N 4KROC 1L7TH 4NKQB 5EU7C 1NBYA 15C8L 1QRKA 1JHLH 4LCWE 4ZOEA 4NOFA 3OWEA 2OMNA 2YXMA 1NCCH 1S7XB 3OTTA 1NPUA 4TNVF 3LRGA 2IEPA 1T89A 4RMSA 2HVKB 2O26U 3CSYB 3QG6A 3HI1B 4P4RB 4POZD 5CSBA 4BQCA 5L8KB 1M6OB 3DVNB 3KJ6H 1BAFL 4PJCA 5K9JL 1FYTB 4AIXA 3P4MA 3K2UL 3MZTA 2IMMA 1NANI 3NFSL 4F9LC 1KN4L 1F6LL 3W0WA 4TVPL 1CXLA 5DHXB 5J3HC 1LO2L 4Y4KA 4XCNA 1T5WA 3PNWA 2CJUL 3QIWC 2N56A 1MCQA 4P3WA 2WSKA 4EDXB 3MRMA 1T66C 4OD1H 4U6HB 5I1EL 1GZQB 2WBJB 5CJ5A 4JEGB 2FEDD 1XGYL 4Y8DC 1XGQB 3T0EE 2NXYB 3O8XD 1MREH 3UPCA 1PG7X 2NLJA 3CFBA 2DLGA 5DWUH 3W2DH 3WS6C 4MNHA 4DK3A 2Z35B 3U1SL 2Z91B 1MLBA 4FQ1H 1WZMA 4PJHE 2VR9A 2CIIB 4S2SB 2YD5A 4QT5B 2AJSH 4JFOB 3TA3D 1U58B 1JRHI 2V2WA 1R6VA 1CDBA 4YXKL 3SKOB 1HH9B 4JQVC 4N0RA 5EU6B 1YN6B 2VC2L 5E5RB 4JN1H 1J5OH 4OZHA 4P5KB 1G84A 4XNXH 2HTLC 5F97E 3X13B 4LEXH 3WO3B 5L8LB 3LMJH 4FQCL 1EK3A 2UUDH 4C56D 1L4IA 4MDIB 4WW1A 3TH4T 5GIRB 2Z31B 3D3VB 1DBKL 3A67L 3GBLA 3N1QC 4JHZA 4E0RB 1K4DB 3A6CL 3TNMB 1QLEH 4X6BA 1BJ1H 2WINB 2Y5TA 2H1PH 1VKXA 4UOJA 2X10A 1G7QB 1NCBL 4LNRB 3L5HA 3LPWA 3QFJD 2Q1EA 3VD7A 1Q9KB 3B83A 1A4KA 1FLTX 4PRDB 3JWDH 3MFFA 2XZCH 3EZ8A 1BBJA 2A0LC 4WGWB 4RDQF 5KSBF 3WN5A 1CLCA 5FYLD 3BEVB 1ED3B 3W9DA 4PGCB 4MXWH 4QRPA 3NIDE 4XMPL 3TBSB 2A6DB 2JK5B 3K8LA 5FUOL 3RGVA 5E7BA 4JO1H 1MCWM 4X4ZA 4IHOB 5C0DB 3GBML 4Q9QH 4FQHB 4DOHB 2XWBB 4U1GB 4XX1E 3FO9A 3WNNA 5JDSA 3EOYG 3CLEL 1LP9A 3QI9A 5DJ8A 3RFZC 1P4IL 4TOYL 2J88H 2A74B 3RHWK 1QZ1A 5IQ9A 3TBYB 4X9GA 3H3KA 5T3XE 5T1KB 3MCLL 1TJHH 5DQJA 1D6VL 3BPOB 5B38G 1LK2B 3O45A 3QHTC 3SCMD 4B41A 4ODBD 4Z7UB 4UQ2B 1Y6NR 3FT4A 4O2FA 2HT3D 4UB0H 3ULUC 1MEXH 3B2VH 4WUUD 1LO3L 4DZ8A 1KYOJ 5KW9H 3QRFM 3AROA 1UM5L 1ND0A 2VLKB 2KL6A 3OKLA 3BE1H 1OQXA 1ADQA 2H6PA 2CGRL 4MWFA 4L1DA 5KS9F 2VYRE 4AEFA 3MLZH 1FVDA 2Q87A 4NDMA 3WE6A 1UQSA 3IVKA 3EYUH 1JNHB 4PB9L 3DROB 2FH6A 5DDHA 4XI5C 3KPRE 3DUUA 2P48B 4MQTB 1P7QD 1YYLH 3RL1A 3QXAB 4R97B 4K3EL 4K8RH 3SQBA 3QXUA 1HSBB 1QSEB 4FS0A 1FJ1B 1IC7L 2Y07H 1KLUB 2FX9H 3C5ZC 4X9IA 3SGKC 4X83A 5DMJB 4KVCH 1YEFL 1P6AB 4X4ME 3PL6B 3NFPB 3OAUH 1MHEB 1SJVA 3B43A 4OLZL 1NDGB 1MCOL 4X80L 5D2LB 1TTFA 5GSVA 4GG6B 3DVIA 1FO0A 5FKPB 3VFRB 1AGCB 4NQTA 4HX1B 4ZTPH 1EMTH 3HPLB 3GSVA 4L8BA 4P5TC 2I9TB 3KR3L 4LMQI 3TH3T 1HQRB 1CGTA 4KUZH 3MRQB 1WSST 4I4WB 4JY6B 4U1SB 5KVFH 3UTQA 5T3ZE 3FOMA 5DRXB 4ZPTB 1BD2D 1U8OA 2KDGA 2PO6C 4YAQB 1Q9LA 3DX6B 3PF2A 1FC2D 4K71B 4PJAB 1ZT7B 4PBXA 3NACL 3EGSA 2Y4SA 3F7YA 3GJFA 3O6MH 2CLVA 5M95B 5I1HH 2VITB 4PJ7A 1CGWA 2EDBA 2C4XA 1J8HD 1VHPA 3QWOA 2DQGL 2EDEA 3QQ4A 3TWCH 5I8KL 3FHAA 4KJYA 2DKSA 4G7YL 2VZSA 5EBLA 5L0QB 1MI5A 4PS4H 1YN7A 5IB2B 4GAJH 1KTDA 3OR6A 4ZPVB 1LK3H 1HXYB 3RQ3A 3CSBA 5F9WB 3UTSB 3FFCA 3B4NA 4CRPA 4ODWB 1J9CT 1EHNA 5FB8A 5HDQH 1EPFA 4FABH 5IEHB 1I3RA 1HWGB 3SGDI 1T3FA 1ZHBA 3KNBB 1T1WB 3DGCR 4KROD 3OKMA 1FNGB 3UYOD 4BH7A 3B5HA 5F1NB 4RX4D 5E94A 4NQED 4H25A 1RUPL 3CVIH 5E8OB 2V9QA 5IVOA 5L6YL 5IW1A 2YKLL 1QSVA 3V4UH 3O4LB 4UT9L 4P9HH 1PSKL 2HFFA 2RBLA 1IC5H 4WFHE 4XXDA 3WFDL 4JFHD 3HI6H 1NBQA 2I9LA 4CMMA 3NIGF 4TVPD 3G5XA 3TCXA 5HY9A 2EIZB 1AXTH 3MRHB 4Y4HD 4YR6A 5J3HD 4YUEL 4HUUA 3QIBA 3U2SA 5AZEH 5SX4H 4MB4A 5FECA 1CD8A 3QIWD 3IETA 1LNUA 5IFAL 2V17H 1A6AB 4DN4H 4LLDB 3FT2A 5IR1A 4I2XE 2E27L 4M1DH 1C5BL 4KQ4H 3BAEH 4M3KB 4X6FA 3SDDB 3ARBB 1KFAL 2OBGA 3MYJA 2E9BA 1TJGL 3OMZA 1G0YR 3SDAC 3NPSC 3KLAB 4NKIL 2SEBB 3QHZL 4H0HB 1EZVX 4JZNA 3MRRB 4PP1C 3KPLB 4HS8H 2ZG3A 4ODSH 1M7DB 1EZVY 2EDQA 3TO4C 4URTB 1IT9H 1WC7B 1S7XA 2EH7H 3IJHB 1NQBA 3KAAA 2HTLD 3U4BL 4P4KC 5IVZB 3O3UN 1DFBL 3CPLB 4NQCE 2FLBT 2HVKA 3CSYA 3GI9H 3HI1A 1PG7H 4P4RA 1WISA 4OLUH 1M6OA 1GGBL 1OAYH 4YIQB 3S4SG 5J89A 2VSDA 5BV7C 5JW3H 3BHBB 3BP5B 3CXDH 3K2MC 3D48R 1MHPL 1SQ2N 3T0AA 1NGZB 3BPNB 1TZHB 1MAML 3C6LB 4LCIL 4EDXA 4PIRF 4DUXA 3BH8B 3CFJB 5EOCH 4K2UH 4GRWE 3WD5H 4U6HA 1GZQA 2WBJA 4QRTB 1LO5B 3C8HA 5GGUB 4H88L 2B1AL 3L5XL 4ZNEE 1DVFC 1IMHC 1QBML 3VFUB 1EFXD 1MFCH 5KVMC 5BO1L 4WTWA 2A0LD 4HBCL 2WP3O 5J6HB 3GSQB 4M48L 4PJDB 3STZA 2Z35A 4HPYL 1RIHH 2Z91A 4X0KB 5A2FA 2CIIA 4S2SA 1JZ7A 4RZCB 1A9BB 5EBMB 4JFOA 4Y0GA 3ARDD 3ULVE 3HNVH 3SKOA 1HH9A 2AXGB 4FQQB 5EU6A 3SOBH 4YHLH 1YN6A 4KI5E 4L8DB 4MDJB 1NEZG 5KOVC 5JHLH 3P4OB 4P5KA 4OGYL 3X13A 1I1FB 2W38A 2Y25A 1CN4A 3SE4A 3RX7A 1C12B 2B5IB 4WV1B 3A6BL 2DLFL 2ESVD 3CK0L 4MDIA 4G8GA 4PRAB 2Z31A 3D3VA 1AE6H 4LSTH 2O5ZH 2Y36L 4E0RA 4L3EE 4XXCC 3TNMA 4TN9A 4UILL 4WWKD 1KJ2H 2WINA 2HLFC 3C60D 1YEGH 4KTYA 4HIJB 3ULUD 1G7QA 1J1OH 1FVCB 2Z4QB 4LNRA 1G9NC 5HYSB 1U9KA 2VDLL 2JTDA 1Q9KA 1G9NL 4L1HA 4PRDA 2AXHA 3KPSB 2GJZB 3IDYB 3IF1B 3VXSB 4Z18A 2BDNL 1JN6A 3BEVA 1ED3A 1MUJB 4PGCA 4G6JH 5SX5H 2BFVH 2OI9B 2A6DA 1QUNA 2JK5A 1FFNB 4DGIH 2DMCA 3ZKNC 4IHOA 1J88A 5C0DA 4FQHA 4OF8A 4UT7L 2XWBA 5FM4A 1JZ4A 1DN2A 5FM5M 1IQDB 3C5ZD 4YFEA 3BT2L 3TBYA 5GHWL 1BFVL 5HHVH 5T1KA 3KYMB 1HHHB 1P7HL 1S9VB 1LK2A 2D7TH 1VGEH 4MLSA 4Z7UA 4UQ2A 4ZOCA 4MCYB 3MBEB 4XNUH 1YNLL 2O5YH 2YRLA 5I30H 1GZPA 4N8CH 1T7WA 5E1AA 3H9SD 4P5TD 2GFBB 1KXVC 1CT8B 2R0ZL 2A6KB 5F8RC 3CFKB 3CZFB 1LD9B 4Q6IA 5CBAB 3FJTA 3FT3A 4R7DB 3FO0H 3C2SA 3D85D 3MJ7A 1ZV5A 2PO6D 1JNHA 1MWAH 3DROA 3D1MC 3EOBB 1XIWD 2A9MH 2B4CL 4LGPB 4MX7A 1Y0LB 3MGAA 2YR3A 5C09E 3CIQA 4XNQA 1IEAA 1NMCC 4NBYB 4OLYL 3QXAA 1W72H 4HEPG 1RZJL 1SEQH 1HHJB 4UNTA 2HFEB 1QBBA 1HSBA 1QSEA 3KYOB 3T2QA 1FJ1A 1KLUA 3LS5H 4RFOL 4DZBA 2R4RH 3FRPG 1L7IL 1MJJB 2CIKB 4LSVL 1NMBH 1RIVL 5FCUL 1MOEA 4F80A 4X6DE 1KCUH 2I27N 3PL6A 3NFPA 3UJTH 3T1WA 2P8PB 1NDGA 3OAZK 2Y06H 5D2LA 4GG6A 1CGUA 5MENB 3VFRA 1AGCA 3MTRA 1YEJL 4HX1A 4PRHA 1U3ZA 3HPLA 2BHZA 1ROWA 4CL7A 2PYED 4OV5B 1YEHL 2I9TA 2FIRT 4RGOH 1HQRA 2VKWA 4CMHB 1X44A 4XBGB 3MRQA 2WWKT 5J56B 4I4WA 1CXEA 2ZUUA 4L4VE 4U1SA 5DRXA 4ZPTA 1NANH 1Q1JL 3DUHA 4H8WH 1FV1B 4HPOL 4K7PX 4YAQA 3DX6A 1YEEL 4PJAA 4LP5A 1ZT7A 4R4ND 4K7PY 2BRRH 4KY1H 1MRDH 3BQUB 1CU4H 3EO1B 3GRWH 1K85A 3OJMB 9CGTA 4IRJB 5DQ9B 4OT1L 5D1ZC 4KKAC 5CD5C 2FATL 5EWIH 3AS1A 5INDB 5INCA 3OAYH 4ZPVA 3ZDZE 2C7UB 3VDBA 1HXYA 4YPGB 4YHML 2C4FT 3UTSA 4LCWB 1AKJD 4NQVB 4U3XA 4K3DH 1JRHH 4HKBB 3SDAD 4L4TE 3CH1B 4ODWA 4HGMA 4UV7L 5IEHA 5JW5B 3KNBA 3N1MC 1T1WA 1FNGA 3TO4D 3DV4A 5F1NA 1SJHA 5IVXE 2MKWA 4HD9A 5E8OA 4QRQB 2QHLA 3LDBC 4UUJB 3PHOB 3EJZC 4JHAH 2NQCA 4V1DE 3O4LA 3RX8A 5AYUH 3VA2C 4V2BA 3MC0A 1EJOL 5JXEA 5D5ME 2F53E 3MYZA 1IE5A 4G80B 5GS0L 4Z8FL 2D0GA 3CFIC 3MGTB 4FN0A 3X12B 2XV6B 5F7YC 1L9NA 4G8EB 4HFWB 3MRHA 3H42L 1CBVH 5FKAB 1NC2B 5E7FA 4LSQH 1A0QH 2DLIA 2F19L 4FTVA 2RCSL 5LVEA 1A6AA 4LLDA 1I8LA 2Z8VC 2XKSA 2G60L 3PP4H 1P7KB 4DEPB 3T4AA 3ZKXB 3DUSB 3SDDA 3ARBA 4PJHB 2P8LB 3MPCA 4JPWH 5JW4M 2OM5A 1AI1L 2FHBA 1DUZB 1OTSD 2JB6B 1I7TB 4ONGL 3KLAA 2B0SH 1FP5A 2SEBA 4LVEA 1KELL 4XWOC 3MRRA 3KPLA 4JR9H 4WFEE 1M7DA 2I5YH 5GJTL 1WVZA 4G42B 4WEBL 5HI3C 2R69H 3GNMH 5K9QI 4PJ5B 1U8NB 4RISH 5IVZA 1R0AH 3CPLA 3O4OC 4F7CB 4OGZA 1S9YA 2XZAH 4D9QE 2FJFB 4G5ZH 5C6PB 1FQ9C 1P4BH 3WN5C 4YIQA 2YA1A 3CLFL 5KSUB 2KZWA 5D6CB 1I7ZB 1U6AH 3BSZL 5D2NE 3MUJA 3BHBA 3BP5A 5F1SA 4PLOB 3RGVC 1YQVL 1NGZA 1TZHA 4HIHB 3C6LA 2D03H 4JM4H 2EDYA 3CFJA 2D7NA 4QRTA 4F8QA 2VDNH 4GS7B 5H37H 1LO5A 1NFDE 1IZJA 3DLQR 5GGRB 5GGUA 4XMLH 1H3PH 5F44A 1F90H 3VFUA 3VG0H 3CDYA 4R8WH 2AJYH 4Z9KB 5J6HA 5FV1L 3BP4B 5ACLA 4PLNC 4ALAL 3JUZA 4XNMB 1BQHB 4CGTA 1JF6A 5D1XD 3EW3B 4PJDA 1OAZH 3WJJC 4X0KA 1FDLL 5BOZG 2EECA 1F6AB 3QIUB 4XNYL 3LOWA 3P11H 2VISB 1QFWL 4RZCA 5EBMA 1F42A 3U7WH 3T2OA 4FQQA 4L3CB 5EUKB 4L8DA 4MDJA 2EKSB 1A7QL 1BZ9B 3MUZ1 4M7ZB 4P2QD 2NY6D 2QQLH 5EU3B 1C12A 35C8L 1ADQL 4JO2H 4OZGF 4PRAA 5KSAC 1NSNH 2AGJH 4ZO8A 5MI0B 1U8JB 4HH8A 3DVGB 3EOAB 4GKOA 25C8H 3NGBB 4F58H 4XMKH 3GKWH 1UKSA 5L88H 4HIJA 1FVCA 2Z4QA 2EIEA 5HYSA 4PJEB 4XB7A 2Q6WB 3MRNB 5ISZD 1QA9B 1PFCA 5BQ7B 2UWEE 4HLJA 1LO0L 4M93B 3K8MA 3KPSA 1SMAA 2XA3A 2GJZA 3RVUC 3IF1A 5GISL 3VXSA 2A1WH 3D2UB 4ZAKD 4YZFF 1MUJA 3HMWL 3RWFB 5D6DC 3O6LH 1YEDB 5C0RL 5CILH 4M7LT 1FFNA 3LKNB 3TBWB 4EIZC 1MCDA 3KJ4B 2R1YB 3D87B 2DI7A 5FA4B 3BW9B 1UVQA 4U1HA 1S78D 3V8CA 4Z7VF 1OTTC 4OI9A 4JM2A 1OM3L 2Z8RA 2VXUL 4JPKH 2VXQL 1QSFE 4EI6B 1J0IA 4OZIE 4M5ZL 5JQ6L 4LRIA 3LEVH 3KYMA 4PY7B 3SGDH 5D4QA 3BX7C 2HKFH 1C7SA 4UU9B 3DHJA 4MCYA 2QSVA 1CWVA 1DQML 2EEAA 3MBEA 3QCVH 1KLFA 4JPVH 1AQKL 5CJ8A 2VQ1A 2B8OT 5KBNC 2LVEA 1JYVA 1DQTA 4M6NH 5TE4H 2GFBA 4PJGB 2A6KA 3CFKA 4MJID 3CZFA 1LD9A 1UENA 3K74B 5CBAA 3QQNA 4A2MA 3UYRL 4BQBA 3ECBB 4HG4K 3QULA 4TUOB 3EOBA 4G6FD 3CNKA 3LN9A 1Y0LA 3PDOB 1REIA 4U7KA 2JJSA 4HMEA 3E2HB 5FO7B 5MP6H 2DWDA 1NAMH 3UDWC 4YE4H 5C2UB 1HHJA 2HFEA 3ULVH 4KKAD 3FQXB 1SBSL 2DQIL 5CD5D 3KYOA 3GB7B 4O5LH 4HXAL 4BSWB 2H32H 1FBIH 1MJJA 5H2BB 2C1OB 4K7PH 4YDIL 2WANA 1MVFA 2NY7L 5ID0B 2IJ0C 1QKZL 4E41E 2P8PA 4N0YH 1JNLL 1BHGA 2J5LC 3KG5A 5MENA 4NZRL 2WMPA 2NTSP 3W0WD 1E4KC 1RHHB 4Y4KD 4FQIH 3QIBC 3QDGE 5FDYA 4G9DB 5HJ3B 5F7MC 4LHUB 4OV5A 4YHZL 1V05A 2W9EL 5CS7A 4F7EA 5GRUH 3EJZD 4XBGA 3UO1H 3X3GH 1DEEB 1DBMH 1UXSA 2E7LC 1KJ2A 4AIOA 4HXBL 4KVNH 5E2VL 2HJKA 5GS0D 1U36A 1FV1A 4JLRB 4PJ8B 4LPYA 1V5JA 1IM3B 1IAII 1FZKB 3BQUA 4JRYB 4W6YB 3EO1A 3H7BA 3WFBL 4IRJA 4NJ9H 5DQ9A 2LQRA 3KPNA 4XZUA 1X9QA 2EKJA 2LTQB 2AKRB 4FP8L 5DLMH 5EU5B 2AK4E 3RDTB 1Z6JT 1P6FA 4NNPH 1G1CA 1Q0YH 3L1OL 4DQOH 5EIIB 2C7UA 1G6VK 2EDOA 4XH2A 3VFNA 5CLWA 5HYQB 4YPGA 1KB9J 1MJ8L 1UM6H 4LCWA 1NH6A 3BZ4B 4HKBA 3CU7A 4UQ3B 3CH1A 5J57B 5JW5A 4NPYB 3PWNA 3O41B 1YY9D 3P30L 5EULV 2QJDA 3W39B 3WNOA 3R8QA 5HI3D 1YDPB 4OFYA 3WLBA 2A38A 1QFPA 3UP1A 4QRQA 4UUJA 5GGVL 2WBJC 1R5IB 4YHNB 3G6JF 4Z78B 2NTFB 4MD5B 5SWSB 2X1OA 1OSPH 5JLZB 3IFNL 3OF6A 1NGYB 4G80A 4H0GA 3MGTA 2RB8A 3X12A 4D3CL 1X5ZA 2VDQL 5DJCB 1XF1A 1A7RH 4G8EA 4QRPD 4GRWB 5HDLA 1OOAA 2E9IA 5AWNL 1QD0A 3MLSL 3W82A 5FYKU 5FKAA 1NC2A 3RGVD 7FABH 3VGDA 2K7QA 3K4DA 1R3IL 3T0EA 4M1GH 2P5EB 2R4SH 1PJ9A 5AG9A 5FGBC 1P7KA 3ARFB 32C2B 4XPAL 3QI9D 1GIGH 4NRXB 5CJOH 3MRCB 4FQ2L 4PJHA 2P8LA 5LXGL 1W72A 4NFCA 1O5DT 1J05B 1DUZA 3PV6B 1MNUL 2Z31C 1HHIB 2BNRE 3FN9A 2JB6A 1I7TA 4Y19E 4BZ2L 5I15H 3MODL 3RL2B 1MFEL 1H3VA 4ENEC 4ZYKB 4U0QB 2H32B 5FUZL 3IDXH 5HVHB 1TCRB 2ZKHH 4G42A 4XP4L 1EAPB 1U8NA 1EH9A 3BRGC 1U41A 3IDUA 3FKUS 1Q72L 1KB5H 2YWZA 1X7QB 4MYWB 3ARSA 4L3EB 2FHFA 4F7CA 5IGXL 1KXQE 4XP9L 2FX8L 2W9DH 2FJFA 1ZLVK 5JW4N 3PWVB 5BS0B 2JB5H 3FONA 5KSUA 1N64L 4HQQL 3I6LE 1I7ZA 2FGWL 3MRDB 2VDRL 5I1DA 4BFEA 5HGGS 1DBJH 1NGWB 1L0XA 4HIHA 4NZUL 5I1IH 4A6YH 1NBVL 5BRZE 4U1GC 5D96B 5GGRA 5TE6H 5KS9E 3BIBX 4J3OC 3RVUD 2XIDA 4N8PA 2EC9U 3BP4A 4XNMA 2YUXA 1UWEL 3BPOC 6FABH 4YO0B 2VLJE 1II4E 5AUMB 3KHOA 5ANME 3CC5B 3LVEA 5IBLC 5L2JB 1F6AA 3QIUA 4ZFZB 2VISA 4WW2B 5I8OL 1WFUA 4KJWD 4Z77A 4WEMB 1EHXA 4L3CA 5EUKA 1KBGH 5E8PA 1GGCH 1SEBB 3TESA 2EKSA 1BZ9A 1L6XA 5E9DE 3BI9X 3QDHA 2VKXA 1IFHH 2HT4C 5EU3A 2XTJE 1Q0XL 1WIPA 2EDXA 4HK3J 4D2NA 4FMFA 4FQLH 3ALPA 3SO3B 2MCG1 4HWNA 4JFXB 3DVGA 3EOAA 1HYSC 4I0KA 3MUGB 5FUCE 2AS5M 4R97C 5CP7B 3T0WA 1QRNB 2EDJA 2X4UB 5DHVH 4B7IA 3RZCB 3OXSA 2VTFA 4PJEA 2Q6WA 4AH2B 2XA8H 3JZ7A 3MRNA 3ROOB 1QA9A 2EDNA 5BQ7A 4GO6B 3IU4H 2H3NB 4PJXB 1XF5B 3VDCA 5DWUL 1MI5D 1X5YA 3KPRA 1R3JB 4KC3B 1JBJA 4FQ1L 5C09B 1KNOB 2HA1A 4XAWH 1UM4H 3D2UA 3JWOH 3T08A 2AJSL 1BFSA 2FGZA 3PL6C 3RWFA 3NMEA 4H20L 3FFCD 4NKOB 4BKLB 1M71B 2XPGB 1YEDA 4N0FB 4JN1L 1J5OL 3VI3F 2QR0B 3LKNA 4XNXL 3TBWA 4YDLB 2R1YA 4NJAH 2B20A 1ZHNB 1QFWM 3JV0A 4LEXL 3BW9A 3LMJL 5FA4A 4X4MA 3HFML 3Q5YA 4DUVA 4X6DB 3K8KA 4F15B 4AL8H 4EI6A 4Q97A 3SDXB 2MFNA 3F58H 4PY7A 2H1PL 1MCPL 4M6MH 5D7KE 3SE3A 2APWA 4UU9A 2HFTA 3OR7B 3Q6FB 3A0OA 1UJ3C 1G7HB 3GMRB 3QIBD 3D25B 4YHYB 2AQ3A 2XZCL 3F65A 4FOMA 4P5MB 5MEPB 3V2AR 4NSKB 3N06B 4PJGA 1ONQB 5L0QC 1F8TL 3NH7L 4MXWL 3NIGE 4ERSH 1H0DB 1QPXA 4WI3A 1IQWL 3ECBA 4JO1L 1KCSH 2E6QA 2V9TA 4RBPH 4TUOA 5CLTA 5F9WC 4Q9QL 5JIKA 1T04B 4XX1G 3PDOA 2B7DT 3QJFB 1MIEH 3Q5OA 1TZIB 3QXTA 4JVUA 3AMKA 5FO7A 1EFQA 1RULH 1G7MB 4WHYH 2FJHB 4CVUA 3FQXA 1I8IA 3MV7E 4MD0B 5EO1B 5GRWA 4E9LA 4KHTL 1TJHL 2ZJSH 3MRJB 5E6YA 5H2BA 1MY5A 2C1OA 3AXLB 5JXEC 5GGSY 5D7SH 5ID0A 4OJFH 4LPWA 4UB0L 1MEXL 3B2VL 3O6KH 5KW9L 1ORQB 1RHHA 4V1DB 3BE1L 1D5IH 4G9DA 5HJ3A 1EXUB 2JF1A 4KJQD 5JQHC 4LHUA 2AXFB 5D5MB 2F53B 2XN9E 3MLZL 4R4BB 4OKVB 2BHYA 1JHKL 3CMGA 5LG1A 5F9JB 2WBJD 2IPTH 5KSVB 1DEEA 2AEQH 5F7DB 3CFDB 2W92A 3SDDC 5HXMA 3ARBC 1C1EH 5DVOA 1G9EA 1T0NB 1UZ8A 2NXYD 4UINH 4KHXH 2H41A 5DHVB 1JZ6A 4JLRA 5I75B 4PJ8A 3PDDA 1NGPH 1FZKA 4I2XA 4JRYA 5FYKL 5T1LB 3MJ9H 4PUBH 2CDFB 2FX9L 3O3BB 4WO4B 3UPAA 3BZEA 3B3IB 3ZMRA 5FF6B 5EU6D 2AKRA 2W0KA 5EU5A 3RJDA 3RDTA 4WFFD 3LIZL 3E6FA 4D9RD 5C07E 2YUZA 5EIIA 2X9WA 5HYQA 1P84K 2VN4A 4ZTPL 3VXUB 2Z31D 1EMTL 3D3VD 4XCCH 4JFEB 3BZ4A 3BJ91 1OSZB 4NPYA 1OP5H 1FZMB 3O41A 3W39A 1BZ7B 4KUZL 5DUPL 3REVB 2AERT 2FD6L 5ESAB 3BPNC 1YDPA 4NQCA 3C6LC 5B39G 3UZVB 1V7NH 4LOUC 3HS0B 1R5IA 4YHNA 3VI4F 2ORBH 2NTFA 4MD5A 4UI2A 5I9QC 3QO1B 4F7PB 5JLZA 5I1HL 5C08E 2AJUH 1F3RB 4JGJA 4DCQB 1O7SA 5H37G 4GW4B 1Z9SA 3VFPB 3C2AL 2Q76B 4GAYB 3IDNA 4LLQB 3UC0H 3MLXL 4ZNEA 4PS4L 2JLLA 4Z7OE 2Y9RT 3GHBH 1UWGH 1NC4B 1LK3L 2P5EA 3VU2A 1OAXL 3VD3A 4J23A 3ARFA 32C2A 3MV8B 2VERN 4NRXA 5EORH 3MRCA 5FYJE 2P8MB 4EN3B 1QHOA 2B5IC 4WV1C 4FABL 5HDQL 1J05A 5T1KD 5SV4A 3PV6A 3IFPB 1HHIA 5LAXB 1CXKA 1EERB 3P3YA 3RL2A 3CVIL 2GCYB 4XBEL 4ZYKA 2H32A 2VWEE 3M8OH 5TFSH 1HWHB 1TCRA 1E4WL 5T1MB 3ARGB 1IC5L 4JFDB 1EAPA 4PLJC 1ZWIB 1AGDB 1X7QA 4G43B 3HNTL 4HCRH 1GH7A 2R56L 4L3EA 4UDUB 1JZ8A 2VQUA 4CJ1A 1WTLA 4NBXB 3E6HA 3MRDA 2OI9C 2V17L 1HYSD 1OAQH 3VWJB 1MRFH 4XNZB 4LRNH 2EDKA 3FQUB 1NGWA 4KQ4L 1IGCH 1JWMB 3RWDB 1QSED 4PJFF 3MLTB 3PQYB 4I3SH 2IF7A 4CVWA 4EUPH 5IBTH 1AGFB 5DD6B 4PV9B 1BP3B 3LKPB 1GHFH 4Y89A 5EA0H 4ODSL 2DM3A 4FG6C 4XCEB 3PL6D 2CR3A 5AUMA 5F7UA 1KTLB 3CC5A 1IT9L 5L2JA 2EH7L 1BX2B 3SBWC 3IGAB 4ODUA 2W0FB 4PRHD 4P2YA 3TZVC 2BSTB 4F37F 1G6RB 3GI9L 5F71A 1PG7L 4OZIB 4OLUL 1SEBA 3MLWL 1F45A 3SY0B 1IVLA 5JORB 3QPXH 2XXMB 3CVHH 4K94H 4N1CA 1I1YB 3CXDL 3S9DB 4HGKC 2XY1A 1XCQB 3P0VH 4LSRH 1A9EB 1QFUL 5EOCL 3WD5L 2GITB 3FB5B 1I85A 2JJSC 3MUGA 5SWZE 3CSPA 3ISWA 1QRNA 2X4UA 2FEEI 1MFCL 3RZCA 1AY1H 1RMFH 4AH2A 3ROOA 3NCFB 5IROC 3X3FL 5ILTL 4TVSa 5JZ7C 2H3NA 4PJXA 1XF5A 2RHEA 1KN2L 4MD4B 1R3JA 1UH2A 1RIHL 5C09A 1KNOA 2ED9A 3FCTB 3I85A 5CCKH 5TQ2L 1IAIH 3MFGB 4NO3B 3ZSSA 3UTSD 3STBA 4BKLA 3SOBL 2XPGA 4JHBA 2MCPH 3QXVA 4OZFH 4N0FA 3CSGA 2WWKO 5JHLL 2DIAA 2QR0A 2CR6A 1ZHNA 5C70A 4M62H 4NCC2 3RWHB 4X6DA 5I71B 4E41B 5CEZE 4CMHC 1AE6L 4LSTL 1UKQA 4DGVH 2O5ZL 5CAYB 3O4LD 5HYIA 3FQNB 1VSCA 3UMTA 5LWYH 1IRAY 5JXED 1KJ2L 3SDXA 3WFZA 1I8MB 4F57H 3C08H 4JVPA 3QDGB 1YEGL 3N85H 5ESQB 3HC4H 1J1OL 1KB5A 4O02H 2FZ3A 1MCNA 3MREB 4YXLH 1AP2B 1OARH 3OR7A 3WO4B 3BQUC 3Q6FA 2NW3B 4EXKA 1G7HA 3GMRA 3VW3L 4GKSB 2G75B 2FO4B 4FTVD 3TNNB 4P5MA 5MEPA 2ZSVB 4NSKA 1UB5B 3S6CA 2HFGH 2XFXB 1ONQA 5HBBA 4G6JL 3RP1A 3CFCL 4JFZH 2BFVL 2FRGP 3L3IB 3SDDD 1H0DA 1N2RB 3ARBD 3V0WH 4WI4A 3ALWA 4DGIL 1FVEB 4N90D 1YNTB 1T04A 3DO7A 3BZFB 3QJFA 5FYKD 4X4YB 1MCFA 3LQAH 5F93C 3W81A 1TZIA 2AK4B 1ZT1B 5E4IA 1L9MA 3QFJB 4EUPB 3N9GH 4HW6A 3VXTB 3FZUC 2X4OB 1G7MA 4OCMC 1ZMYA 2FJHA 5EIVA 1FGVH 3VDAA 4MD0A 1NKRA 5EO1A 5C3TA 1GRWA 1INQB 4FQPA 3MRJA 4PRIE 1K6QH 4QHKJ 5DUMH 2GJJA 2D7TL 1VGEL 2B1HH 3AXLA 4MXVF 3LEYH 2F15A 1SVCP 4KGLA 5I30L 4AIZA 1UZ6E 4N8CL 3DRTB 4LP4A 1KGCE 5GJSH 1ORQA 2OQJB 3DXAB 1RU9H 1ES0B 2WBWB 3CVHB 4V1DA 4WDIA 3UPRB 1DQLH 3AB0B 2VLRB 3C6LD 2AXFA 5D5MA 3FO0L 2F53A 4R4BA 4RMRA 4DKFH 5HI5C 4OKVA 4POUB 4LOUD 3GJEB 1NGXA 5F9JA 1AXSA 3IAPA 3PGDB 5KSVA 3RY4A 4DEPC 3ZKXC 5F7DA 3CFDA 4S11A 3KLSA 2KBGA 4GQ9L 5DHVA 3NCBB 1W72L 2VUOA 3ARUA 3GMNB 2C3WA 4L8SA 3TO2B 1ZHLB 2AVGA 3DSFH 1NLBL 5T1LA 2ED7A 2CDFA 1GC1H 5B3NA 4WO4A 5KSBB 4MNGB 5EZOH 3D18B 2ARJB 3GIVB 5J13C 2ZUQB 5IKCB 3UJTL 4Y19B 2BNRB 3L3JB 1JPSL 4OZFB 2Y06L 3KDMB 1D9KC 1IEBB 1RUML 5FA3B 5IBUG 3NCYS 3VXUA 4JM2F 1RD6A 3GJFK 4JFEA 5HYJE 4NGHH 2OYPA 1FHGA 3LSOB 1FZMA 4RGOL 2E7HA 4R0LB 1BZ7A 4WI5A 1YEKL 2O5XH 4JZOB 3REVA 4Z7WE 5ESAA 4PLJD 2PR4H 4IS6B 3QSKB 5E6IB 1KENL 4NNXB 4H8WL 3HS0A 4GS7C 4NRZB 3KPSD 4OZGE 2BRRL 4KY1L 2BMKB 3K7UA 4R7NA 3QO1A 4F7PA 3VXSD 2RFXB 2YC1B 1CU4L 4DKDC 3L5JA 3GRWL 3S35L 2X4QB 4DCQA 5ALCH 5E8DL 3VFPA 2AJVH 2Q76A 4CDHA 5BRZB 3I3EA 5EWIL 1AFVH 5ACZA 3I02B 1SJXA 5KS9B 4LLQA 5C6WH 1JP5A 5F9AC 1K8IB 1NC4A 2NR6C 3JVGA 4LFHG 4QRUB 5IESH 2D4DA 2J8UE 4JM2D 2VLJB 5DFTA 3MV8A 4U0RB 5T3XL 4YZFE 3CAFA 4K3DL 1JRHL 4OUUB 4J7RA 5ANMB 2W65B 2P8MA 4EN3A 2LAAA 1LGVA 3BDBA 3GMOA 3VG9C 4OM1H 4PRBB 4FG6D 3BISA 3IFPA 5LAXA 5E70A 4W4NA 5MI0C 3MRBB 3QDJE 2PTUA 3OKNB 1RSFA 3EO9H 1YNKH 3NGBC 3MBED 1I7RB 4JHAL 1TNNA 1QSZA 4ZSOE 5F7WC 5E9DB 4AEHL 1RURL 3ZTNH 5AYUL 1XFPA 5T1MA 4JFDA 5SV3A 1F13A 1ZWIA 4M02A 1AGDA 2M2DA 3RKPA 1XR9B 3FOLB 2R0LH 3TT3H 4G43A 4O51B 4F9PA 4J12A 3EYSH 4HH9B 4EOWL 1T03L 4N0CC 3IAQA 4M93C 1FRGH 1OWWA 5EC1B 5EDXA 4UDUA 5HHMB 1BQSA 2G9HB 1MF2H 3HG1E 3EJJX 2DF3A 5F9DC 4OIAA 1IGIL 4YNYB 5FGCE 4RWYH 4LSQL 2EO1A 4GT7A 4UNVA 5HHXH 4NOBA 1Z5LB 3TN0A 4HS3B 4CNIB 5DZLA 4X7TB 3VWJA 4HAGA 5IV2B 4HJ0C 4JPIB 3FQUA 2VRAA 2YXFA 3KJ4C 2FCBA 1Q9OB 4JPWL 3RWDA 4QHMB 4P2RE 5JZ7D 3MLTA 1PLGL 1FLRH 2WIIB 3VRJB 2B0SL 1AGFA 3L9RB 5DD6A 4PV9A 1MFBL 3LKPA 4KV5F 5KVDH 4JR9L 1DL7H 3H3PH 4XCEA 2I5YL 4OLVL 2R69L 2J12B 1KTLA 1R5VB 4RISL 3SE3C 1JNNL 1H3UA 3QAZB 5MEND 4GKZB 1BX2A 4P3DA 3ARZA 2PXYB 3IGAA 1PYWB 2W0FA 5F1OB 3RWIB 3HUJF 1ORSB 2V2XB 2D4FA 1OLZA 2BSTA 4ZO6A 1G6RA 4OZIA 5L7XH 4G5ZL 4P57B 1JYXA 3VGFA 4RAVB 5T3ZL 1P4BL 5CMAB 5JORA 2P44B 3F7RA 2ZOLB 5A3ID 5GS2D 2BNQB 5BW7A 4XC1H 1A21A 3FHQA 3JBG7 2VH5L 3QISA 3SDCC 3WUWB 3ETBF 3ILQC 4G7VL 1XCQA 4KDWA 2D03L 5DMKA 4K3JH 4JM4L 3UTPE 4L3AA 3ARXA 3VRIA 1D3CA 1G9MC 2GITA 3FB5A 1ZA3B 3BEWA 3BQUD 1SY6H 3E2HC 4WU7B 2F54E 5FGRA 1H3PL 1VB9A 1F90L 4IRJD 3VG0L 3WYRA 4R8WL 2H45A 4LLYB 3DWTA 4P0DA 3O9WB 2XKNB 5I19H 3K4AA 1OAZL 4X6EB 4MD4A 1QR4A 3WXWH 2DDQL 1WGOA 5F3HB 6CGTA 4NO3A 1A3LL 2VZ3A 2AQ1A 2YUVA 5I66B 4HEME 4NQDE 3L3KB 4LCWD 5I1JH 3MV7B 5DTFB 3BP7A 1V3KA 4XVUC 4F3FA 4M7KL 1DLFH 4OB5H 4O4YL 4H1LH 4HWBA 3RWHA 2XYCA 4N8VB 3VJ6A 3H3BC 1YMME 4JO2L 4XP6L 4E41A 5K9QG 1VCAA 2QQNH 2OTPA 2AGJL 3FQNA 4YX2H 4KRPC 1WWWX 3RWEB 3V5HA 3GKWL 4F58L 1I8MA 3QDGA 3RVTC 5L88L 5ESQA 2QLVB 2VB5A 4ZXBB 4BUHA 3MREA 3SE9H 2XN9B 2GKIA 4MVBC 2AJZB 1AO7E 4CUCA 1JFQL 1I1AB 2P24B 2NW3A 1NC2D 3O2DH 1U93B 3V4VH 2AABL 2Q8AL 2G75A 1VDGA 2FO4A 5GGTH 3TNNA 4RCAA 4EKXA 1UEMA 2ZWLT 4Q7DA 1QPPA 2ZSVA 3AMLA 3G6JE 3T0ED 1UB5A 5HI5D 2LTQC 1TQCB 2DD8H 3AFLA 4TUJB 2XFXA 3RDTC 5FOBB 2MQ3A 3L3IA 2X1QA 3RAJH 3O6LL 4AG4H 3EDDA 5DEZA 5JR1H 1FVEA 1MHHB 2EYSB 5F6IB 4HS6B 4WWKB 1YNTA 1FAIH 5E56A 1XGTB 2W91A 3ME0A 4X4YA 5I8EB 2AK4A 1ZT1A 3L6FB 4XPHH 4EUPA 4XCYB 4OFPA 1BF8A 3VXTA 4C4KT 1BVKB 1FSKB 2X4OA 5C07B 4JPKL 3SDYH 4RGNE 3KLHD 3L5WB 3MOBL 4D94A 3LKOA 1INQA 3ORJA 3LEVL 4TNWF 3V6ZB 3QNXA 5D70H 4LU5H 1N26A 2HKFL 3HB3C 4Y16B 2UYLB 1TETH 1UFUA 4HUVB 2AJ3B 4JPVL 2FSEB 1S9XB 3DRTA 1EIBA 4M6NL 5TE4L 5CZVH 1U3HB 2OQJA 4H0IA 3DXAA 3HN3A 4C54A 1ES0A 1S5HB 3CVHA 3UPRA 2VLRA 4HKXB 1T20B 4EQ3A 1CTNA 1CE6B 4U6VH 2LU4A 5C08B 1XF2B 3GJEA 3LKRB 3LRSB 3UBXI 2LE9A 3PGDA 1KIPB 3ARFC 5C71A 1FORL 5MERB 4HIXH 4L9LB 2C26A 4DGYH 3QEQE 5LKNA 4JZJB 2A73B 2QQKL 4GAFB 5MP6L 3GMNA 4YE4L 3V4PH 4HG4J 3TO2A 1ZHLA 2AP2A 1M7XA 1BWMA 3QIUD 3PIQB 3LY6A 4O5LL 3CX2A 5HVHC 5KSBA 3D18A 2ARJA 3GIVA 2I60H 5T3XD 5IKCA 1HKLH 2OJEB 5L9DH 4UTBH 4Y19A 2BNRA 3L3JA 1KTKE 5F7LB 2VO5A 5CEZH 4OZFA 2ZOKB 3KDMA 3Q1SH 4N1HB 5DMGD 1OP9A 3H7LA 4DJMA 3GUTB 3TJHC 1IEBA 5FA3A 4FQIL 1EAJA 5E0QA 4NC0B 1OCWH 1C08B 5ERWB 1I9EA 3U30B 4I77H 3VXPB 4R0LA 2XKUA 1RHFA 4NC1E 5GRUL 3WHE0 4JZOA 1A7OH 5TQ0L 4IS6A 3QPQC 2MPAH 4KVNL 5E6IA 4NNXA 1D5MB 2OJZH 5F88B 1BLNB 1B6UA 5D7IF 4NRZA 3KPRD 2CH8A 2BMKA 3FN3A 3GM8A 4WNQB 3BH9B 5H94B 2F5AH 2RFXA 2YC1A 3BO8A 5CBEB 3D2UD 5FYLE 1A1MB 1SYSB 4IDLA 1ULVA 2X4QA 4UV4H 2YD8A 2R23B 1CLOH 5BRZA 1MSPA 5CIPH 4CW1B 2GHWB 3I02A 3THMH 2KKQA 5KS9A 2PYEB 4WW2C 1J86A 3LKQB 1Q0YL 1K8IA 3RY6C 4QRUA 1S7UB 3IAGC 3LHPL 3V5KA 2VLJA 2W0PA 4OUUA 5ANMA 3BGFB 4V2CB 2W65A 2Z8WC 4QHNA 4PG2C 4PRBA 1CI5A 5J06A 1WCQA 5DMIH 3SO3C 3MRBA 3OKNA 1HN1A 1KIUA 4OLXH 1S5IH 1I7RA 1I85C 1HNFA 5E9DA 1A14H 5DJ0A 4TULH 3RZCC 5T3ZD 1OSPL 1XR9A 4O51A 4AK1A