5D7IA

Structure of human mr1-ac-6-fp in complex with human mait m33.64 tcr
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
269
structure length
263
Chain Sequence
RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELLYSCHVEHSGVHMVLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 70
structure length 263
sequence length 269
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7iA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5d7iA01
1KJ2L 4PY7B 2BVEA 3VWKB 5J1AB 3QJHA 5EUOE 4L8BB 5I71B 3VD5A 1R0AL 5HXMA 1D5MA 3GSNA 1N4XL 3MRKA 4PYHA 4WTXA 4B53A 1GJIA 4ZS6C 1J7VR 1VFBA 3PABB 3STBA 1QO3A 3ALWA 3CCHA 4H20L 3UP1A 1SBSH 3WDJA 1KCRH 4JPVH 2X89A 4RIRB 1WISA 2VERN 3H9YA 4JGUA 5T3XD 3BRGC 4L9LB 1MUJA 1PQZB 3SE9H 3UZVB 1QLEL 3P0GB 3P40A 4LCWD 1OSPL 4MB4A 3K4DA 4QCIA 1QEWB 5D7JD 1FYTB 2ADFL 2BVUA 4L4VE 4PJBF 2WZPD 3S37X 5IIEB 1W72H 3B9EA 5C3TA 4FFWC 1MCWW 1M05A 1H3TA 4R6UA 4OFVA 1U8MB 1AGBA 4RGND 5DD6A 3N1MC 5D1ZC 3D69B 2HT4D 3OHXA 1TTGA 3LEYH 3EFFB 2ITCA 3AGVA 4NKOB 1MHCB 1YPZA 4Q0XL 2R1WB 4L8BA 4F7PB 1PYWB 1MCOL 3TFKA 1NMAH 3O6KH 1NAKH 3VRJB 1OW0C 1OGAA 4ORGB 5EZJB 4AM0A 3PJSA 1WWAX 5GJSL 5DC9B 3MA7B 1A6ZA 1QRNA 4G8GE 4J3SA 2W0FA 3TBWB 2YKLL 2UWEA 4OQTA 4TUKH 2FL5B 4HKXB 1A7BA 2HVKB 3RIAK 5EOCH 3BT2L 3BJ91 4RZCB 1MWAA 4X98B 3WMSA 4S0TD 4GH7B 3KDMA 5EC2B 2FR4A 2NMSA 5A16A 1DBJL 2X2YA 4N8VB 4XGZA 4JDVB 4EOWL 2W65B 4HWZB 5FV1L 4R4FH 3ULVD 4NZTH 4OLUL 2NY4B 3PJSB 1AHWB 2YHGA 3ULVH 2C26A 3ISWA 3UX9B 3NFPA 1UXSA 4XXDB 1P7HL 4HQQL 3TO4C 2R1WA 4ALAL 4X99B 5KAQG 1NGYA 5GS1B 3BZEA 2IH1A 4PJEE 3WUWG 1ADQL 1ZLUH 2QHRL 4U1KB 1LE9B 1D5XA 2W92A 2J4WH 3ARDA 5DF0A 4XWGL 5H94A 1JRHL 2V2XB 4QOKB 4XP6L 4IRZL 1DJSA 5CP7B 4EXKA 4EQ3A 2KZ1B 2BFVL 4QTIL 4WUUD 1KN4L 4V1DB 4JO4L 4U1KA 5E1HB 4OT1H 3ZSSA 1DBBL 3DV4B 5BMFL 3VXUE 2PYED 1E6OH 1T03L 5L88H 2AQ2A 4IOSD 3LKSB 4K3JL 4WEMB 3UAJC 3ZKSD 4J7RA 2Y1VA 5FECB 1S9VB 3Q6GL 4OZGA 2D03H 5T1KA 5I16A 1FZJA 2HJKA 3LOWA 2C9AA 4HJJL 1BREA 3U0WL 1QFUH 4NJ9H 2V5SA 3F58L 4JJ5B 2AEQL 1DQDL 2UWEB 4QXUL 3RA7L 4MJIA 4NRXA 1I8MB 4I77L 5KSBF 1MI5D 3QPQD 4OLVL 4LEXH 1JPGB 3VI4E 2P8MB 1CE1L 4UU9A 1IKNC 3KNBA 3EJZD 4QRPD 1MCIA 4MXQC 4OAWA 1FVEB 5E94B 2BRQA 1VADB 1RJYB 1T1ZA 3VXPB 2EIDA 3I6KB 4JPKL 4NJAH 4OZFA 4YDIL 5KVGH 1RZKC 2Q76B 4I48A 4XVJH 3RWHB 1NC4D 5ANMB 5IQ7L 4Z7UB 4M1GL 1BQUA 4UBDD 3MMEB 3I75A 4P2QA 3BP6A 2HKHL 4DN3L 4K2UL 1CXFA 5A3IC 5JPMA 2J2ZA 2FYYA 5KN5A 4N1CA 1B6DA 2F58H 5SWQA 4LSVL 3SQOH 2DWEA 2VUYA 1WGOA 4MJ6B 2DIAA 1IAOA 1QBML 2IBZX 4R4BA 5AD0B 1WK0A 3CLEL 1HILA 2RQ8A 4H8WH 5E00A 3QAZC 1TIUA 3D3VB 3VGEA 3KWWB 2E3VA 1I9EA 3QEUB 1VESA 3O6LL 3TIDA 1CLYH 4LLMA 1GYAA 4YBLC 1CL7I 4FQCH 5EC1A 1RUKH 3E1F1 5DDHA 4F2MA 3HNTH 3HN3A 2ZUSA 5JA9A 1F4YH 2OI9C 5DVOA 3GIVA 4JFYB 2X44D 1AO7E 3W0WA 4RNRA 4L4VD 3H7BB 1T5WA 3ULVL 4NZDA 3IS0X 5SX5K 3RWFB 4HT1H 2X9XA 3GI8H 5E2JA 4PTUA 3GHBL 4Y4FA 3RZCA 4MD5B 3BQUC 5E8EA 1B4JL 2Y36H 4OB5H 5ID0A 1CG9B 5M7QA 2V7NB 1D6VL 1IVLA 4O58L 3REWA 3EGSB 1OAYL 2NX5D 4A6YA 3GSXB 1NBYB 3OGOE 4R2GB 5SWZD 2C1OA 1EH9A 4B7IA 1U92A 1BVKB 2C4FT 5C08B 3UJJL 5B39G 3FB8A 4PRID 4S1QL 4D0CB 1L6ZA 1CGVA 5F88A 3K81A 3WL9B 3C9NA 3IDYB 5EIIB 4IS6B 4ELKA 5D7JC 1FFPB 3LB6C 2XQBL 4AT6A 5J9PA 5TQ2H 2Z4QA 1T7XA 3INUL 4WW2B 4P5TC 1RZIB 4TN9A 1B6UA 5CBAA 2AV7B 3MBEB 2OR7A 1DBKH 3PHOA 3ULUF 4ZAKA 4Q7DA 5I15L 4Y4HC 2WLYA 1ES0A 1G7PB 4X4ZA 4JM2F 3RWCA 1I3GH 4JFED 5T1MB 4UQ2B 2G9HB 4NYLB 3QIBA 4G6AD 3MFGB 1A2YB 2VUOA 1YEFL 2X4RB 3TEUA 2P7TA 4APQA 1QFUL 4NJ9L 1NFDE 5DRWA 3BIAX 4NO0A 4GG6B 4OCWH 1QA9A 2ZOKA 3MYJA 2NY4C 5DR5H 2EDWA 5E99L 4FG6D 1T20B 3GI9H 1GL4B 2COQA 3HPLB 5KSAD 4KRMB 3WHE1 3KPSA 3GHBH 1KJ3L 3QULB 4L4TA 3KS0H 3HNVL 5CJXA 4X4MA 2PCPB 2XA8H 1R5WB 5TDOA 4KHTL 4V2BA 2GJ6D 1G84A 1F3DH 1A4KB 3NGBC 4Z7QE 5DD1H 5FB8B 4MVBD 3NCJL 2MWCA 3MLVL 3DXAB 2FGWH 5GISH 1BVZA 3VD4A 2AEPL 5DTFA 5E5MB 4MLSA 3PHSA 3KPOA 4XI5C 4XP4H 4J3WA 3U46B 5J4MA 1L7TL 4TUJA 4QRSB 1BFSA 4X9HA 4E42A 1UM6L 4Y1AB 5DLML 4ENEC 2V7HA 5T1LA 3OR6A 3QCTL 1QBMH 3VD7A 4I0PB 4Y4FC 3RZCC 5JIPA 3QSKB 3EKCA 2VOTA 1M71A 3BIKB 1MVUB 2V9TA 4OZIF 4PGDB 5EOTA 1QSVA 3JZ7A 4YEFA 4GAGH 1NANI 2NTFB 4ZOBA 1P5UA 3LS5H 3RNKA 4JCLA 2Y4SA 1KXVC 3THML 1IEBA 3C6LC 4PRHA 3QFDA 4XVTL 1WF5A 1MFCL 3IAQA 1UWEL 1CDBA 4OSUH 1T4KB 1XF1A 4AL8H 3O45B 2CKBH 3MV9A 4HCRH 3LQZB 4DUVA 1QFWM 5KVMC 2GSIB 1KSRA 1Y18B 3ORJA 4W6XB 4U6XB 2YD7A 2XZAL 2FSEB 3DARA 4U1SB 4IRSD 2X70B 3ZKXB 3BZFA 1NAMB 5IVNA 2OXGA 3OGCA 5IW6B 4LVOB 4KK8C 3PWUB 2DQFB 3B5HA 4BFIB 1IAIH 1VGEH 4O2EB 5T5NF 1DN0B 4GBXD 3WD5H 2ED7A 3LEYL 2AJVH 1K8DA 2GJJA 1A3RH 3KPMB 4WY7L 1HKLL 3RGHA 4QHUA 4KRNA 3DI3B 4BH8A 5C0EA 2ILLA 4HZLB 3LKQA 4G8GB 5B4MC 1Q9OA 3U0TA 4Q74A 3B4NA 3ROLA 1YN7B 1OSPH 3TZVC 3ZYIA 1MAJA 2NW3A 4XPHL 1AI1H 5B8CB 2ZUUA 4OF3A 4PGZA 3L95B 1D9KC 1LP9A 4L9LC 4CU8A 2V9QA 5IBTL 3O81A 2CUIA 4XNYH 2UZXB 5E1AA 2WMPA 3RIFF 3IDIB 1A6VL 1WC7A 4ACPA 4K3EL 5E9DE 5HHNB 1RMFL 3SKNA 1FO0B 5D2NE 2IFFH 1LO4H 4I0PA 4MA3A 1DN2A 2CRMA 1TJGL 5I66B 5F1IA 5DR5L 4NO5B 4XAKD 3TN0B 4DZBA 3CGTA 4G6FD 4KQ3L 4OI7A 1BQSA 1IC7L 4OLYL 4ERSH 4XPFH 1AC0A 1A9BB 4NBZB 1X5GA 2FEEI 3AB0C 5EIVA 4E41B 4TTGA 3W5MA 5BMFH 1DQTA 3D39E 1J0ZA 1HQRB 1LO3H 4PJBA 5C86A 2NXZC 3UC0H 4PG2C 3F7VB 4JPIB 1KCUH 4XBGA 3C5ZC 3C8KB 4P5MA 3NFNA 2OI9A 4GKZB 4XVUD 2OS7A 3CMOL 2CK2A 4JFHD 4AIOA 4O5LL 3CFJA 2M8XA 5F7NC 4BH8B 1NGZB 4MD4A 2C4FU 4NO0D 2GITA 1M7DB 1T89A 4LCIH 3WFDH 2PO6D 3SDXA 2G60L 1NEZG 3L3KA 3KPMA 1FZMA 4QOKD 4JREB 4KC3B 3U0PB 5FYKD 1V05A 3IU4L 3IF1A 2APTA 3PP4H 4NKIL 2AJXL 1QR1A 2IFGA 1XF4A 1V7ML 4FTVA 1CL7H 2SEBB 4HAFA 1IGTB 1AH1A 1WWWX 2V6HA 3FKUS 3U36B 3H2WA 2I26N 1A1NA 2CDFB 4TPRH 1RU9L 3WXWH 4V1DE 4LEOA 3O11A 1FNGB 1JMZA 2ZCLH 4OCRL 4PGCB 5HYQB 5I17A 5E8PA 1U3HD 2BDNH 2FDBP 3KLSA 3CFKB 3D39D 1ZT7A 4PJ7A 2XNAB 2OZ4A 1LE5A 1RJLB 3K1KC 5FHBL 2P5WA 3EJYC 1ZA6B 5DVNA 3OAUH 3JVGC 1W0VB 4PP1D 3RVTC 4L3CA 1OWRM 3PE9A 3D0LA 1W2KT 4JN2A 5C0BD 3S34H 2OJZH 1OD7A 2DJUA 4XVTH 3KJ6L 4OKVA 2OYPA 1YEHH 2OTUB 4MWFA 1NC2D 2B5IB 2HAZA 2D7MA 5LKNA 2X4TA 4G8IA 1P7QB 2YC1A 3KR3L 5CLTA 5A3ID 4I2XE 3FFDB 1A14H 1VFUA 2E9WA 3QDMA 3NPZB 5CBEB 4H8WL 3GI8L 1UVQB 4OV6F 5FYLL 2EIZA 3T2PA 3SDXF 2ICES 2NY1C 4N0FB 3LKRB 1UB5A 5ITBL 3DXAD 3IDXL 2ED9A 3B8SA 5GRUL 1ODAA 2HFTA 4I13B 1D5BA 4OAWB 4XHJC 2IQAA 4NQDB 1JNLH 4S1QH 2CPCA 4JY5H 5I74C 3S98A 3RHWF 2HFGL 1RUAL 1A3QA 2WBJD 4GXUN 1PSKH 3BFOA 3CJJA 3B9AA 5CEXB 3KLAB 4OZ4B 5EZLA 3GZKA 2VKXA 1HHGB 4PREA 1RIUH 5T1KB 3MLXL 5GZND 3KWWA 1IGMH 4OZFH 5GGQH 4HXBL 4R26L 2VDRH 3RKDD 2X7LA 4OGYH 2F53D 1KCGC 3RPIB 2AVGA 2YA1A 4KK6C 5DJAA 4F58L 2O61A 3O3BA 1WTLA 3VXOB 1FGVL 4MS8A 4RQQB 4R8WL 3V4UL 4X99A 3BD5A 1RIHL 5ICXB 4XPAH 2DQIL 1PQZA 3N1PC 1KACB 3MRDB 3PDDA 4N9GA 2O5ZL 1DR9A 3WE6B 3K8MA 1JGVL 3SE8H 5CWSA 5HVHC 5BO1H 3EO0B 3VXSA 4R7DB 4YHLL 4HG4K 1YNKL 2WUBL 5H94B 3DUUA 5KG9A 5I8OL 1MIEL 4MXWL 1TDQA 3FFCD 4C55A 3CZJA 4DUWA 2V5YA 1UJ3A 1ZOXA 4OB5L 2VLRE 2OBGA 3DO7A 3LKPA 5CEXA 5SX4I 1CR9L 3V95A 3VXMA 1U3YA 4UQ3B 1OQOA 1YJDC 2BZDA 4P23A 3CDGA 1I1FB 4NQVA 2MHAB 1LMKA 4RCAA 3N06B 3GI9L 4M03A 3EO1B 1O0VA 4UU9B 3IFOB 3LHPL 4OF6A 5EUOB 1JL8A 5T3XH 4ZUWB 2WSKA 3HZMA 3KPNA 4X6FA 4TSBL 2A77H 3LQMA 1J8HA 4LSUL 4NZUH 4XNZC 2D0HA 3O3EB 3VXMB 3UPAA 4Y2DA 4YJZL 1UZ8A 4YQXH 1T1YA 4M6NL 2OJEA 4ORZC 2GK2A 1N64L 5FM5M 4M6MH 4KDVA 5F3BA 5IMMA 2PR4L 4WO4B 3MROA 1OT1A 5D1ZA 1AGCA 2OXHA 1S78D 4CVZA 5K9KB 3VGAB 2VIRA 5J12B 3QCVH 4HIIA 2IAMA 1X5JA 4LDOB 4R7DA 3DYPA 3WFCL 4JAMB 1RZ7L 1NLBL 2ZG3A 5IGXL 2X4TB 1Q38A 3BZ4B 4G8IB 3I9GH 5M95B 3WE6A 4UINL 3PIQB 4JO1L 2KZWA 1FQ9C 3TO2A 1AXIB 4UQ3A 4YDJA 3WO3B 3MNZA 5E08L 2CDEB 2R0WH 3D2UA 1HHHB 4WEBH 1GGBH 3PGFL 5EB9A 1XAUA 2DQHL 1IAOB 4Y8AA 4YHLH 1HINH 4OGXL 4XTRD 1DBML 5DJAB 5CCKL 1MFDL 4P59H 1U8OA 4X6CB 4IRJB 5FKAA 1LEGA 2OP4H 3V2AR 2QKIB 5BCAA 5J11B 4U2ZA 2BHYA 2W9DH 3P9MA 1UH4A 3HE6A 2CGRL 5EU5A 5ECJE 3FQXB 2PO6A 1OSZA 3MNZB 1XR9B 1TZHB 2IBGA 4WV1B 5D1QB 2NXYD 4IOIB 1AE6L 1OOAA 2G5RA 3BXNB 1N26A 4WU7A 1N5YL 2GJ6E 3FRPG 4L1DA 2E5EA 3DROB 2H2SC 1S7TA 3G6JA 4HS3A 1Q72L 3EZ8A 4ONFH 4LSTH 5TE6H 5IVOA 2GFBA 4KWUA 4LLAA 4MNQA 5CD5D 1A7RL 3AROA 4RMUA 1P4BL 4YHMH 3Q6GH 2VDPH 2EDYA 4M7KH 4ETQB 4Q58C 1UWGH 5D6DC 3O3EA 4OGYL 3U7YL 1BZ9A 1YA5A 4GBXC 4G6FB 1CIDA 1EVUA 2X9WA 3RWGA 3RA7H 4JO4H 4NIKB 4D8PA 4PGEB 2DJSA 4NRZB 2A74B 3SHSA 4K2UH 5KANG 4G80B 4WI2A 4H0IA 1JWSB 1SVZA 4F3FB 3IKCA 4X4YB 3OR6B 4PP1C 1U8HA 2Z35A 2A9ML 1KPUA 3NCYS 5IVXB 1ZHKA 4H1LB 1JPTL 4OBSA 5JHDB 4X6BB 1HINL 3PQYA 2MKWA 1TZGL 3OAZH 1LQSR 3IDNB 2VWEE 2CH8A 4PRIE 5EUKA 2H1PL 4UDTA 3P0YH 4XVSH 4YC2C 4QRPA 3UCRA 4WGWB 4UDUA 4X83A 1Q9LA 1TLKA 1ZT1B 2YXMA 3HZVB 5FYKL 4PS4L 4ZODA 2GTZA 3CVHH 1F11A 2MJWA 1RURH 4N9OB 5TDOB 1DQMH 1T04B 2Q6WB 4PJAB 2I07A 3QQ3B 3FO9B 3CFEB 4KUCD 1S7XA 2NW2A 4EBQH 5IW1A 4K71C 1T0MA 4LRNH 1F00I 3QH3B 4KK9D 3VJ6A 1WEJH 1KCLA 3HZKB 3OG6B 3PWUA 4XCYA 1MI5E 3GSNB 3HZVA 3ZTNH 3V0WL 2AJ3A 2YK1H 3MREA 4YGVB 5CKAA 4EDWL 3ZE0E 2AJXH 1RK1A 2P8PB 1CLCA 3VRIA 5BV7L 3O2VL 3HG1B 4U6XA 3TJEL 1JI1A 4PJBB 4CVWA 5DUMH 3O4LA 4QTHB 3V6OA 1J1OL 4IOFC 4PB0H 1KTDA 3BRDA 3F12B 1VACA 3V79C 1IRAY 1EO8L 1JMXA 2H32A 3BE1H 2BDNL 5D6CA 5DK2B 1QYGH 2ADGA 5HDBE 2CO7B 5I1AA 3JWDH 5CJQH 1IM9D 1SJHB 4WUUE 2I9LA 2P42B 1SQ2N 4JFDE 5IM7A 5BV7C 3ABZA 5IB5A 2ZUYA 4Z0XB 8CGTA 4PJCF 5GZOC 1G7LB 3HCVB 4HD9A 4HC1H 4PRNB 1WAAE 5GS0D 1SM3H 3DVGA 4CMMB 3VGHA 3MGOB 3QUZB 1R24B 2EYSA 1HHJA 4G8GA 3LKQB 4LPWA 1O7SA 3M8OH 1G1YA 2Z93B 3TZVB 5D1XB 3C5SA 5DEGB 1FAIL 5LQBL 4XNMB 3ROOA 3S88H 3ZDXE 5TPWH 1L9NA 3WIIH 5T1DL 3NA9L 1EAPB 3E6FA 2JJUA 3C8HA 3KPLA 3GO1L 1WFTA 3LDBC 1JF6A 2VXTH 1U8IA 4QTHA 4QRTA 1W0YT 1H15A 1VEOA 1FZKB 3MV8E 1IQDB 1BJ1H 2PW1B 4G6JL 3KJ6H 1XEDA 5TF1H 4M8QA 5BV7B 4S0UC 3PWJA 1NMAL 2YZ1A 3ARFD 4YEEA 3OJMB 5EORL 3NA4A 3WS6C 1D5MB 3U30B 2DICA 1U8IB 5I1CH 4JFDD 4Z78A 3HAEG 3OKLA 4GUPB 1W0WA 1ZEAL 4ZG1A 5GIRB 4RFNB 2EDQA 1EJOL 5I18H 3ARGC 5EU3A 3VFNB 3GEWB 5C07B 2V2TB 3EOBB 1TPXB 1LGVA 2NTFA 2J12B 4TSCL 5EH1A 3VXRD 4R90H 1SY6H 5D6DA 4G8FB 3E6FB 3Q5OA 5D8JL 4NUJB 2ADJA 3JV4A 5F6IB 3P30H 5GZNC 5CJ5A 4BZ1H 2R2EA 1MFCH 1ZANH 5LXGL 2B1HH 2YUXA 2AJSL 4Z7VA 4YR6B 3R06B 4E41A 2GW5A 3G6JE 5JO5A 3ILPA 4X9IA 2WBJB 1I8IB 3MJ8B 1SEBB 3GMPB 4PJ5B 5IR1B 5T3ZL 2AXFA 1H9VA 2OM5A 4UV4L 5TE7L 5IM7B 1T3FA 4NO2A 4WWKA 3DX9B 3BGMA 2UWEF 2FIRT 4GRLB 4U6VL 2EKSA 4S1DD 1LP9F 3MV7B 1S5HA 2YRPA 4WVRA 4QF1A 4MJIE 5DURD 3L95A 3WFHA 1WCBB 1UENA 4HGKC 2K7QA 3WDIA 3OKNA 3UTPE 2HFFA 2V5MA 3FQNB 3ILQD 2NY2B 4NQDE 3DVIA 1TJIL 4QHMB 3SKMA 2CO6B 3WD5L 4KZEH 3L6FB 5FGBC 2C3GA 4LQFL 2BOBB 4AIZB 25C8H 3CFBA 2Q7YB 4WRLA 1X5AA 3OAYH 1FAIH 2GQHA 5IB3B 4M7LT 1IQDA 5IBTH 1CICB 1EBAA 5DVLA 1S9XB 2UUDH 3BEWA 4GW5A 1TETL 3JV6A 3OKMB 4PR5A 4PRIA 5ICXA 2WV3A 1UM5H 5CINH 5CEZH 1ZXQA 5DEZA 2D7NA 3DLQR 3MACL 1CE6A 5L0QC 4LHUA 3D85A 2UVFA 4YZFF 4QOKA 3GB7B 4ENED 4BSWA 1MCFA 4PJ9C 2R0ZL 3I50L 5GGTH 5SV4A 1YY9C 4OLXL 4BFEA 2Z8SA 3WEXA 2FWOB 5HJ3A 1TJGH 2X4NA 4KY1H 3TH3T 1EV2E 3CMOH 1UEYA 5IBLC 4M4RA 1P7KB 2XXCB 2BJMH 3T77B 1YC8A 4KFZC 3S5LB 2PW2B 4JHAH 2KPNA 4NP4H 5T3XE 1MH5B 1INQB 3K2UL 3UEZA 1F2XK 3GMQA 4XPFL 1UZ6E 5IV2A 4BUGA 4JZJB 2F5AL 4N90E 5DQJA 4Y0GA 1RQ5A 2P49B 4OLZH 4HFUH 1FSKC 4JE4B 2CRZA 4FP8H 1KG0A 4NFCA 5DSCA 4JY6A 3JWDC 4NQCB 5SWZA 2OJEB 1YEEH 3GSRB 1U3ZA 2FL5A 1Q72H 1MVFA 5DMYA 4YK4C 3I9GL 2IANA 3QBTB 4UT6H 4C57C 3SCMC 1YN6A 4HPYH 4EXPX 1MCDA 3BDXA 3QWOA 2EE3A 4WI4A 1MREH 4KHXH 3X14B 4X6DE 4XPBL 4X5WB 4IHOB 1JCKA 4F7CA 2HJLB 3P30L 4HUXA 4NN6B 2K9UA 2VTFA 5GJTL 1Z6JT 4G6ML 3T2NH 3LKSA 1JYWA 1WAAA 5F6HJ 3TYGH 2BVTA 4D9QE 2OTPA 1T66C 5J6GA 2EH8L 5C6TH 2BERA 1ZAGA 4HKJA 2OQJB 5ADPL 1AR2A 2V5TA 4LVOC 4OF5A 4PJGA 1AGBB 1IZJA 4YE4L 5AUMB 1TMCB 4IRJA 4MX7A 1NBZA 3IJSA 3QDGE 3KXFB 2Q20A 4YNYB 1MAKA 3V4VL 2A6JB 5CP7A 2EXWC 4JCMA 1FAKT 1RI8A 3HE6B 1D3CA 3BP6B 5CWSB 3ESVF 5CIPB 3UPCA 3VDBA 1MRCL 1I7RB 4K8RH 5HSFA 3QQNA 1LEGB 3GM0A 1HK6A 1NFDA 1AXTL 1P1ZB 4ELME 3HUJE 4P4RA 5DD5H 2XZQL 3QWQB 3EYFB 2YPLB 2QQKL 1VADA 1YECH 2DBLL 3VXPA 1YY8B 5HGHB 1A64A 2DN7A 3BH9A 2PXYA 1GZQB 4DK6A 3DNKA 3MODL 2ORBH 3ARQA 1MJ7H 2ADFH 4ONFL 3IJYA 5TE6L 4WFED 3V5DA 3LV3B 5I1GH 2CJUL 3CVHL 2EDLA 4AJ0A 1X44A 1AP2B 3QCTH 3AB0B 3HFML 4JY6B 1F4WH 1U8LA 2NY3D 4OFIA 1VFOA 5EWIL 1LK3L 3CSYA 4YC2B 1XIWC 3TV3H 1AO7B 2C3VB 3KNBB 1PX4A 3U7YH 4HKZB 3P4OB 4O9HH 4J4PD 1C16A 1F5WA 1CGYA 1OARL 1JV5A 3S4SA 4D9RD 4FQLH 5F9WB 1KJVB 4IRJC 5J11C 2NNAB 3MRMA 5MEOB 5EC1B 3MUGB 4KHTH 1S9YB 4ZPVA 3RQ3A 4LAJH 5GS2D 4FQHB 2XYCA 4JDZA 3PV6A 3EOTL 5AUMA 1CU4L 5IROA 2APWA 5D1XC 4Q9QH 3F58H 3EO0A 5HYFA 2HP4A 1KB5L 2MPAH 5CJXC 1QZ1A 1D5IH 1NUFA 1HNGA 4Y5XA 3MRNB 5FHAL 1RZFL 1QSZA 1MFEL 2N1KA 3VXOA 1V5JA 3DXAE 4DAGL 3BW9B 3JTTA 5HGAB 3E6HA 5D1QC 5A1AA 4RFOH 1CQKA 3K0WA 5D5MF 3QNYA 3IFPB 2CMRL 2XICA 2XZQH 3FHQA 3ILQC 3VI3F 3VH8G 2WP3O 1C16B 4X7TB 5DZLA 1TQCB 4IRZH 3TV3L 3ZYJA 1VHPA 3OF6D 4QTIH 4ZFOA 5CEYB 1U93B 3DO3A 3L3DB 2BFVH 5JOPD 4OBRA 3HG1E 1WVZA 1FNSL 3FJTA 4K7PH 3U83A 3D85D 1EFXB 4FZ8H 2R0WL 1ZVSB 5F1NB 3CAFA 3PGDB 4FQQB 2FEDC 4JB9L 4UINH 1FZJB 2V7HB 1LK3H 1U8KA 4PJAE 5T1LB 5L2KA 4I9WE 3FO0L 4U2YA 2E7LE 5FK9B 4NKMB 2VN4A 2DIBA 4NUGH 4WDIB 2MNUA 2IC2A 4PJFA 5C09D 4HUVA 4X9GA 5JLZA 4RMVA 1K9TA 4MVBC 4YFLI 4S2SB 4LP5A 4PYGA 5TGBA 3SDAB 1N2RA 3RVWD 1TZHA 4WV1A 2JELL 1RV6X 3HR5A 3GSVA 5FYKE 1WZKA 1IGFH 2BVPB 1U3JA 5DRXA 5IMOB 3O3DA 1MRDL 1UB6B 4JR9L 3CDCA 3UTQB 3OL2A 5MP6H 1QP1A 4XVJL 1JUFA 3WJLC 3MRQA 1C08B 4FQ2H 2Y07H 5TQ0H 3U1SL 2IH3B 3UTZB 4LU5H 3GMNB 5EO9A 5HHOA 1AQKH 4FTVE 5BRZA 3HC0A 2AQ3A 1A6AB 5INCB 1SVCP 4FA8A 3RUGE 1PG7H 1T83A 3LRSB 3M1BA 3QUMH 4P2OA 4AEIH 2XN9A 5DJYB 5F96H 3T0EA 4PJGE 1IJ9A 1XF5B 4RAUB 1T2XA 4U1HA 1T21B 1XCTA 3MV8B 4HWEL 3VWKC 3KPLB 2VWEC 4PJDE 3DX9A 3EUUA 1XR8A 5HI3D 4ODUA 1F6AA 3MCG1 4WFHD 2VDQL 4FQJL 1KUMA 3K2MC 1JIBA 3PL6C 4XNMA 3ROOB 5DMKB 5I18L 2D7PA 5T3ZE 1F6FB 2JB5L 4LSPL 5J9PB 5IB2B 3C09B 1PKQB 3B2VL 1LK2A 3BGAA 3VD3A 4F37F 5ENWA 5FYKU 3MFFA 1OM3L 2YBRA 3GMMB 5ALCH 2JB6B 2A6DB 3VFOB 1QSFE 5EBLB 3L3JB 5D1ZD 2R0ZH 4OCSL 5EOQL 4K94C 1AGFB 3WXWL 2QADD 1YMME 3EOAB 4FZ8L 5I1KL 5E56A 1G9MC 2PETA 2ESVD 4H26B 4K94H 3DMMC 4MJ5A 2Z92B 5BVPL 1VACB 2AXJA 4Z78B 1QNZL 3FO2B 3LKOB 5DC4B 1A22B 2Q87A 5C0EB 3BP4B 5F21B 5B8CA 4LHUB 3KHQA 4DVRH 3K8LA 3KPOB 2C3HA 3VRIB 3KYNB 3SE4C 1BHGA 4JKMA 1XR8B 2L4OA 1G6RH 2QL1A 3FFCA 5FKPB 3UTOA 2P24A 4DVBB 1FNEB 1DN0A 5D7IF 4HJ0C 1DE4B 4RIRA 4S0SD 1NC4B 2DQFA 1UQSB 1YEKL 2YD2A 4DKFH 3IF1B 3NAAL 5IB3A 5HGBB 4YXKH 4OM1L 1IARB 1U6AH 1SY6A 3C08H 3X12A 4PJ8A 3EYQC 1TVBA 2YK1L 1R3IL 4CAGA 3W9EB 1X7QB 5FKPA 5DJ8B 2G5BA 5C0IB 3MV9B 2HH0L 3ZE2F 1FFRA 5F1OB 4GKZA 1S7UA 3BEVA 3TBYB 2DQGL 4KQ4L 3DTXA 3MCLL 4JPIA 4KJPD 3IB4A 4O51A 4QY8B 2YD4A 4NQCA 5SWZB 3LN5B 3RHWK 4X9BA 3QUML 2GSGA 4DGYL 1J0HA 4FXGA 3S37H 4ZD3H 1XGTA 3MNWA 3RGVB 3EHBC 3VXSE 5A2JH 4TVPH 2Q8BL 5C0RL 1FO0L 2OZ4L 1T3FB 4JFXB 3ZE1F 2NZ9D 3GKWH 3TT1H 5I1DB 4FHBD 2AXFB 4PJ5A 5IR1A 2BSSB 1FO0A 4LRNL 4Z5RA 4TQEL 4W4OA 1K8IA 3MBED 1UCBL 2FD6L 2VDNH 5GGRY 3WLWC 2OR9H 5KSAB 5IESH 35C8L 4DW2H 1OF2A 1G7IA 1F4WL 5F7HA 1NGPH 3KPSD 4ZSOE 1HH6B 3U9PL 4I3RL 2J1KA 3O4OC 1B0GB 1DP0A 2PNDA 1ZT4B 1J0YA 2APVA 5GSRA 4QRSA 4ZOEA 4BFGA 1Q9OB 3ZT6A 2BSSA 2I60H 4TRPH 5K9OA 4LLUA 1MHEB 3QUYD 2CDGB 2C5DC 3SGKA 3QG7L 3C60B 4NNXB 4YHZL 1FG9C 4AH2A 2CLVA 3QWRD 5DO2D 1H5BC 4HUWB 3OXRA 2E7LA 3W5NA 4LF3A 5DVMA 4MNQD 5BOPA 2H8PB 4IMLB 2Z91B 4MXQD 5C2BL 2QQNH 5JW5B 1Z3GH 4Z9KB 3V4VH 2P5EA 4OZHA 1I7ZA 3QEQE 1VFMA 1ONQB 4A2MA 3QEQB 1OP9A 3ESUF 3FQUB 3O41B 2DKUA 4OCSH 2YMXL 1N3NB 3VXTA 3IU3B 5B8CC 2E7LC 5JW5A 1RZKL 3OKDA 2R4SL 2QSTA 5MEQA 4P46C 1KPVA 5TFSH 4QXWA 5JHLH 5DJXB 4X6CF 4JFPA 4F9PA 2BY3A 3MA9L 4WNQB 1YUHA 2FATL 4YWGH 1KIRA 5MEPA 2KL6A 4ELMF 4XMKH 3EBAA 3GGWA 5D96C 3D2UB 4YBQC 1DVFB 4PRHD 3R8BB 4P2CG 1KV3A 1ND0B 4BZ1L 3RAJH 5HVGB 3O6LH 2AXHA 3L7FA 3O6FB 4K9EH 4HWBH 3BYTA 2UY6A 5D71L 3F7VA 1MCCA 1CK0L 4HKBA 1NMBH 4BQ9A 4R3SA 5J89A 3B3IA 3EFDH 3BPLB 4N8VA 5GQBA 1X3DA 4YR6A 4ZOAA 5CZXD 1BOGA 4Z5RB 1GAFH 1T7WA 3A6CL 4L3AA 3U6RB 4IIQA 2BNQB 1D9KA 1FVDA 3MXVL 3QQ9C 3VA6A 4OFYD 4R0LA 5SWSE 4L3EB 4OD2B 5I9QB 3VFTA 2IALB 3H9HA 4PRAB 1UJTA 3OR7A 1T6VN 4XNXH 3I6GB 5DS8B 5T1LD 3U9UA 3N9GL 4Z7WA 4AM0B 4U0RC 3G5YB 1AIFA 1F3JB 1EO7A 2PTUA 2IFFL 4O51B 4QY8A 4YO0B 4RGNC 1QACA 4UB0H 1QSFA 1KIUA 1MFDH 3B9DA 4KGLA 3QIWC 1UFUA 2R9HD 1ZS8B 4UAOB 3A6BL 1JHTA 3GRWA 1FE8H 1FBIL 1X5ZA 4RDQF 2BVOA 5BZDA 3VFVA 1CXLA 5K9QI 3VFUA 2QKIA 1CVRA 3NCFB 5EBWA 3QO1A 1GZQA 1KFAH 4M1CD 4MA1B 5D5MA 2B0SH 2YPKA 3BPCB 1HOCB 1M6OA 3OPZL 1U95B 1BFOB 2CKBA 3BMWA 5E00B 3FN9A 3TO2B 4P9HH 4P2QD 3ZKQD 1RZFH 3ME0A 4JKLA 5D7LA 4QRPE 1F6LL 2W07A 4RQQA 5CFHA 1Q1JH 3AS1A 1A5FL 2X4QB 4KUZH 1OAQH 5I19L 2UY7A 1HOCA 3IDYC 5EA0L 3DV6A 4MS8C 5JXEA 2BNRE 3WKML 1AGCB 4KAQH 4X6CA 3STZB 4R2GC 3O6ML 1CD0A 2VZ3A 1DBAH 3NBNA 2C3WA 1IKFH 2UV3A 1J1OH 2ICWA 4GSDH 1JNHA 5DHVH 2G75B 4TVPE 3IAGC 5DFVC 5E94A 4V3EB 2BC4B 4F7CB 2JCCE 3C6LD 1M1SA 3S4SG 2VDQH 1PKOA 2VDRL 3I2CH 1YEFH 3ZTNL 5KS9E 5BJTA 3WUZA 1AO7A 2ID5A 3BWUC 2FLBT 4P4KA 4JJHA 3V4PL 3LH2H 2OCFD 2LU4A 2FX9H 5CGMA 1Q8MA 1PG7W 4GMSL 3UZEA 1XGRB 4PJDB 4G9FA 1AR1C 5IWLA 2HFGH 2GFBB 5GGSY 2C1PB 3QNYB 5EU6D 3PGDA 1FHGA 1WIPA 4HIJB 4K3DH 3QI9C 1JZ8A 3DUUB 3CFCH 3QRGH 4JHBA 5J57B 3AAZA 3FRPA 5D2LE 4IIQC 4JFDA 1RD6A 2EDRA 2WK2A 1DDHB 4WU7B 1DBJH 2H1PH 3IKKA 4HV8A 5DUPL 2IGFH 2MHAA 3S35L 3B2UC 5GGUA 2OTWB 5C1MB 3T0EB 1C8PA 5GGQL 1VPOL 5EULV 4DTGL 4HSQA 4LPYA 4P4RB 3RVUC 1G7JB 4HFUL 2F54B 1HI6B 1QFOA 5C6TL 3OX8A 1C08A 5KN5B 3SOBH 1DBBH 4FQHA 1ERNA 4PJIA 2P46B 1KXQE 2DBLH 3PG2A 3H42H 3PQYB 3BW9A 3JTTB 1YQVL 4A6YL 1L9MA 1U9KA 3MRMB 3QT2A 5DRXB 4P3CH 1B2WH 4I8DA 1J5OH 3GUTB 2X4OB 4P49A 1G0DA 4ZMAT 1U3HA 5IFAH 1U58B 4G8GD 3NFPB 4LCCA 3RP1A 1KEGL 3D1MC 4IBLT 4RRPG 5AYUL 4EZMA 5E99H 2P4AB 1YEIH 4TSAH 2W60A 4JQVC 3KVQA 3CSYB 4QO1A 3Q1SL 4PJFB 2DI8A 5I19H 2ENYA 4P46A 3VDCA 1YECL 4Z7OF 3MRGA 1U8LB 1V7NH 1FL5A 4X4ME 4X6EB 4TOYH 5EIIA 3WL9A 4JKKA 1T1YB 5IFHH 4LBEB 1T03H 3R1GH 2F53B 1UKTA 5JDJA 4TVPL 3QUXA 3S96B 4FNLH 5LBSL 1F42A 4EDXB 4MD0B 3TT1L 1FL5B 2GY5A 2ZSWB 1BGXL 4KRPD 4D0DB 4GRWB 5LAXB 2FX9L 3QIUB 4P5KA 3QFJB 5DHXB 4AENB 2DYPA 4H0HB 4JM2D 4ZO6A 3SDDD 3G9VA 4C56B 4RFNC 2ATKB 3FB6A 5ICYB 4FOMA 3HE7C 4CMHB 3RU8L 5CAYB 3FQRA 2X4UA 3PNWA 3DX6B 1R5VB 1K4DB 1LP9B 5E9DB 1AXSA 3C60C 3KPPA 5C0CE 5L0QB 4HK0A 3FQTB 1F8TH 1T6WA 1H3GA 4Y5XC 3VXUA 2F5BL 5EO1A 2ZSVA 4PFEA 3DETD 2RCSL 2CSPA 1CVSC 5IB1B 5MI0C 1NGWA 2JIXA 3MUY1 3N1GC 4UNVA 3X13A 4NHUE 4OZGE 4IDLA 2AJSH 3SBWC 5FO7A 3PWNA 1OARH 4ERSL 2DI9A 5C0AE 2P43B 5ICZB 3SDCA 3SE4A 1LILA 4Q9RH 1T1WB 4Q6IB 4HAGA 3GSNL 4KKLD 2JJSC 3BMVA 3IDJA 4TULH 1FORH 3BUYB 3BZFB 5JQ6L 2EEAA 1MCPH 4U6VH 3TBVA 5K59E 1TVDA 3CXHJ 2HA1A 4U49A 4AEFA 4UILL 1K3IA 3T0AA 4HH9A 5IOPB 1K4CA 4XMLH 3ZKXC 3HLAA 4ZUVA 2ZOLA 3T1WA 4J8RA 3QFDB 5IW3A 5F1IB 2MCPH 3ZYOA 1NGXA 1LEKB 1R3LB 4ODHH 3AMLA 1Y0LB 4Y7MA 1KJMB 1YEHL 4IRJD 3QDMD 4N0UB 2WUCL 1XGYL 2X5PA 3ZLQC 4WIQA 2PYEA 5C0DB 3AREA 4D2NA 4K7PY 3QDJD 2R56L 1YPZB 2H6PB 1LDSA 3VXQA 2WY3A 2EH7H 2UZYB 4LL9A 5JDSB 4N0YL 1JJUA 1I1AD 1LNUB 1C5CH 3HCVA 5TDPB 4QRUA 4CUCA 1DANT 5J13C 4PDCE 4HF5H 1JGEA 5HJ3B 4WWKD 2IADA 3QG7H 4YHZH 1E4JA 4XAWL 1A1OB 3G5ZB 3FZUD 1S5IL 1Q0XH 3TN0A 4AK1A 1NCWL 2WQ8A 4HXBH 3QYCA 1YNLL 3D39A 2WIIB 1INQA 3M07A 1J8KA 2OMNA 2VE6A 1K8DB 4XMPH 5CJBA 5C0CB 1E4WL 1F4AA 1KPVB 4PJCB 3BEWB 3KXFE 3QDGB 3MJGX 5INDA 3AY4A 3L3IB 5CJOH 2NW3B 2Y72A 5DMIL 4O02L 3ROLB 1E6JH 3X3FH 3IDUA 5F7WC 3D2UD 2AJ3B 3MLUL 4JG0L 5JHLL 4QRQA 1AQDA 5L88L 4LLWB 4U1SA 3W9EA 3HI5L 3J8F7 2MQ0A 3QFJE 4M8QB 4NN6C 4P57A 4LVHB 4HIEB 1QQDB 1BBJA 1SYVA 4FFYH 4NOFA 3P9WB 2XFXA 3ARZA 2HJLA 3L3IA 3PDOB 4HUNB 4ZOCA 2B4CL 2YSSB 1OCWH 1ZWIB 1ACYH 5J06A 4DVBA 4HUWA 3QIBC 2L7UA 4XGZB 5C0GB 5I75B 1WT5C 1QG3A 3KPRE 3ERYA 5F7LB 5HHVH 2Q3AA 4ZNEA 5HY9B 3L6FA 4PY8I 5ESVB 3QEGH 3LKOA 5GISL 1R24A 1LO0H 1T22A 2F5BH 1BBDH 3GM8A 3LN4A 3H9SB 3IAPA 4KPHL 5CUSH 3BSZL 1W8OA 4NZTL 3GBML 5HYJE 4HHAA 3CUPB 1DL7H 4I2XA 5MENE 5ISZB 5C0GA 4UIMA 3E3QA 4G8FA 1CFNA 4HCRA 4YHNB 1VSCA 2DBJA 4G5ZL 1OP5H 1JTPA 4NO2B 4XXCA 2A6IA 3W39A 2ITCB 2CLRA 4JQVA 3EFFA 5D6CB 4Q9RL 3QUMB 4I0KA 3Q5YA 3LQAL 3H9SA 5HHMA 5JW4N 2EDTA 2XNAA 32C2B 4HS8H 1KTKE 3CFKA 3B43A 4LP4A 1VGEL 5C9JB 4HZLA 3KPSE 4G7VH 1YDPB 5EBGA 1UM4H 1OVZA 1FCGA 3FQUA 5DJZB 4FQIH 4KQ4H 3TA3D 1CU4H 3C09C 1U91B 3T09A 3PWPD 1WUNT 1YNLH 3VFPB 3RDTD 4BQ8A 1BFOA 3DVNB 3HPJB 4WENB 1OB1A 5ERWB 2YXFA 5FCUH 3X3FL 1FNEA 3QG6A 2IF7A 1U6AL 2D7QA 4JHZA 4KRPC 3PL6D 4WTZG 2IWGA 2NXZD 3S35X 4Z7WF 3SO5A 1C5CL 3L7EB 4X9FA 1NLDH 4WI8A 4EUPG 5H35B 2PUQT 4WO4C 2GSIA 4XP5L 4BUHA 1FL6B 1UCTA 4PBXA 5BVJB 4FABL 6FABH 4XTRC 4LOUD 2PW1A 5B3JF 5KS9B 2HFFB 5JORA 1Q0XL 3QQ4B 5EFIB 5EORH 1D6EA 1MELA 4PJCA 4HS6B 1A6UH 2X9YA 1FVCB 3D3VD 1KULA 4NGHH 4U6HA 4XPHH 5E7BA 2NY5H 3DMMD 3W11D 2E8ZA 2FJGA 2R8SL 4NRYA 2H45A 2BNQA 1NDMA 3GSOB 3MX0A 4IIQB 4KTEL 1JGUH 5HHMD 1SY6L 1R0AH 3CVHA 4OFPA 1QLFA 1FVCA 1KB5A 2X4PB 4M6OH 1IT9L 2D7OA 3GSQB 5IMMB 1JHKH 1JPGA 4UZGA 1A6PA 2ZUQB 3KYKL 4GRWE 3ARYA 1MRFL 2P47B 4C56D 3SE3A 5AZ2L 5B39A 5FHAH 3WNMA 4G6KH 2VZTA 1DLHA 1TVHA 3TLRA 1KELL 3ZHDA 2HJKB 3QEUA 4QHLB 1RUPH 1FC1A 3J7HA 2EZ0C 4K7PX 5I1IL 3CDGB 3EYQD 4G7VL 3FL7A 1IL1A 1XGPA 3GSWA 3TJHA 1CF8L 4PJFE 1I9IL 4LDLB 4JO2L 3LPGA 5E2TH 3UYRL 1AFVL 3SKOB 3IDMB 1EHNA 3TIEA 3NABL 3GNMH 4LCCB 2HTLC 4UTBL 1GGIL 1IBGL 4F57H 5I1EL 4YIQB 3RTQC 4CDHA 4XCFH 3EO9H 3M45A 4EI5A 1TTFA 1FFNB 2E7MA 3SDYH 4OZHB 5HGGS 4G3YL 3NH7L 4N68A 5E7FA 1XH3A 2IG2L 3KXFA 2ICEB 4JQIH 3D3VA 3BKCL 3GSUA 1JGLH 1XIWB 3FO1B 3GMRB 4ZDHB 4WI3A 2H32H 4GAJL 4LCUB 4NWUL 4IMKC 3K8KA 5DUML 4X4YA 3TCLB 4NZRL 3MBEC 4X8XA 1WJ3A 3Q5TA 12E8L 2YD9A 1MEXH 3UJTL 1X5FA 3QFJA 1TNMA 5DFTA 1U42A 6CGTA 3T3PF 3T0EE 2IAMB 3H3KA 1KBGL 4U6YA 4PJ7F 4JFZH 1KEMH 3NPSC 4KTEH 1JPSH 4PJDA 3KLHD 3REWB 4OZFB 1CGWA 4PRPA 3IRZA 2V7NA 3INUH 5DK0B 5ETUB 2GT9A 3BIBX 1S9VA 1FORL 3BAEL 3H3BC 1G9ML 4NM4L 4XRCB 4J12A 2A74A 1J8HB 2DMKA 1N6VA 3K4ZA 3X11A 2GYSA 2FIKB 3N50A 2ZSWA 3UJJH 4K94L 3WN5B 1NBVH 3C8DA 5IHUH 5T33L 2NY4D 1I4FA 2EDHA 3L3HB 3UDWA 1QR4A 4AG4H 5DD5L 4YPGB 3MREB 5CBEA 4LDEB 3U4EA 2WQRA 1ZVHA 3FB7B 4GS7C 4NKQB 3WLWD 3OAYK 1HYSD 1HCVA 2VL4A 5FCSH 3SDCB 3B5TA 5GZOD 3CFEA 2YPVH 3B6SA 4NFDA 4LMQI 5E2WH 1F3DJ 3SJVA 4M1DH 5HHME 5GS0C 1S7TB 3G6JB 4M5ZH 3VFMB 3LKNB 4YFLF 4JQIL 1HHHA 3SE8L 5I1HH 1U58A 5ALBL 3ARFB 5EO1B 3GMRA 2X4OA 4Z0BH 4NCC2 4HV8B 1IT9H 1QFHA 3GMLB 1NQBA 1XZ0B 1SJVA 4GQ9L 1MCRA 2GJZB 3C5ZB 1NUNB 3SJVB 3MLZH 1ZTXL 3KGRA 2NNAA 3ALXA 4WDIA 4M5YL 5FA3A 3U7WH 4QEGA 4LLDA 4XPAL 1U8KB 5L2KB 3TF7A 3HE6C 3O9WC 3NTCH 3HMXA 5TDPA 2W0PA 4NQEB 4LSQH 1YZZA 2HFEB 4YPGA 3O8XB 1I1AB 2I25N 4UV7H 3KPRD 1ACZA 4MCYB 5I8OH 2E7CA 3L3HA 3IYLW 5F7MC 1GGCH 2QR0B 4WHTB 1ZHNA 4ZS6D 4HJJH 4XC3H 2OK0H 3DHMA 3H0TA 2HWZL 1R3LA 1LEKA 4X4XA 3UJIH 3AVEA 2XTLA 5E2VH 3LS5L 2R9HC 4RSVA 2J8UB 1OAXH 4MCYA 4CVZB 5BW7A 4U1NA 5K9KA 5JOFB 4DFIA 5IB2A 5FUCC 1N5AB 4FFVD 3ET9F 3LDBB 4KV5E 4RNRB 3BVNB 2XTJD 4W6YB 3OMZA 3WIHL 3MV7D 1WICA 1RZGB 4R4NC 2BNQE 4M1DL 2DKSA 1R6VA 4JO1H 2CR6A 1OT2A 4HS3B 3H42L 5H37H 1GC1H 3S8WA 1QPXA 1OHQA 1XF5A 2GK0A 1MQ8A 5HDOA 3EO1A 4IOIA 5TDNB 3T0VA 5F1SA 2Q8AL 4PJXB 1HZHL 2Z8WC 3V5HB 4NQXA 3PGCA 3O9WA 3PP3H 5FDWB 3OKKA 5AZEH 5J3HC 3WO4C 3ZDYE 1BD2B 1KCVH 4HEME 4P2RD 2XG4A 3CMGA 1JF1B 1IAIM 1NL0H 3V6BR 3EYSL 4W68A 5D7LD 4BZYA 1CFVL 1BJ1J 4QHUB 3ZDYF 4WFEE 5FOJA 5FYLD 1VFAA 3MXWL 1MHPH 4ZFFB 4M61B 3TO4B 4NQXB 4YBLB 2YR3A 2XKNB 1A7PH 2E6QA 1KNOA 4WHDA 4MA7L 3T1FA 2IPUK 3K46A 4M7LL 4P9MH 4KK8D 1MI5B 3KS0J 5GS2H 3PHQA 5F9OH 2FO4A 4F37K 3VCLB 5IW6A 1QO3B 2AK4D 3FT4B 2FD6H 1L6XA 4JPWH 1R3JB 4TUOA 4V2CB 2HWZH 3WS6A 1AR1D 2BOCA 1JZ7A 4NM8H 3I3DA 2WANA 2ICCA 4KV5F 4UOW0 2OL3A 4MS8D 1BQLH 1YMHB 5IG7B 1VEMA 1D6VH 1OLLA 3TN0C 1MPAH 2A83B 1P7QA 3RVVD 4H1LH 2BCKA 4C4KO 4ZSOB 2EKSB 5I73B 1D9KD 5LXGH 4KK9C 5D7KD 3ULUE 4CVUA 4QRRA 1H0DB 2BSED 2QJDA 2N7BA 5E4EB 4MQSB 5ESQB 5K9JH 1CL7L 1MCSA 4Y5YA 3WEXB 1HH9B 4HBCH 1KTDB 1A6WL 4EVNA 5E1AB 3FOMA 3UTTA 4LPTA 4IOFD 4U7SA 5LGHH 2DWDA 3ARBB 1ORQB 3PL6B 4P3DA 5IEKB 1RFDL 1F4XH 3T0DA 4BH7A 1NCUA 3UBXG 3RX7A 3D85B 1MY5A 4LGSB 3MV9E 5EU3B 2APBA 4X80H 1TZGH 2H8PA 3UMTA 1XF4B 3WNNA 2ZG2A 4Y4HB 1HEZA 1S7XB 2NW2B 2VJXA 1CWVA 4JLRA 3GFUA 2J88H 3OXRB 3UZQA 3CCHB 2I5YL 1NC4A 3V6OC 1INDH 2DQCL 1BF2A 3A67H 4ZO9A 3ZKMC 1RZ8B 3DVNA 1QRND 4EJ1C 1AHWA 3KJ4C 3RX5A 3VFPA 3B9VA 3NN8B 4QRQB 2YD1A 1F2QA 2NY1D 3FMGL 3UROR 1MPAL 3EYUL 4OIAA 4N5EA 1HH6A 4QNPF 4PY7A 3MOAL 1WWCA 5FYLH 4QRTB 2BY1A 4HKXA 4X7CC 4W4NA 3MV7A 4EVNB 2KH2B 2H3NB 1FL3A 1B90A 2AJZA 4JANA 1UACL 4ZUUA 3RY4A 1I1YA 2BNRA 3RDTA 2IAMD 2R69H 4PJ9A 1A47A 3C60A 3WFHB 4NRYB 4OCWL 3LKRA 3WJJC 3G5ZA 4F7PA 3GHEH 3HTLX 4CMMA 2OI9B 1MVUA 2FH6A 3B3IB 3NIDF 2VQUA 4UTAL 4LSSH 4GS7B 2VLMD 1LNUA 1MHHB 1YEGH 4G9DB 2CD0A 4KK6D 3ZHLA 5KS9A 4MWFB 4XNQB 2OTUA 4ZAKD 4PG9B 1D5ZA 4ISVB 3P77B 1IC5H 1P2CA 2VLJA 5C07A 3HC4L 1RFDH 7FABH 5D4QA 2VDML 5ADOL 4K7FB 1NCDL 1WLHA 2AJZB 3EDJA 4JANB 5IWLC 3EOBA 1JVKA 4BK4A 4G6JH 2ITDB 2D31B 4X0KB 4S1RL 5EFIA 1CFSA 1DQQA 5I1KH 4Y89A 1PAMA 1S7UB 1MFBL 1ADQA 4X6DA 4YIQA 5C0IA 3O4LE 3GO1H 3V6OE 4UNTA 2VITA 1JN6A 4MCZB 4U1GC 4XNYL 4ZFGH 3BP4A 5DQ9B 4LLWA 1IILE 4FTVB 1NCWH 2CUHA 3MYZA 3QI9B 3V7AE 1MNUH 1NGPL 3I85A 3L9RB 1JFQL 1URLA 2B1AH 3QG6B 1RZJC 1IGJA 3SN6N 2Z31C 1TCRA 5IFJB 5SWQB 1ZANL 2B7DT 2ARJA 2Q7NA 3CFJB 1MFEH 1X9QA 4YHPB 5B39B 1IGIL 4KJWC 5L7XL 4HMEA 3OG4B 2P5WE 4WW2F 4JAMA 1NPUA 1J8HD 3GMPA 1G9EA 4PP2A 4K3EH 1RK0B 5SX5H 4PV8A 4KU1A 5C9JA 4Z7UA 3RWJA 5B22A 1BZ7B 1I8LC 4LCYB 1KEGH 3VE0B 2DAVA 4OLEA 5F9WC 3MV8D 3VWJB 2ZZUT 2DQGH 3OB0K 4MNHB 2YD5A 4MDJB 4OCYH 4QYOA 5A43C 2WP3T 3T4AB 4DKEH 4L29A 3QHTC 4UIMB 3SOBL 1HSAB 1P4LB 4V3DB 4PV9B 3PWLB 4ZXBB 3FOLB 1D6EB 1RJCA 3D6GA 2E6JA 3MV9D 4Y4KB 1U8NB 3ARGD 2FWOA 4P23B 4YLQT 5EU6E 3ARRA 4F7EB 3LKPB 2ESVA 2ZP0T 5C70A 3QZWA 5DD3H 4BSWB 1TCMA 2VKWA 4L4TE 1DQML 5GRVL 1OWWA 1CDIA 2VRAA 4M62L 5HPMA 4X6DB 2X89D 3BPNC 5C0NC 2AGJH 4LU5L 5DGQA 5EU7E 1K85A 1KB9J 1CD8A 5DJ2A 3U7WL 1XMWA 1HKFA 4A6YH 4AZ8A 2AI0L 4FFVC 1U3HB 2W38A 5HPMB 5CD5C 2WNGA 4JM2A 4PBWD 3SDDA 4WW1B 3DI2B 3G08B 3TO4D 3C2AH 4LSTL 3MGTB 2J7LA 1KLGA 2QADB 4PJIB 5HTSA 3SCMD 4I1NB 3IXTA 3RTQA 2X7LB 1N6QH 5ILTH 2NY6C 3OB8A 5DI8B 3TCXA 1GGCL 4YHKH 1OQXA 3ULSB 5ITBH 1WBXB 2ARWA 1A2YA 2VLLB 3I75B 5KSUA 1IAII 4OGZA 3F62A 3B2VH 2BY0A 1P4LA 3GSVB 1LO2L 3DBXA 4JFFA 5HBBA 1L0XA 3W2DL 4YHIB 5LBSH 3AS2A 4PRHE 5KJRH 1I8KB 5FA4B 3DURA 1OTSC 2BVYA 4LPVA 3RNQB 4O4YH 4JRYE 1EVTC 3BP5A 3K1DA 3C5JB 5J6HB 5E95B 2QSQA 5D1ZB 2HVJA 1T5WB 5T1DH 3QDJA 5F9OL 3BKYL 1JZ5A 1SYSB 2C1OB 1KC5L 1UA6H 1QD0A 3NCCB 4PJ9D 4J6RL 2NY6B 3A6CH 1F13A 3SGDI 3QEQD 4IRSA 1KTLA 1FZOA 2IBBA 3WXVL 3K74B 3EO9L 3ZKND 2QR0A 4WHTA 2JJWA 1JNNL 4JQXA 1NJ9B 1I1RA 3RWFA 3RGVD 3EYFA 5SWSD 3RPKA 3CVIH 3HB3D 1QOKA 1QYGL 5DMJB 4ZO7A 1I9IH 3CDYA 5D1QA 3TYGL 1ADQH 4UDUB 3HUJB 1NDGA 3GNML 5KVEL 5DRWB 2X1XR 15C8L 3BHBB 3C5ZA 3U4AA 3HA0A 3TESA 2AI0H 5HYSG 1PW3A 3TFKD 3ZT5A 2FEEL 3EDKA 4UBDC 1B0WA 5T1MA 5IVXA 4X7EC 5FUCE 1I1CA 1ZGLA 2VO5A 2XOTA 1G7JA 2JJVA 3CU7A 2HKFL 4CKVX 4JG1L 2NY1B 2CJUH 4GKSA 2AJYH 4HH8A 3G5XB 5E6IA 1MFAH 5HHOE 1RZIA 1BLNA 4WW2A 2CIKA 1X6LA 3C60D 1PY9A 1X5XA 2FYYB 1A21A 5FK9A 1KTLB 5DUPH 4QNPE 5MERA 5DA4A 3VFOA 5D72L 1YJDH 1J1XH 3RKPA 1B0RA 4OT1L 4LCCC 1OL0A 1F02I 3QUXB 1VEPA 3UO1H 2YEZA 4OGAD 5CEZE 1LO4L 5JPNA 4NDMB 5I16B 1M7XA 1UZ8B 3PWPA 4MNQE 2H32B 2Q8BH 2F58L 3T2QA 1BWMA 4AENA 3EYUH 1I1AA 3ZO0A 3BKYH 3WUWB 5AYQA 2O26U 4KKLC 5AWNH 5HI5D 3O4LB 3OTTA 4LKXA 3EJYD 2VXVH 5JXED 2VDNL 5IQ7H 1FDLH 3CPLB 4KMLB 3AMKA 3IFPA 3S96A 2MFNA 2NY5C 3F8UB 2DDQL 4ODWA 1KB5H 4J4PA 1CR9H 4N0CD 1N0XH 4JZNA 3F7QA 5C0AB 3SDAC 4X6EA 2KDGA 4WFGD 4LLDB 4DQOL 5HYJB 4NHUB 2I60L 4Z77B 3L3GB 2ERJC 2HJFA 2Q6WA 3MZGB 4NC0B 1T04A 3O2DL 3G5XA 4Y1AE 5E6IB 4FQXA 2XWJA 4OV5A 3ZE1E 3WIHA 4OCLC 2JIXB 2ESVE 4OZGF 4EIZC 1NGQL 3ARGB 3HRPA 4RGNB 2HT2D 1NCNA 2DTML 4I4WB 3K3QA 5IF0A 4M6NH 1RIVL 3VXSD 4QLRA 1CTOA 3OKOA 4R90L 3L5JA 4AG4L 3FFCE 4OQTH 3DRTB 4PRDA 3RBSA 5HYSA 3TBTB 5FO9B 4J4PC 4OJFL 4YDLB 1G6RA 1Q94B 3OX8B 4LLYA 3NZHH 2X4UB 2Z35B 5IEHA 1DQLH 4S10A 2XZCL 3RVWC 2GCYB 3O6FD 4RMWA 4QHKJ 3AU1B 3WUWA 4NPYB 4U1NB 2BMKB 2O5XH 4U1LB 1Y6KR 5I76A 5F1NA 5IFHL 1KOAA 5KS9F 2H26B 2CLVB 4OCRH 3HMWH 5D7IE 5CCKH 2JCCF 2OLDA 1NGZA 4MD4B 4ZQKA 4ODTL 1IAMA 2F53E 3UTSA 3LEVH 3LQAH 1YEIL 1Z9LA 2BMKA 4WI6A 4FXKA 3C6LA 5FM8A 2FX7H 3TPUE 5GRYA 2DLHA 2EDEA 1KT2A 3MO1B 4K8RD 1J1PH 3MJ8A 4XPGH 4HQQH 5DJ6A 2E7HA 4PJ5E 4CVXA 2BHZA 5BZWB 3M17B 3QNXB 1M05B 1BLNB 3BDYH 4N5ED 3DJ9A 4O5LH 1OGTB 3VW3L 3FN0H 1MJUH 3NVQA 35C8H 4DW2L 3SPVA 3GIZH 5F9JB 4L4VA 1HQ4A 3D0LB 2R23B 4U3HA 4HFWA 2A0LC 4RAHA 5D93B 5JHDE 5CEZL 2HLFD 3U1SH 4D0BA 2CKNA 5BS0B 1KGCD 3L9RA 1RIVH 4CGTA 3HKFA 2DDQH 4LVEA 5I71C 2Y6SD 2F54E 4Z76A 2CLZA 3TJHC 4XCNB 4OM0H 1A1NB 2VDLL 5I75C 1UXWA 3OKKB 1NAKL 4ZFZB 4KZDL 1CE6B 4WFHE 5IIEA 2O5XL 1I7TA 1AD0A 4NT6B 4OTXL 1AJ7H 4M6AA 3WIFA 1DQLL 5C0BE 1FZKA 1I7ZB 2LAAA 2HMIC 2YWYA 1OB1B 5ERWA 2Q1EA 3D18B 3NABH 5BO1L 4N0RA 4N8CL 4MNGA 4G42A 2ZKHL 2VE6B 3D3VE 3I2CL 2Q7YA 3SDXB 3FB5B 4NHCH 3ZKNC 4QT5A 1MJJB 3P9LB 4F9LC 2LV4A 2EDKA 1UYWL 4G43A 5DT1H 2XKUA 5C0ND 5DD0L 4JFOA 1A1OA 1BJ8A 1DANU 3H3PH 1NMCB 2D3VA 5JUEL 1RAMA 1BZ7A 1LDPH 4U05A 1NGQH 1KJ2B 3SGDH 2W0FB 3TBWA 3VW3H 2UYLB 3QIWB 4UUJA 1FH5H 1YY9D 1RHFA 3B2UD 5DLMH 1JHLH 3V5DB 4ODBD 2ADJB 3JV4B 1L8JA 2W9EH 4U33A 1JWUA 1H5BA 3IDGB 1T66D 1CFNB 4YHNA 1EERB 4HX1B 4Z7VE 5IBLD 5ANME 5ISZA 2OSLB 4LKCB 5HHXL 3R0NA 4FFWD 4HS6A 1AGDA 3QUZD 4I18A 2FJGB 2R4RH 2Z0BA 2BNRB 3DWTA 5IHBA 1I8IA 2NY6D 4NM8L 2DQEL 1VPOH 4WUKL 5C09E 3PWPE 3MRCA 1U3HC 3RGVA 5JW3H 1WSST 4I9WD 5F6IC 3LN5A 3WIIL 2HN7A 1S7WA 4LSRH 4PP2B 3DSFL 3IU3A 3GIZL 3MGTA 1H3PH 1CFQB 4GAYB 4H8WC 4XX1E 1IEHA 4QHNB 5LGJB 3BAEH 4PJXE 1IM9A 4WW1A 5H8DA 4OFKA 4GT7A 4PR5B 2VLKE 2R0KL 4MAUH 4F9LA 4JG0H 4LNRA 1U95A 2Z91A 5TE4L 4H25B 2FJHA 2O61B 1KBGH 1U41A 4UMGA 4GOSA 2XI9A 3IFNL 1ITCA 3EIFA 3CFBB 5EZOH 5ID1B 1IC7H 3MCKA 2J8UE 1UWXK 3Q1SH 4FQLL 1U91A 5E5UB 5D7SH 3NCYP 2LU3A 1OAZL 3QDJB 1S7WB 4XHQA 1D7FA 4B50A 3FOLA 3OKEA 4JM2C 5CMAB 3SDDC 1RHHA 1RJZA 2AEIT 4LIQL 1FFOA 4K55A 3SGKC 1N59B 4LSSL 3CX2A 1KEML 4GKNA 2GT9B 4KKBD 5DMGC 3REVB 4PJ9B 1SEBA 5GS3A 3HNTL 4M8VA 1D5ZB 3F7YB 4RA0C 3IDGA 5GSRB 1WT5A 4M7JH 1X4ZA 4R97B 4ONHB 4ZNCD 4QRRD 2GTWA 3Q2CA 3DYOA 5D70H 1FV1A 4XCEA 2AJYL 3O8XC 3DTXB 2HG5B 3FHAA 2WW8A 3BN9C 3DVFA 1MIMH 4GXUM 2YPVL 2VDOL 1ND0A 5GHWH 3CXHK 4CJ0A 3MCKB 1T2QH 4Y2OA 3IETB 2ZG1A 3IGAA 5GSVA 3FB5A 1HXMB 1YUHB 4LCUA 4YGAB 1RUKL 1BM3H 2DLFL 3MRJB 4CADA 1EBPA 3QI9A 4KZEL 1RJZB 3FT3B 2IANE 4YAQB 4KJYB 3QNZB 3ETBF 2EICA 2H2PC 3A6OA 5T5NG 3O41A 5FGCE 2ZWLT 2GJ6B 4L1HA 4EN3D 4PJXF 2FHCA 1RULL 2HYMA 4NO0B 4Y5VA 5DEFB 4GG6A 1ZHLB 4HLJA 2ADIA 4U1IB 4LPUA 1DEEA 3SY0A 1RVFH 5GS0H 3P4MB 2R39A 4BZ2H 3QZWB 1RZJH 5JHDA 3LN9A 4OCNC 4MHHI 5DJ0B 1IL1B 2GUOB 4ZUTB 3BPLC 4RGMB 4PD4K 5L8JB 1YEDB 1NFIA 4P3WA 2F54A 3L5IA 4R4BB 1CZ8H 3ARED 1CK0H 3NTCL 5FO8B 1OW0A 1L7TH 4MJ6A 3H9SD 2FEDD 1DLFH 1J1XL 1ZSDA 1S8DA 4HGMA 2OTWA 1FYTE 1T7YA 1S7QB 1OAXL 3QA3A 5JW3L 2R2BB 3MLSH 3BZ4A 1YEEL 1BQHG 4XC3L 3C9NB 4LLVA 5GRXG 4RGOL 1MQKL 4M1CC 3G5VB 1BVKA 4JO2H 3TVMA 3RWHA 4JGJA 1RZGA 1NBYA 4Q0XH 4FMFA 4JZJC 1MREL 3KYMB 3DUHA 4EUPA 2E6PA 4D0CA 2EDDA 2EYRA 3P4OA 1VGKA 4C56A 1VKXA 4L8DB 2CKBL 4CL7A 3RJDA 1DCLA 4JZOB 2FO4B 4OUOA 4OZHE 1GSMA 2WBKA 3KJ4B 1MJ8L 1IGIH 1P84K 1SHMA 3A6BH 3BXNA 4ZS7L 3DX8A 5E6ID 4LFHD 3QO0B 3L3DA 2AW2A 4HXAH 1E6OL 4YBQD 3BUYA 4JJ5A 2AV1A 3OPZH 2AK1L 4PJHE 4PLJC 5HVFB 5C0CD 2B0SL 4CN1A 4JHAL 4LLMB 1GIGL 2J8UF 3WV0A 1T0MB 4XBEH 5CGYC 5FA3B 1FCCA 4P9HL 3S3PA 1MF2H 3MXWH 5FFLA 1G6RB 2XV6B 3V6FB 2EDFA 5F7YC 2DRUA 4EI5D 4PLOB 3E6HB 1T1WA 2GEEA 1I85C 1C12B 1SEQH 5KZCD 1T2JA 1TXKA 4OLUH 4QXUH 1OLZA 2DWEB 5I6XC 4G3YH 2ZNXA 1KNOB 1XR9A 4JHWH 4PJXA 3S36X 4OM0L 4JRXD 3BKJH 5IBUB 1EHLH 5DHYA 3LZFL 4E41E 5CIPA 5E4EC 4F7MA 3O3BB 3MTRA 2O5ZH 2ZSVB 3HS0A 4F33B 1K5NA 4GW4B 5SWSA 1YYLH 3BESR 4W4OC 1U8HB 5D2NB 5C0AA 1LO2H 2IG2H 4Y19D 4KTDH 1WTGT 5IB5B 3SDYL 3O0RH 2ATKA 3MQIA 2I9LB 4FMKA 4BQBA 2B39A 3BKCH 5GPRA 1IE5A 3RL2B 1KJMA 5J3HD 4NZJA 5FGCB 1ETZB 1MIEH 1KN2L 5DMIH 4PTUB 4Y4FB 3RZCB 4LVNB 5HHVL 4NPYA 3AM8C 1P9MC 4S11A 1LQVA 4KQ3H 3EW3B 3BP7A 5D5ME 4XNUH 4NQDD 3I3EA 3WFEL 4FQQA 4XT1C 4U6YB 3UTPD 1EGJL 4S1SL 5B4MD 2AEQH 4KXZI 4LFHG 5C0BB 1R3HB 4MJID 2DM2A 3MRGB 4U6TA 2YSSA 5I9QC 4KVNH 4H20H 2YWZA 3PWNB 4OGXH 4XI5D 1TJIH 4GKSB 1OSZB 1RZKH 3DSFH 4P57B 2WBWB 3BKML 4RMQA 4HJGA 5DVKA 3UTZA 4BSJA 4DGIH 2AKRB 2QADC 1T1XA 1TZIB 3W9DB 5C0JB 1B4JH 2Y36L 5GGVH 4MSWB 2VZOA 2Z9TA 3GUTA 5IMKA 3TN0D 4CW1B 4Z76B 5I6XB 4E0RB 3WHE0 2R0LL 5BS0A 5E8PB 5SX4H 5E24E 3QCVL 5CUSL 3IRPX 1WIUA 3BHBA 1TETH 4ODWB 4POZD 3BISA 3S5LG 5C6PB 4MZ2A 3LMJL 2CXKA 3QUZC 3VXRE 3S37L 1KPUB 4LQ1A 1ES0B 4LSRL 5ESAB 4HJGB 3BN9D 3VMOA 1OAUH 4TRPL 3WSQL 4M93B 1LO3L 4EN3B 4ZFOL 1MFBH 2XWJB 4OV5B 5CSGA 5BRZE 4ODSH 1UKSA 4XB8A 3L3GA 1E28A 3RUGA 1W72L 4M3KB 4OCXH 1Z0MA 4D8PB 5JNYB 3DSNA 2XY1A 5D8JH 2I9TB 3KHOA 1A14L 3WLBA 1R3HA 4XNXL 2OK0L 2QTEA 5F9DC 4QHMA 3SKMB 5C08A 4HIHA 5DZOA 2BNRD 2ZCHH 5HDQH 4MJ4A 2MQCA 1KCRL 1AKJD 1HQRA 3C6SA 2R4SH 1HSBB 3O2DA 1TFHA 4J8RB 4DGVL 1IGCH 1I9RL 1D5BB 4UT9H 4OLZL 2M1KA 4NWTH 3FT2B 4W70A 2F74B 4AMKH 2GKIA 2GCYA 3T04D 4RX4A 1NMCC 5D2NA 4LAQH 2NZ9C 4JVUA 4M6OL 3VI3E 1WAAF 3IU4H 5CZKA 3ARFC 5MENA 4DOHE 3GBLA 1TJHL 1UM5L 1X5YA 4PJ7E 1FN4B 1QSEB 3MLYL 2K1MA 3MRIB 4ELMA 4NUJA 1XGQA 2PXYC 3V8CA 4XB7A 1MWAL 4NGHL 2F9BT 5C0FA 3N1FC 4K23L 4KKBC 1KIPB 4HULB 1EFQA 1DVFA 2ZCLL 5EU6A 1IC4H 3L1OL 4KROC 4PJ8B 1GC1L 1OTTC 2YN5A 1C5DA 3CH1B 1G0YR 1MLBA 2P8LB 3NGBB 5GS1A 3BZEB 1PSKL 1OAKH 1ZA6A 3VD9A 1GCFA 4X6DF 3U0PA 1QPPA 3JV6B 4TUKL 3MLVH 3O8XD 5MEQB 2N7AA 5DO2C 4LNRB 4MLIA 1XIWD 4RISH 4FQJH 1SBBA 4ODSL 4ZAKC 4OI9A 1R5VA 1CIUA 4LEOB 3WSQH 1X4YA 3GK8H 4WU5B 2VH5L 2P5EB 5C3LD 1GHFH 4HKJB 1AIFB 1F3JA 3DUSA 3GJEA 3LSOB 2LFGA 2F74A 4JRXE 1NCBL 2X4PA 3TJEH 3MRPB 3T0EC 5HI5C 3S88L 1CDYA 5IK3B 2V17L 4IHOA 3ES6A 4RDQG 5E8NB 4YXHL 3IGAB 3TT3H 1J87A 3C5SB 3AFLA 3NMEA 5HHNA 4H1LG 1JWUB 1TJHH 3T3ME 1ZT4A 1EA9C 3SDAD 3D87B 3UYOD 4CNIB 1Z0NA 3C8KA 4J1UB 4JFFE 4P5MB 1KYOK 4M00A 3OHXB 2NY5L 5E8OA 1BOGB 1M4KA 5DD6B 1FGVH 1BPVA 5IVZB 1G0XA 4FRWA 3RVTD 4TVSa 4WV1C 3PWVA 5KJRL 3DPBA 1SJHA 3QHZH 1O7VA 4HWEH 4KZDH 2W0KA 3EDEA 2NYYD 4X7DC 3MLYH 3P9LA 4HF5L 5IT2H 4P0DA 2XQYG 5I8EA 5D7LB 3E3QC 5LGHL 3SKNB 3MRBB 1FL3B 2XTJB 1MUJB 1UWEH 3SDCD 3TWCL 4S1DC 1N3NA 3VXTB 3L5HA 1II4E 4QHKI 4XMPL 3S7GA 3NIGE 4EI5B 1E4WH 3O9WD 5KZCB 4PP8C 1CXHA 5B3JE 4KMQA 5EOQH 1N6UA 3PV7A 5GXBB 5TPWL 4I0CC 4Y5VB 5DEFA 1FH5L 2BXYA 1A7NH 3UC0L 5GS1C 4J23A 2FJHB 3QUMA 3F6IA 3L5XL 5JZ7C 4QHLA 4ZXBA 4G7YH 2UWEE 4F15B 1IQWL 3IETA 1YN6B 2HKHH 1FYHB 5C6WH 1P4IH 1KENL 3MJ6A 4NNXA 2D7TL 3V4PH 5DWUH 3MLRH 3VXRA 2VLRD 4R4ND 4Z6AT 5K9OB 2FBOJ 3U6RA 4U0RB 4LVHC 5F7KC 1BF8A 3VDAA 4RWYL 2EIZB 3LN4B 4ONHA 2ESVB 1XCQA 2BSTA 1U36A 3MRCB 2VXQH 3ECBB 5IB4B 4OUUB 1GHFL 1ZHBA 4PV8B 3BPOC 3G04B 4HKBB 4G8EA 5I1JL 3U2SA 4KROB 4UV7L 2VQ1B 3VXRB 2GTWB 1GPOH 2CLRB 5GGVY 5FA4A 2RHEA 3BYYA 1IGYB 2PTTB 4JQXC 4JFFB 1YYLL 5C08E 3WJJA 3T4AA 4Z7NF 1RHHB 1P7KA 4JB9H 1IGJB 2CK0L 3B9KC 3MLPA 3U2SB 5F7UA 4LNVA 4RBPK 1JWMA 1OGAE 2FX8H 5DJXA 4L8CA 3IXTB 1U2HA 5E08H 3KG5A 3STLA 4E5XA 3N1QC 5FCUL 3CVIL 4F7MB 3GIVB 3DYMA 5I17B 2VITB 4HMDA 2HRLA 4MNQB 4U1IA 4H5SA 3WFDL 2GI7A 2AXGB 5JW4Q 1G1CA 3HC3L 1PY4A 2GJ6A 2Z8RA 3HI1B 4YX2L 1OTSD 5D2LB 4R96A 2CMRH 3QJFB 2EKJA 5D7SL 1YMMD 3QPQC 3KPRA 1T5XB 1XGPB 2NY2D 3GSWB 4NNPH 5D5MB 1A1MA 4K7FA 1CYGA 5AD0A 2DMCA 1CFTA 4KDTC 1EEZA 1WEJL 3FQWB 1KCVL 1S78C 3F6LA 1T20A 4BK5A 2A9NH 1ED3B 4HUKB 1KENH 2YZ8A 4F7EA 2HLFC 5FYKH 2PKDA 1IQWH 2YA2A 2VISA 2NY3C 3NIGF 4NFBA 3MUGA 4LCWB 1P6FA 2EC9T 5HD8C 1H3XA 4LPCA 2DOCA 1HYRC 3CVHB 5CGTA 3S3JA 4L29B 5FYJL 4ZTOH 3PIQA 4EOWH 4M93C 2X6MA 3JSSA 2VQ1A 5GRWA 1V7NL 2FX8L 4MD5A 2VL5A 4MYWB 4P2YA 1RUAH 3QIUA 4JRXA 3HLAB 3RU8H 3TFKC 4B0MM 4WO4A 1OAUL 5IKCA 3W0WB 1DSFL 1N8ZA 4AQOA 1NKOA 4GRLD 1KJ3H 2N4IA 4Y88A 4V1DD 3IDXH 5L2JA 4PB9H 4ETQA 2N56A 3B9KB 2PYEB 5C0DA 1OP5K 1X6NA 3UTSE 2P1YA 5MHSE 3BO8B 1H8SA 1MRCH 4K8RL 5I2IB 2BK8A 1MIML 3H0TB 4JRWA 3UAJD 5AZ2H 3IFOA 5ICZA 1AQKL 5FECA 5JW4M 1R5WA 3QXUA 1I1FA 4PLKC 1HILB 2R1XA 4DEPB 1F11B 1AGEB 2KUTA 5BRZB 1JGDA 4NN7C 5F44A 5D2LA 2NZIA 2XN9B 5DJYA 3UTSD 3VXUB 3AS3A 4XPBH 1FPTL 3MNVB 1G6VK 2NY7H 4KK5C 2FB4L 2QHLA 5HGAA 2R29H 3HC3H 4MXWH 3PQYE 4CW1A 1CZ8L 3MRQB 2YA0A 2X4SA 1DFBL 3ARFA 3S3SA 1RZJL 1W8NA 4RGOH 4D9LL 5F8QC 1OTUC 3I6KA 3RNKB 4PJIE 4PTTA 3MLSL 1NJ9A 4XPGL 4NRZA 5TGBB 3P0VL 1DLFL 1XGUB 2IBZY 4WWKC 2P45B 4PRNA 1J86A 5C0BA 2OMBA 1JNNH 4MD0A 1ZEAH 4FXKB 1CE1H 4TNVK 3IFLH 3P11L 4UI2A 2HTLD 4YPJA 4MNGE 1FO0H 4LCIL 1KGCE 3BP7B 3VGGA 4WI9A 4P23D 4I77H 5ESQA 4YXHH 4W6WB 5A2LH 1UJ3C 2CGRH 5C7XH 2I9TA 1CBVH 4XH2B 5H2BB 5LWYH 1RMFH 2W9DL 1MSPA 4FXLA 2H26A 1FVEA 5CEYA 1UM4L 1DQJB 4D0DA 1J18A 2ORBL 5DD0H 3RWEA 2XRAH 3U9PH 5JW4R 4WEBL 2DQEH 5B38G 4N1EA 4JFHE 5JZ7D 3CLEH 4PJ8D 1TITA 3DRQA 4HPOH 1VFAB 1X7QA 5HYSB 4PBVC 4AMKL 1CGXA 3X12B 3LRHA 1F3RB 2CLZB 1B2WL 2ZUWA 3AREC 4Z7OE 4MSWA 1GIGH 1MWAH 1OGAD 3DGGA 4PPTA 4U31A 5FO7B 4PTTB 2W0LA 1AKJA 1HEZB 4Y5YC 5A2KH 25C8L 3ARGA 4G9FD 3O9WB 2EXYC 5E8DH 4NYLA 3FZUC 4FABH 6FABL 4FQXB 1OP3H 3PXJA 4BKLA 4PRIB 4Z7NE 4ZS7H 3RWCB 3CLFH 1A4JB 1ZTXH 4U1GB 3SGJC 5GGTA 3HRZA 5EU4B 3S34L 3V6ZB 2RJMA 4EEEA 4N8CH 4E0RA 3LZFH 4H1LA 2QSCL 1HH9A 4I5BA 4CVXB 4HG4J 5DJ6B 4L5FL 5C0JA 5TE4H 1RUQL 4BYHA 3V9FA 3MLTB 3QEHA 1ZLSL 1PBYA 2VDKH 1JK8B 2G60H 1K6QL 4XCCH 4CNIA 4HUMB 3DIFB 4RMTA 3VXQB 4JFEB 4KJQC 1YYMH 2J8UA 4YHML 1G7MB 1X5IA 4GO6B 1J10A 3L3KB 1QRKA 3SE3C 4Q6YA 5F97E 2JB6A 2Z31B 3ARDD 3MRRB 4RWYH 1I7UB 4HZAA 4KDTA 3TBSB 3RAJL 1QHOA 1A0QL 5D2NC 4XH2A 5H2BA 1E27B 4HH9B 3QAZB 5ITFB 2VSCA 2XKSA 3ZZ1A 3TWCH 3N85L 3S36L 4XMKL 1X5LA 4XBPA 4XP1H 5JO5B 2DLIA 2FGWL 3DMMB 1E28B 1W72B 2ZUXA 4KVNL 4R3SB 1CCZA 3U4BH 3MRRA 3MXVH 1RIUL 3UO1L 4MA3B 4R2GD 4LGRB 4M62H 3D18A 4KVCH 1EUUA 4XWOD 5C08D 5ESAA 3RIAF 5I8CB 2XXMB 3OQ3B 1CGTA 2ARJB 4WCYH 3A0OA 3LRSA 1IM3A 4FFZL 5F1KC 3CH1A 5L7XH 5CKGA 2F19H 2QQNL 2FJFB 4X6CE 4O2FA 2DM4A 4JFPB 1YN7A 3NCJH 2NX5A 1U8MA 2VLJD 4U7KA 1LE5B 3U0TB 4ESKA 1CDGA 12E8H 4DN4L 3VH8B 3BWAA 1K6QH 4XCCL 3EHBD 1A9EB 3L7EA 4P2OD 3P4LA 3P73A 4OZIA 3O11B 1T7ZA 2MTPA 1QEWA 1VDGA 4P9ML 1IM3B 3CC5B 4XMLL 5F7EL 5GGRA 1QSFB 3LEXB 5TFSL 5HHOD 4HC1L 4A2LA 5BXFB 4M48H 3SCMB 2ZJSH 1FE8L 1CFSB 1DQQB 1UM6H 2VDKL 1WIOA 3X14A 3D0VB 1MHPL 1HNFA 2XN9D 1S9XA 4U4BA 5FYJU 1QVOA 4DK3A 3BN3B 4L5FH 1YEJH 1A0QH 2J5LB 2RFXB 4M3JA 4N0YH 4AH2B 1JZ6A 1VFBB 5CJQL 4X5XB 5EC2A 1LEIB 1QBLH 2Y06L 1QFPA 4IJ3C 3UYRH 1AO7D 2WAHA 1I9RH 3BE1L 3JVGA 3P77A 4NNPL 1NEUA 3U79A 3HHRB 4OZ4A 5EZLB 4O00A 1NFDF 4F8QA 3FQNA 5DK3A 1XFPA 4NSKA 1I7UA 3GSRA 3MPCA 2YUVA 1INEL 4KTYA 4ORGA 3PXHA 2A6IB 3W39B 3O2VH 4HLZG 5KSAA 4KJPC 4JFEE 2VDLH 2EXWD 2XZCH 2HT4C 4GMTL 4NQVB 5EZIL 4OKVB 4PB0L 3R8QA 2VDOH 4WWKB 1JNHB 1DBMH 2EEDA 5I1DA 4GG8A 4OCXL 1J0JA 5B3NA 5IHZA 2DM7A 5MEPB 4GXVH 1P9MA 4U6HB 1F4HA 2CXGA 2BSRA 2EDXA 1UVQA 3T08A 4JDTH 8FABB 2H3NA 5TF0A 4LPXA 2XQYK 4POZC 1RPQA 2NY0C 1GOHA 1CLZH 1D5IL 1LHZA 2X4QA 3OF6A 4WCYL 3IJSB 3L7FB 5SWZE 3NIDE 5EBMB 5CD3B 5DJ8A 5CSZB 4JRYD 3BPOB 1SEQL 2DD8L 4LLQB 3E8UH 4XPTH 2XZAH 2W9LA 3U82B 2EDJA 4UT7H 1A1MB 2X1PA 3EOYG 2EZ0D 2VAAA 2ICEA 3N85H 2VXTL 1XH3B 4WHYH 3AY4C 1NANH 1JN6B 4MCZA 5LG1A 4PGCA 2DM3A 3WFZA 4OM1H 3ARPA 5HYQA 2IGFL 5CSZA 1ZHLA 2VZSA 2AJVL 1A6VH 5CILH 4G9FB 1CFQA 4R97C 4PJ8C 3ULUC 1G7IB 3IDMA 1FRGL 4IMLA 4YHOL 1RUMH 1UWGL 4PV9A 32C2A 3RVXD 1J5OL 5J6HA 1FPTH 1FG2A 3RIFK 1I9JH 1A7RH 1VKXB 1QTYT 4X7SH 3FMGH 4PB9L 4O02H 3KR3H 2CDGA 4QF1B 5DK0A 3WS3A 1GZPA 3BO8A 1DSFH 4GRLA 4Y4KC 1TVHB 1CLYL 2PW2A 1IGYA 4XNQA 4LIQE 3ULUL 3CUPA 1IMHC 4G9DA 4L4TD 3L3OB 4BQCA 1FDLL 1WBXA 2A38A 1FLRL 1RSFA 5C0RH 5EPMB 2X4NB 3ZKMD 4G5ZH 4NQSB 4HUUB 4OIBA 4Z95H 1BX2A 2G2RA 2VMFA 4JRYA 1QBBA 2BXZA 5IT2L 2VL5B 2ICWI 4NBXB 2Z31D 3DV6B 3OV6A 4JN2B 3WS3B 3REVA 3FQWA 3P0YL 5FO8A 4M5ZL 1LEIA 4WTZA 4E9LA 4Z8FL 2B2XH 3ZDZF 4YHPA 1N59A 4YHYC 3TVMC 1EPFA 3FONA 1JYNA 1P7QD 1NEZA 2DIJA 3DOSA 4ZFGL 3BKJL 3QRFM 4JR9H 5D72H 4Q6IC 5F7DB 5C9KA 4YXLL 3CFIC 4QXGL 2W1NA 5ABDE 4PJGB 2JTDA 4S1RH 3O3UN 2CIIA 2FGZA 4FS0A 3ARBC 2P5WD 1NC2A 4OD1L 4WGVB 2YD3A 1C5BH 4P3CL 2EC9U 4PJFF 1UZ6F 5GGSB 1IAKB 2AAVA 5C8JB 3BX7C 4APQB 4RA3A 3TP4A 1UEMA 1C7TA 2E8YA 4DGIL 2PYEE 4KKNA 4DWHA 4P2RB 4MQ7A 1A7OH 1I3VA 2CDEA 3MRFB 3Q3GB 4DCQB 2IPKA 2DQUH 4OZIE 3MLZL 43CAA 3VFTB 4EKXA 5FF6A 4NQSA 1FLRH 2BVQA 3JTSA 5EOCL 5EZOL 2CRIA 5DSCB