5D7CA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a ligand
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Azaindole Ureas as a Novel Class of Bacterial Gyrase B Inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 65
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5d7cA00
3HYYA 3TZ0A 1UYDA 5FNFA 2BU8A 2VCJA 2GQPA 2CCTA 3Q5JA 4CWFA 1MU5A 4LWIA 4MB9A 2E0AA 2XDLA 4MPCA 1MX0A 2IOQA 4XITA 4AWOA 3DGEA 4HZ5A 2YGEA 2WI7A 4HXWA 5M4MA 1TC0A 3OWDA 3CGZA 3QDDA 1GJVA 2YKEA 3A0XA 2WI3A 3TZ5A 4ZKIA 5IDJA 4O05A 2JJCA 3HHUA 4LWEA 4KTNA 1UYKA 5D7RA 4MP2A 3O6OA 1EA6A 3G7EA 4AWQA 3ZXQA 2IWUA 4LP0A 4XC0A 1UYLA 3R4OA 2H8MA 3GIGB 4HZ0A 4YKQA 1YSZA 1Z5AA 4URLA 1YT0A 4P7AA 4PRVA 4GFNA 4GGLA 5M4HA 2C2AA 4YKWA 2QFOA 3A0ZA 1U0ZA 1UYCA 3TTZA 2IWXA 1UYMA 2CH4A 5BODA 2Q8FA 3KE6A 4CE3A 2UWDA 2YE8A 5L3JA 3EHHA 2XJXA 4PL9A 1UY9A 4MOTA 4KSHA 1I59A 1EI1A 2YJXA 3B24A 3JZ3A 4CE1A 2YEJA 4XE2A 3FV5A 3K97A 4XTJA 3A0TA 1B3QA 1YT2A 4QPJA 4FCQA 2ZDXA 3H80A 2CG9A 3WQ9A 3VHAA 1Y8PA 2XDKA 2XHRA 3LPSA 3ZKDA 1UYEA 4JASA 2XHXA 4V25A 1UYHA 4BAEA 3R92A 3U2KA 3T0HA 2Q8HA 4E01A 2FXSA 2BRCA 2CGFA 3O0IA 4EEHA 2YKIA 4AWPA 2HKJA 1I5AA 4O0BA 4XDMA 2WI2A 1YC1A 1YETA 4CWTA 2BREA 2YGAA 4EFUA 3R91A 4R3AA 3VADA 4O09A 1TILA 5FNCA 3CRLA 3O2FA 2FYPA 3BMYA 1YSRA 2ZBKB 3OPDA 2IWSA 3D36A 4XIRA 3HEKA 1AMWA 3TUHA 3K98A 3EKOA 1AJ6A 4GEEA 4NH9A 4MP7A 4Q20A 3HZ1A 4LPBA 5CTWA 2CCSA 2BU6A 5IDMA 2O1VA 2WERA 1US7A 2IOPA 4MPEA 3C0EA 4B7PA 1QZRA 3RKZA 3OMUA 4CE2A 2AKPA 4YKXA 5J6AA 2BTZA 3GIFA 3MNRP 1H7UA 2EXLA 2YE5A 2VCIA 2YE9A 4V26A 5CTUA 1PVGA 1S14A 3G75A 5CTXA 4ASGA 3TZ2A 5GGZA 4YKYA 2YI7A 4FCPA 4YKZA 1Y8NA 3PEHA 3U2DA 1YT1A 4XKKA 4FMTA 4L94A 4EMVA 3LNUA 3GIEA 4PU9A 1THNA 2WEQA 4EGKA 3B27A 3K99A 4ASBA 1QYEA 5M4PA 4FPPA 4MPNA 3A0RA 1AH8A 4X9LA 1BYQA 1ZXNA 4I5SA 2YEGA 3H4LA 2XX2A 1BGQA 1TC6A 1AH6A 2Q8GA 2YECA 2YEDA 4LWGA 1Y4UA 4R1FA 2QF6A 4KP4A 3CWVA 4L93A 4HXZA 3A0WA 2Q2EB 1QY8A 4YKTA 5M4KA 4NH7A 3B26A 1NHJA 4O04A 3CGYA 2QG2A 4EFTA 3B25A 3B28A 4ZVIA 3VHDA 2YE6A 4BIZA 3TZ4A 3HZ5A 4YKUA 2QG0A 3QTFA 4JQLA 1NHHA 4U7OA 3R4PA 4AS9A 4PRXA 3GIGA 2WI5A 2WI4A 4XCLA 1BKNA 4L90A 4XIQA 2YI0A 4LWHA 4B6CA 2HCHA 2Q8IA 5M4EA 2XDSA 4GCZA 4KQVA 4HYMA 2YEIA 2YJWA 4BIUA 3INWA 1ID0A 3EHFA 2XD6A 4GQTA 1UYFA 1UY7A 2XJJA 4EGIA 1I5BA 3HYZA 2YE7A 3NMQA 2FWYA 3C11A 5M4NA 1I58A 3ZM7A 4CWOA 2YI5A 2XX4A 1I5DA 4FCRA 4L91A 2YK2A 4U93A 4YKRA 4EM7A 3RLRA 3INXA 2GFDA 1B62A 3T2SA 2ESAA 2YKBA 4K4OA 3EHGA 4HYPA 3K60A 3VHCA 4CWSA 1YESA 4R3MA 2BSMA 3T1KA 4EGHA 3OWBA 3U67A 4CWPA 1JM6A 3OW6A 5D7DA 5CF0A 4URMA 3R4NA 4BXIA 1ZXMA 3FT8A 2BYIA 1OSFA 1YERA 1Z5CA 1I5CA 4BQGA 4KFGA 2YGFA 2WI6A 3SL2A 4H7QA 2VW5A 2XDUA 3WHAA 1U2OA 4MBCA 1GKXA 4UROA 1YC3A 2H55A 1ZW9A 4W7TA 1TH8A 4CWRA 4U7NA 5BOCA 3RLPA 4URNA 2XCMA 5CPHA 1GKZA 4H81A 4DZYA 1Z5BA 2WEPA 1UYGA 2O1WA 5F5RA 3T10A 4BQJA 4GT8A 2YK9A 4HY1A 4DUHA 3EKRA 3T0ZA 3R4MA 4ASFA 1L0OA 1KIJA 3BM9A 2YEBA 3Q5LA 3D0BA 4I3HA 2BU5A 2ZDYA 4WUDA 2IORA 2YKJA 2JKIA 2BU2A 1BXDA 3RLQA 2BU7A 3IEDA 2XHTA 4NH8A 5F3KA 3G7BA 2XX5A 4CWNA 2BZ5A 3EHJA 5FNDA 2XDXA 2PNRA 2HG1A 5IN9A 4XKAA 3Q5KA 4P8OA 1AM1A 1H7SA 2BYHA 4LWFA 4HY6A 1Y4SA 2CCUA 3ZKBA 2YEFA 5J71A 1UY6A 4XD8A 1KZNA 2YE3A 1Y8OA 2FWZA 5C93A 1B63A 4JAVA 3CRKA 2YE2A 2WI1A 5CTYA 1UYIA 2XK2A 4H85A 4E02A 2XJGA 5FWKA 4XKOA 2ZKJA 4KSGA 5D6QA 5D7CA 2YKCA 2YEAA 4O07A 2YEEA 4WUBA 2VWCA 1S16A 1A4HA 1YS3A 1ZWHA 5D6PA 4ASAA 4WUCA 1NHIA 3D2RA 4L8ZA 4E00A 4XCJA 3A0YA 2YI6A 4CWQA 4JAUA 3ZXOA 4XIPA 2YEHA 1R62A 2BT0A 2O1UA 1Z59A 1TBWA 2YE4A 1UY8A 2K5BA 3PEJA 3FT5A 2XABA 4QPKA 1YC4A 1TIDA
chains in the Genus database with same CATH superfamily
3HYYA 3TZ0A 1UYDA 5FNFA 2BU8A 2VCJA 2GQPA 2CCTA 3Q5JA 4CWFA 1MU5A 4LWIA 4MB9A 2E0AA 2XDLA 4MPCA 1MX0A 2IOQA 4XITA 4AWOA 3DGEA 4HZ5A 2YGEA 2WI7A 4HXWA 5M4MA 1TC0A 3OWDA 3CGZA 3QDDA 1GJVA 2YKEA 3A0XA 2WI3A 3TZ5A 4ZKIA 5IDJA 4O05A 2JJCA 3HHUA 4LWEA 4KTNA 1UYKA 5D7RA 4MP2A 3O6OA 1EA6A 3G7EA 4AWQA 3ZXQA 2IWUA 4LP0A 4XC0A 1UYLA 3R4OA 2H8MA 3GIGB 4HZ0A 4YKQA 1YSZA 1Z5AA 4URLA 1YT0A 4P7AA 4PRVA 4GFNA 4GGLA 5M4HA 2C2AA 4YKWA 2QFOA 3A0ZA 1U0ZA 1UYCA 3TTZA 2IWXA 1UYMA 2CH4A 5BODA 2Q8FA 3KE6A 4CE3A 2UWDA 2YE8A 5L3JA 3EHHA 2XJXA 4PL9A 1UY9A 4MOTA 4KSHA 1I59A 1EI1A 2YJXA 3B24A 3JZ3A 4CE1A 2YEJA 4XE2A 3FV5A 3K97A 4XTJA 3A0TA 1B3QA 1YT2A 4QPJA 4FCQA 2ZDXA 3H80A 2CG9A 3WQ9A 3VHAA 1Y8PA 2XDKA 2XHRA 3LPSA 3ZKDA 1UYEA 4JASA 2XHXA 4V25A 1UYHA 4BAEA 3R92A 3U2KA 3T0HA 2Q8HA 4E01A 2FXSA 2BRCA 2CGFA 3O0IA 4EEHA 2YKIA 3LMMA 4AWPA 2HKJA 1I5AA 4O0BA 4XDMA 2WI2A 1YC1A 1YETA 2C1GA 2BREA 2YGAA 4CWTA 4EFUA 3R91A 4R3AA 3VADA 4O09A 1TILA 5FNCA 3CRLA 3O2FA 2FYPA 3BMYA 1YSRA 2ZBKB 3OPDA 2IWSA 3D36A 4XIRA 3HEKA 1AMWA 3TUHA 3K98A 3EKOA 1AJ6A 4GEEA 4NH9A 4MP7A 4Q20A 3HZ1A 4LPBA 5CTWA 2CCSA 2BU6A 5IDMA 2O1VA 2WERA 1US7A 2IOPA 4MPEA 3C0EA 4B7PA 1QZRA 3RKZA 3OMUA 4CE2A 2AKPA 4YKXA 5J6AA 2BTZA 3GIFA 3MNRP 1H7UA 2EXLA 2YE5A 3CYGA 2VCIA 2YE9A 4V26A 5CTUA 1PVGA 1S14A 3G75A 5CTXA 4ASGA 3TZ2A 5GGZA 4YKYA 2YI7A 4FCPA 4YKZA 1Y8NA 3PEHA 3U2DA 1YT1A 4XKKA 4FMTA 4L94A 4EMVA 3LNUA 3GIEA 4PU9A 1THNA 2WEQA 4EGKA 3B27A 3K99A 4ASBA 1QYEA 5M4PA 4FPPA 4MPNA 3A0RA 1AH8A 4X9LA 1BYQA 1ZXNA 4I5SA 2YEGA 3H4LA 2XX2A 5JENA 1BGQA 1TC6A 1AH6A 2Q8GA 2YECA 2C1IA 2YEDA 4LWGA 1Y4UA 4R1FA 2QF6A 4KP4A 3CWVA 4L93A 4HXZA 3A0WA 2Q2EB 1QY8A 4YKTA 5M4KA 4NH7A 3B26A 1NHJA 4O04A 3CGYA 2QG2A 4EFTA 3B25A 3B28A 4ZVIA 3VHDA 2YE6A 4BIZA 3TZ4A 3HZ5A 4YKUA 2QG0A 3QTFA 4JQLA 1NHHA 4U7OA 1IXMA 3R4PA 4AS9A 4PRXA 3GIGA 2WI5A 2WI4A 4XCLA 1BKNA 4L90A 4XIQA 2YI0A 4LWHA 4B6CA 2HCHA 2Q8IA 5M4EA 2XDSA 4GCZA 4KQVA 4HYMA 2YEIA 2YJWA 4BIUA 3INWA 1ID0A 3EHFA 2XD6A 4GQTA 1UYFA 1UY7A 2XJJA 4EGIA 1I5BA 3HYZA 1F51A 2YE7A 2FWYA 3NMQA 3C11A 5M4NA 1I58A 3ZM7A 4CWOA 2YI5A 2XX4A 1I5DA 4FCRA 4L91A 2YK2A 4U93A 4YKRA 4EM7A 3RLRA 3INXA 2GFDA 1B62A 3T2SA 2ESAA 2YKBA 4K4OA 3EHGA 4HYPA 3K60A 3VHCA 4CWSA 1YESA 4R3MA 2BSMA 3T1KA 4EGHA 3OWBA 3U67A 4CWPA 1JM6A 3OW6A 5D7DA 5CF0A 4URMA 3R4NA 4BXIA 1ZXMA 3FT8A 2BYIA 1OSFA 1YERA 1Z5CA 1I5CA 4BQGA 4KFGA 2YGFA 2WI6A 3SL2A 4H7QA 2VW5A 2XDUA 3WHAA 1U2OA 4MBCA 1GKXA 4UROA 1YC3A 2H55A 1ZW9A 4W7TA 1TH8A 4CWRA 4U7NA 5BOCA 3RLPA 4URNA 2FTKA 2XCMA 5CPHA 1GKZA 4H81A 4DZYA 1Z5BA 2WEPA 1UYGA 2O1WA 5F5RA 3T10A 4BQJA 4GT8A 2YK9A 4HY1A 4DUHA 3EKRA 3T0ZA 3R4MA 4ASFA 1L0OA 1KIJA 3BM9A 2YEBA 3Q5LA 3D0BA 4I3HA 2BU5A 2ZDYA 4WUDA 2IORA 2YKJA 2JKIA 2BU2A 1BXDA 3RLQA 2BU7A 3IEDA 2XHTA 4NH8A 5F3KA 3G7BA 2XX5A 4CWNA 2BZ5A 3EHJA 5FNDA 2XDXA 2PNRA 2HG1A 3S5TA 5IN9A 4XKAA 3Q5KA 4P8OA 1AM1A 1H7SA 2BYHA 4LWFA 4HY6A 1Y4SA 2CCUA 3ZKBA 2YEFA 5J71A 1UY6A 4XD8A 1KZNA 2YE3A 1Y8OA 2FWZA 5C93A 1B63A 4JAVA 2HHIA 3CRKA 2YE2A 2WI1A 5CTYA 1UYIA 2XK2A 4H85A 4E02A 2XJGA 5FWKA 4XKOA 4E72A 2ZKJA 4KSGA 5D6QA 5D7CA 2YKCA 2YEAA 4O07A 2YEEA 4WUBA 2VWCA 1S16A 1A4HA 1YS3A 1ZWHA 5D6PA 4ASAA 4WUCA 1NHIA 3D2RA 4L8ZA 4E00A 4XCJA 3A0YA 2YI6A 4CWQA 4JAUA 3ZXOA 4XIPA 2YEHA 1R62A 2BT0A 2O1UA 1Z59A 1TBWA 2YE4A 1UY8A 2K5BA 3PEJA 3FT5A 2XABA 4QPKA 1YC4A 1TIDA
chains in the Genus database with same CATH topology
3HYYA 3TZ0A 1UYDA 5FNFA 2BU8A 2VCJA 2GQPA 2CCTA 3Q5JA 4CWFA 1MU5A 4LWIA 4MB9A 2E0AA 2XDLA 4MPCA 1MX0A 2IOQA 4XITA 4AWOA 3DGEA 4HZ5A 2YGEA 2WI7A 4HXWA 5M4MA 1TC0A 3OWDA 3CGZA 3QDDA 1GJVA 2YKEA 3A0XA 2WI3A 3TZ5A 4ZKIA 5IDJA 4O05A 2JJCA 3HHUA 4LWEA 4KTNA 1UYKA 5D7RA 4MP2A 3O6OA 1EA6A 3G7EA 4AWQA 3ZXQA 2IWUA 4LP0A 4XC0A 1UYLA 3R4OA 2H8MA 3GIGB 4HZ0A 4YKQA 1YSZA 1Z5AA 4URLA 1YT0A 4P7AA 4PRVA 4GFNA 4GGLA 5M4HA 2C2AA 4YKWA 2QFOA 3A0ZA 1U0ZA 1UYCA 3TTZA 2IWXA 1UYMA 2CH4A 5BODA 2Q8FA 3KE6A 4CE3A 2UWDA 2YE8A 5L3JA 3EHHA 2XJXA 4PL9A 1UY9A 4MOTA 4KSHA 1I59A 1EI1A 2YJXA 3B24A 3JZ3A 4CE1A 2YEJA 4XE2A 3FV5A 3K97A 4XTJA 3A0TA 1B3QA 1YT2A 4QPJA 4FCQA 2ZDXA 3H80A 2CG9A 3WQ9A 3VHAA 1Y8PA 2XDKA 2XHRA 3LPSA 3ZKDA 1UYEA 4JASA 2XHXA 4V25A 1UYHA 4BAEA 3R92A 3U2KA 3T0HA 2Q8HA 4E01A 2FXSA 2BRCA 2CGFA 3O0IA 4EEHA 2YKIA 4AWPA 2HKJA 1I5AA 4O0BA 4XDMA 2WI2A 1YC1A 1YETA 4CWTA 2BREA 2YGAA 4EFUA 3R91A 4R3AA 3VADA 4O09A 1TILA 5FNCA 3CRLA 3O2FA 2FYPA 3BMYA 1YSRA 2ZBKB 3OPDA 2IWSA 3D36A 4XIRA 3HEKA 1AMWA 3TUHA 3K98A 3EKOA 1AJ6A 4GEEA 4NH9A 4MP7A 4Q20A 3HZ1A 4LPBA 5CTWA 2CCSA 2BU6A 5IDMA 2O1VA 2WERA 1US7A 2IOPA 4MPEA 3C0EA 4B7PA 1QZRA 3RKZA 3OMUA 4CE2A 2AKPA 4YKXA 5J6AA 2BTZA 3GIFA 3MNRP 1H7UA 2EXLA 2YE5A 2VCIA 2YE9A 4V26A 5CTUA 1PVGA 1S14A 3G75A 5CTXA 4ASGA 3TZ2A 5GGZA 4YKYA 2YI7A 4FCPA 4YKZA 1Y8NA 3PEHA 3U2DA 1YT1A 4XKKA 4FMTA 4L94A 4EMVA 3LNUA 3GIEA 4PU9A 1THNA 2WEQA 4EGKA 3B27A 3K99A 4ASBA 1QYEA 5M4PA 4FPPA 4MPNA 3A0RA 1AH8A 4X9LA 1BYQA 1ZXNA 4I5SA 2YEGA 3H4LA 2XX2A 1BGQA 1TC6A 1AH6A 2Q8GA 2YECA 2YEDA 4LWGA 1Y4UA 4R1FA 2QF6A 4KP4A 3CWVA 4L93A 4HXZA 3A0WA 2Q2EB 1QY8A 4YKTA 5M4KA 4NH7A 3B26A 1NHJA 4O04A 3CGYA 2QG2A 4EFTA 3B25A 3B28A 4ZVIA 3VHDA 2YE6A 4BIZA 3TZ4A 3HZ5A 4YKUA 2QG0A 3QTFA 4JQLA 1NHHA 4U7OA 3R4PA 4AS9A 4PRXA 3GIGA 2WI5A 2WI4A 4XCLA 1BKNA 4L90A 4XIQA 2YI0A 4LWHA 4B6CA 2HCHA 2Q8IA 5M4EA 2XDSA 4GCZA 4KQVA 4HYMA 2YEIA 2YJWA 4BIUA 3INWA 1ID0A 3EHFA 2XD6A 4GQTA 1UYFA 1UY7A 2XJJA 4EGIA 1I5BA 3HYZA 2YE7A 3NMQA 2FWYA 3C11A 5M4NA 1I58A 3ZM7A 4CWOA 2YI5A 2XX4A 1I5DA 4FCRA 4L91A 2YK2A 4U93A 4YKRA 4EM7A 3RLRA 3INXA 2GFDA 1B62A 3T2SA 2ESAA 2YKBA 4K4OA 3EHGA 4HYPA 3K60A 3VHCA 4CWSA 1YESA 4R3MA 2BSMA 3T1KA 4EGHA 3OWBA 3U67A 4CWPA 1JM6A 3OW6A 5D7DA 5CF0A 4URMA 3R4NA 4BXIA 1ZXMA 3FT8A 2BYIA 1OSFA 1YERA 1Z5CA 1I5CA 4BQGA 4KFGA 2YGFA 2WI6A 3SL2A 4H7QA 2VW5A 2XDUA 3WHAA 1U2OA 4MBCA 1GKXA 4UROA 1YC3A 2H55A 1ZW9A 4W7TA 1TH8A 4CWRA 4U7NA 5BOCA 3RLPA 4URNA 2XCMA 5CPHA 1GKZA 4H81A 4DZYA 1Z5BA 2WEPA 1UYGA 2O1WA 5F5RA 3T10A 4BQJA 4GT8A 2YK9A 4HY1A 4DUHA 3EKRA 3T0ZA 3R4MA 4ASFA 1L0OA 1KIJA 3BM9A 2YEBA 3Q5LA 3D0BA 4I3HA 2BU5A 2ZDYA 4WUDA 2IORA 2YKJA 2JKIA 2BU2A 1BXDA 3RLQA 2BU7A 3IEDA 2XHTA 4NH8A 5F3KA 3G7BA 2XX5A 4CWNA 2BZ5A 3EHJA 5FNDA 2XDXA 2PNRA 2HG1A 5IN9A 4XKAA 3Q5KA 4P8OA 1AM1A 1H7SA 2BYHA 4LWFA 4HY6A 1Y4SA 2CCUA 3ZKBA 2YEFA 5J71A 1UY6A 4XD8A 1KZNA 2YE3A 1Y8OA 2FWZA 5C93A 1B63A 4JAVA 3CRKA 2YE2A 2WI1A 5CTYA 1UYIA 2XK2A 4H85A 4E02A 2XJGA 5FWKA 4XKOA 2ZKJA 4KSGA 5D6QA 5D7CA 2YKCA 2YEAA 4O07A 2YEEA 4WUBA 2VWCA 1S16A 1A4HA 1YS3A 1ZWHA 5D6PA 4ASAA 4WUCA 1NHIA 3D2RA 4L8ZA 4E00A 4XCJA 3A0YA 2YI6A 4CWQA 4JAUA 3ZXOA 4XIPA 2YEHA 1R62A 2BT0A 2O1UA 1Z59A 1TBWA 2YE4A 1UY8A 2K5BA 3PEJA 3FT5A 2XABA 4QPKA 1YC4A 1TIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HYY A;  3TZ0 A;  1UYD A;  5FNF A;  2BU8 A;  2VCJ A;  2GQP A;  2CCT A;  3Q5J A;  4CWF A;  1MU5 A;  4LWI A;  4MB9 A;  2E0A A;  2XDL A;  4MPC A;  1MX0 A;  2IOQ A;  4XIT A;  4AWO A;  3DGE A;  4HZ5 A;  2YGE A;  2WI7 A;  4HXW A;  5M4M A;  1TC0 A;  3OWD A;  3CGZ A;  3QDD A;  1GJV A;  2YKE A;  3A0X A;  2WI3 A;  3TZ5 A;  4ZKI A;  5IDJ A;  4O05 A;  2JJC A;  3HHU A;  4LWE A;  4KTN A;  1UYK A;  5D7R A;  4MP2 A;  3O6O A;  1EA6 A;  3G7E A;  4AWQ A;  3ZXQ A;  2IWU A;  4LP0 A;  4XC0 A;  1UYL A;  3R4O A;  2H8M A;  3GIG B;  4HZ0 A;  4YKQ A;  1YSZ A;  1Z5A A;  4URL A;  1YT0 A;  4P7A A;  4PRV A;  4GFN A;  4GGL A;  5M4H A;  2C2A A;  4YKW A;  2QFO A;  3A0Z A;  1U0Z A;  1UYC A;  3TTZ A;  2IWX A;  1UYM A;  2CH4 A;  5BOD A;  2Q8F A;  3KE6 A;  4CE3 A;  2UWD A;  2YE8 A;  5L3J A;  3EHH A;  2XJX A;  4PL9 A;  1UY9 A;  4MOT A;  4KSH A;  1I59 A;  1EI1 A;  2YJX A;  3B24 A;  3JZ3 A;  4CE1 A;  2YEJ A;  4XE2 A;  3FV5 A;  3K97 A;  4XTJ A;  3A0T A;  1B3Q A;  1YT2 A;  4QPJ A;  4FCQ A;  2ZDX A;  3H80 A;  2CG9 A;  3WQ9 A;  3VHA A;  1Y8P A;  2XDK A;  2XHR A;  3LPS A;  3ZKD A;  1UYE A;  4JAS A;  2XHX A;  4V25 A;  1UYH A;  4BAE A;  3R92 A;  3U2K A;  3T0H A;  2Q8H A;  4E01 A;  2FXS A;  2BRC A;  2CGF A;  3O0I A;  4EEH A;  2YKI A;  4AWP A;  2HKJ A;  1I5A A;  4O0B A;  4XDM A;  2WI2 A;  1YC1 A;  1YET A;  4CWT A;  2BRE A;  2YGA A;  4EFU A;  3R91 A;  4R3A A;  3VAD A;  4O09 A;  1TIL A;  5FNC A;  3CRL A;  3O2F A;  2FYP A;  3BMY A;  1YSR A;  2ZBK B;  3OPD A;  2IWS A;  3D36 A;  4XIR A;  3HEK A;  1AMW A;  3TUH A;  3K98 A;  3EKO A;  1AJ6 A;  4GEE A;  4NH9 A;  4MP7 A;  4Q20 A;  3HZ1 A;  4LPB A;  5CTW A;  2CCS A;  2BU6 A;  5IDM A;  2O1V A;  2WER A;  1US7 A;  2IOP A;  4MPE A;  3C0E A;  4B7P A;  1QZR A;  3RKZ A;  3OMU A;  4CE2 A;  2AKP A;  4YKX A;  5J6A A;  2BTZ A;  3GIF A;  3MNR P;  1H7U A;  2EXL A;  2YE5 A;  2VCI A;  2YE9 A;  4V26 A;  5CTU A;  1PVG A;  1S14 A;  3G75 A;  5CTX A;  4ASG A;  3TZ2 A;  5GGZ A;  4YKY A;  2YI7 A;  4FCP A;  4YKZ A;  1Y8N A;  3PEH A;  3U2D A;  1YT1 A;  4XKK A;  4FMT A;  4L94 A;  4EMV A;  3LNU A;  3GIE A;  4PU9 A;  1THN A;  2WEQ A;  4EGK A;  3B27 A;  3K99 A;  4ASB A;  1QYE A;  5M4P A;  4FPP A;  4MPN A;  3A0R A;  1AH8 A;  4X9L A;  1BYQ A;  1ZXN A;  4I5S A;  2YEG A;  3H4L A;  2XX2 A;  1BGQ A;  1TC6 A;  1AH6 A;  2Q8G A;  2YEC A;  2YED A;  4LWG A;  1Y4U A;  4R1F A;  2QF6 A;  4KP4 A;  3CWV A;  4L93 A;  4HXZ A;  3A0W A;  2Q2E B;  1QY8 A;  4YKT A;  5M4K A;  4NH7 A;  3B26 A;  1NHJ A;  4O04 A;  3CGY A;  2QG2 A;  4EFT A;  3B25 A;  3B28 A;  4ZVI A;  3VHD A;  2YE6 A;  4BIZ A;  3TZ4 A;  3HZ5 A;  4YKU A;  2QG0 A;  3QTF A;  4JQL A;  1NHH A;  4U7O A;  3R4P A;  4AS9 A;  4PRX A;  3GIG A;  2WI5 A;  2WI4 A;  4XCL A;  1BKN A;  4L90 A;  4XIQ A;  2YI0 A;  4LWH A;  4B6C A;  2HCH A;  2Q8I A;  5M4E A;  2XDS A;  4GCZ A;  4KQV A;  4HYM A;  2YEI A;  2YJW A;  4BIU A;  3INW A;  1ID0 A;  3EHF A;  2XD6 A;  4GQT A;  1UYF A;  1UY7 A;  2XJJ A;  4EGI A;  1I5B A;  3HYZ A;  2YE7 A;  3NMQ A;  2FWY A;  3C11 A;  5M4N A;  1I58 A;  3ZM7 A;  4CWO A;  2YI5 A;  2XX4 A;  1I5D A;  4FCR A;  4L91 A;  2YK2 A;  4U93 A;  4YKR A;  4EM7 A;  3RLR A;  3INX A;  2GFD A;  1B62 A;  3T2S A;  2ESA A;  2YKB A;  4K4O A;  3EHG A;  4HYP A;  3K60 A;  3VHC A;  4CWS A;  1YES A;  4R3M A;  2BSM A;  3T1K A;  4EGH A;  3OWB A;  3U67 A;  4CWP A;  1JM6 A;  3OW6 A;  5D7D A;  5CF0 A;  4URM A;  3R4N A;  4BXI A;  1ZXM A;  3FT8 A;  2BYI A;  1OSF A;  1YER A;  1Z5C A;  1I5C A;  4BQG A;  4KFG A;  2YGF A;  2WI6 A;  3SL2 A;  4H7Q A;  2VW5 A;  2XDU A;  3WHA A;  1U2O A;  4MBC A;  1GKX A;  4URO A;  1YC3 A;  2H55 A;  1ZW9 A;  4W7T A;  1TH8 A;  4CWR A;  4U7N A;  5BOC A;  3RLP A;  4URN A;  2XCM A;  5CPH A;  1GKZ A;  4H81 A;  4DZY A;  1Z5B A;  2WEP A;  1UYG A;  2O1W A;  5F5R A;  3T10 A;  4BQJ A;  4GT8 A;  2YK9 A;  4HY1 A;  4DUH A;  3EKR A;  3T0Z A;  3R4M A;  4ASF A;  1L0O A;  1KIJ A;  3BM9 A;  2YEB A;  3Q5L A;  3D0B A;  4I3H A;  2BU5 A;  2ZDY A;  4WUD A;  2IOR A;  2YKJ A;  2JKI A;  2BU2 A;  1BXD A;  3RLQ A;  2BU7 A;  3IED A;  2XHT A;  4NH8 A;  5F3K A;  3G7B A;  2XX5 A;  4CWN A;  2BZ5 A;  3EHJ A;  5FND A;  2XDX A;  2PNR A;  2HG1 A;  5IN9 A;  4XKA A;  3Q5K A;  4P8O A;  1AM1 A;  1H7S A;  2BYH A;  4LWF A;  4HY6 A;  1Y4S A;  2CCU A;  3ZKB A;  2YEF A;  5J71 A;  1UY6 A;  4XD8 A;  1KZN A;  2YE3 A;  1Y8O A;  2FWZ A;  5C93 A;  1B63 A;  4JAV A;  3CRK A;  2YE2 A;  2WI1 A;  5CTY A;  1UYI A;  2XK2 A;  4H85 A;  4E02 A;  2XJG A;  5FWK A;  4XKO A;  2ZKJ A;  4KSG A;  5D6Q A;  5D7C A;  2YKC A;  2YEA A;  4O07 A;  2YEE A;  4WUB A;  2VWC A;  1S16 A;  1A4H A;  1YS3 A;  1ZWH A;  5D6P A;  4ASA A;  4WUC A;  1NHI A;  3D2R A;  4L8Z A;  4E00 A;  4XCJ A;  3A0Y A;  2YI6 A;  4CWQ A;  4JAU A;  3ZXO A;  4XIP A;  2YEH A;  1R62 A;  2BT0 A;  2O1U A;  1Z59 A;  1TBW A;  2YE4 A;  1UY8 A;  2K5B A;  3PEJ A;  3FT5 A;  2XAB A;  4QPK A;  1YC4 A;  1TID A; 
#chains in the Genus database with same CATH topology
 3HYY A;  3TZ0 A;  1UYD A;  5FNF A;  2BU8 A;  2VCJ A;  2GQP A;  2CCT A;  3Q5J A;  4CWF A;  1MU5 A;  4LWI A;  4MB9 A;  2E0A A;  2XDL A;  4MPC A;  1MX0 A;  2IOQ A;  4XIT A;  4AWO A;  3DGE A;  4HZ5 A;  2YGE A;  2WI7 A;  4HXW A;  5M4M A;  1TC0 A;  3OWD A;  3CGZ A;  3QDD A;  1GJV A;  2YKE A;  3A0X A;  2WI3 A;  3TZ5 A;  4ZKI A;  5IDJ A;  4O05 A;  2JJC A;  3HHU A;  4LWE A;  4KTN A;  1UYK A;  5D7R A;  4MP2 A;  3O6O A;  1EA6 A;  3G7E A;  4AWQ A;  3ZXQ A;  2IWU A;  4LP0 A;  4XC0 A;  1UYL A;  3R4O A;  2H8M A;  3GIG B;  4HZ0 A;  4YKQ A;  1YSZ A;  1Z5A A;  4URL A;  1YT0 A;  4P7A A;  4PRV A;  4GFN A;  4GGL A;  5M4H A;  2C2A A;  4YKW A;  2QFO A;  3A0Z A;  1U0Z A;  1UYC A;  3TTZ A;  2IWX A;  1UYM A;  2CH4 A;  5BOD A;  2Q8F A;  3KE6 A;  4CE3 A;  2UWD A;  2YE8 A;  5L3J A;  3EHH A;  2XJX A;  4PL9 A;  1UY9 A;  4MOT A;  4KSH A;  1I59 A;  1EI1 A;  2YJX A;  3B24 A;  3JZ3 A;  4CE1 A;  2YEJ A;  4XE2 A;  3FV5 A;  3K97 A;  4XTJ A;  3A0T A;  1B3Q A;  1YT2 A;  4QPJ A;  4FCQ A;  2ZDX A;  3H80 A;  2CG9 A;  3WQ9 A;  3VHA A;  1Y8P A;  2XDK A;  2XHR A;  3LPS A;  3ZKD A;  1UYE A;  4JAS A;  2XHX A;  4V25 A;  1UYH A;  4BAE A;  3R92 A;  3U2K A;  3T0H A;  2Q8H A;  4E01 A;  2FXS A;  2BRC A;  2CGF A;  3O0I A;  4EEH A;  2YKI A;  3LMM A;  4AWP A;  2HKJ A;  1I5A A;  4O0B A;  4XDM A;  2WI2 A;  1YC1 A;  1YET A;  2C1G A;  2BRE A;  2YGA A;  4CWT A;  4EFU A;  3R91 A;  4R3A A;  3VAD A;  4O09 A;  1TIL A;  5FNC A;  3CRL A;  3O2F A;  2FYP A;  3BMY A;  1YSR A;  2ZBK B;  3OPD A;  2IWS A;  3D36 A;  4XIR A;  3HEK A;  1AMW A;  3TUH A;  3K98 A;  3EKO A;  1AJ6 A;  4GEE A;  4NH9 A;  4MP7 A;  4Q20 A;  3HZ1 A;  4LPB A;  5CTW A;  2CCS A;  2BU6 A;  5IDM A;  2O1V A;  2WER A;  1US7 A;  2IOP A;  4MPE A;  3C0E A;  4B7P A;  1QZR A;  3RKZ A;  3OMU A;  4CE2 A;  2AKP A;  4YKX A;  5J6A A;  2BTZ A;  3GIF A;  3MNR P;  1H7U A;  2EXL A;  2YE5 A;  3CYG A;  2VCI A;  2YE9 A;  4V26 A;  5CTU A;  1PVG A;  1S14 A;  3G75 A;  5CTX A;  4ASG A;  3TZ2 A;  5GGZ A;  4YKY A;  2YI7 A;  4FCP A;  4YKZ A;  1Y8N A;  3PEH A;  3U2D A;  1YT1 A;  4XKK A;  4FMT A;  4L94 A;  4EMV A;  3LNU A;  3GIE A;  4PU9 A;  1THN A;  2WEQ A;  4EGK A;  3B27 A;  3K99 A;  4ASB A;  1QYE A;  5M4P A;  4FPP A;  4MPN A;  3A0R A;  1AH8 A;  4X9L A;  1BYQ A;  1ZXN A;  4I5S A;  2YEG A;  3H4L A;  2XX2 A;  5JEN A;  1BGQ A;  1TC6 A;  1AH6 A;  2Q8G A;  2YEC A;  2C1I A;  2YED A;  4LWG A;  1Y4U A;  4R1F A;  2QF6 A;  4KP4 A;  3CWV A;  4L93 A;  4HXZ A;  3A0W A;  2Q2E B;  1QY8 A;  4YKT A;  5M4K A;  4NH7 A;  3B26 A;  1NHJ A;  4O04 A;  3CGY A;  2QG2 A;  4EFT A;  3B25 A;  3B28 A;  4ZVI A;  3VHD A;  2YE6 A;  4BIZ A;  3TZ4 A;  3HZ5 A;  4YKU A;  2QG0 A;  3QTF A;  4JQL A;  1NHH A;  4U7O A;  1IXM A;  3R4P A;  4AS9 A;  4PRX A;  3GIG A;  2WI5 A;  2WI4 A;  4XCL A;  1BKN A;  4L90 A;  4XIQ A;  2YI0 A;  4LWH A;  4B6C A;  2HCH A;  2Q8I A;  5M4E A;  2XDS A;  4GCZ A;  4KQV A;  4HYM A;  2YEI A;  2YJW A;  4BIU A;  3INW A;  1ID0 A;  3EHF A;  2XD6 A;  4GQT A;  1UYF A;  1UY7 A;  2XJJ A;  4EGI A;  1I5B A;  3HYZ A;  1F51 A;  2YE7 A;  2FWY A;  3NMQ A;  3C11 A;  5M4N A;  1I58 A;  3ZM7 A;  4CWO A;  2YI5 A;  2XX4 A;  1I5D A;  4FCR A;  4L91 A;  2YK2 A;  4U93 A;  4YKR A;  4EM7 A;  3RLR A;  3INX A;  2GFD A;  1B62 A;  3T2S A;  2ESA A;  2YKB A;  4K4O A;  3EHG A;  4HYP A;  3K60 A;  3VHC A;  4CWS A;  1YES A;  4R3M A;  2BSM A;  3T1K A;  4EGH A;  3OWB A;  3U67 A;  4CWP A;  1JM6 A;  3OW6 A;  5D7D A;  5CF0 A;  4URM A;  3R4N A;  4BXI A;  1ZXM A;  3FT8 A;  2BYI A;  1OSF A;  1YER A;  1Z5C A;  1I5C A;  4BQG A;  4KFG A;  2YGF A;  2WI6 A;  3SL2 A;  4H7Q A;  2VW5 A;  2XDU A;  3WHA A;  1U2O A;  4MBC A;  1GKX A;  4URO A;  1YC3 A;  2H55 A;  1ZW9 A;  4W7T A;  1TH8 A;  4CWR A;  4U7N A;  5BOC A;  3RLP A;  4URN A;  2FTK A;  2XCM A;  5CPH A;  1GKZ A;  4H81 A;  4DZY A;  1Z5B A;  2WEP A;  1UYG A;  2O1W A;  5F5R A;  3T10 A;  4BQJ A;  4GT8 A;  2YK9 A;  4HY1 A;  4DUH A;  3EKR A;  3T0Z A;  3R4M A;  4ASF A;  1L0O A;  1KIJ A;  3BM9 A;  2YEB A;  3Q5L A;  3D0B A;  4I3H A;  2BU5 A;  2ZDY A;  4WUD A;  2IOR A;  2YKJ A;  2JKI A;  2BU2 A;  1BXD A;  3RLQ A;  2BU7 A;  3IED A;  2XHT A;  4NH8 A;  5F3K A;  3G7B A;  2XX5 A;  4CWN A;  2BZ5 A;  3EHJ A;  5FND A;  2XDX A;  2PNR A;  2HG1 A;  3S5T A;  5IN9 A;  4XKA A;  3Q5K A;  4P8O A;  1AM1 A;  1H7S A;  2BYH A;  4LWF A;  4HY6 A;  1Y4S A;  2CCU A;  3ZKB A;  2YEF A;  5J71 A;  1UY6 A;  4XD8 A;  1KZN A;  2YE3 A;  1Y8O A;  2FWZ A;  5C93 A;  1B63 A;  4JAV A;  2HHI A;  3CRK A;  2YE2 A;  2WI1 A;  5CTY A;  1UYI A;  2XK2 A;  4H85 A;  4E02 A;  2XJG A;  5FWK A;  4XKO A;  4E72 A;  2ZKJ A;  4KSG A;  5D6Q A;  5D7C A;  2YKC A;  2YEA A;  4O07 A;  2YEE A;  4WUB A;  2VWC A;  1S16 A;  1A4H A;  1YS3 A;  1ZWH A;  5D6P A;  4ASA A;  4WUC A;  1NHI A;  3D2R A;  4L8Z A;  4E00 A;  4XCJ A;  3A0Y A;  2YI6 A;  4CWQ A;  4JAU A;  3ZXO A;  4XIP A;  2YEH A;  1R62 A;  2BT0 A;  2O1U A;  1Z59 A;  1TBW A;  2YE4 A;  1UY8 A;  2K5B A;  3PEJ A;  3FT5 A;  2XAB A;  4QPK A;  1YC4 A;  1TID A; 
#chains in the Genus database with same CATH homology
 3HYY A;  3TZ0 A;  1UYD A;  5FNF A;  2BU8 A;  2VCJ A;  2GQP A;  2CCT A;  3Q5J A;  4CWF A;  1MU5 A;  4LWI A;  4MB9 A;  2E0A A;  2XDL A;  4MPC A;  1MX0 A;  2IOQ A;  4XIT A;  4AWO A;  3DGE A;  4HZ5 A;  2YGE A;  2WI7 A;  4HXW A;  5M4M A;  1TC0 A;  3OWD A;  3CGZ A;  3QDD A;  1GJV A;  2YKE A;  3A0X A;  2WI3 A;  3TZ5 A;  4ZKI A;  5IDJ A;  4O05 A;  2JJC A;  3HHU A;  4LWE A;  4KTN A;  1UYK A;  5D7R A;  4MP2 A;  3O6O A;  1EA6 A;  3G7E A;  4AWQ A;  3ZXQ A;  2IWU A;  4LP0 A;  4XC0 A;  1UYL A;  3R4O A;  2H8M A;  3GIG B;  4HZ0 A;  4YKQ A;  1YSZ A;  1Z5A A;  4URL A;  1YT0 A;  4P7A A;  4PRV A;  4GFN A;  4GGL A;  5M4H A;  2C2A A;  4YKW A;  2QFO A;  3A0Z A;  1U0Z A;  1UYC A;  3TTZ A;  2IWX A;  1UYM A;  2CH4 A;  5BOD A;  2Q8F A;  3KE6 A;  4CE3 A;  2UWD A;  2YE8 A;  5L3J A;  3EHH A;  2XJX A;  4PL9 A;  1UY9 A;  4MOT A;  4KSH A;  1I59 A;  1EI1 A;  2YJX A;  3B24 A;  3JZ3 A;  4CE1 A;  2YEJ A;  4XE2 A;  3FV5 A;  3K97 A;  4XTJ A;  3A0T A;  1B3Q A;  1YT2 A;  4QPJ A;  4FCQ A;  2ZDX A;  3H80 A;  2CG9 A;  3WQ9 A;  3VHA A;  1Y8P A;  2XDK A;  2XHR A;  3LPS A;  3ZKD A;  1UYE A;  4JAS A;  2XHX A;  4V25 A;  1UYH A;  4BAE A;  3R92 A;  3U2K A;  3T0H A;  2Q8H A;  4E01 A;  2FXS A;  2BRC A;  2CGF A;  3O0I A;  4EEH A;  2YKI A;  4AWP A;  2HKJ A;  1I5A A;  4O0B A;  4XDM A;  2WI2 A;  1YC1 A;  1YET A;  4CWT A;  2BRE A;  2YGA A;  4EFU A;  3R91 A;  4R3A A;  3VAD A;  4O09 A;  1TIL A;  5FNC A;  3CRL A;  3O2F A;  2FYP A;  3BMY A;  1YSR A;  2ZBK B;  3OPD A;  2IWS A;  3D36 A;  4XIR A;  3HEK A;  1AMW A;  3TUH A;  3K98 A;  3EKO A;  1AJ6 A;  4GEE A;  4NH9 A;  4MP7 A;  4Q20 A;  3HZ1 A;  4LPB A;  5CTW A;  2CCS A;  2BU6 A;  5IDM A;  2O1V A;  2WER A;  1US7 A;  2IOP A;  4MPE A;  3C0E A;  4B7P A;  1QZR A;  3RKZ A;  3OMU A;  4CE2 A;  2AKP A;  4YKX A;  5J6A A;  2BTZ A;  3GIF A;  3MNR P;  1H7U A;  2EXL A;  2YE5 A;  2VCI A;  2YE9 A;  4V26 A;  5CTU A;  1PVG A;  1S14 A;  3G75 A;  5CTX A;  4ASG A;  3TZ2 A;  5GGZ A;  4YKY A;  2YI7 A;  4FCP A;  4YKZ A;  1Y8N A;  3PEH A;  3U2D A;  1YT1 A;  4XKK A;  4FMT A;  4L94 A;  4EMV A;  3LNU A;  3GIE A;  4PU9 A;  1THN A;  2WEQ A;  4EGK A;  3B27 A;  3K99 A;  4ASB A;  1QYE A;  5M4P A;  4FPP A;  4MPN A;  3A0R A;  1AH8 A;  4X9L A;  1BYQ A;  1ZXN A;  4I5S A;  2YEG A;  3H4L A;  2XX2 A;  1BGQ A;  1TC6 A;  1AH6 A;  2Q8G A;  2YEC A;  2YED A;  4LWG A;  1Y4U A;  4R1F A;  2QF6 A;  4KP4 A;  3CWV A;  4L93 A;  4HXZ A;  3A0W A;  2Q2E B;  1QY8 A;  4YKT A;  5M4K A;  4NH7 A;  3B26 A;  1NHJ A;  4O04 A;  3CGY A;  2QG2 A;  4EFT A;  3B25 A;  3B28 A;  4ZVI A;  3VHD A;  2YE6 A;  4BIZ A;  3TZ4 A;  3HZ5 A;  4YKU A;  2QG0 A;  3QTF A;  4JQL A;  1NHH A;  4U7O A;  3R4P A;  4AS9 A;  4PRX A;  3GIG A;  2WI5 A;  2WI4 A;  4XCL A;  1BKN A;  4L90 A;  4XIQ A;  2YI0 A;  4LWH A;  4B6C A;  2HCH A;  2Q8I A;  5M4E A;  2XDS A;  4GCZ A;  4KQV A;  4HYM A;  2YEI A;  2YJW A;  4BIU A;  3INW A;  1ID0 A;  3EHF A;  2XD6 A;  4GQT A;  1UYF A;  1UY7 A;  2XJJ A;  4EGI A;  1I5B A;  3HYZ A;  2YE7 A;  3NMQ A;  2FWY A;  3C11 A;  5M4N A;  1I58 A;  3ZM7 A;  4CWO A;  2YI5 A;  2XX4 A;  1I5D A;  4FCR A;  4L91 A;  2YK2 A;  4U93 A;  4YKR A;  4EM7 A;  3RLR A;  3INX A;  2GFD A;  1B62 A;  3T2S A;  2ESA A;  2YKB A;  4K4O A;  3EHG A;  4HYP A;  3K60 A;  3VHC A;  4CWS A;  1YES A;  4R3M A;  2BSM A;  3T1K A;  4EGH A;  3OWB A;  3U67 A;  4CWP A;  1JM6 A;  3OW6 A;  5D7D A;  5CF0 A;  4URM A;  3R4N A;  4BXI A;  1ZXM A;  3FT8 A;  2BYI A;  1OSF A;  1YER A;  1Z5C A;  1I5C A;  4BQG A;  4KFG A;  2YGF A;  2WI6 A;  3SL2 A;  4H7Q A;  2VW5 A;  2XDU A;  3WHA A;  1U2O A;  4MBC A;  1GKX A;  4URO A;  1YC3 A;  2H55 A;  1ZW9 A;  4W7T A;  1TH8 A;  4CWR A;  4U7N A;  5BOC A;  3RLP A;  4URN A;  2XCM A;  5CPH A;  1GKZ A;  4H81 A;  4DZY A;  1Z5B A;  2WEP A;  1UYG A;  2O1W A;  5F5R A;  3T10 A;  4BQJ A;  4GT8 A;  2YK9 A;  4HY1 A;  4DUH A;  3EKR A;  3T0Z A;  3R4M A;  4ASF A;  1L0O A;  1KIJ A;  3BM9 A;  2YEB A;  3Q5L A;  3D0B A;  4I3H A;  2BU5 A;  2ZDY A;  4WUD A;  2IOR A;  2YKJ A;  2JKI A;  2BU2 A;  1BXD A;  3RLQ A;  2BU7 A;  3IED A;  2XHT A;  4NH8 A;  5F3K A;  3G7B A;  2XX5 A;  4CWN A;  2BZ5 A;  3EHJ A;  5FND A;  2XDX A;  2PNR A;  2HG1 A;  5IN9 A;  4XKA A;  3Q5K A;  4P8O A;  1AM1 A;  1H7S A;  2BYH A;  4LWF A;  4HY6 A;  1Y4S A;  2CCU A;  3ZKB A;  2YEF A;  5J71 A;  1UY6 A;  4XD8 A;  1KZN A;  2YE3 A;  1Y8O A;  2FWZ A;  5C93 A;  1B63 A;  4JAV A;  3CRK A;  2YE2 A;  2WI1 A;  5CTY A;  1UYI A;  2XK2 A;  4H85 A;  4E02 A;  2XJG A;  5FWK A;  4XKO A;  2ZKJ A;  4KSG A;  5D6Q A;  5D7C A;  2YKC A;  2YEA A;  4O07 A;  2YEE A;  4WUB A;  2VWC A;  1S16 A;  1A4H A;  1YS3 A;  1ZWH A;  5D6P A;  4ASA A;  4WUC A;  1NHI A;  3D2R A;  4L8Z A;  4E00 A;  4XCJ A;  3A0Y A;  2YI6 A;  4CWQ A;  4JAU A;  3ZXO A;  4XIP A;  2YEH A;  1R62 A;  2BT0 A;  2O1U A;  1Z59 A;  1TBW A;  2YE4 A;  1UY8 A;  2K5B A;  3PEJ A;  3FT5 A;  2XAB A;  4QPK A;  1YC4 A;  1TID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...