5D7IE

Structure of human mr1-ac-6-fp in complex with human mait m33.64 tcr
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
200
structure length
200
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVMDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 200
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7iE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7iE02
1S8DA 1CYGA 3P0YL 4P9MH 4GRLB 3VRIA 2NXYC 4IMLA 3TYFA 5K59E 1JGUH 1ZHBB 4JR9H 2OL3L 4YXKL 4ACPA 4OI8A 3D39E 4U6HA 1PKQB 3JBG7 4PGZA 2DLIA 1VPOL 3VFRB 4KVCH 2QHRH 4FFZL 4Z0XB 3IB4A 1F6FB 1A14L 2M2DA 3MV9B 5D96B 2XOTA 1TZHB 5L8JB 4PJEB 3WFCL 1A4JB 4HGMA 1C1EL 1ZGLM 1MCPH 1XGRB 4ZFGH 1RURL 3W9EB 4HDIB 5CKGA 4PFEA 1FAKT 1JNNL 1RHFA 3T0DA 2BRQA 5GGTA 4Y5YB 3JTTB 4M93B 3VMOA 3D48R 2HFGL 4JFYA 2G9HB 4MD4B 1CT8A 4FHBD 2EC8A 3NABH 3O6ML 2UUDK 1IM9D 4OLWL 1A7PL 5D72L 1TQCB 4YHPA 4GLRH 4NZTH 1Y0LB 4HBQA 1JZ6A 1FG2A 1S7VB 3G08B 2HWZH 2PW2A 2C3VA 1AHWB 1NBYB 1JUFB 5JHLL 1MCLA 4DTGL 1AH1A 3ROOA 5T33H 3E2HB 3ROLB 1S7SA 4LCWB 2UY7A 4X0KA 4FTVB 4UINH 5I1CL 1CICD 2JB5L 4PLOB 4F7TA 2NPLX 1NC4A 1FCGA 1GSMA 3DTXB 3KYKH 4ZUWB 2EH8H 5EU6A 2VDRL 4FQHB 4OKVA 2VZOA 1U93A 4KC3B 1IT9L 2HVJB 4RNRB 4P59H 1GL4B 5TH2B 4X6DA 4AEIL 2R39A 5C2UB 5JNYA 3VXTA 3BQUB 43C9A 3D18A 1NL0H 2WUCH 5GSRA 3RNQA 1VFOA 4GH7B 4OCWL 1SY6A 5EU5B 2X4PA 3J8F7 1JTPA 1D5IH 5E6YA 2FIRT 4MMZC 4J23A 4Y5VA 2CPCA 5F88B 4P46D 4NQCD 1FRGL 2Q86A 1XF4A 4KK8D 3KPQB 3ZYOA 1EGJA 1RJYB 2Y6SC 3CFBA 3BRDA 1JRHI 4XAKD 5EU6E 5FGCB 2G2RB 5IVXB 1IKNC 4GAYA 2KQNA 4GG8A 1WEJL 3LS4H 1Z0MA 3ULVH 4JM4L 4Z6AT 2Z93B 5GRWA 4AT6B 2NY3B 4XMLH 5DD3L 4X6DE 4YDVB 2X70A 4I3GA 2N4IA 1BQLH 1MHCA 4Z78B 3PWVB 3NCMA 3HMWH 3N06B 1F4YH 2Q20A 4IOFC 4NKMB 5HYJB 1YEDB 2Q7NA 4XTRD 1L7IL 4M6MH 2JK5A 4W6XB 5CEXB 5EU3A 3O11A 4GG6F 1ADQH 1YMHA 5DD5H 3S34H 5C9JA 2Q8AH 4J3XA 4KJQD 3VXUD 2YRPA 4ZFFA 2VUYA 1CG9A 4DVRL 2HG5B 1FVEB 5IWLC 2OS7A 4POUB 1I85C 3ULVD 3ZL4H 2ICWI 3LB6C 1AGBB 4NO0D 4P5TC 4XP6L 1AJ7H 3SKJL 3TT3L 4FNLL 3KPOA 3CVHA 3KPMA 4Z7QF 3VG9C 2HLFD 2Z91B 2DRUA 3SJVD 5E5MB 4OV5A 3EJYC 4S1RL 1SJEA 2IANB 3TFKC 1DDHA 3QHZH 1CICA 1MCEA 3GMRB 3H7BA 3QIWD 2CDFA 3ARGC 3Q6FB 4E41B 3NAAH 1QLRB 5I1JL 2DQIH 5EUOA 5BZWA 1QPXA 1CD8A 5E00B 1WWWX 1DQQB 1K4DB 4BSVB 3RGVC 3QDGB 1BD2A 3BD3A 1PSKH 3GSXB 1JHKH 1U42A 3BZFB 5CZVH 1TNNA 1G0YR 2BY1A 1SYSB 5ICXA 1J1PH 2OP4H 5H35B 3T0WA 3NGBC 5BQ7A 1UQSA 1EBPA 1AI1H 2HRPH 5GXBB 3EJZD 1KN2H 3C9NB 5IB2B 4OZHA 1XGUB 2HTLC 4GRLC 3KLAB 5DJ8A 4NQCA 2AEWA 4XVJL 1T2QL 5FXCH 3DXAD 1IAMA 4L4TD 3ME0A 2H9GB 3D0LA 1YJDL 5EZIL 3QWOB 3BKYH 5EUOE 5HDQH 3WXVL 1JI1A 1HDMA 5C92A 5BOPA 3CFKB 2UZIH 3HAEH 1F58H 5EZJB 1YY8B 1ZWIA 3U9PL 4KGJA 1A1MB 1HINH 4MJID 4UBDD 2AEPL 5F7MC 4ZO6A 3ULUF 3BN9D 2Y36L 2F8VA 1E4JA 1P7QD 1GGCH 3DVNB 2FH8A 1EH9A 4OD1H 4DN4L 5C0AD 4CNIA 1AXTL 1M71B 1ZANH 2J7LA 1QBML 5BV7H 4LNRB 5IW1A 4GS7C 5FV2A 5EUKB 1DQLL 5CHNB 2J8UF 5D7IA 25C8L 5AD0B 4Q9BA 4MNGA 4OZHE 4LLVB 4GW5B 3VXUA 1ED3A 1QYGL 5T3ZH 1KENL 4NQCE 1TQCC 4IDLA 1I1YA 3L5WA 1KB5B 1LK2A 1C7SA 2GEEA 4NC1E 3VDAA 4XAKE 4U3XA 4YIQB 4HIEB 4L3CB 1RU9H 2HLAB 5DC0A 5CEYA 3JXAA 1NAKL 4M43L 1AHWC 5I15L 4W4NA 3RX7A 2FO4B 4W81A 1ZXQA 3C08H 4UT7H 3SJVA 1PYWA 3E2HC 3QIUD 4MA8H 3C5JB 2X4NB 4L8DA 2CKBH 3LKQA 4KWUA 4XPTL 3CXHJ 1C5DA 1KC5H 1PQZB 3KYAA 4RAVB 2IADB 4DOHB 1EMTH 1MLCA 2ID5A 4JGJA 1UWXK 4BSWB 1A6AA 1QPPA 3DO7B 5T3ZD 5HYQB 1RUMH 3B43A 3U9UA 1UM6L 4ZS7H 4HGKC 1KNOA 3QISA 2WQRA 4ONGL 1RZFL 4MAUL 3MRKA 4OM1H 4MNGE 4UV4L 3VXUE 3K2UL 3OKLB 2B4CC 5LKNA 2DQDH 2ARWA 2GK0A 2QQQA 3BQUC 3N85H 3ULVE 1H3XA 5DJXB 2YS4A 1CLZH 1WQVT 5GS1A 5IM7A 3D87B 3S3JA 3SJVE 2MQ3A 4CDGC 1N7ML 1QR1B 2ICWB 4AIOA 5F6IC 2HYMA 5JA9A 2BXYA 2E6JA 4GFTB 4EIZC 4PY8I 5L0QB 4JHAH 3RBSA 4JE4B 1N0LA 1GGTA 1HHHB 4M4PA 1CR9H 1ACYL 2BC4A 3JV6A 3LPGA 1O7VA 2B1HL 4KUZL 1CFTB 2Y07H 4JPIB 4IRJD 5AZ2H 5B4MC 4PRAA 5D70L 5I1IL 3QEQA 3CJJA 1OM3H 2XZQL 3HZVB 5BVJB 3QEHB 3DX7A 1KJMA 1BZ9A 4U6XB 3O3BA 4UIMB 4LHQB 1F42A 2AK1H 4MJ5A 1P7QA 3ILQD 4X7EC 5EBGA 3DBXB 3N1PC 4P5MB 1X4XA 1VEPA 5C0GB 1CQKA 1SM3L 3O9WD 4WV1A 3JWDC 2QKIB 3NACH 4MAYD 5IQ9B 1C8PA 1EDQA 4ODVL 1XGQA 5I1DA 3DXAE 1UZ8A 1XIWC 4L4TE 3HAEA 5IKCA 2GI7A 4PJAA 3VG0H 4LIQE 3ZKXB 4NQDD 3VFMB 4J3SA 4JPKL 1G9MH 2RFXB 4U3CA 1KPVB 1QNZL 4GAGL 3C8KA 1BM3H 2CLZB 3BKCH 3QEQE 3UTSB 2D7OA 5D7LD 1SEBB 3QEUB 1ZA3B 3IF1B 3PHQB 3OJDB 5C0AE 2OX5A 5CUSH 4N8CH 4XNUH 4QRUA 5H37G 1G7HA 4JDTH 2BHYA 2JJSC 5DD6B 1H8OA 4XPHL 4HW6A 2ZUQB 5IW6A 5LGJA 4HIHB 3MLXL 1CLYL 1XF5A 4JM2D 5IROC 4M6NL 4DW2H 5B3JF 2EDLA 1EVTC 2NW2B 1T1ZA 4JGUA 4PJAE 1BF8A 4TRPH 2HJFA 5DRNA 4M02A 1YEIL 4DKFH 4XC1H 3VD9A 2EYRA 3VFOB 1Z9LA 4D9RD 4OZGB 1WFNA 5F44A 3TPUB 3PP4L 1NKRA 4XC3H 1QOKA 2IMMA 5IJVA 5ALBH 5EU4A 2A9NL 1NMCC 1ZHNA 3ARSA 3UTTA 5T3ZE 5CBEB 3MMEB 4XCEB 4AZ8A 1JBJA 1NH6A 4BFIB 4QNPE 1KCRL 4IRJA 1ZVSB 1IAKA 2BHZA 1J88A 3O3AA 1CDIA 5EPMA 3UXFA 5F1NB 2VE6A 3QFDB 4LPWA 4FXLA 3WO3B 1G6RA 4LLQA 3TBTB 3GMMB 2H26A 4IRSC 1M4KA 4QHKJ 4QOKB 2EIZB 3RUGF 2OMNA 3EHBD 5M95B 5MEOB 2NY6B 2D03H 3D3VD 3GZKA 1U8OB 3PQYA 1LP9B 4PRDB 3O9WA 2P8PB 3MYJB 1FNEB 1O5DT 3DX9B 5IQ7L 2OTWB 4Z7WB 4U05A 2FLRT 4PJ5D 5I1AA 4X9GA 1YECL 4IMKC 4RZCB 4XAWL 5ESQA 1R3JB 3FQRA 4KI1A 4NQDA 4XH2A 1LVEA 3BYYA 4FQ1H 3BW9A 3AS0A 4KKCD 4X8XA 4LSSH 5FO8B 3G5YB 1VADB 3FZUD 2GIYA 3FO9A 4MQ7B 5A40E 2GFBA 2QR0A 4RGOL 4AK1A 5DRXA 4YBLC 5E2TH 2CO7B 4CJ0A 1L6ZA 1YEEL 4HJ0C 2AQ2A 3GSOA 4G43A 1HHIA 3MNWB 4X6EB 1F4WH 3BEWA 3BP5A 3E6HB 5DF0A 4WFGD 1J8KA 3LV3A 2V2XA 2BSED 3N9GL 1KTLA 5LQBH 1MNUL 2Q8BL 4OFYD 2E8YA 3C2AH 1JHTB 1LEIA 2EH7L 3MLUL 4ZS6D 3K1KC 5IV2A 4NQDE 1IM9B 4NKOB 4G6KL 4OSUH 2WINA 2A6DB 1JNHB 1M7XA 4OBRA 4PTTB 3MRBA 3JV0A 2NXZB 2R56H 2EDBA 5I16B 2R4RH 3U0PA 4OLXL 4PJ9B 3OKDB 3VXMB 4W70A 4P57A 3FB8A 5EOCL 4LCCC 2FECL 3KPPB 1AGEB 1CZ8H 5I1EL 1N8ZA 2HT4C 1J1OL 1I9IH 4NKQB 5IJKC 4OUUB 1ZS8B 4OFVA 4KQ4L 2G5RA 2DQFB 3HI5H 2CKNA 1YEHL 1NJ9A 5DMIL 5IBLC 3A6BL 3FO2A 4D9RE 2VXVL 5D93B 3D3VA 3CGTA 5GRJH 3MLRH 4N9OB 3CMOL 1AD0B 5I19H 4ONFH 5I1HL 1CGVA 5H2BA 4ZNEA 4J8RA 1Q8MA 3QDMB 1NFDE 2FATH 5DEZA 4NP4L 5LG1A 4G6JH 4PJ5A 3ZKXC 1AXIB 5IFJA 5CBAA 4NQVA 5FUOL 2H6PB 4C4KT 1BX2A 3PNWB 5I8OL 5TE6L 3M1BB 4G9DB 4B41A 3TH2T 1YNKL 5FK9A 4U2YA 2V2WB 1MFBH 4AEEA 1AFVH 1Z9MA 3BSZH 2W9LA 3WIFB 1E6OL 3HRZB 1KOAA 4JZJB 1OAQH 1YQVH 1AGDA 2O5YH 5IHZB 5IP4A 4HX1A 4P2RD 1JNJA 3GRWH 3D3VE 3AY4C 4I4WA 4PLNC 2ZUQC 4LGPB 4JDVB 3VWJD 4MSWA 2EEBA 4DAGH 1T1XA 4ZTPL 4GW4B 2BP3A 2GSIB 4U4BA 4PJ5E 5IEHA 5B38A 3ULUL 2GCYA 4HIJA 3DUUB 5K9KB 4K7PX 1KLUA 5EOTA 4U3HA 5KBNC 4NO0B 2AV1A 2HT2C 3HHRB 1KT2B 2YK1H 1MCJA 3DX6B 4E0RA 3T0EC 3GM0A 2W9DH 1G9NH 3IFLH 4XXDB 2EKSA 3MRLA 5BOZG 3SGEI 3QZWB 3ZTNL 4UT9L 3LRSA 4RDQG 3TT1H 1CGTA 1EJOH 5DD0H 5J1TC 4K8RL 3OAZH 3TO4D 4OJFH 3HMXL 3QIWB 1P4IH 1BPVA 3O2VH 2A77H 4XNMB 7FABL 1W0WA 3W9DB 5FKPB 4OIBA 3ESVF 3RIAK 3V5DA 2P5WB 4GRWH 4R7NA 4K7PH 5E8PA 5BO1H 4M8VA 1PAMA 1I85A 1IC4H 1GIGH 2X5PA 1HXYB 1TJHL 4Y8AA 3SEPA 1DBJL 2FEDC 3DRTB 3AU1A 4P5TA 4QY8B 2AEQH 1NLDL 1HZHL 1JWMB 3H9YA 1MAKA 5EN2B 4IOIA 5C7XH 1YN7B 4LLWB 4QHLA 4XWOC 4BZ1H 1GC1H 2MHAA 4M4RA 1T2JA 1EPFA 4MDJB 3MYZA 3DXAB 4MLIA 4U6VH 4L4TB 3PDDA 1MFNA 1Q38A 1I7UA 3QUKB 4O51B 5IMOA 1QEWA 3HZMB 1KTDB 3WDHA 3ARGA 1IARB 2RCSH 3OGCB 3T77A 3VI3E 3GMOA 1VFAA 2ED9A 2R0ZL 2PO6D 1R5IA 4JHWL 2XRAL 4MJIB 3U7WH 5K33A 1N0XL 1A9EA 1A0QH 3HFML 5AUMB 1W2KT 5GGRB 1B9ZA 3BRFA 4ALAL 4LEOB 4YXHL 4P2RA 5D2NA 5C0AB 5B39G 4NM8H 3QULA 3HG1D 1MELA 2I24N 4H20H 5IMMB 1P4BL 3GK8L 3VWJA 3QO1A 5JQ6H 1BVZA 5JW3L 2VDOL 3QRFM 4AEHH 1EX0A 4HJGA 5FF6B 1E4XH 3I50L 5K59F 3BGMB 3WFHB 3HI1B 1LO4L 5A2LH 1Q0XH 3MNZA 3PGFH 2OXHA 3N50A 2HA1A 4LPCA 1IGCH 4LCYA 5AZEH 1RZKC 1YUHA 2NXZC 3QIUB 3VFRA 4AJ0A 1FQ9C 1JMXA 5BV7B 3MV9A 3MOAL 1QO3A 4PJ9C 4U7MA 4U1KB 3TJEH 2DJ4A 1BOGB 1CXIA 4P2RE 1DZBA 3QXUA 2KZ1B 5D2NE 3FRUA 3QWRD 2JIXD 4HDIA 4LKCA 1C7TA 3FT2B 2C1PB 2FRGP 3BPCA 3TZVD 4JPWH 4D0DB 1GGIL 2CH8A 3JTTA 4OCRL 5BMFH 3GI9H 4KDTC 4I77H 2YD6A 3WXWH 4F7EA 1UYWL 2DKSA 2BXZA 3OR7B 4O2CB 3ELAT 1DBAL 1JGLH 4HK3J 4I48A 1Y6MR 2FD6H 3LKNB 5GJSH 3LDBC 2CKBB 2CK0L 4YDJB 1RJCA 1MVUB 2A1WL 1DUZA 1QFUH 4LHJB 1FFOA 3VMPA 2R1WB 4GSDL 1H3GA 2WUBL 4Z95H 1I4FB 1NBYA 1QP1A 1FZJB 4X6CE 2DQHL 4R0LA 1G7QB 2XZCL 3NMEA 3O4OB 4FTVA 5F7UA 2AABL 1MRCH 1T3FA 1VGKB 3VXPB 1ORSB 1I8IA 4HS8H 2R0WH 2NNAA 1NCCL 1G6VK 5CGTA 4LHUD 4U6YB 2GSGA 3TP4A 4FQHA 1MQ8A 2XICA 1EFXD 4NZRH 2Y25A 4MA1B 4XCNA 2PN5A 3F5WB 2V7HA 4F7MB 5A3ID 5DURD 2VDLH 4DGIH 5JW5B 3CX5K 4XPAH 3ALXA 5F9OL 1T5WB 5ANMB 3RVXC 2VIRA 3EO0B 3VFUB 4H5SA 3HG1A 4PB9L 3D85B 1A47A 5HSFA 2FX7L 3L3JB 1G7IB 1TIUA 4MAYB 3Q3GB 1CGSL 4X7TB 5C0EA 3PWPB 2CLRA 2AVGA 4PJBB 3EYFB 5I8KL 3PIQA 3QUXB 4HWZA 1RJYA 3MV8D 3IDUA 4MB4A 1NUFA 4HUUB 1A1NA 4HZLA 3KYMB 2ICEB 1MRDL 5D7LB 4HWEH 1QACA 2AJSH 4OLUH 3IDNB 4XHJC 2ICES 1WTGT 1UCTA 3OKEA 4X6DF 4YDVA 15C8L 1GHFH 1NGQH 4DVBA 5CJ5A 4MXVE 4YH6A 2AGJL 5GRUH 3ULSB 3CH8A 3HG1E 1OP5K 1INEL 1F90H 1MPAL 5CEXA 4WRLA 3TZVA 2YD2A 1L0XA 3GBMH 5ITFB 3ZTJH 1HHGB 1FZKB 2HG5A 4OF7A 1OD9A 4JM2B 3LIZH 1IZJA 2EO9A 2WW8A 2YBRA 4JN1H 4LSQL 5DC9B 3IGAB 4LKXB 1REIA 1XIWA 4O58L 2IF7A 1OF2A 4KZDH 3HB3D 5DYOB 3FONB 3X17A 1LNUB 1MJ7L 4NKIL 3T65B 2AW2A 2IANA 1ZT7B 1IEAB 3DROB 4GKZA 5F7YC 5GHWL 3UPRA 1NFDB 2X41A 5KN5A 4XBPB 3Q6FA 2BY3A 3JWOC 3MRJA 2NY5H 2XN9B 4LHUA 4YK4B 3H2WA 2XFXB 4PJFA 4JRYD 4BKLA 4DK3A 1RULH 4J4PD 3AM8A 1EFXA 1FL5B 2EZ0C 1EO8L 4ISVB 2JJSA 5DQ9A 3BZFA 4E5XA 4YBHA 5FYKL 1JYXA 5IFHH 3QB7C 1SYSA 4LQFL 2ZKHH 3X14B 5H35A 3I6LD 2P8LA 3MPCA 1F4XL 3H0TA 1D9KD 4U2ZA 3ABZA 2NY7H 4G8GA 4N90E 3EDEA 2YRLA 4WHDA 4FQQA 4EN3B 2FGWL 2VDQH 5I66B 4QHMB 5TDNB 4YC2B 1HSAA 5HVGB 3X12A 5H8DA 5EUOF 4AY0A 3RPKA 1C12A 2DJUA 2JB6A 4PJFE 5KANI 1VESA 2NX5B 4HFUH 1KYOJ 1EEZA 3MODL 1IGJB 2EDXA 5HGDB 3CXDH 3VA2C 3MBXH 1ODAA 4TSCH 4WO4D 2WP3T 4MD5B 1JHLH 4KKBD 4WDIB 3U7AA 1M71A 2R0LH 4IRSA 2DWEB 4OLYH 1U41A 3DGGA 3WLWC 1HEZB 3OTTA 3SDAB 4OZHF 4XBEL 2IQ9L 2BVPB 4LLVA 2EC9U 1RJZA 4PRPA 4CVXB 3ARED 4ZAKB 3TCLB 1S9VB 1LO5A 1INDH 1T83A 3DI2B 2EXYD 4Q0XL 3KPTA 4DZ8B 1KJVB 2N7BA 3BH8A 4L5FH 5TQ0L 1WCBB 4RX4D 5DK0B 3UJJH 5FA4B 2VAAB 3GJFA 3CSYB 3VU2A 5EFIA 1CD1A 1P7KB 1I8MB 2A38A 2XYCA 2YPLA 4PLKC 1A6ZB 1PQZA 3EZ8A 5HTSA 2IADA 4N68A 1RQ5A 1ZLWK 3H7LA 4JG0L 4EUPG 5KG9A 4C56D 2UY6A 3OG6B 4MA1C 2XWBB 2OZ4A 4NQUA 4JRYA 1NKOA 1YN6A 2EECA 2C26A 4J4PA 1L9NA 2V7NB 1QVOB 4GW1A 4JLRB 1TJGL 1QFOA 5CEZH 3CAFA 1YDPB 5DQJA 5KS9A 5EC2B 1G0XA 3MUGB 2NY1B 4PJIA 5IHUL 3K8LA 2WWMC 4HIIA 1I7RA 1M6OB 2ICWA 3V95A 3HNTH 1RY7B 4MCZA 2YPLE 5TGBB 4K7FA 3MZTA 1MIEL 1QHOA 1EXUB 3BUTA 3QUXC 1WSST 2Y06H 2UYLB 1V05A 5D8JH 4B50A 3W39B 4PG2C 2Z4QA 4JPIA 4JRYE 5CEZD 3H42H 2ZSWB 2YMXH 5L88H 1N64H 4LCCA 1UCBH 1S7TB 1V7NL 4CVZB 5IJKA 2EE3A 1W72A 5KS9E 3I6LE 4H1LG 1FZOB 3RA7L 5J9PA 5FYJH 4PRBB 1C16B 5MEQA 1BFVL 4RFEB 1IGIH 5FHAH 3WDIA 4H26B 3AREA 1WBZA 4MJ2A 4G6FB 5EU7C 4NN6B 1JZ8A 2XKNA 2I9LB 4TOYL 5DXWA 1JV5B 5DA0B 4PREA 4WTXA 4KHXL 3V6FA 1CU4L 1ZV5A 5EZLB 4OI9A 1S7UB 3GSQB 4RX4A 5CP3A 1DJSA 4NQSB 5EB9A 3GUTB 1UB5B 3QH3A 5FYJD 5GJTH 3ARFB 5JZ7C 1P5VA 2LAAA 1ZA3A 1ZEAL 3PHQA 1RUAH 1OOAA 4D0CB 2R23A 3MRMA 3S37L 4N8PA 1B90A 1UACH 3WFEL 3WIHH 3ZKNC 2HFFA 4C56A 3S5LB 1OARH 1QFWL 4FXKA 1NPUA 4I0PD 3BX7C 3IDXH 3MLWH 4MA3B 2FEEI 1N6QL 3UYRL 5ICYB 2FX9L 1B6DA 1CL7L 4PJAF 5ABDE 4RMWA 5D7SH 3P11L 4I8DA 1AXSB 4NM4L 3FKUS 4KMLB 3CSGA 3VFOA 4OZGA 3C09B 4HKZB 4EN3C 5IGXH 3T0EA 4G42B 4A6YA 2V5RA 1KULA 4YC2C 1AO7D 2NY0C 2ERJB 1SHMA 4UV7L 5C0DB 2AKRA 5IMKA 1R3HB 1P53A 4C56E 4QNPF 2E7LC 1I3RB 4GRWB 3T08A 4D8PB 3QDJB 3ETBF 3UEZA 5D71H 1X6LA 3ZT5A 1VENA 1Z5LB 4P4KB 4QRTA 4LPTA 2AXGB 4PV8B 5C0RH 2PO6B 2Q6WA 4CMMB 3GMMA 3L9RB 3C60D 4JFDD 3LCYA 4HWNA 4U1IA 3L3IB 1BJ8A 5MEPA 4MHHG 5CWSB 4OD2B 3SDAC 3IS1X 4ZAKC 3GJEB 3I75B 2WIMA 4AH2B 2HKFH 2P8PA 2MPAH 4KRPB 1B0GB 2FGZA 2V6HA 3TBVA 3TBSA 3REVB 4RAUB 5LCVH 4X8JA 1WBYB 5CEZE 2D4DA 4LVOC 2AAVA 2AJ3B 4F7CA 1VADA 4HXAH 3VFGH 3IAPA 4PY7B 4ELKB 3U2SB 1CXEA 1FLRH 5EC1B 3F12B 4YO0B 3UPCA 1Q9OA 2APVA 1U3HC 1XF3B 5F6HI 3QUYD 4NHCL 4AG4H 1T66C 1M7IA 2JIXB 5FGBC 3LRHA 1KBGL 1PG7H 5CLTA 4I0PA 3BXNA 4F9PA 1BIIA 5D6CB 1HSBB 3MRHA 4I18B 1S7QB 2NY1C 2P5ED 4M48H 4X7CC 4YR6B 1YYLH 4NKOA 3RWEB 3CC5B 4WI8A 2A6DA 4NBYB 1JNHA 5DUBA 1E27A 5FYJE 4UAOC 3S4SG 2I25N 5IUSA 4DUWA 1UXSA 1SBSH 1FDLL 5D7JD 1AO7A 2G60L 3NFSH 4G8EB 4YLQT 1OHQA 1A7NH 1EGJL 4G80B 5CINL 5HHOD 2X4TA 5J4MA 2AXFA 2J4WL 3MRRA 3IS0X 3G9VA 5BS0A 1DLHA 4P3CL 4YHLH 4EI5B 1NCDH 4BH7B 3GIZH 2Z8WC 3T4AB 1AGEA 2GTWB 4RMVA 3I3BA 1QBLH 1CIUA 3OG4B 5EBWB 1NSNH 1TCRB 3WJJC 4MX7A 5CCKL 5JDJA 2FLBT 4KDTA 2OTUB 2D9QB 5DURB 4U1HB 1NAMB 2BNRD 4Z76A 4P9ML 2CO6B 4EBQH 1J7VR 1B4RA 1JGUL 4ONHA 4JR9L 1PZ5A 2P24B 2Z92A 4RSVA 1AO7E 3QDMA 3EOBB 3MXWH 3BYTA 4KVCL 2QHRL 3EO1B 2CDEB 2FIKB 4JFFD 5BS0E 1ES0A 2VZVA 5AG8A 2Z8SA 3W0WB 1MCPL 1U92A 4ZFGL 5SWZA 3MV8B 3M1BA 4JFOA 3RY6C 3MLZH 3ARFC 4AL8H 2MQCA 2JCCE 4XHQA 5C0IA 2B5IB 1OVZA 3RVUD 5JPNA 1JFQH 2V2WA 3D25A 2V2TB 1WWBX 3DLQR 4ZXBD 3FTGB 4JFDE 5ESAA 4ENED 4HUMB 2VLJB 2WANA 4QTHA 2GKIA 2DB8A 5DTFA 4J1UB 3NABL 5FB8A 5MEND 3UBXB 4NZTL 3KPSA 2HWZL 4ZTOH 4OF6A 4JKMA 1U3ZA 1UWXH 3QJHB 2P5EA 4OCYH 3JTSB 4UINL 5I1GH 4ZODA 3C09C 3HRPA 1T0MA 4PJ8C 3SDCB 3NCYP 3IVKA 4W68A 4I13B 5TFSH 3KYKL 5EO1A 4M9PA 5JLZB 2EH8L 3L7FA 4QYOA 1TPXB 2ERJC 3RWIB 1BQHA 1G0DA 4PJCE 2DBJA 1LGVA 1T4KA 5HHOA 4RBPK 1YY9C 1TITA 3NCEB 3LH2H 4P59L 2ADIB 1FFNB 1LO2H 5I76B 1NL0L 3VJ6A 4W6YB 4JO4H 2WUCL 3KPSE 2C4FT 2EKJA 3W9DA 1UXWB 4P4KC 4QWWC 4FS0A 2P5WA 3BJLA 1D5IL 1GXEA 2C7UA 5K93A 2P5EE 1NFIA 2OJEA 2E5EA 3GMPA 3HTLX 3LQAH 2J8HA 1HXYA 3CFDA 4KRPC 3DRTA 1D9KB 5J56B 3UJTH 1KXVC 1ZAGA 4YFDB 4ODWB 4IRZH 1WFOA 1HWHB 3LS4L 4ZUVA 3ULVL 1W8NA 4N8VG 3HCVB 4Y4FD 5HHOE 1V3JA 4Y5XB 3VGAB 2CXKA 4XMLL 1J0YA 4MDJA 3THMH 1BQLL 2DM4A 4OQTH 3HMWL 4HGWB 1F4YL 1HIMH 1MAJA 2P47B 5BRZB 4M6ML 1FL6B 5C0FB 1ADQL 2ZSVA 5DD5L 3S34L 1L4IA 5I8CB 3TWCH 3OGOE 2Q8AL 4Y1AD 3VI4F 2X10A 4FMFA 4WO4B 4NOFA 3RU8H 2BNRE 3ARZA 3GGWB 4LEOA 5D2LA 1P4LB 3B3IB 1G1YA 3ZL4L 4LASH 3JZ7A 5DDHB 1J11A 3FB5B 1ZMYA 4M6OH 2R29H 4R4FH 2R1YB 1AJ7L 5BJTB 2R8SH 4DGVH 5H94A 1MUJB 5T1KD 1X5AA 4UDUB 3PHOA 1OGTB 1WT5C 5C86A 3LEYH 4JFFE 3VD4A 3CDFA 3QHZL 1XGTA 4P3WA 3WKMH 5GGSB 3CCHB 3IFNH 3VFSA 1NGZB 3NAAL 4Q6IB 2IFGA 2DQIL 3WDJA 3ARDD 2O5ZH 3MRCA 2YA2A 1VEOA 4M62H 1BZ7A 2NZ9C 1F11B 4M1CC 4U1KA 1PSKL 3SOBH 4EI5C 1JHKL 4ZUUB 1RHHA 3BP4A 5CZVL 4NQEA 5LJYH 3PGCA 5MENE 3KLHD 1J1PL 2OP4L 4GQ9H 4EDWH 3ARVA 4Z7VA 1CFQA 1AI1L 2HRPL 2X1WL 4X4XB 3OKYA 1KN2L 1EUUA 5B21A 3VFPA 4KMQA 1JYNA 3G6JE 5JW4R 4PLJD 1K9TA 4EJ1C 5HYFA 1F6AB 4NC0B 4WU7B 3BKYL 3MBED 5KOMC 1I3UA 5HDQL 1J8HD 1CDGA 1S7WB 1FZJA 2UZIL 4G9FD 1F58L 1MI5B 1FORH 4H25B 4RQQA 3RRQA 1HINL 1HYSD 3MGOB 5DJZB 1VGKA 4JEGB 5ENWB 1EHAA 1J05A 5HDOA 4Q6YA 1GGCL 3B9VA 1LEGA 4NWTH 4OD1L 3PWUA 5IEKA 1ZANL 2B5IC 5BV7L 4F2MA 2YSSA 4OLVH 4DFIA 5DFVC 5CD3A 4AYFA 1UZ6E 3MGAA 4OF0A 3F5WA 3TBWA 4J3WA 5T3ZL 4F7MA 5ANMA 1JPFA 3EO0A 2WZPD 5JTWA 5KSBB 1RU9L 4BFGA 4R90H 5HPMB 3IFPA 3L3HA 3GSUA 3MR9B 3QA3A 4UT7L 4MA8L 5E6ZA 3H9SA 4JJHA 4TVPH 1QQDA 2CKBL 1TVBA 3D69B 4V2CB 3SDCC 3QNZA 3QUXA 5JOFB 1KC5L 4PJXA 3WFBH 1EMTL 2QSVA 1TPXC 3MV7D 1RUML 3LKOB 4ZS7L 5IVNA 4K71B 2VABA 4JFEA 1CFNA 4OM1L 1MJUH 3UROR 2DQDL 5SX5K 4GBXD 1NCTA 4MXVF 3N85L 2IMNA 1CLZL 3IFOA 4TVPD 5J6GB 4X4ZA 5D6DC 3SCMB 1EEYB 5F1IA 3RVTD 5FM8A 5ITFA 2AV7B 1RV6X 4X5XB 4ZSOE 1ETZA 3EOYG 4JHAL 3SN6N 3IGAA 1JE6A 3TH3T 1I1AD 5DYOA 2FJHA 3FONA 5KVGH 1CR9L 3CSPA 4WW2B 5J3HD 3FT4B 3RWFA 2WSKA 1LNUA 2OI9B 5TDPA 1J8HA 1G7PB 2Y07L 3FOMA 1ND0B 4WI4A 5AZ2L 1JZ7A 1T1WB 3RTQD 4Y5XC 3VGAC 2O61A 1BF2A 1OM3L 5B22A 5A2KH 1XR8A 4XBPA 3WKNA 4M9OA 2AK1L 1FO0A 4Y4HB 3L3KB 3V79C 2VTFA 5KW9H 4JRXD 2BNUA 4G8FB 1FL5A 3D0VA 3A6OA 2XTJB 5DFTA 2JCCB 4R3SB 4PP1C 3NACL 1WZMA 3FFCB 2IBBA 2QL1A 3VGBA 1OAZH 5LXGH 2V5SA 2E7CA 1LE9B 4LLUB 1YC8A 3VG0L 1U8HA 2FX8H 2VSCA 1NCAH 2X4SB 1J8HE 1FPTH 4NUJA 1QRND 1G9ML 2Y7QA 3SKOB 3I02A 1BM3L 3BKCL 4G9FE 1OCWH 2VNCA 2VXSH 4Z7NE 2H45A 1L9MA 3GIVB 3MFFB 4BQ9A 1CLCA 2GT9B 2GITB 5ECJE 4PJFF 5D1ZD 3PV6B 4Q6IC 43CAB 3GBNH 5CUSL 1FFQA 1A5FH 4N8CL 2E7LA 1IGJA 4XNUL 3BPOB 4TULH 4JDTL 2JF1A 4ZPTA 2BOBA 5FFLA 1D5BA 4PJCB 3HC0A 4NZJA 4DW2L 3O2WH 5F21B 2VLKB 1ZTXH 3IXTB 3U1SH 4AEFA 3QDHA 4NDMA 4TRPL 4HFWB 4BJLA 3QUYB 5E99H 4DKFL 4XC1L 2W9EH 4RRPA 4S0SD 1T22A 1JJUA 2KPNA 2IWGA 4XC3L 4P99A 2VITA 3ZLQC 5ALBL 2ZG2A 2NYYD 2J2ZA 4WTZG 1NANI 2R9HD 4M03A 4HLZG 3BEVA 3MV7E 4QHNB 3T8XB 1LD9A 3F7RA 1M7DB 1RZJC 4Y4KD 2VXQH 1LQSR 4HF5H 1OWRM 5INDB 1U8LA 1ITBB 2DF3A 1E4KA 4ELMB 4MXWH 3L3OA 4U1JB 4XBGA 4Z7OE 2YUVA 1U3HA 2JELH 2J1KA 4UQ3A 3RPIA 3U36B 1P7HL 4JRXA 3BO8B 5FGBA 1MIMH 2D03L 4K55A 4BQCA 5IESH 3Q5YA 3OL2A 4YHKH 1AP2B 1K8IA 3SQOH 4JY4B 1YDPA 3X13A 3QUMB 3AMLA 2BNRB 3NCCB 3AC0A 3TIEA 3R0MA 1M6OA 1NGWB 4KTEH 3HR5B 3IDMB 2VLLA 1FIEA 4FQ1L 2QQKH 5TGBA 1FFPA 4LSSL 1LILA 4NKDA 3S98A 2J88H 2UYLA 4G3YH 3WV0A 1FN4A 4LQ1A 4XI5C 1JYWA 5E2TL 3QXDA 3V5KA 4JFFB 1W0VB 5D1ZA 3U7YH 3U0TA 4K71C 3CH1B 1F4WL 5DZLA 1T5XA 2R2BB 3Q6GH 4KK9C 4JRXE 2D2OA 3UCRA 4HKBB 5DSCA 1W0YT 1HOCB 4M5YH 1LHZA 5F7NC 3MRQA 4KKNA 5GSVB 1URLA 4CVZA 4KV5E 4ZXBB 5LQBL 4GT7A 5KS9F 2XIDA 3C2AL 3K0WA 4PJIF 1HILA 1PEWA 3HNVL 1FZOA 1A1OB 1TDQA 1J86A 3SCMC 2ATPB 1U9KA 1KJ2H 4PRBA 3VWKD 4KKAC 4P2YA 4FG6D 1QRNE 4JFPB 1VERA 5MENB 1U95A 4OSUL 3NZ8A 4H26A 4Y2OA 5L2KD 3ZT6A 2DQGH 2YKLH 2OJZH 3TVMC 4Z5RA 2F53D 2XI9A 3UTQB 5C1MB 5IG7A 2I9LA 5HGHB 1JV5A 5CSZB 1X5HA 5I75B 4NHUB 3EJJX 3TNMA 2R4RL 1DVFD 4NUGH 5EZLA 2FWOA 3GSVB 4RMQA 2X4UA 4JGMA 1OSPL 1CGXA 4GJTB 5BCAA 2X4OA 4LVNB 4WHTA 4Y4KA 1KUMA 5IF0B 3RY6A 1XEDA 3ARFA 1IM3B 1EK3A 1CZ8L 1JWSA 1I9IL 2E8ZA 4Y4HC 5E03A 3CFJA 4WWID 4KJYA 4NOBA 4R97B 3HI5L 5C0ND 3QJFB 5L2JA 1OGAB 2IBGA 2XTJC 4MA3A 2AJYH 1FSKB 2YC1A 5ICYA 3KYNB 5GRJL 3MLRL 1IJ9A 1RFDL 4BELD 5I19L 1YNLH 4ONFL 2WLYA 3SDYH 2L7JA 4M61B 2W07A 2HMID 4K3HA 3QXWA 3DECA 2FATL 3ZMRA 3KPLA 4G6JL 3GMLA 3G5VB 4JDZA 2CIKA 5C0CD 4PJ8A 3WS6C 2VQ1A 4Y2DB 1MHEB 1J0IA 4J3UA 3STLB 4FQXD 4JQVA 3KS0H 3RI5K 5BZDB 5ID0B 1EO5A 1MFBL 4WY7H 1AFVL 3QR2A 4AMKH 5C71A 4FQPA 3BSZL 4GMTH 4MCYA 1OAQL 1YQVL 2O5YL 5CGYC 5DJCA 1K2DB 3HE7B 3QDJA 5GZOD 4UOJA 3GRWL 1P84K 3Q5TA 5HD8D 2GJ6D 3T2QA 4Z8FH 3MRIB 4DAGL 3DVGB 2QEJA 1OT2A 5ACZB 4S1SH 4Y1AB 3SO3B 3N1QC 2E7MA 5EDXA 1H3WM 2IGFH 4ZFOB 3ZYJA 5ISZD 1Q9KB 2BMKB 3ECBA 3KJ4B 3VWKA 4PR5B 3CDGA 1AQDA 5DZNA 4CW1B 2YK1L 3WUWG 1HHKA 4KK6D 3VGHA 5L2KA 4NO2B 2W9DL 1KFAH 2V9QA 2Y5TA 5T1KB 2OBGA 1G9NL 4ODHH 3IFLL 3KLDA 3MJ6A 4RGMB 1UKQA 4EQ3A 4HS6B 1ZSDA 4LPYA 1BLNB 2VAJA 1OP5H 4RAUA 4M7JH 3TT1L 3E0GA 1DVFA 1EJOL 4YHIA 5DD0L 5FA3B 2MKLC 1BVLB 4OJFL 3V6OA 2HH0H 2COQA 1P4IL 4P9HC 3O2VL 5E0QA 2A77L 4PY7A 1PBYA 4KHTH 5D4QA 3ARDB 2X1PA 4HMEA 1DEEA 2R0KH 3DI3B 4YO0A 2IH3A 1MQKH 3P4NA 4K7PL 1GVIA 2GYSA 4HK0A 5BO1L 3T1FB 2A6IA 4GKNB 1IC4L 2Z8RA 4PIRF 1GIGL 1FNSH 5E2WH 4BQBA 2EDJA 3FMGH 5L2KE 4QXTA 1CDUA 2AEQL 2F53E 2VLRD 3WHE1 5I9QB 5C7XL 1XF2A 3HAEG 4YR6A 5DK2B 1WT5A 3FFDA 3ZE0E 2PYFA 1GC1L 4WW1B 4BZ1L 3CC5A 3V6OE 5EIIB 3GM8A 1B0RB 2I07A 4BFEA 3O45B 4U6VL 1KG0B 5IR1B 1YYMH 4WUKH 3MBEB 3DWTA 5HHVH 2RCSL 4N5UA 3IAQA 2Y9RT 4FQXA 4NGHH 2XQYG 3SKMA 3TGXA 4G9FB 3DYOA 3DV6A 3S35H 3U7WL 4Q2ZA 1A0QL 3BDBA 2YUXA 5EBMB 5FECB 5GPRA 1CTOA 2ED8A 2C4XA 1E28B 2OL3B 2ZNWA 4PP2A 5D1XD 4HHAB 3S96A 2ZCLH 4NM8L 3HI6H 3RWGA 2GJ6A 2YD3A 4H20L 4L29B 4X99A 2Z8VC 3MCKB 5JQ6L 5SWQA 3RX8A 5E1AA 1JPSH 3ZDXE 4AEHL 2LU3A 1NAMA 1E4XL 2I27N 3BMWA 5C0CE 3W81A 5KZCB 4L4VB 2LU7A 2YUWA 2DN7A 5SWSB 3KDMA 2FSEB 5J6HB 1Q0XL 1N4XH 4P23B 2BVYA 4MQSB 3EYQC 3PGFL 1OP3K 4H8WC 5T1MB 3RVVD 1XCTB 1IGCL 1QSED 2DYPD 1NBQA 5GS0H 1II4E 5AZEL 5IMLA 1CGWA 4APQC 2O5XH 4OZIB 2ZPKH 1KXQE 2Q76B 1TZGH 1Y18B 3E1F1 1KIRA 5EG6C 3ILPB 3V6ZB 3TJEL 4EUPH 4LVNC 3IT8D 2D3VA 3DUSA 3NIFE 2E6PA 1N59B 1DQJA 3MV7B 1J0HA 5DUPH 2GJ6E 3TBYB 5DD1H 4G8IA 4J3TA 3K81A 4JPWL 2GTZB 5BMFL 1EHXA 3GI9L 4I77L 4R97C 3VXNA 3WXWL 1WIUA 3EDDA 2VLJA 4GQPH 3RZCB 5ISZE 1VDGA 5GS0D 1CXHA 4J1UA 1JGLL 3BE1H 5IVZB 1FSKC 2FD6L 3P9MA 5GJSL 4HWBH 1X3DA 3NCFB 4RIRA 2K7QA 3P4OB 1QFUL 1J87A 3LS5H 4Y19B 1N2RB 2WLZA 1CVSC 3BVNB 1ZGLP 3LN5A 4Z95L 3SE8H 3MCG1 2EDEA 3LRGA 1ZLWH 4W4OC 5KSAD 2WNGA 4M7LT 1U6AH 1JYVA 1A6UH 2ITDA 3SDCA 5IIEA 4Y2DC 1MRCL 2F74A 4XP5H 1I1AB 4BFBD 4HS8L 2R0WL 4CGTA 3QAZB 4TPRH 2A6JB 2NW3A 5DK3A 5DRWB 2W60A 3N1FC 4L3EA 1A3QA 3PABA 2GY7B 3VRJB 3RTQB 4YHYC 2FJFA 2D7NA 4NZRL 3NFNB 5E2VH 1DEDA 4IDJH 3TJHD 3MNVA 3ARBD 3HE7C 1MCBA 4I2XA 2VDLL 3KWWB 1M05B 4DGIL 3WS3B 2HFEA 1A4KB 4XPAL 5GGQH 4KXZH 3PDOB 3U83A 4PPTA 5D1XA 5D6DA 1KCSH 2YN5A 3KPRD 2VLRE 4JFXB 3SO3C 3JSSA 3KJ4C 2P45B 3PJSB 5DJ6B 1VEMA 8FABB 2F5AH 1OAYH 3REWB 4PRNA 4L3EE 1QRNB 4RGMC 1QSEA 2DWDA 4QRPB 3EDKA 2GUOA 4HWEL 2AJSL 4OLUL 3SGKA 4Y5XA 3RGHA 1JMZA 1WV7T 2H8PA 1JI2A 4O5LH 4I2XE 2VL5A 4DZBB 4ZOCA 3IETB 1GHFL 1NGQL 1SJHB 2F8OA 3WLBB 4HUVA 3AFLA 3GSNH 5GRUL 1HKFA 4AM0A 3QXAA 1FL6A 1F90L 3GBML 4H0IA 4Z7UA 1NGXB 5JOPD 2J5LB 4U6TA 4ZUTB 3LIZL 4JN1L 1UM5H 3B3IA 3O41A 1FV1A 4P2OC 1SVZA 2G75B 3DIFB 1D6EA 1T89C 4GRMA 4KZDL 5I9QC 1QSEE 3ORJA 1KEMH 5EIVA 3VXRB 1H5BA 4HUWB 5KSAA 1WC7B 2D31A 2X05A 1D5ZA 4L9LB 5DO2C 4UNTA 4XZUB 3IXAA 1BWWA 1FGVH 1YPZB 4PGDB 2NY5L 4HG4K 4LSRH 4G6AC 5AYQA 3DSNA 1RULL 2P46B 4HWBA 5DJDB 4XPBH 5D2LF 1U8NA 5T3XD 3WL9A 3ARBA 5IFHL 4RFNB 1NGYA 4P2CG 3ZSTA 4JZOB 1U8MA 3L5JA 2ZKHL 5BXFB 1T04A 3BP7A 3FQUB 1ZVYA 2V17H 5GRVK 2WIIA 4LOUD 2NY7L 3OR6A 3DETD 4XRCA 5B38G 2PTTA 3SKNA 3VFNA 3DMMD 1MJJB 2VDQL 3MRGB 4MB3A 4O9HH 1FE8H 4QF1B 1KLGA 4KROC 3PGDB 4P23C 3MA7A 4YGVA 1PEZA 2SEBB 4HFUL 1A22B 3K8KA 4P2QD 3RKDD 3KXFD 2RR3A 3CXDL 3MBXL 3WFDH 2GAZA 5B39B 5DJZA 3AXLA 4TSCL 3G04A 5I0DA 1QSFD 4M1DL 3NFPA 4V1DB 4N0YH 2EE9A 1JHLL 1Q9LA 4Z7VF 1OB1B 5I74B 2R0LL 3W11D 1INQB 3QNYB 4OLYL 3KPRE 3EOTH 1UZ6F 2LU4A 1LEKA 2X4QA 4DKEH 4L8SA 3RZCC 2E9IA 5JO5A 4NRYB 3TYGH 1INDL 4PYHA 2KKQA 2OQJB 1V3MA 5GGVH 4FN0A 1RK0A 1IQWH 4L5FL 3UJJL 2WWKO 5HPMA 1J18A 3OXRB 4QHUA 3IU3A 4HCRH 1N3NB 3VMNA 3GSNA 4BUGA 2F53B 3MGTA 2E9WA 4MXQC 4LCIH 5JHDD 4C83A 1CE1H 5C08D 1JVKA 5B8CC 5KSUB 5DVNA 2DQUH 4YUEH 1RK1A 4HH8A 1WCQA 4NNPH 1KJ2B 5HY9A 3DX8B 4UDTB 5JOPE 1MY7A 4MWFB 1CGYA 4LVHB 4L8BA 5CEZL 1CBVH 1MLBB 2QQNH 4KVNH 1DLFH 1EEYA 3KG5A 3O8XB 1NC2D 3WYRA 3KS0J 2CR6A 1RZGA 5F3HB 2H2PC 4Y88A 4OZ4A 3CX5J 3HNTL 1AE6H 1QLFB 1NDMA 4PJXF 3A67H 3FO1B 4OV6F 3TVMA 4OIAA 2Y06L 5FYKU 4YE4H 5D8JL 4X5WA 3FOLA 5C0CB 4Z18A 1NDGA 1BGXH 2ZOKB 5LAXB 3R06B 3UO1H 1GZPA 4TTDC 4OM0H 2HN7B 1F13A 3H42L 1JNLH 2YMXL 3BMVA 5F89B 3OAZK 5L88L 1N64L 4FZEH 3P77B 4PJGA 5T3XE 2PXYD 4X7SH 5EO9B 2EDKA 1F4HA 1UCBL 1P1ZB 4FABH 3D2UD 2IPKA 3FQNA 4NO5B 1S7XB 1FH5L 1R3LB 4JJ5A 4N0UB 3VFVB 4B7LA 4KRLB 4R2GB 5C0BD 5FYJL 5DQDH 2OK0H 2VLMD 1NUDA 5HHQB 2BJMH 1AD9B 5FHAL 4ZYKA 1IGIL 3DOSA 5DI8A 1WIOA 3CU1A 1JPGA 4UU9B 2FECI 4LLUA 2DLGA 4K2UH 5ISZB 3O2DH 4PTUB 3HE6D 3MSPA 4HWUA 4P2QE 4YBQD 3SKOA 4Z7NF 3KXFE 3QIBB 2EYSA 1QD0A 1U8QB 1UH3A 2FBJH 4L9LC 4U0QB 2GT9A 3EFFA 4QRRD 5GJTL 1YEGH 3LEXA 2DLEA 1QSFE 3L5XH 4WUUA 3S3SA 1ZLUH 1RUAL 5C08A 4KFZC 4GXUN 5E6IB 5K9OA 1UACL 4HS3A 3UDWC 3WIHL 5TE7H 4D0BB 3MROB 1OARL 1WBXB 1A21A 3LN4A 5DHYA 5HJ3B 3IDXL 3MLWL 2HT3D 3F7VB 2HFTA 1F3DH 4YQXH 1YJDC 4WWKD 4NO3B 1BP3B 1AR1D 4KK5D 2XACC 4YAQB 5D7SL 2CGRH 1PX4A 2A83A 5C09B 3G5ZA 1DUYB 5D1QD 3ZZ1A 5C70A 5CIPA 1NC2A 3T3ME 4LU5H 5IGXL 3IDJB 4RBPH 5IB1A 2AK4B 1MCDA 1UADC 5A16A 4YZFF 5JHDE 4WUUE 5C08E 2X1XR 4U1MB 3SGDI 4OZFH 3EYVB 3CFEA 5CMAB 4X9IA 3RWDA 4XCYB 4EEEA 1I7TA 2IFFH 4F58H 4JO2H 4NSKB 1FGNH 2VR9A 1S9KC 5D71L 2PXYA 2HJKA 5C0RL 3D2UA 1JF1B 2FZ3B 4CADB 4U1LB 5I74C 5IFAH 4Z7OF 2H41A 3LEVH 1IAOB 2HVKB 1A7RH 5C0BA 4NRZB 3E8UH 2XQBH 4EI6A 2HKFL 2MPAL 5D5MA 5E4IA 1RJLA 1UB6B 2XG4A 2AQ1A 3QUMA 2W65A 4QRQB 1MJ8H 1NGWA 4HD9A 1KPUA 3AGVA 2FNBA 3IDMA 5LCVL 4CDHA 2Z31B 3B9KD 3QFJD 4KKLD 2OYPA 3TPKA 2V9RA 4MS8C 3GMNB 4HXAL 4XVTH 3VFGL 4PGEB 3CUPA 3HZYB 3RUGE 4QRRA 1FLRL 4N1CA 4N0FA 4PV9B 2IBZX 5DHVH 1A6TB 5TE4H 1VHPA 4GG6B 4LHUG 5C0BE 3VDBA 1JGEB 1I7ZA 1AGCA 4AG4L 2VLME 1PG7L 2EYTB 4GKSB 3MLTB 3SGJC 5E8EA 2G5BB 5GSVA 4HSQA 4KV5F 4LVHC 4YXLH 3VFWA 1MAMH 2VXUH 3RNKB 4PGJA 1KCUH 3B2VH 1TJIH 4JAMA 3ET9F 3BHBA 4M48L 1CDHA 3O8XC 1YYLL 5HVHC 5FOBA 1D5MB 2VQUA 4NWUH 5CS7A 5D1QA 1WZLA 5JPMB 5B8CA 1OSZB 3QQ3A 4EUPB 1BJ1J 1SEQH 1X7QB 3QUZD 4YHNA 3VE0A 4NQTA 4QRRE 2APFA 5HGHA 5CSZA 3F6IA 5FO7A 1SBSL 3BUYB 4APQA 2F54D 3NFSL 3RHWF 3V4UL 3NN8B 1A7NL 1F3JA 4QRSA 4YDIH 4XNQA 1VSCA 1BEYH 3F62A 4N1EA 1KCLA 2ESVD 5GIRB 4MHHI 4YHLL 1NCDL 5FKAB 1ZE3C 4R4ND 1WIPA 3GIZL 1ORQA 4WIQA 4YGAB 3QDAA 3OSKA 5CSBA 3GJFK 1FVDA 4M8QA 1QBLL 3OJVC 1NSNL 3JV4B 3JWNC 1P2CB 1GRWA 1UJ3B 3QNXB 9CGTA 5HI3D 1OWWA 1QA9A 4MVBC 4R2GC 4ZFZB 3TA3C 4OAWB 1IMHC 3UTPD 4P0DA 4EBQL 3LKRB 5BW7C 1I9RH 3OXSB 4R96B 5FM5O 3SKUD 3ARYA 3KPRB 5F97E 4XGZA 1KEGH 1JPTH 5FAAA 2FYYB 2HP4A 2MNUA 3FQTB 3MXWL 4S10A 4W4OA 2ZUWA 4RGND 4XVUC 2PETA 4TUJB 5FDYA 3QIBC 2VKWA 1RMFH 1FJ1B 4XPFH 5ETUA 4HKXA 3IDIA 3MLZL 3MO1A 4H1LB 4AL8L 5TF1H 1DSFH 1JFQL 2WBJD 3F8UB 1NCBH 2NLJB 3AAZB 5I2IA 5E6IC 3UC0H 5DZOA 3ZTJG 1FLTX 5C2BH 4PBWD 5I1LB 4J3VA 3GSWA 4CJ1A 2J8UB 5HGBA 3DVIA 4FFWC 3CK0H 2DQEL 3O6FD 5DMKB 3L3DB 2NMSA 4DQOH 3BH9B 4NPYB 4ZTOL 3QG7H 3CXHK 1J10A 1NBVH 4QO1A 2WM0A 5J89A 4LARH 3V5HA 3LN9A 2ZG3A 4OCYL 3CLEH 5I1GL 1U58B 3OBAA 3CFCH 3RDTB 3QFJE 4LBEB 2NTFA 5HHNA 2AI0H 1EAJA 2EXWD 4PGCB 5TFSL 5SX5H 4HH9B 3PWNA 3HLAB 1S7RB 1S9WB 1HK6A 5HHME 2F54A 3RL2A 5A43C 3IRZA 4K9EH 1UENA 2KBGA 3L95A 5GS2D 3FQWB 3LH2L 2RB8A 2ESVA 1LO2L 1JPST 1F2XK 4JO4L 5AG9A 4CVWA 2GHWB 4ZOEA 4BH8A 5CJOH 5GGTH 4XPGH 2X9XA 5IB5A 1VKXB 3MRNA 4DCQB 2QSQA 4LLDA 4JG1H 1S9XB 3T1FA 2BOCA 2APTA 4GKNA 4S1DC 3LQAL 4NNXB 1TVHA 4P2OA 2ADGA 4KJWD 3MRFB 4Z77B 1I8KB 1T89A 1G1CA 3UJTL 3LY6A 3EDFA 3ES6B 2CLVB 1CWVA 1IC7H 4IRZL 1RZIB 2F54E 4RFOH 4X7DC 4XB7A 2IQAB 4BA8A 3ZE0F 2W0FB 4KI5C 2YOCA 1OAXH 1DN0B 5FDWA 3H3PH 3DMMB 4WW1A 3WNKA 1QSZA 1A3RH 2Z31C 2ESVE 3THML 2GJJA 2GK2A 4MNQB 4MB5A 1R5VB 1OTTD 4OQTL 3CIQA 3LHPH 2XNAB 1FL3B 1HIML 3GI8H 4P2QB 4LF3B 4UIKH 3KXFB 2OLDA 3TWCL 2RAMA 3RWJB 2PF6A 1GH7A 4RAHA 5E8OB 4BM7A 4JZNB 4JO1H 3JUZA 4MDIB 5L8LB 1VFBA 3RU8L 1QSFB 4YNYB 3UTPE 5HHXH 4LASL 3FB7B 3VGGA 5DMGD 4M6OL 4CAGA 2VJXA 2R29L 4R4FL 2IAMD 2NY2C 1SY6H 3V8OA 2R8SL 4DGVL 2PR4H 4WFFE 1IE5A 3B2UD 3ZDXF 4FQLH 2DICA 2BVEA 3UYOD 4XMPH 3CZFB 4NN5B 3LEYL 4JCLA 2HTKD 4RGNE 3DVFA 1Q94B 4F8QA 3WKML 1FNGB 3MRDA 3E3QE 4HLZH 3GFUA 4P23A 3IFNL 3D9AH 3GB7B 1XCTA 3RVWC 3SDXA 3TESA 1MWAH 2VISB 4TSBH 1S3KH 2O5ZL 2KDGA 4D3CH 4M62L 4YWGH 3SOBL 1X4YA 5IT2H 4X9BA 1A7QH 4D9LH 3TBYA 3MLYH 4GQ9L 2A73A 2GTZA 4RA0C 4EDWL 1PG7W 5K9JH 3OKOB 3M17A 5HI5C 1UJ3C 3GSRB 1K4CA 1HXMA 2MWCA 3FAXA 4ZOBA 5IVZA 4OGAD 4LMQI 4ZNCD 3S4SB 3P3YA 5F7EH 4Q58C 3CVHH 4F15B 2L4OA 5GZNC 5JA8B 2BNQB 4BYHA 3LKPB 2QQLH 4DEPB 5DJ2B 2W92A 1FORL 3GHBH 1CFSA 3BZ4A 1Z9OA 1UJTA 3QCTH 4UOW1 2A9MH 2PYEB 2X89A 3LZFH 4NWTL 4NRXA 3ULUC 1NEZA 1N6UA 4OLVL 5SV4A 1P9MC 4B7IA 1NCWH 4UB0H 3P73A 3RUGB 4M7ZC 1MCHA 1UH2A 5IK3A 1FYTB 2PCPB 4OGYH 3SDDB 2J12B 4XCCH 2IAMA 4K8RC 4LEXH 4M43H 4R90L 2F9BT 1WZKA 2EIEA 1U8KA 2A74B 4TVPL 8FABA 4ETQB 2CRZA 3TO2B 4LP4A 3RDTC 3DHJA 3U4EB 1BD2D 3WFBL 4DN3H 3TEUA 5DT1H 1G7JB 1F3DJ 4NFDA 3HE6B 2QHLA 4QRPA 5GRZA 5IB3A 3WN5C 5GGUA 1XR9B 2VWEC 2YD4A 3DURB 1MJUL 1MCKA 2FL5A 4PJDB 4Y8DC 3WLBA 4K94C 1S78C 4S2SB 5DJYA 1HN1A 1OTSD 2H32B 1B2WH 3KHQA 4N5ED 1IGYA 2H2SC 5F7DB 5FO9B 1U3YA 4IHOB 1BQUA 3QI9B 4O2EB 2PW1A 5DEGA 3DYMA 2VDMH 4WWKB 4ZUTA 1MWAA 5J12C 4HBCH 4GAJH 3TIDA 1CE6A 4WCYH 4U33A 4HV8A 3U6RA 1KPRA 3IJSA 5KVGL 1T21B 5C6WH 1CDJA 5E8NB 4IIQC 4MQXD 1TETH 4PRIB 4D2NA 2CRYA 3VXOB 1PKOA 4J7RA 4PJ7A 4DJMA 3TLRA 4OCSH 3FB6A 1GGBH 5J8OA 2BSTB 1U36A 1JZ5A 1Q0YH 1JWUA 1QSVA 1TENA 3QYCA 3VXQA 3HPJB 5DLMH 1YNTA 2XA8H 3O81A 4Z7UF 5KW9L 2XWTB 2FJGA 4HIXH 3C5SB 2ARJB 2X09A 1BVKB 3NCYS 3RIFF 1OAZL 3QPQC 4UTBH 4HUXB 5C0JB 5LXGL 3HS0B 1K85A 4N8VB 1BFOA 2EDQA 2FX8L 3C5ZB 3IKCB 1NCAL 5F9JB 1FPTL 4NZUH 1QNZH 1OCWL 4MD0B 4PJ7E 1IAIH 2VXSL 4TSAH 1HI6B 2WK2A 4CMHC 1AKJD 1OLZA 4WJ5B 3PGDA 1TQBB 1RZ7H 2F58H 2E3VA 4LIQH 3CPLA 3GBNL 2X4RA 1GAFH 2IPTH 1A5FL 3B9KB 1BQHG 3UZEA 4M7KH 3BZDA 4TULL 5LWYH 2MCPH 3QO0B 1IQDB 4UQ2B 3VXSD 1HH9B 1HWGB 3EO9H 3HPLA 3O2WL 1ZTXL 2HKHL 3U1SL 5EO0B 1OB1A 4C54A 4C59B 1U91A 4POZC 5E99L 2P8MB 1EAPA 2W9EL 1B6UA 5GGRY 3RWCB 5TPWH 1IEBB 4ODUB 2CIIA 1R5WB 4LDOB 1JIBA 5J1AA 1L7TH 3QEQD 1BD2E 5D96C 2X7LB 4LLYB 2BVQB 4N0CD 5TDOB 1GPOH 4LP5A 3NCBB 5DHVB 3QQ9D 4YPJA 4FFVD 3E6FB 4I1NB 4DEPC 1WFTA 2VXQL 5DJAB 3QUZB 1MCFA 5L7XH 4HF5L 4JREB 4Y5YC 1EEQA 4M93C 4NYLB 1O0VA 1ZHKB 5ESVB 4MXWL 1PW3A 4X6FB 4P3DB 2JELL 3ZYIA 3STZB 1MIML 1E4WH 3X11B 5IESL 3CLFH 2Q1EA 3SGJA 2NR6D 2WBWB 4MWFA 4YHKL 2AP2A 3SDDC 3SQOL 1GZQA 3ZKQD 5DJ0A 4DUXA 1EZVY 3MUHL 3HUJA 3QXTA 3WE6B 3KVQA 3IAGC 2A0LD 1K5NB 4KTEL 1QLFA 2QQKL 1ZT4A 5T1LB 2UZXB 4GXUM 5C3TA 5JXED 3L7EB 5D7IE 2J88L 4OBSA 1AKJA 5C8JA 4G3YL 2ZG1A 4HLJA 3U0WH 1T20B 3U7YL 3BIKA 1JGDA 1ERNA 3TNNA 1TZIB 1XZ0A 2ADJA 3Q6GL 5HI4C 3O4LB 4M3KB 1MCWM 5ICZA 4M5YL 3R0NA 1HQ4A 4MA7H 2WBJB 3VXSA 3BIBX 3MJ7A 4NO5A 1G6RH 3ZDZE 2QADD 4F7PA 1ZHLB 3J7HA 5F9WB 3PXHA 2VRAA 1OP3H 1KJ2L 3QI9C 3SPVA 3TA3A 1ONQA 3UTTD 3PL6B 3O6FB 1FFRA 3LSOB 5BW7A 2OSLB 2DQGL 2YKLL 2OJZL 3FQXA 4UZGA 1UA6H 1U2HA 4LPVA 4CL7A 2AJZA 4PG9A 4AENB 2NY3C 1OT1A 2Q3ZA 3D39B 4RMSA 4L8CB 4NUGL 2ATKA 1B3JA 1KCKA 4RCAA 3OF6D 5GS3A 3L6FA 4PJGF 1MF2H 2R2EB 3LPWA 1Q72H 4X6BA 1XGPA 4TNWF 3B8SA 3VH8A 5JORA 3VXSE 5DC4B 4WI5A 2H3NB 1S5HA 4LCUB 4QHKI 1ZA6B 5C07A 2ZOLB 3PQYD 1UC6A 3C6SA 1S9YA 5F7KC 3N0PB 1PFCA 3MROA 1T1YB 3MJ9H 3B6SB 1S8DB 5HJ3A 3KAAA 2AJYL 2NY4B 4PJHA 3VRIB 5ITBH 3C6LD 3KLSA 4IMLB 3TYFB 5I30H 4HPOH 1R3IH 1YNLL 3SDYL 4QGTA 3P2TA 3UAJC 4BUHA 1D5XA 4KJPD 3I3EA 3C5ZC 4X4YA 2JJWA 1DUYA 2PTUA 3T3MF 5ERWA 5ADOH 2VN4A 5A2IH 5CJ8A 4GLRI 5JXEA 5C07E 4JN2A 3VFTB 2EEDA 5MI0B 3WSQH 4X7FC 1EHLH 32C2A 4WY7L 5HDBE 2J3SA 3TN0D 2VYRE 4AMKL 2UWEA 2ZUXA 4GMTL 4JFYB 2ITCA 5KAQF 1CT8B 1HKLH 4XP9H 1OY3B 4NSKA 2BCKA 2ZUYA 3B4NA 4YHPB 2LE9A 1OTUC 1FG2B 2NXYD 3KYOA 4Z8FL 1JF1A 4X98A 4YEEA 1CN4A 2C3VB 4HK3N 1DTUA 4S1SL 3DUHA 3VCLA 2IGFL 3ROOB 3ALWA 1CD0A 4NRZA 3MJ8A 1S7SB 3DSFH 1YA5A 4ODXA 4MJ6B 1RIVH 2DAVA 1A9BA 1CLOH 4YDLB 1G7LA 1NC4B 1KFAL 3ZHKA 1UB6A 4ODHL 3VD5A 5EU6B 3DHMA 4Y16B 1K3IA 4BZ2H 2LAGB 2UWEE 4OKVB 4FQJH 3EBAA 1UKSA 4M7JL 1U93B 2Z31A 3OQ3B 5MERA 2HH0L 3BD5A 3U4AA 1NMBH 3OF6A 4G5ZH 4EDXB 4X6DB 3GMNA 5JNYB 1ZT1A 4TN9A 3VXTB 3H9HA 4KHTL 3I6KA 1JN6A 5GSRB 2R0KL 5C6TH 4PV9A 2X4PB 1L0QA 4OLEA 3SY0A 1MQKL 4L9DA 4DKDC 3WEXA 4O00A 4Y5VB 3DPBA 1DANT 5HHPA 3UTTE 1MCNA 2EYTA 4KU1A 1FNSL 5E2WL 2Q86B 3U82B 2K9UA 1XF4B 3FMGL 3I2CH 5D5MF 3RP1A 1X5FA 3C6LA 4WNQA 5ID1A 5E24E 1T03H 2EDNA 2CMRH 4KI5E 4GAYB 5EZOH 1XMWA 2YR3A 2F19H 2LTQB 1GOFA 1MFCH 2YWZA 2X70B 1KIQA 1MHCB 1YYML 1UVQA 4WUKL 3UMTA 2IALA 5HHVL 5CZXC 5CGMA 1C5CH 3MJ9A 4NGHL 2D9CA 3BDXA 3PQYE 2JK5B 3OKNA 5EU3B 1U8IB 5E7FA 3TN0A 3S35L 5C9JB 1ZGLA 1N0XH 5FIEA 4M5ZH 5GIRA 1DFBH 4ZFFB 1CG9B 1XT5A 1Q9WA 5GQBA 5IOPA 4CKVX 3QRGH 2ZCLL 3HI6L 1JCKA 4CU8A 2Y6SD 5F9WC 5L0QC 1GGYA 3KPOB 4AQ1B 3KPMB 4JFQA 4ZOAA 1JPSL 4OV5B 4ZFZA 5FUCC 1SJEB 1KLFA 4JCMA 2JTDA 1R24A 3PL6C 4XP1H 4RRPG 1DDHB 4YHOH 1CICB 4R96A 1N4XL 4NNYA 3H7BB 3KNBB 4X5LA 2CDFB 3GKWH 3OHXA 1MHHA 1SMAA 3EGSA 3K46A 5GS0L 4IOFD 2O5XL 3I6GB 2ZPKL 5EUOB 3R8QA 4BZYA 5BZWB 4QXUH 1TZGL 4TUJA 3L3GA 3FRPG 2N56A 3BZEA 1BD2B 5SX4H 3U46A 3F65A 1RIUH 1TTUA 2FHFA 5DUPL 1GYAA 1I1RA 1CCZA 5DD1L 4ODBD 35C8H 4UUJA 5ICXB 4CBPA 3LB6D 3LMJH 4NQXB 1P9MA 2VN7A 4P5TD 5BQ7B 1UQSB 3TH4T 5IB4A 3MFGB 5F7HA 1YMMA 3EJYD 4OZHB 3VGEA 2P7TB 3BE1L 4XX1E 2NY4C 5DJ8B 4P46B 4HWBL 3TFKD 3L3DA 4NQCB 3RHWK 1I1FA 3NTCH 1HH6A 1EA9C 3LS5L 2AJXH 3D0LB 3MXVH 5F72S 3ARGD 5E9DD 3SE8L 5CD5C 3HMXA 4U1NA 5BVPH 1R3KA 1HDMB 1MCRA 3BWUC 3ZKMC 4HQQH 1ZWIB 3RGVD 3RDTA 4XP5L 4LPUA 3V0VA 2YZ1A 1P69B 1ULVA 4XWGH 4TPRL 4GMSH 5MI0C 3DRQA 2L0DA 3WHXA 1IGMH 1XCQA 2FBOJ 4CNIB 4NJAH 2JE8A 3RL1A 2XWJA 5IW1B 4F57H 2FR4B 3WN5A 1LE5B 2W59A 5E2VL 1YMME 1OQOA 2CXGA 4IDJL 4ZNEE 1QTYT 2E6QA 4LSVH 4MNGB 3VXUB 1ED3B 1UWGH 3AMKA 5DS8A 2FB4H 4P4RA 1KIPB 2J8OA 4KMTL 1MCOH 3C8DA 5GGQL 3L5WB 4JKPH 2HTLD 4GRLD 3PWLA 4WHCA 1LDSA 1LK2B 5HGGS 1KCSL 5HYSA 4DCQA 3O6LH 3OKKA 5JIKA 1MH5B 5CEYB 3OJ2C 2XPGA 1MEXH 1PLGH 1S9XA 2DD8H 1P84J 3G6DH 3SJVB 1PYWB 1IKNA 2Z35A 4L8DB 3LKQB 4KDVA 3MV9D 2F5AL 3FHAA 1OAYL 4YDLC 2VMFA 1MLCB 3ES6A 4IIQA 1A6AB 2Q87A 1JK8A 4Y16C 3U9UB 2IQAA 2Y23A 1KNOB 2CUIA 1DN0A 3CZJA 3MRKB 4PRHA 4O5LL 3FT3A 1R5VA 2C4FU 5J06A 2GK0B 4QTIH 1I75A 1FL3A 4ZDHB 3GSNL 2QSTA 4PGBA 5IWLA 2NY6C 4LF3A 3T0BA 4I5BB 3MREA 5IM7B 3ZDYE 4TUOB 5HGAB 2B4CH 3GNMH 4JZNA 4MDIA 4K94L 5E4EB 3KPNA 4P5KA 1CD9B 3WUWB 1UM5L 4XNXH 2OXGA 4LCWD 4R6UA 4FTVD 5JW4Q 5E7BA 3GO1H 4I3SL 4G7VH 2XA3A 2IEPA 4F37K 2BC4B 1KEML 3JV6B 2CDGA 5E9DA 1R0AH 4F33A 1KTKE 1FNAA 2LTQC 4QT5A 2P43B 3MUZ1 1Q94A 3LAFA 1K6QH 4PRAB 3QEQB 4O2FA 1G7MA 2CJUL 2QV2A 3RGVA 3DX7B 4J2XA 1KJMB 1FZMB 4F3FA 4N9GA 1FGVL 3BQUD 3VI4E 4MJ5B 1P7QB 3BJ91 1C08B 2VISA 1K3ZA 4LSRL 3WO4B 2LABA 4XPBL 3UTZA 4YFLF 2WWKT 4WV1B 1LO3H 1I3GH 1XGQB 5I1DB 1UZ8B 5IKCB 4GRLA 3HAEB 3WD5H 4PJAB 4PB0H 3P4MB 3OKOA 2V17L 5AYUH 5E9DE 1ZHBA 3S36X 2F15A 4MGXA 3JWDH 4NJ9H 4JHBA 3C8KB 1PKQA 1PY4A 2X44D 4Z0XA 5B4MD 4WEMB 4O9HL 1CICC 1FE8L 3SDXF 1B4JH 1TZHA 4PJEA 4K23H 1A4JA 1V7MH 5EA0H 6FABH 2BNQA 1XGRA 2BVTA 4F9LC 1AY1H 5HYJD 3W9EA 4QRUB 1KJ3H 1G7HB 3WFDL 4Y5YA 5IW6B 5LGJB 2G9HA 4MD4A 1CXFA 1XF5B 4N0YL 4D94A 1DE4B 1T1ZB 5FGRA 2YD7A 2MTPA 2HJFB 3GKZA 1XIWD 3EOTL 4UILH 5D93C 1Y0LA 3S36H 4TQEH 1S7VA 3G08A 1IRAY 4DKEL 1AHWA 1JUFA 2ZCKH 4K3JH 2IAND 2QADB 2I5YH 3MV9E 4N90D 4P46C 3ROLA 5IJVB 1DBKH 1MFEH 5GGVL 4LCWA 4JHZA 2VC2H 4KK8C 1ZHNB 1IQWL 4NC1C 4E41D 5E1HB 4OT1H 4FQCH 3DTXA 4HCRL 4ZUWA 1IFHH 4ETQA 1KCVH 4IRJB 3F7QA 2N1KA 3O3AB 3K8MA 4JZJC 1VACB 1CE1L 1G7JA 2HVJA 2VE6B 4RNRA 5T1DH 5TH2A 3B9DA 4X9FA 1G6RB 2DQUL 3BQUA 4YUEL 2H26B 2XZAH 4XTRC 4NNPL 3V0AC 3MJGX 2VXTH 2RIKA 4KJQC 5EU5A 4G8GD 4PJDA 4S2SA 4B0MM 3O9WB 4LCWE 5F88A 3MTRA 4FTVE 4AQOA 3ULVC 1WF5A 1R6VA 1CBVL 2QQNL 4KVNL 1DLFL 3QCVH 5I1AB 2CRMA 2DM3A 3KPQA 5ESQB 1PZUB 5I73B 3FQRB 2HLFC 3PWJB 4NQDB 1AE6L 2B8OT 2G2RA 4XH2B 4PD4J 5IVXA 3BW9B 5ILTH 1FNLA 1KB5H 3A67L 4LSDA 5JW4N 4KY1H 2Z93A 4AT6A 3FO9B 2GFBB 2QR0B 4YE4L 2D7TH 3ZHDA 3QIWC 5DRXB 4YFEA 4Z78A 1BGXL 4PRIA 3GSOB 3GJFH 3LQZB 3PWVA 4G43B 1HHIB 3UO1L 4NKMA 1JRHH 3BEWB 3BP5B 1YEDA 4IRSD 4OCXH 4OM0L 5HYJA 2WMPA 3R1GH 1JNLL 4FZEL 3DO3A 4X7SL 3LV3B 4IS6B 4PRPD 2B2XH 4FABL 1FVEA 1KTLB 4LLAA 4XNZB 1LEIB 2XXCB 2FHBA 2OZ4H 1AGBA 1CFVH 3SE3C 5DQDL 5IV2B 3IDYB 5FGCE 2OK0L 3F7YB 5IVXE 2BJML 4OKDA 3EJZC 2Z91A 2NXYB 2WINB 3BP6B 1CK0H 2P49B 5E5MA 3AB0B 4JB9H 5CP7B 1XH3B 1SQ2N 2P48B 2YPLD 3MRBB 4K2UL 2A2QT 3B9AA 3O2DL 3GMRA 3O3DB 2R15A 5HYJE 5IHLB 4E41A 4HJ0D 4PJ7F 4EIGB 1QLRA 4P57B 1HCFX 4OB5H 5E00A 2FBJL 1DQQA 3CMGA 3FB8B 1K4DA 4UBDC 4BSVA 5I18H 1YEGL 3QDGA 3IJHB 3L5XL 3NIGE 1N8ZB 3BN9C 3GSXA 1HHJB 5IROA 2RJMA 3K74B 8CGTA 5TE7L 5DGQA 3WO4C 4JY5H 1NJ9B 3FO2B 4WI6A 4YQXL 5J7CC 4I0KA 4HG4J 3D3VB 2IANE 3EUUA 3C9NA 5IB2A 1WWAX 1W72H 3RJQB 1XGUA 2CGRL 5H2BB 3KLAA 1PD6A 3LPFA 4LMQE 4MZ3A 4XXCC 4PJ5B 4E41E 3BAEH 3CDCA 2H9GA 5IFJB 5CBAB 4NQVB 3QWOA 4M6AA 3T4YB 1J0ZA 4LU5L 5IHBA 3QIUC 1BX2B 4YDKH 3CFKA 3QDGE 5GISH 4XCFH 5BV7C 5EZJA 1YY8A 2KZWA 2ZNXA 1A1MA 4LDLB 4UMGA 5FK9B 2AXHA 1J9CT 2HT4D 5CP3H 4JQIH 1NBZB 5I6XB 3DVNA 1T80A 1AGDB 2IFFL 5DJAA 4JO2L 4F58L 4LNRA 1FGNL 4HX1B 3RIFK 1D7FA 5EUKA 5CHNA 3RQ3A 5IBLD 4G8GE 1NGPH 1BECA 2EDRA 5GGSY 5AD0A 2D0FA 4GW5A 5ESVA 4MSWB 2IH1B 1T1XB 5JXAH 4X6FA 5IFAL 1GJIA 2B39A 3LEVL 5B38B 1KB5A 2GCYB 4HIJB 4YIQA 1KLUB 4HIEA 4L3CA 5EOTB 2HLAA 3E8UL 4IMKA 2XQBL 3AUVA 2AV1B 5IBUG 4S1QH 2FO4A 4E0RB 3UTSD 2F5BH 3C5JA 2X4NA 3O4OC 4R8WH 4EZMA 3ZHLA 2EKSB 3MRLB 3O3EB 1M1SA 4OCMC 4R4BB 4RAVA 1MJ8L 4KDWA 3LRSB 4U7SA 3ZE2F 4BSWA 3DO7A 5T1LA 5HYQA 5FYJU 5D7IF 1XAUA 4IRJC 4A6YH 5K9QG 4YJZL 4XVTL 4OF8A 4PRPE 1WLHA 1F8TH 3OKLA 4OFKA 4MNHB 2BERA 2Q3AA 3V5DB 4OUOA 2EDOA 2HJLB 1D3CA 5TE4L 3ILQC 5DJXA 3WJLC 4R7NB 5E8PB 5FYLH 4MZ2A 3O9WC 3P9LB 3ZDZF 1QR1A 4YXLL 2HT2D 3AU1B 4MAYC 1MAML 2VXUL 3V6BR 1F4AA 1ZHLA 3HUJF 3T0ED 1KCUL 3B2VL 1TJIL 1OQXA 2UVEA 4EOWH 4OTXH 4DOHE 4QHLB 1HHHA 5I73C 4NWUL 3N1MC 1OLLA 2OSLA 5HXMA 1CFTA 1I7UB 3T3PF 5IMOB 1QEWB 3ARGB 5FYLD 2V5MA 4LNVA 3HZVA 5BVJA 1KB9J 3T77B 3GMOB 3V4VH 3QEHA 3TCXA 3EKCA 4U6XA 4YDIL 1R5IB 4UIMA 4K3EH 1BEYL 1A9EB 1DBBL 1E4XI 4QOKD 4P3CH 3DBXA 4P5MA 1BHGA 4PJIE 2FH6A 3RI5F 4P2RB 5D2NB 1RIHH 2MQ0A 5C0GA 4GKOA 4LCUA 3QULB 3NGBB 4JM2C 1G9MC 2QKIA 2FEDD 4XNZC 5IQ9A 3VWJB 3QO1B 4ZO8A 1T1YA 3B6SA 3IDYC 1QLEH 4HJGB 3RY4A 4XWOD 2VDNH 3VFMA 1I9RL 3AB0C 4KZEH 2RFXA 1KPVA 3MNZB 2VR4A 2CLZA 3UTSA 1KEGL 1JPTL 4LCYB 3ARWA 2VR5A 4WHYH 1SEBA 3DARA 1YUHB 1MCWW 3QEUA 1QUNA 2DTSA 4X6CB 4X9HA 1QO3B 3IF1A 3OJDA 5T5FH 1RMFL 4YK4C 2YPVH 4XPFL 3TO4B 3FRUB 1IKFH 2VQTA 3VFTA 3WBDA 4LKCB 1RZKH 4DK6A 5TF1L 3BPCB 5HDBF 1DSFL 5DD6A 2AJVH 3AY4A 4GS7B 1NCBL 4K3DH 4HIHA 3UC0L 2YD9A 5C2BL 3DV4B 4JFHD 4OFIA 2NW2A 4F7EB 4PJHF 3CK0L 4I48B 3VD3A 3EHBC 2RBLA 4DQOL 5E8DH 4XT1C 3UTSE 3QG7L 1DUZB 1FFOB 1Y6NR 3FN9A 1NBVL 3TPUA 3O0RH 4LARL 1A2YB 4TNWK 4R0LB 1F2QA 2NXZD 3CLEL 4XP4H 4MJ6A 3CFCL 4PJ9D 1K8DB 1T3FB 5CBEA 3MMEA 3VXMD 4XCEA 3M8OH 4U1GB 1I8IB 2AI0L 3ARTA 5BS0D 3A0OA 4KKCC 2NNAB 4BFIA 1UG9A 1KN4H 4GXVH 1HQRB 4Y16A 2UWEF 2GSGB 3FZUC 1ZVSA 1PVHA 4WI3A 3X3GH 5F1NA 4K9EL 3OB8A 3CSBA 4IOSD 5I6XC 4XCNB 3WHE0 3QFDA 3EYOB 3TBTA 3UBXI 1SJXA 4QOKA 4EDXA 2V7HB 1ITCA 2EIZA 1BAFH 3S3PA 1KTRL 1N5AB 4OZGE 3VD7A 5MEOA 5CJOL 5GGTL 2VIRB 4XPGL 1U8OA 2APWA 4H5SB 3HG1B 1LP9A 1IGFH 4PRDA 4NC2B 3T0EE 4JG1L 3T0AA 3L1OH 3MYJA 1FNEA 3DX9A 3DYPA 5HVFB 2OTWA 3QDMD 4Z7WA 5F6IB 3PP3K 4ZS6C 3QEGH 1NCNA 5C0EB 4RZCA 2CLRB 3RY5A 1R3JA 4WTZA 2DLTA 3PIQB 4HWZB 2RHEA 5E94B 5KVMC 3QT2A 4KI5F 2DOCA 3SO5A 5FYLE 5SWZD 1Z2KA 5D9SB 4RFOL 1IC7L 1ZLVK 5FO8A 2WAHA 3T2PA 4HZLB 1A1NB 3G5YA 1OAXL 4MQ7A 3H3PL 3NOIA 3MOBH 1A3RL 3OKEB 4QOKE 3MNWA 4X6EA 4DVBB 3E6HA 3LHPL 2CR3A 3GI8L 4R26H 1LP9E 4UIKL 1MHPH 3RVXD 3TZVB 1U8IA 2BY0A 3KPSD 4Z7WE 4JO1L 1JHTA 2VO5A 1L6XA 3EFDH 5HHXL 2YBRB 1IM9A 2OCFD 5KAQG 1XIWB 1SY6L 1OF2B 3UPAA 2PR4L 3F7PC 3BPLB 4FQLL 4XMPL 3LQMA 5I8EB 5JQHC 4RWYH 4PTTA 4XHJD 5I16A 4HULB 4GKZB 3U79A 3KNBA 4PJ9A 3UPRB 3D9AL 3OKDA 2VERN 3VXMA 2IG2H 5KN5B 2VDKH 1MWAL 1MREL 2GQHA 4F9LA 3ALPA 3MRJB 4YEFA 3I6GA 3FAWA 4LHUB 4TSBL 4ZQKB 4PJFB 3B5HA 1S3KL 2VUOA 3KPPA 4RMRA 4BKLB 4D3CL 2P5WD 4YWGL 2YRZA 3T0XA 1EFXB 4JFHE 4OUUA 1ZS8A 5DQ9B 2BK8A 1A6VH 4E5XB 2DQFA 5IT2L 3T2NH 2FDBP 1A7QL 4JKWA 3JWOH 4D9LL 5D2NC 3MLYL 2AEIT 4Q9QH 1E6JH 2P8LB 4NIKB 4NQXA 5F8QC 5K9JL 3VWJC 3H0TB 4JPVH 2VH5H 1AD0A 1AQKH 4G8GB 2AJUH 4NN6C 4BK5A 2P7TA 1ZOXA 4FQQB 4P46A 4I3RH 1DQMH 4J6RH 5F7EL 3VXME 1HSAB 1EZVX 1NMCB 2H6PA 3CVHL 3X12B 1DN2A 2DQJH 2GW5A 3PNWA 1C12B 2JB6B 3V2AR 5J57B 2IPUK 2QQLL 4G9DA 1EEZB 3GHBL 4WVRA 3QCTL 4UNUA 2EZ0D 3TO4C 1Y6KR 2A9ML 3WIFA 3HRZA 3QQ4B 4JZJA 5IHZA 3LZFL 1FC1A 4IRSB 1ZLUK 2FR4A 1DP0A 1N26A 1T7YA 1LE5A 4JDVA 3DGGB 4Y7MA 1NCWL 4UB0L 1EO7A 3QDME 4GW4A 1RJZB 4PRPB 2GSIA 1L0YA 2ICWJ 4DGYH 1KIPA 1LO5B 2JKXA 1G9NC 4RMTA 3DUUA 4WTWA 4OGYL 5K9KA 5T33L 3O3UN 3K80A 2IPUG 3PG2A 4NO0A 4XCCL 1IL1B 1MH5A 5SWZE 1KT2A 4LEXL 3DX6A 3BH8B 3VDCA 5L9DH 4R0LC 3GJFB 5EFIB 1X5LA 4XXDA 4I0CC 1CD1B 3PE9A 2YPLB 3QZWA 1X5ZA 4DN3L 2YXFA 3HC4H 1ADQA 4U1GC 3EZJB 5DT1L 4NQED 3QIWA 4YBLB 2EICA 2KQMA 5KG9B 1WFUA 4XNMA 3BKMH 5HYEA 5FKPA 4JRYB 1XF1A 1YN6B 2PO6C 3WLWD 1CGUA 3SGEH 2VB5A 4OCNC 5F1OB 4GW1B 5TJWK 3RZWA 4R7DB 5DA4A 1IZKA 4ZDHA 1B2WL 4OGXH 3NBNA 2W91A 2BDNH 1GC1C 4I5BA 3ZDYF 5DQJB 2CUMA 3SE3A 5KS9B 4TUOA 5HGAA 4PJIB 4HIIB 4QY8A 1I7RB 4LFHD 1JWMA 5EN2A 2VDML 3WUWA 4MCZB 4K7FB 1YN7A 4LLWA 2LVEA 4HBCL 4GAJL 4OLZH 5I17B 3OWEA 4WCYL 4PLKD 1BIHA 2DKMA 1DL7H 3ARXA 4OZFG 3DXAA 4L4TA 1KXTB 1TETL 3QUKA 4O51A 3HZMA 1KTDA 3NZHH 3OGCA 2Z4QB 4M7LH 4QXGH 2P5WE 2E9BA 2AERT 4O02H 4OCSL 2ZUVA 4MJIA 4LCCB 1GGBL 1S5IH 3QQNA 5AUMA 1FZMA 5GGRA 3F58H 2EDTA 1Q0YL 4K3GA 5DRZB 3MLSH 1C08A 1TCMA 1W72B 5DLML 2DDQH 2XA8L 5C0AA 3TZVC 4UTAH 3CVIH 2C1OB 2DLFH 5EOQH 5J9PB 1T7VA 2X1OA 3CD4A 5IMMA 3D85D 5MEQB 4HIXL 2WWMD 1RPQA 4R9HA 4I18C 3AREB 3H9SD 1KACB 3PWPD 1F97A 1WBZB 5FF6A 4UTBL 5CILH 2XKNB 3QUXD 3BGMA 3P4MA 4PREB 5EBLB 3MZGB 3WFHA 3V6FB 3HI1A 4XXCA 3BPLC 1TNMA 5KSVB 4JY6B 4WEBH 4WI2A 4NZUL 1JF6A 1IAIL 4TSAL 3OX8B 3QIUA 4JFED 3ISWA 1YEFH 4MJIE 3TF7C 5DR5H 2K7PA 1EFQA 3QH3B 1EEUA 1RZ7L 2F58L 2DL9A 5D2LE 1BOGA 4LIQL 1LK3H 3V0WH 1GAFL 2IPTL 2R23B 3MRMB 4M7KL