5D7CA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a ligand
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
b'AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Discovery of Azaindole Ureas as a Novel Class of Bacterial Gyrase B Inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
total genus 65
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5d7cA00
3T10A 4CWNA 4JASA 4E00A 3EHJA 3CWVA 1Y8PA 3ZKDA 3FV5A 1YSRA 4CWOA 3RLPA 4HZ5A 1R62A 5IDMA 1YSZA 4XKAA 3VHAA 4I3HA 2YEBA 4LPBA 1S14A 4AWOA 2QF6A 3HEKA 4KSGA 2YEEA 4EGIA 1H7UA 1TC0A 2YEDA 3G7EA 5F3KA 3HYZA 2YKEA 3VADA 1YT2A 3A0TA 2BU2A 4I5SA 1UYDA 3GIFA 4ASGA 3HZ1A 2YI7A 2WI1A 4FMTA 2XX5A 3TTZA 3ZKBA 5M4HA 3IEDA 4H81A 3B27A 5D6QA 4ZKIA 5CTUA 2IOQA 2XJGA 1YC1A 2BU5A 2YEJA 2XDUA 3Q5KA 3CRKA 4YKYA 4O05A 2CCTA 1I59A 3T0ZA 2E0AA 4WUCA 2CGFA 1UYLA 2WEQA 4XIRA 2GQPA 4DUHA 1Y4UA 1THNA 4W7TA 3G75A 3CGYA 2YE3A 4MB9A 4XIPA 2YEFA 3U67A 2QG2A 2BTZA 3CRLA 4UROA 3B24A 1UYIA 1TH8A 3EHFA 4U93A 5CF0A 1I5DA 4XITA 4QPJA 1Z5BA 3HHUA 1YS3A 2WI6A 5CPHA 4NH8A 4XE2A 1TBWA 1UY9A 3O6OA 4U7OA 5CTXA 1MU5A 3A0ZA 2IOPA 2BYIA 4R3AA 4ASBA 2YE6A 4ASFA 4GT8A 2CCSA 1QYEA 4H7QA 3OWDA 1US7A 3EKRA 2HG1A 1UY8A 4GCZA 2O1VA 5J71A 1AMWA 3QTFA 4QPKA 2BRCA 1BYQA 2WI4A 1Y8NA 5IN9A 4HYPA 4EM7A 2IORA 4NH7A 5D6PA 4CWSA 4EGKA 3OPDA 3TZ5A 2YI5A 4B6CA 1Z5AA 4URNA 1UYMA 3R4PA 4BXIA 2CG9A 4FPPA 1I5CA 4EGHA 1Y4SA 2YE8A 2YKJA 2YECA 1AH6A 1ZW9A 4PU9A 1BGQA 3FT5A 4MPEA 1UY6A 1I5AA 3TZ4A 2YGAA 1EI1A 3INWA 4Q20A 2ZKJA 3RLRA 4XIQA 2XDKA 3MNRP 2Q8FA 4CWTA 4E01A 2YE9A 4H85A 2XJJA 2YEAA 1Z5CA 2YKBA 1YC3A 3T2SA 4O09A 1I5BA 3B25A 4HXWA 1UYEA 3NMQA 2IWSA 3D36A 5CTYA 1YC4A 4AWQA 2YGEA 4YKXA 5IDJA 3D0BA 3HYYA 2YKCA 2YJWA 1UYCA 5BOCA 2BU6A 3PEJA 4CWRA 4LP0A 1MX0A 3A0RA 4HY1A 2Q2EB 2HKJA 5D7RA 4MBCA 2K5BA 1UYFA 4XD8A 2H55A 3BM9A 4MPNA 2YGFA 1BXDA 4X9LA 2WEPA 5L3JA 5J6AA 2QFOA 2FWYA 4CE3A 2XHRA 3O2FA 3ZM7A 1TIDA 4CWFA 2HCHA 3SL2A 4L94A 1YETA 4L8ZA 2YE2A 4L91A 4FCPA 4XKKA 2AKPA 3K97A 4CWQA 5M4NA 4XCLA 1TILA 4CE2A 5FNDA 3RKZA 4KP4A 1AM1A 2IWXA 3LNUA 3C0EA 4XDMA 4B7PA 3QDDA 4GQTA 4V26A 4AS9A 2BZ5A 4FCQA 1TC6A 2YKIA 1JM6A 1Z59A 2YE5A 4KFGA 3EKOA 5GGZA 2BYHA 4LWGA 1GKZA 2UWDA 3G7BA 3OW6A 4ZVIA 4EFUA 4XCJA 3GIEA 1UYHA 3Q5LA 4HYMA 2YI0A 2ESAA 2WERA 4R1FA 3EHGA 1NHHA 4GGLA 1YT0A 2YEHA 4PRXA 4EEHA 4LWIA 2XDSA 1AH8A 2YEGA 4YKZA 4LWEA 2PNRA 5M4EA 1A4HA 2Q8GA 4MP7A 3C11A 4XC0A 1UYKA 1H7SA 1B62A 2YK9A 3ZXQA 1ZXMA 3GIGA 1L0OA 1ID0A 4FCRA 4KQVA 3A0YA 4MPCA 4U7NA 3H80A 2VCIA 5F5RA 4EFTA 1KZNA 5FNCA 5FWKA 3VHCA 1AJ6A 4JAVA 2Q8IA 2WI3A 4MP2A 3D2RA 3H4LA 4O04A 4ASAA 3K60A 3U2KA 1OSFA 4PRVA 3R4NA 2YI6A 1YT1A 3DGEA 1ZWHA 4EMVA 1B3QA 5D7CA 3WHAA 4P8OA 2CCUA 3TUHA 1U2OA 4URLA 2FXSA 4YKRA 3K99A 4AWPA 4NH9A 3B26A 3OMUA 4P7AA 1B63A 3A0XA 2H8MA 4HXZA 4XTJA 4MOTA 3R4MA 3VHDA 1GJVA 4DZYA 4L93A 2FYPA 2XDXA 2XCMA 1U0ZA 1S16A 2XX4A 2XHXA 2WI5A 4KSHA 5FNFA 2C2AA 4PL9A 2VWCA 2XD6A 3BMYA 2FWZA 2VW5A 4L90A 5D7DA 2ZBKB 2XABA 4BAEA 4HY6A 4YKWA 3JZ3A 3T1KA 4GEEA 3B28A 5C93A 1GKXA 1NHIA 4CWPA 4KTNA 4BQJA 2JJCA 4XKOA 1UY7A 2YK2A 2JKIA 4JQLA 4E02A 4JAUA 2CH4A 1BKNA 3R91A 4LWHA 2XK2A 4YKQA 3WQ9A 1EA6A 3R4OA 1UYGA 2GFDA 2YEIA 4WUBA 4YKUA 4BIZA 3R92A 1YESA 1QZRA 4WUDA 3INXA 3PEHA 2BSMA 2VCJA 2IWUA 2ZDYA 3GIGB 3K98A 4R3MA 3RLQA 3Q5JA 1KIJA 1NHJA 1QY8A 1ZXNA 2YJXA 2XJXA 2O1UA 4YKTA 2WI2A 2YE4A 2XDLA 1YERA 2ZDXA 4GFNA 4CE1A 3O0IA 2XX2A 4BQGA 4K4OA 2BU8A 3OWBA 5BODA 2BREA 1PVGA 5M4PA 3A0WA 3LPSA 3KE6A 3T0HA 5M4KA 2BT0A 3TZ0A 4URMA 2Q8HA 3FT8A 3ZXOA 5M4MA 4BIUA 1I58A 5CTWA 2YE7A 3TZ2A 2QG0A 3CGZA 4LWFA 2O1WA 4O07A 4V25A 2XHTA 2BU7A 3HZ5A 1Y8OA 4HZ0A 3U2DA 3EHHA 2EXLA 4O0BA 2WI7A
chains in the Genus database with same CATH superfamily
3T10A 4CWNA 4JASA 4E00A 3EHJA 3CWVA 1Y8PA 3ZKDA 3FV5A 1YSRA 4CWOA 3RLPA 4HZ5A 1R62A 5IDMA 1YSZA 4XKAA 3VHAA 4I3HA 2YEBA 4LPBA 1S14A 4AWOA 2QF6A 3HEKA 4KSGA 2YEEA 4EGIA 1H7UA 1TC0A 2YEDA 3G7EA 5F3KA 3HYZA 2YKEA 3VADA 1YT2A 3A0TA 2BU2A 4E72A 4I5SA 1UYDA 3GIFA 4ASGA 3HZ1A 2YI7A 2WI1A 4FMTA 2XX5A 3TTZA 3ZKBA 5M4HA 3IEDA 4H81A 3B27A 5D6QA 4ZKIA 5CTUA 2IOQA 2XJGA 1YC1A 2BU5A 2YEJA 2XDUA 3Q5KA 3CRKA 4YKYA 4O05A 2CCTA 1I59A 3T0ZA 2E0AA 4WUCA 2CGFA 1UYLA 2WEQA 4XIRA 2GQPA 4DUHA 1Y4UA 1THNA 4W7TA 3G75A 3CGYA 2YE3A 4MB9A 4XIPA 2YEFA 3U67A 2QG2A 2BTZA 3CRLA 4UROA 3B24A 1UYIA 1TH8A 3EHFA 4U93A 5CF0A 1I5DA 4XITA 4QPJA 1Z5BA 3HHUA 1YS3A 2WI6A 5CPHA 4NH8A 4XE2A 1TBWA 1UY9A 3O6OA 4U7OA 5CTXA 1MU5A 3A0ZA 2IOPA 2BYIA 4R3AA 4ASBA 2YE6A 4ASFA 4GT8A 2CCSA 1QYEA 4H7QA 2C1IA 3OWDA 1US7A 3EKRA 2HG1A 1UY8A 4GCZA 2O1VA 5J71A 1AMWA 3QTFA 4QPKA 2BRCA 1BYQA 2WI4A 1Y8NA 5IN9A 4HYPA 4EM7A 2IORA 4NH7A 5D6PA 4CWSA 4EGKA 3OPDA 3TZ5A 2YI5A 4B6CA 1Z5AA 4URNA 1UYMA 3R4PA 4BXIA 2CG9A 4FPPA 1I5CA 3S5TA 4EGHA 1Y4SA 2YE8A 2YKJA 2YECA 1AH6A 1ZW9A 4PU9A 1BGQA 3FT5A 4MPEA 1UY6A 1I5AA 3TZ4A 2YGAA 1EI1A 3INWA 4Q20A 2ZKJA 3RLRA 4XIQA 2XDKA 3MNRP 2Q8FA 4CWTA 4E01A 2YE9A 4H85A 2XJJA 2YEAA 1Z5CA 2YKBA 1YC3A 3T2SA 4O09A 1I5BA 3B25A 4HXWA 1UYEA 3NMQA 2IWSA 3D36A 5CTYA 1YC4A 4AWQA 2YGEA 4YKXA 2FTKA 5IDJA 3LMMA 3D0BA 3HYYA 2YKCA 2YJWA 1UYCA 5BOCA 2BU6A 3PEJA 1F51A 4CWRA 4LP0A 1MX0A 3A0RA 4HY1A 2Q2EB 2HHIA 2HKJA 5D7RA 4MBCA 2K5BA 1UYFA 4XD8A 2H55A 3BM9A 4MPNA 2YGFA 1BXDA 4X9LA 2WEPA 5L3JA 5J6AA 2QFOA 2FWYA 4CE3A 2XHRA 3O2FA 3ZM7A 1TIDA 4CWFA 2HCHA 3SL2A 4L94A 1YETA 4L8ZA 2YE2A 4L91A 4FCPA 4XKKA 2AKPA 3K97A 4CWQA 5M4NA 4XCLA 1IXMA 1TILA 4CE2A 5FNDA 3RKZA 4KP4A 1AM1A 2IWXA 3LNUA 3C0EA 4XDMA 4B7PA 3QDDA 4GQTA 4V26A 4AS9A 2BZ5A 4FCQA 1TC6A 2YKIA 1JM6A 1Z59A 2YE5A 4KFGA 3EKOA 5GGZA 2BYHA 4LWGA 1GKZA 2UWDA 3G7BA 3OW6A 4ZVIA 4EFUA 4XCJA 3GIEA 1UYHA 3Q5LA 4HYMA 2YI0A 2ESAA 2WERA 4R1FA 3EHGA 1NHHA 4GGLA 1YT0A 2YEHA 4PRXA 4EEHA 4LWIA 2XDSA 1AH8A 2YEGA 4YKZA 4LWEA 2PNRA 5M4EA 1A4HA 2Q8GA 4MP7A 3C11A 4XC0A 1UYKA 1H7SA 1B62A 2YK9A 3ZXQA 1ZXMA 3GIGA 1L0OA 1ID0A 4FCRA 4KQVA 3A0YA 4MPCA 4U7NA 3H80A 2VCIA 5F5RA 4EFTA 1KZNA 5FNCA 5FWKA 3VHCA 1AJ6A 4JAVA 2Q8IA 2WI3A 4MP2A 3D2RA 3H4LA 4O04A 4ASAA 3K60A 3U2KA 1OSFA 4PRVA 3R4NA 2YI6A 1YT1A 3DGEA 1ZWHA 4EMVA 1B3QA 5D7CA 3WHAA 4P8OA 2CCUA 3TUHA 1U2OA 4URLA 2FXSA 4YKRA 3K99A 4AWPA 4NH9A 3B26A 3OMUA 4P7AA 1B63A 3A0XA 2H8MA 4HXZA 4XTJA 4MOTA 3R4MA 3VHDA 1GJVA 4DZYA 4L93A 2FYPA 5JENA 2C1GA 2XDXA 2XCMA 1U0ZA 1S16A 2XX4A 2XHXA 2WI5A 4KSHA 5FNFA 2C2AA 4PL9A 2VWCA 2XD6A 3BMYA 2FWZA 2VW5A 4L90A 5D7DA 2ZBKB 2XABA 4BAEA 4HY6A 4YKWA 3JZ3A 3T1KA 4GEEA 3B28A 5C93A 1GKXA 1NHIA 4CWPA 4KTNA 4BQJA 2JJCA 4XKOA 1UY7A 2YK2A 2JKIA 4JQLA 4E02A 4JAUA 2CH4A 1BKNA 3R91A 4LWHA 2XK2A 4YKQA 3WQ9A 1EA6A 3R4OA 1UYGA 2GFDA 2YEIA 4WUBA 4YKUA 4BIZA 3R92A 1YESA 1QZRA 4WUDA 3INXA 3PEHA 2BSMA 2VCJA 3CYGA 2IWUA 2ZDYA 3GIGB 3K98A 4R3MA 3RLQA 3Q5JA 1KIJA 1NHJA 1QY8A 1ZXNA 2YJXA 2XJXA 2O1UA 4YKTA 2WI2A 2YE4A 2XDLA 1YERA 2ZDXA 4GFNA 4CE1A 3O0IA 2XX2A 4BQGA 4K4OA 2BU8A 3OWBA 5BODA 2BREA 1PVGA 5M4PA 3A0WA 3LPSA 3KE6A 3T0HA 5M4KA 2BT0A 3TZ0A 4URMA 2Q8HA 3FT8A 3ZXOA 5M4MA 4BIUA 1I58A 5CTWA 2YE7A 3TZ2A 2QG0A 3CGZA 4LWFA 2O1WA 4O07A 4V25A 2XHTA 2BU7A 3HZ5A 1Y8OA 4HZ0A 3U2DA 3EHHA 2EXLA 4O0BA 2WI7A
chains in the Genus database with same CATH topology
3T10A 4CWNA 4JASA 4E00A 3EHJA 3CWVA 1Y8PA 3ZKDA 3FV5A 1YSRA 4CWOA 3RLPA 4HZ5A 1R62A 5IDMA 1YSZA 4XKAA 3VHAA 4I3HA 2YEBA 4LPBA 1S14A 4AWOA 2QF6A 3HEKA 4KSGA 2YEEA 4EGIA 1H7UA 1TC0A 2YEDA 3G7EA 5F3KA 3HYZA 2YKEA 3VADA 1YT2A 3A0TA 2BU2A 4I5SA 1UYDA 3GIFA 4ASGA 3HZ1A 2YI7A 2WI1A 4FMTA 2XX5A 3TTZA 3ZKBA 5M4HA 3IEDA 4H81A 3B27A 5D6QA 4ZKIA 5CTUA 2IOQA 2XJGA 1YC1A 2BU5A 2YEJA 2XDUA 3Q5KA 3CRKA 4YKYA 4O05A 2CCTA 1I59A 3T0ZA 2E0AA 4WUCA 2CGFA 1UYLA 2WEQA 4XIRA 2GQPA 4DUHA 1Y4UA 1THNA 4W7TA 3G75A 3CGYA 2YE3A 4MB9A 4XIPA 2YEFA 3U67A 2QG2A 2BTZA 3CRLA 4UROA 3B24A 1UYIA 1TH8A 3EHFA 4U93A 5CF0A 1I5DA 4XITA 4QPJA 1Z5BA 3HHUA 1YS3A 2WI6A 5CPHA 4NH8A 4XE2A 1TBWA 1UY9A 3O6OA 4U7OA 5CTXA 1MU5A 3A0ZA 2IOPA 2BYIA 4R3AA 4ASBA 2YE6A 4ASFA 4GT8A 2CCSA 1QYEA 4H7QA 3OWDA 1US7A 3EKRA 2HG1A 1UY8A 4GCZA 2O1VA 5J71A 1AMWA 3QTFA 4QPKA 2BRCA 1BYQA 2WI4A 1Y8NA 5IN9A 4HYPA 4EM7A 2IORA 4NH7A 5D6PA 4CWSA 4EGKA 3OPDA 3TZ5A 2YI5A 4B6CA 1Z5AA 4URNA 1UYMA 3R4PA 4BXIA 2CG9A 4FPPA 1I5CA 4EGHA 1Y4SA 2YE8A 2YKJA 2YECA 1AH6A 1ZW9A 4PU9A 1BGQA 3FT5A 4MPEA 1UY6A 1I5AA 3TZ4A 2YGAA 1EI1A 3INWA 4Q20A 2ZKJA 3RLRA 4XIQA 2XDKA 3MNRP 2Q8FA 4CWTA 4E01A 2YE9A 4H85A 2XJJA 2YEAA 1Z5CA 2YKBA 1YC3A 3T2SA 4O09A 1I5BA 3B25A 4HXWA 1UYEA 3NMQA 2IWSA 3D36A 5CTYA 1YC4A 4AWQA 2YGEA 4YKXA 5IDJA 3D0BA 3HYYA 2YKCA 2YJWA 1UYCA 5BOCA 2BU6A 3PEJA 4CWRA 4LP0A 1MX0A 3A0RA 4HY1A 2Q2EB 2HKJA 5D7RA 4MBCA 2K5BA 1UYFA 4XD8A 2H55A 3BM9A 4MPNA 2YGFA 1BXDA 4X9LA 2WEPA 5L3JA 5J6AA 2QFOA 2FWYA 4CE3A 2XHRA 3O2FA 3ZM7A 1TIDA 4CWFA 2HCHA 3SL2A 4L94A 1YETA 4L8ZA 2YE2A 4L91A 4FCPA 4XKKA 2AKPA 3K97A 4CWQA 5M4NA 4XCLA 1TILA 4CE2A 5FNDA 3RKZA 4KP4A 1AM1A 2IWXA 3LNUA 3C0EA 4XDMA 4B7PA 3QDDA 4GQTA 4V26A 4AS9A 2BZ5A 4FCQA 1TC6A 2YKIA 1JM6A 1Z59A 2YE5A 4KFGA 3EKOA 5GGZA 2BYHA 4LWGA 1GKZA 2UWDA 3G7BA 3OW6A 4ZVIA 4EFUA 4XCJA 3GIEA 1UYHA 3Q5LA 4HYMA 2YI0A 2ESAA 2WERA 4R1FA 3EHGA 1NHHA 4GGLA 1YT0A 2YEHA 4PRXA 4EEHA 4LWIA 2XDSA 1AH8A 2YEGA 4YKZA 4LWEA 2PNRA 5M4EA 1A4HA 2Q8GA 4MP7A 3C11A 4XC0A 1UYKA 1H7SA 1B62A 2YK9A 3ZXQA 1ZXMA 3GIGA 1L0OA 1ID0A 4FCRA 4KQVA 3A0YA 4MPCA 4U7NA 3H80A 2VCIA 5F5RA 4EFTA 1KZNA 5FNCA 5FWKA 3VHCA 1AJ6A 4JAVA 2Q8IA 2WI3A 4MP2A 3D2RA 3H4LA 4O04A 4ASAA 3K60A 3U2KA 1OSFA 4PRVA 3R4NA 2YI6A 1YT1A 3DGEA 1ZWHA 4EMVA 1B3QA 5D7CA 3WHAA 4P8OA 2CCUA 3TUHA 1U2OA 4URLA 2FXSA 4YKRA 3K99A 4AWPA 4NH9A 3B26A 3OMUA 4P7AA 1B63A 3A0XA 2H8MA 4HXZA 4XTJA 4MOTA 3R4MA 3VHDA 1GJVA 4DZYA 4L93A 2FYPA 2XDXA 2XCMA 1U0ZA 1S16A 2XX4A 2XHXA 2WI5A 4KSHA 5FNFA 2C2AA 4PL9A 2VWCA 2XD6A 3BMYA 2FWZA 2VW5A 4L90A 5D7DA 2ZBKB 2XABA 4BAEA 4HY6A 4YKWA 3JZ3A 3T1KA 4GEEA 3B28A 5C93A 1GKXA 1NHIA 4CWPA 4KTNA 4BQJA 2JJCA 4XKOA 1UY7A 2YK2A 2JKIA 4JQLA 4E02A 4JAUA 2CH4A 1BKNA 3R91A 4LWHA 2XK2A 4YKQA 3WQ9A 1EA6A 3R4OA 1UYGA 2GFDA 2YEIA 4WUBA 4YKUA 4BIZA 3R92A 1YESA 1QZRA 4WUDA 3INXA 3PEHA 2BSMA 2VCJA 2IWUA 2ZDYA 3GIGB 3K98A 4R3MA 3RLQA 3Q5JA 1KIJA 1NHJA 1QY8A 1ZXNA 2YJXA 2XJXA 2O1UA 4YKTA 2WI2A 2YE4A 2XDLA 1YERA 2ZDXA 4GFNA 4CE1A 3O0IA 2XX2A 4BQGA 4K4OA 2BU8A 3OWBA 5BODA 2BREA 1PVGA 5M4PA 3A0WA 3LPSA 3KE6A 3T0HA 5M4KA 2BT0A 3TZ0A 4URMA 2Q8HA 3FT8A 3ZXOA 5M4MA 4BIUA 1I58A 5CTWA 2YE7A 3TZ2A 2QG0A 3CGZA 4LWFA 2O1WA 4O07A 4V25A 2XHTA 2BU7A 3HZ5A 1Y8OA 4HZ0A 3U2DA 3EHHA 2EXLA 4O0BA 2WI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T10 A;  4CWN A;  4JAS A;  4E00 A;  3EHJ A;  3CWV A;  1Y8P A;  3ZKD A;  3FV5 A;  1YSR A;  4CWO A;  3RLP A;  4HZ5 A;  1R62 A;  5IDM A;  1YSZ A;  4XKA A;  3VHA A;  4I3H A;  2YEB A;  4LPB A;  1S14 A;  4AWO A;  2QF6 A;  3HEK A;  4KSG A;  2YEE A;  4EGI A;  1H7U A;  1TC0 A;  2YED A;  3G7E A;  5F3K A;  3HYZ A;  2YKE A;  3VAD A;  1YT2 A;  3A0T A;  2BU2 A;  4I5S A;  1UYD A;  3GIF A;  4ASG A;  3HZ1 A;  2YI7 A;  2WI1 A;  4FMT A;  2XX5 A;  3TTZ A;  3ZKB A;  5M4H A;  3IED A;  4H81 A;  3B27 A;  5D6Q A;  4ZKI A;  5CTU A;  2IOQ A;  2XJG A;  1YC1 A;  2BU5 A;  2YEJ A;  2XDU A;  3Q5K A;  3CRK A;  4YKY A;  4O05 A;  2CCT A;  1I59 A;  3T0Z A;  2E0A A;  4WUC A;  2CGF A;  1UYL A;  2WEQ A;  4XIR A;  2GQP A;  4DUH A;  1Y4U A;  1THN A;  4W7T A;  3G75 A;  3CGY A;  2YE3 A;  4MB9 A;  4XIP A;  2YEF A;  3U67 A;  2QG2 A;  2BTZ A;  3CRL A;  4URO A;  3B24 A;  1UYI A;  1TH8 A;  3EHF A;  4U93 A;  5CF0 A;  1I5D A;  4XIT A;  4QPJ A;  1Z5B A;  3HHU A;  1YS3 A;  2WI6 A;  5CPH A;  4NH8 A;  4XE2 A;  1TBW A;  1UY9 A;  3O6O A;  4U7O A;  5CTX A;  1MU5 A;  3A0Z A;  2IOP A;  2BYI A;  4R3A A;  4ASB A;  2YE6 A;  4ASF A;  4GT8 A;  2CCS A;  1QYE A;  4H7Q A;  3OWD A;  1US7 A;  3EKR A;  2HG1 A;  1UY8 A;  4GCZ A;  2O1V A;  5J71 A;  1AMW A;  3QTF A;  4QPK A;  2BRC A;  1BYQ A;  2WI4 A;  1Y8N A;  5IN9 A;  4HYP A;  4EM7 A;  2IOR A;  4NH7 A;  5D6P A;  4CWS A;  4EGK A;  3OPD A;  3TZ5 A;  2YI5 A;  4B6C A;  1Z5A A;  4URN A;  1UYM A;  3R4P A;  4BXI A;  2CG9 A;  4FPP A;  1I5C A;  4EGH A;  1Y4S A;  2YE8 A;  2YKJ A;  2YEC A;  1AH6 A;  1ZW9 A;  4PU9 A;  1BGQ A;  3FT5 A;  4MPE A;  1UY6 A;  1I5A A;  3TZ4 A;  2YGA A;  1EI1 A;  3INW A;  4Q20 A;  2ZKJ A;  3RLR A;  4XIQ A;  2XDK A;  3MNR P;  2Q8F A;  4CWT A;  4E01 A;  2YE9 A;  4H85 A;  2XJJ A;  2YEA A;  1Z5C A;  2YKB A;  1YC3 A;  3T2S A;  4O09 A;  1I5B A;  3B25 A;  4HXW A;  1UYE A;  3NMQ A;  2IWS A;  3D36 A;  5CTY A;  1YC4 A;  4AWQ A;  2YGE A;  4YKX A;  5IDJ A;  3D0B A;  3HYY A;  2YKC A;  2YJW A;  1UYC A;  5BOC A;  2BU6 A;  3PEJ A;  4CWR A;  4LP0 A;  1MX0 A;  3A0R A;  4HY1 A;  2Q2E B;  2HKJ A;  5D7R A;  4MBC A;  2K5B A;  1UYF A;  4XD8 A;  2H55 A;  3BM9 A;  4MPN A;  2YGF A;  1BXD A;  4X9L A;  2WEP A;  5L3J A;  5J6A A;  2QFO A;  2FWY A;  4CE3 A;  2XHR A;  3O2F A;  3ZM7 A;  1TID A;  4CWF A;  2HCH A;  3SL2 A;  4L94 A;  1YET A;  4L8Z A;  2YE2 A;  4L91 A;  4FCP A;  4XKK A;  2AKP A;  3K97 A;  4CWQ A;  5M4N A;  4XCL A;  1TIL A;  4CE2 A;  5FND A;  3RKZ A;  4KP4 A;  1AM1 A;  2IWX A;  3LNU A;  3C0E A;  4XDM A;  4B7P A;  3QDD A;  4GQT A;  4V26 A;  4AS9 A;  2BZ5 A;  4FCQ A;  1TC6 A;  2YKI A;  1JM6 A;  1Z59 A;  2YE5 A;  4KFG A;  3EKO A;  5GGZ A;  2BYH A;  4LWG A;  1GKZ A;  2UWD A;  3G7B A;  3OW6 A;  4ZVI A;  4EFU A;  4XCJ A;  3GIE A;  1UYH A;  3Q5L A;  4HYM A;  2YI0 A;  2ESA A;  2WER A;  4R1F A;  3EHG A;  1NHH A;  4GGL A;  1YT0 A;  2YEH A;  4PRX A;  4EEH A;  4LWI A;  2XDS A;  1AH8 A;  2YEG A;  4YKZ A;  4LWE A;  2PNR A;  5M4E A;  1A4H A;  2Q8G A;  4MP7 A;  3C11 A;  4XC0 A;  1UYK A;  1H7S A;  1B62 A;  2YK9 A;  3ZXQ A;  1ZXM A;  3GIG A;  1L0O A;  1ID0 A;  4FCR A;  4KQV A;  3A0Y A;  4MPC A;  4U7N A;  3H80 A;  2VCI A;  5F5R A;  4EFT A;  1KZN A;  5FNC A;  5FWK A;  3VHC A;  1AJ6 A;  4JAV A;  2Q8I A;  2WI3 A;  4MP2 A;  3D2R A;  3H4L A;  4O04 A;  4ASA A;  3K60 A;  3U2K A;  1OSF A;  4PRV A;  3R4N A;  2YI6 A;  1YT1 A;  3DGE A;  1ZWH A;  4EMV A;  1B3Q A;  5D7C A;  3WHA A;  4P8O A;  2CCU A;  3TUH A;  1U2O A;  4URL A;  2FXS A;  4YKR A;  3K99 A;  4AWP A;  4NH9 A;  3B26 A;  3OMU A;  4P7A A;  1B63 A;  3A0X A;  2H8M A;  4HXZ A;  4XTJ A;  4MOT A;  3R4M A;  3VHD A;  1GJV A;  4DZY A;  4L93 A;  2FYP A;  2XDX A;  2XCM A;  1U0Z A;  1S16 A;  2XX4 A;  2XHX A;  2WI5 A;  4KSH A;  5FNF A;  2C2A A;  4PL9 A;  2VWC A;  2XD6 A;  3BMY A;  2FWZ A;  2VW5 A;  4L90 A;  5D7D A;  2ZBK B;  2XAB A;  4BAE A;  4HY6 A;  4YKW A;  3JZ3 A;  3T1K A;  4GEE A;  3B28 A;  5C93 A;  1GKX A;  1NHI A;  4CWP A;  4KTN A;  4BQJ A;  2JJC A;  4XKO A;  1UY7 A;  2YK2 A;  2JKI A;  4JQL A;  4E02 A;  4JAU A;  2CH4 A;  1BKN A;  3R91 A;  4LWH A;  2XK2 A;  4YKQ A;  3WQ9 A;  1EA6 A;  3R4O A;  1UYG A;  2GFD A;  2YEI A;  4WUB A;  4YKU A;  4BIZ A;  3R92 A;  1YES A;  1QZR A;  4WUD A;  3INX A;  3PEH A;  2BSM A;  2VCJ A;  2IWU A;  2ZDY A;  3GIG B;  3K98 A;  4R3M A;  3RLQ A;  3Q5J A;  1KIJ A;  1NHJ A;  1QY8 A;  1ZXN A;  2YJX A;  2XJX A;  2O1U A;  4YKT A;  2WI2 A;  2YE4 A;  2XDL A;  1YER A;  2ZDX A;  4GFN A;  4CE1 A;  3O0I A;  2XX2 A;  4BQG A;  4K4O A;  2BU8 A;  3OWB A;  5BOD A;  2BRE A;  1PVG A;  5M4P A;  3A0W A;  3LPS A;  3KE6 A;  3T0H A;  5M4K A;  2BT0 A;  3TZ0 A;  4URM A;  2Q8H A;  3FT8 A;  3ZXO A;  5M4M A;  4BIU A;  1I58 A;  5CTW A;  2YE7 A;  3TZ2 A;  2QG0 A;  3CGZ A;  4LWF A;  2O1W A;  4O07 A;  4V25 A;  2XHT A;  2BU7 A;  3HZ5 A;  1Y8O A;  4HZ0 A;  3U2D A;  3EHH A;  2EXL A;  4O0B A;  2WI7 A; 
#chains in the Genus database with same CATH topology
 3T10 A;  4CWN A;  4JAS A;  4E00 A;  3EHJ A;  3CWV A;  1Y8P A;  3ZKD A;  3FV5 A;  1YSR A;  4CWO A;  3RLP A;  4HZ5 A;  1R62 A;  5IDM A;  1YSZ A;  4XKA A;  3VHA A;  4I3H A;  2YEB A;  4LPB A;  1S14 A;  4AWO A;  2QF6 A;  3HEK A;  4KSG A;  2YEE A;  4EGI A;  1H7U A;  1TC0 A;  2YED A;  3G7E A;  5F3K A;  3HYZ A;  2YKE A;  3VAD A;  1YT2 A;  3A0T A;  2BU2 A;  4E72 A;  4I5S A;  1UYD A;  3GIF A;  4ASG A;  3HZ1 A;  2YI7 A;  2WI1 A;  4FMT A;  2XX5 A;  3TTZ A;  3ZKB A;  5M4H A;  3IED A;  4H81 A;  3B27 A;  5D6Q A;  4ZKI A;  5CTU A;  2IOQ A;  2XJG A;  1YC1 A;  2BU5 A;  2YEJ A;  2XDU A;  3Q5K A;  3CRK A;  4YKY A;  4O05 A;  2CCT A;  1I59 A;  3T0Z A;  2E0A A;  4WUC A;  2CGF A;  1UYL A;  2WEQ A;  4XIR A;  2GQP A;  4DUH A;  1Y4U A;  1THN A;  4W7T A;  3G75 A;  3CGY A;  2YE3 A;  4MB9 A;  4XIP A;  2YEF A;  3U67 A;  2QG2 A;  2BTZ A;  3CRL A;  4URO A;  3B24 A;  1UYI A;  1TH8 A;  3EHF A;  4U93 A;  5CF0 A;  1I5D A;  4XIT A;  4QPJ A;  1Z5B A;  3HHU A;  1YS3 A;  2WI6 A;  5CPH A;  4NH8 A;  4XE2 A;  1TBW A;  1UY9 A;  3O6O A;  4U7O A;  5CTX A;  1MU5 A;  3A0Z A;  2IOP A;  2BYI A;  4R3A A;  4ASB A;  2YE6 A;  4ASF A;  4GT8 A;  2CCS A;  1QYE A;  4H7Q A;  2C1I A;  3OWD A;  1US7 A;  3EKR A;  2HG1 A;  1UY8 A;  4GCZ A;  2O1V A;  5J71 A;  1AMW A;  3QTF A;  4QPK A;  2BRC A;  1BYQ A;  2WI4 A;  1Y8N A;  5IN9 A;  4HYP A;  4EM7 A;  2IOR A;  4NH7 A;  5D6P A;  4CWS A;  4EGK A;  3OPD A;  3TZ5 A;  2YI5 A;  4B6C A;  1Z5A A;  4URN A;  1UYM A;  3R4P A;  4BXI A;  2CG9 A;  4FPP A;  1I5C A;  3S5T A;  4EGH A;  1Y4S A;  2YE8 A;  2YKJ A;  2YEC A;  1AH6 A;  1ZW9 A;  4PU9 A;  1BGQ A;  3FT5 A;  4MPE A;  1UY6 A;  1I5A A;  3TZ4 A;  2YGA A;  1EI1 A;  3INW A;  4Q20 A;  2ZKJ A;  3RLR A;  4XIQ A;  2XDK A;  3MNR P;  2Q8F A;  4CWT A;  4E01 A;  2YE9 A;  4H85 A;  2XJJ A;  2YEA A;  1Z5C A;  2YKB A;  1YC3 A;  3T2S A;  4O09 A;  1I5B A;  3B25 A;  4HXW A;  1UYE A;  3NMQ A;  2IWS A;  3D36 A;  5CTY A;  1YC4 A;  4AWQ A;  2YGE A;  4YKX A;  2FTK A;  5IDJ A;  3LMM A;  3D0B A;  3HYY A;  2YKC A;  2YJW A;  1UYC A;  5BOC A;  2BU6 A;  3PEJ A;  1F51 A;  4CWR A;  4LP0 A;  1MX0 A;  3A0R A;  4HY1 A;  2Q2E B;  2HHI A;  2HKJ A;  5D7R A;  4MBC A;  2K5B A;  1UYF A;  4XD8 A;  2H55 A;  3BM9 A;  4MPN A;  2YGF A;  1BXD A;  4X9L A;  2WEP A;  5L3J A;  5J6A A;  2QFO A;  2FWY A;  4CE3 A;  2XHR A;  3O2F A;  3ZM7 A;  1TID A;  4CWF A;  2HCH A;  3SL2 A;  4L94 A;  1YET A;  4L8Z A;  2YE2 A;  4L91 A;  4FCP A;  4XKK A;  2AKP A;  3K97 A;  4CWQ A;  5M4N A;  4XCL A;  1IXM A;  1TIL A;  4CE2 A;  5FND A;  3RKZ A;  4KP4 A;  1AM1 A;  2IWX A;  3LNU A;  3C0E A;  4XDM A;  4B7P A;  3QDD A;  4GQT A;  4V26 A;  4AS9 A;  2BZ5 A;  4FCQ A;  1TC6 A;  2YKI A;  1JM6 A;  1Z59 A;  2YE5 A;  4KFG A;  3EKO A;  5GGZ A;  2BYH A;  4LWG A;  1GKZ A;  2UWD A;  3G7B A;  3OW6 A;  4ZVI A;  4EFU A;  4XCJ A;  3GIE A;  1UYH A;  3Q5L A;  4HYM A;  2YI0 A;  2ESA A;  2WER A;  4R1F A;  3EHG A;  1NHH A;  4GGL A;  1YT0 A;  2YEH A;  4PRX A;  4EEH A;  4LWI A;  2XDS A;  1AH8 A;  2YEG A;  4YKZ A;  4LWE A;  2PNR A;  5M4E A;  1A4H A;  2Q8G A;  4MP7 A;  3C11 A;  4XC0 A;  1UYK A;  1H7S A;  1B62 A;  2YK9 A;  3ZXQ A;  1ZXM A;  3GIG A;  1L0O A;  1ID0 A;  4FCR A;  4KQV A;  3A0Y A;  4MPC A;  4U7N A;  3H80 A;  2VCI A;  5F5R A;  4EFT A;  1KZN A;  5FNC A;  5FWK A;  3VHC A;  1AJ6 A;  4JAV A;  2Q8I A;  2WI3 A;  4MP2 A;  3D2R A;  3H4L A;  4O04 A;  4ASA A;  3K60 A;  3U2K A;  1OSF A;  4PRV A;  3R4N A;  2YI6 A;  1YT1 A;  3DGE A;  1ZWH A;  4EMV A;  1B3Q A;  5D7C A;  3WHA A;  4P8O A;  2CCU A;  3TUH A;  1U2O A;  4URL A;  2FXS A;  4YKR A;  3K99 A;  4AWP A;  4NH9 A;  3B26 A;  3OMU A;  4P7A A;  1B63 A;  3A0X A;  2H8M A;  4HXZ A;  4XTJ A;  4MOT A;  3R4M A;  3VHD A;  1GJV A;  4DZY A;  4L93 A;  2FYP A;  5JEN A;  2C1G A;  2XDX A;  2XCM A;  1U0Z A;  1S16 A;  2XX4 A;  2XHX A;  2WI5 A;  4KSH A;  5FNF A;  2C2A A;  4PL9 A;  2VWC A;  2XD6 A;  3BMY A;  2FWZ A;  2VW5 A;  4L90 A;  5D7D A;  2ZBK B;  2XAB A;  4BAE A;  4HY6 A;  4YKW A;  3JZ3 A;  3T1K A;  4GEE A;  3B28 A;  5C93 A;  1GKX A;  1NHI A;  4CWP A;  4KTN A;  4BQJ A;  2JJC A;  4XKO A;  1UY7 A;  2YK2 A;  2JKI A;  4JQL A;  4E02 A;  4JAU A;  2CH4 A;  1BKN A;  3R91 A;  4LWH A;  2XK2 A;  4YKQ A;  3WQ9 A;  1EA6 A;  3R4O A;  1UYG A;  2GFD A;  2YEI A;  4WUB A;  4YKU A;  4BIZ A;  3R92 A;  1YES A;  1QZR A;  4WUD A;  3INX A;  3PEH A;  2BSM A;  2VCJ A;  3CYG A;  2IWU A;  2ZDY A;  3GIG B;  3K98 A;  4R3M A;  3RLQ A;  3Q5J A;  1KIJ A;  1NHJ A;  1QY8 A;  1ZXN A;  2YJX A;  2XJX A;  2O1U A;  4YKT A;  2WI2 A;  2YE4 A;  2XDL A;  1YER A;  2ZDX A;  4GFN A;  4CE1 A;  3O0I A;  2XX2 A;  4BQG A;  4K4O A;  2BU8 A;  3OWB A;  5BOD A;  2BRE A;  1PVG A;  5M4P A;  3A0W A;  3LPS A;  3KE6 A;  3T0H A;  5M4K A;  2BT0 A;  3TZ0 A;  4URM A;  2Q8H A;  3FT8 A;  3ZXO A;  5M4M A;  4BIU A;  1I58 A;  5CTW A;  2YE7 A;  3TZ2 A;  2QG0 A;  3CGZ A;  4LWF A;  2O1W A;  4O07 A;  4V25 A;  2XHT A;  2BU7 A;  3HZ5 A;  1Y8O A;  4HZ0 A;  3U2D A;  3EHH A;  2EXL A;  4O0B A;  2WI7 A; 
#chains in the Genus database with same CATH homology
 3T10 A;  4CWN A;  4JAS A;  4E00 A;  3EHJ A;  3CWV A;  1Y8P A;  3ZKD A;  3FV5 A;  1YSR A;  4CWO A;  3RLP A;  4HZ5 A;  1R62 A;  5IDM A;  1YSZ A;  4XKA A;  3VHA A;  4I3H A;  2YEB A;  4LPB A;  1S14 A;  4AWO A;  2QF6 A;  3HEK A;  4KSG A;  2YEE A;  4EGI A;  1H7U A;  1TC0 A;  2YED A;  3G7E A;  5F3K A;  3HYZ A;  2YKE A;  3VAD A;  1YT2 A;  3A0T A;  2BU2 A;  4I5S A;  1UYD A;  3GIF A;  4ASG A;  3HZ1 A;  2YI7 A;  2WI1 A;  4FMT A;  2XX5 A;  3TTZ A;  3ZKB A;  5M4H A;  3IED A;  4H81 A;  3B27 A;  5D6Q A;  4ZKI A;  5CTU A;  2IOQ A;  2XJG A;  1YC1 A;  2BU5 A;  2YEJ A;  2XDU A;  3Q5K A;  3CRK A;  4YKY A;  4O05 A;  2CCT A;  1I59 A;  3T0Z A;  2E0A A;  4WUC A;  2CGF A;  1UYL A;  2WEQ A;  4XIR A;  2GQP A;  4DUH A;  1Y4U A;  1THN A;  4W7T A;  3G75 A;  3CGY A;  2YE3 A;  4MB9 A;  4XIP A;  2YEF A;  3U67 A;  2QG2 A;  2BTZ A;  3CRL A;  4URO A;  3B24 A;  1UYI A;  1TH8 A;  3EHF A;  4U93 A;  5CF0 A;  1I5D A;  4XIT A;  4QPJ A;  1Z5B A;  3HHU A;  1YS3 A;  2WI6 A;  5CPH A;  4NH8 A;  4XE2 A;  1TBW A;  1UY9 A;  3O6O A;  4U7O A;  5CTX A;  1MU5 A;  3A0Z A;  2IOP A;  2BYI A;  4R3A A;  4ASB A;  2YE6 A;  4ASF A;  4GT8 A;  2CCS A;  1QYE A;  4H7Q A;  3OWD A;  1US7 A;  3EKR A;  2HG1 A;  1UY8 A;  4GCZ A;  2O1V A;  5J71 A;  1AMW A;  3QTF A;  4QPK A;  2BRC A;  1BYQ A;  2WI4 A;  1Y8N A;  5IN9 A;  4HYP A;  4EM7 A;  2IOR A;  4NH7 A;  5D6P A;  4CWS A;  4EGK A;  3OPD A;  3TZ5 A;  2YI5 A;  4B6C A;  1Z5A A;  4URN A;  1UYM A;  3R4P A;  4BXI A;  2CG9 A;  4FPP A;  1I5C A;  4EGH A;  1Y4S A;  2YE8 A;  2YKJ A;  2YEC A;  1AH6 A;  1ZW9 A;  4PU9 A;  1BGQ A;  3FT5 A;  4MPE A;  1UY6 A;  1I5A A;  3TZ4 A;  2YGA A;  1EI1 A;  3INW A;  4Q20 A;  2ZKJ A;  3RLR A;  4XIQ A;  2XDK A;  3MNR P;  2Q8F A;  4CWT A;  4E01 A;  2YE9 A;  4H85 A;  2XJJ A;  2YEA A;  1Z5C A;  2YKB A;  1YC3 A;  3T2S A;  4O09 A;  1I5B A;  3B25 A;  4HXW A;  1UYE A;  3NMQ A;  2IWS A;  3D36 A;  5CTY A;  1YC4 A;  4AWQ A;  2YGE A;  4YKX A;  5IDJ A;  3D0B A;  3HYY A;  2YKC A;  2YJW A;  1UYC A;  5BOC A;  2BU6 A;  3PEJ A;  4CWR A;  4LP0 A;  1MX0 A;  3A0R A;  4HY1 A;  2Q2E B;  2HKJ A;  5D7R A;  4MBC A;  2K5B A;  1UYF A;  4XD8 A;  2H55 A;  3BM9 A;  4MPN A;  2YGF A;  1BXD A;  4X9L A;  2WEP A;  5L3J A;  5J6A A;  2QFO A;  2FWY A;  4CE3 A;  2XHR A;  3O2F A;  3ZM7 A;  1TID A;  4CWF A;  2HCH A;  3SL2 A;  4L94 A;  1YET A;  4L8Z A;  2YE2 A;  4L91 A;  4FCP A;  4XKK A;  2AKP A;  3K97 A;  4CWQ A;  5M4N A;  4XCL A;  1TIL A;  4CE2 A;  5FND A;  3RKZ A;  4KP4 A;  1AM1 A;  2IWX A;  3LNU A;  3C0E A;  4XDM A;  4B7P A;  3QDD A;  4GQT A;  4V26 A;  4AS9 A;  2BZ5 A;  4FCQ A;  1TC6 A;  2YKI A;  1JM6 A;  1Z59 A;  2YE5 A;  4KFG A;  3EKO A;  5GGZ A;  2BYH A;  4LWG A;  1GKZ A;  2UWD A;  3G7B A;  3OW6 A;  4ZVI A;  4EFU A;  4XCJ A;  3GIE A;  1UYH A;  3Q5L A;  4HYM A;  2YI0 A;  2ESA A;  2WER A;  4R1F A;  3EHG A;  1NHH A;  4GGL A;  1YT0 A;  2YEH A;  4PRX A;  4EEH A;  4LWI A;  2XDS A;  1AH8 A;  2YEG A;  4YKZ A;  4LWE A;  2PNR A;  5M4E A;  1A4H A;  2Q8G A;  4MP7 A;  3C11 A;  4XC0 A;  1UYK A;  1H7S A;  1B62 A;  2YK9 A;  3ZXQ A;  1ZXM A;  3GIG A;  1L0O A;  1ID0 A;  4FCR A;  4KQV A;  3A0Y A;  4MPC A;  4U7N A;  3H80 A;  2VCI A;  5F5R A;  4EFT A;  1KZN A;  5FNC A;  5FWK A;  3VHC A;  1AJ6 A;  4JAV A;  2Q8I A;  2WI3 A;  4MP2 A;  3D2R A;  3H4L A;  4O04 A;  4ASA A;  3K60 A;  3U2K A;  1OSF A;  4PRV A;  3R4N A;  2YI6 A;  1YT1 A;  3DGE A;  1ZWH A;  4EMV A;  1B3Q A;  5D7C A;  3WHA A;  4P8O A;  2CCU A;  3TUH A;  1U2O A;  4URL A;  2FXS A;  4YKR A;  3K99 A;  4AWP A;  4NH9 A;  3B26 A;  3OMU A;  4P7A A;  1B63 A;  3A0X A;  2H8M A;  4HXZ A;  4XTJ A;  4MOT A;  3R4M A;  3VHD A;  1GJV A;  4DZY A;  4L93 A;  2FYP A;  2XDX A;  2XCM A;  1U0Z A;  1S16 A;  2XX4 A;  2XHX A;  2WI5 A;  4KSH A;  5FNF A;  2C2A A;  4PL9 A;  2VWC A;  2XD6 A;  3BMY A;  2FWZ A;  2VW5 A;  4L90 A;  5D7D A;  2ZBK B;  2XAB A;  4BAE A;  4HY6 A;  4YKW A;  3JZ3 A;  3T1K A;  4GEE A;  3B28 A;  5C93 A;  1GKX A;  1NHI A;  4CWP A;  4KTN A;  4BQJ A;  2JJC A;  4XKO A;  1UY7 A;  2YK2 A;  2JKI A;  4JQL A;  4E02 A;  4JAU A;  2CH4 A;  1BKN A;  3R91 A;  4LWH A;  2XK2 A;  4YKQ A;  3WQ9 A;  1EA6 A;  3R4O A;  1UYG A;  2GFD A;  2YEI A;  4WUB A;  4YKU A;  4BIZ A;  3R92 A;  1YES A;  1QZR A;  4WUD A;  3INX A;  3PEH A;  2BSM A;  2VCJ A;  2IWU A;  2ZDY A;  3GIG B;  3K98 A;  4R3M A;  3RLQ A;  3Q5J A;  1KIJ A;  1NHJ A;  1QY8 A;  1ZXN A;  2YJX A;  2XJX A;  2O1U A;  4YKT A;  2WI2 A;  2YE4 A;  2XDL A;  1YER A;  2ZDX A;  4GFN A;  4CE1 A;  3O0I A;  2XX2 A;  4BQG A;  4K4O A;  2BU8 A;  3OWB A;  5BOD A;  2BRE A;  1PVG A;  5M4P A;  3A0W A;  3LPS A;  3KE6 A;  3T0H A;  5M4K A;  2BT0 A;  3TZ0 A;  4URM A;  2Q8H A;  3FT8 A;  3ZXO A;  5M4M A;  4BIU A;  1I58 A;  5CTW A;  2YE7 A;  3TZ2 A;  2QG0 A;  3CGZ A;  4LWF A;  2O1W A;  4O07 A;  4V25 A;  2XHT A;  2BU7 A;  3HZ5 A;  1Y8O A;  4HZ0 A;  3U2D A;  3EHH A;  2EXL A;  4O0B A;  2WI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...