5D7IE

Structure of human mr1-ac-6-fp in complex with human mait m33.64 tcr
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
200
structure length
200
Chain Sequence
b'GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVMDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 200
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7iE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7iE02
1P84J 2Z35B 4MD5A 1NMBH 3VE0A 2C1PB 2DIAA 3WCYA 1YMMD 1P9MA 4K2UH 1C16B 3BHBB 5F6IC 1JGLH 1KBGH 2CIIA 2GCYA 3EKCA 5GGRY 5FA3B 4JR9L 4QOKB 3X14A 1H8OA 1G7PA 2E9JA 3OR6B 3CX2A 3QNZA 4R2GD 3MCKB 3O4LD 2AV1B 1HWHB 1UB5A 4QTIL 4BFIA 3O6KH 1I1AD 2YUVA 1SHMA 3HE7D 3DGCR 3MRRA 2VDPH 3QG7H 5TDOA 4OB5L 3SE3C 3KG5A 3KPSB 4WW1B 5FCUH 1PG7L 4MQXC 3C5ZA 3TWCH 1LE9A 3GM8A 2VDQH 4JCLA 1CBVH 3S35H 1WF5A 3QIUD 3DWTA 2CH8A 1KG0B 2E9BA 1IC5H 4HKJA 3W82A 4R4BA 3QHTC 1RUQH 4CNIB 3SJVE 2CDGB 2EDTA 2F19H 4S1DD 4QHMA 5DJ6B 3HI1A 1A7RH 3MOQA 4HUXB 4YHIB 5I1CL 2GSGA 1HOCB 3UAJC 1X9QA 2VISA 1MHHB 3BGFB 1BFSA 3I6LD 4ZFOB 2ICEB 2Z92A 1UB6B 5DQJB 4FQ1H 3ARGD 4LCIL 3QUKB 4KJQC 3L5JA 1KB5B 1U91B 2QHRL 4X5WB 4XMPH 4NRYB 5FGSA 1TTGA 5DHVH 1LDPL 2YPVH 3MROA 5BRZD 3B3IB 5SV3A 1TJIL 3NFSL 3RGVD 3RU8L 3ARRA 4IMKC 4E41A 2Y7QA 1XCTB 2IG2H 3KYOB 3IRPX 1X6NA 1B4JL 4KK8D 4TSCH 5BMFH 1JZ6A 1NLDH 3LPWA 4RBPH 4M7ZC 4IIQC 3JV4A 5GS2D 3NAAH 5JPNA 2NY4C 1G6RL 1MVFA 2XQBH 2R23B 4HJJL 4XH2A 5JTWA 5EIQA 1KN4L 1UG9A 3UYPA 5E6YA 3GBML 5F8QC 5F70A 1N7ML 5TDNB 3ECBB 1YEFL 1BREA 4G6AC 5E2WH 3HPJB 5BXFB 4I0KA 5T3ZL 4P23A 5I1KH 1RJYA 1KIQA 1TQCC 5CJXA 5DD5H 4HWZB 2A6IA 2A0LD 3IETB 4UBDC 4F58L 1FZMA 8FABB 1MCJA 2VLMD 2R1YA 3UROR 5FUOL 4IRJA 3VDAA 4Z7WA 3ILPA 3D0LB 2EXWC 1Q0XH 1NAMB 4PJXA 5HHOE 4TOYH 4U6HB 3N9GL 1R5WB 2JELL 4Y0GA 4IS6A 3MCLH 4UQ3B 4OD2B 3ETBF 1Z5LA 3WE6A 3PV6B 1BD2B 5DRWA 3L95A 3HB3D 5EIIB 4I4WB 5TQ2L 4FXGB 4HH9A 1DLFL 4RA0C 1UM5H 5MERA 4Y19B 2VKWA 2J8HA 3ZDXF 2R4SL 1MHPH 4Y2OA 4RFEB 3DUUB 4K94L 4DGVL 4AENA 1ZT7A 3GMRA 3ROLB 2YN5A 4OZIE 1T22B 5EU5B 2Q86A 4MA7L 1MI5A 2B1AL 4WFFE 2F74B 4ZDHB 4I5BB 1NMAH 5HHPA 3NGBC 3WFCL 1ZWIB 2IFGA 5IB4A 1YN7A 5F9DC 4H26B 5I8EA 1IAIH 1VEPA 4LCCB 3W5MA 2DDQH 3TZVB 4N9GA 2UWEB 1GGBH 3C6LA 2IPKA 6CGTA 2IGFH 4WWID 5D2NA 4GAFB 1NFIB 5CSGA 4FMKA 2ESVE 3PGFL 3V5HA 1N59B 4OSUL 5TH2B 5F7UA 5LXGH 5BJTB 1OOAA 3E6HA 2FBJL 4O02H 5K9JH 5ICXA 2MOVA 3I6GA 5C8JA 1D3CA 1VFBA 2OJZH 3T0VA 3N85L 5T5FL 3LEXB 2FX8H 5J56B 2R9HC 1PDKA 3O3BB 4KPHH 5ALBH 1GVIA 4I13B 3W9DB 3BEVA 4J3TA 3MJGX 4H20L 4LASL 1OHQA 1ERNA 2BHZA 4H5SB 4JFQA 1OAYH 5SWZA 3RHWF 5JOPE 4W70A 4L4VE 2N4IA 2PUQT 5FYLL 5FV1L 3FTGB 4KTYA 1VADA 3MA9L 3QDMB 1S78C 4NFCA 4JVUA 5D1XB 4GRWF 2CDEB 1S7UB 5DJZA 2B8OT 1BLNB 2WQ8A 2HWZL 1G9NC 5HHXH 2CD0A 5BO1L 1I3RB 2JB5H 3GM0A 4KQ4H 1KELH 2XZQH 1BMGA 32C2B 3PV7A 3VGAC 3O3DB 1FQ9C 2GEEA 1XZ0B 4RMTA 1A6ZB 2VDOH 2MHAA 3DMMC 3BDBA 2BVOB 4F2MB 2IEPA 5DJ2A 3O81A 3VRJB 3OR7A 2DRUA 4ZFOL 1Q9OB 1MF2H 1P4BH 1OTUD 4K7PX 3NFPB 5J9PB 4HPOH 4K55A 4DN4L 1KB5L 4H25B 4LLQA 4JFEA 4PJ9B 4WHYG 1W72A 2V2XB 3G5YA 1ZV5A 2IPUK 1MIMH 5CBEB 2OP4L 4YXLH 4U6XB 3U6RA 3TNMA 2AXFA 2EE2A 3DSFL 4XBPA 5L2KB 4ZPVB 3TH3T 3RAJL 4OAWA 3RIFF 2BXYA 3IAQA 2N7BA 1YECL 5EWIL 4NM8H 4ZQKA 3N06B 3QUML 2EO9A 2AABH 2AKRA 1RZ7H 1BJ8A 4UUJB 4PJCE 2H45A 4N9OB 1EAPB 4LGRB 3UZVB 1PGRB 3VXRB 2GSIA 3T8XB 3VCLA 4TSBH 4M6OL 5J7CC 4MXVE 4Y1AA 4ELMF 3UTPD 3S3SA 3IU4L 4YX2L 4XNMB 2X7LA 4OGAC 4U3XA 3VXMA 2LE9A 1P1ZA 4RGNB 5FCSH 5AWNH 2VAAB 2RFXB 4CW1B 1WQVT 1QBML 2VH5L 2CO7B 2IQAA 2QR0A 4U31A 1BOGA 2PYEA 4N1CA 1KC5L 3OX8A 3DXAA 1NAML 1FCGA 3ULVL 5KVEL 2D7TL 4NPYB 4UT9H 4XBEH 4DQOH 5E94A 1H3XA 4UTAH 1FH5H 4MA8H 2MMXA 1AO7A 5CZXD 1TCRA 1QSFB 2E3VA 3BI9X 1EO7A 2BDNH 4XNQB 3CNKA 4MQXD 2F53A 4PGCA 1N26A 4WI5A 5IR1B 4PJ8A 5EOCH 1MAML 4G9FA 2FHBA 1WFTA 4WEMB 3L3JA 3V5KB 4IOSD 1PLGH 4TVPL 1WTGT 2FGZA 5B39G 2Q76A 2N56A 1UGNA 5I8CA 1GGUA 2IBZY 3T0EE 1RD6A 5CP3A 4YHZL 2AK4B 1RIHL 2Q8AL 5E8OA 3MXVL 3IDNA 4U1HB 2VDNL 5E6IC 1INDH 4M43L 4JANA 1XEDA 2DQEL 5MENA 1XR8A 3GMNA 4W4OC 4L29A 2BNUA 1HXMB 1K5NB 3LSOA 1I9RL 3ARVA 4KJQD 4KKBC 4RFNB 4KY1H 1N5YH 3HRZA 3CFIC 1H3PH 1OGTA 5J1TC 3OAYK 1KJ2H 3QXUA 4X98B 1IMHC 5GRJL 3A6OA 5EZLB 5FUZL 4R7DB 5FK9B 3RL1A 1UM4H 2IQ9L 3HC0B 1MREH 2UZYB 5FDWB 3WD5L 2AXGA 1M7DB 4K9EC 4D8PA 4XPBL 2EICA 1T1XA 3QEHB 3WXWL 5F7HA 5IW6B 5JR1H 2NY4D 5DMIH 4P3DA 3T2PA 3RNKB 4F33A 5DMJB 3QFDA 1DUZA 4JHWH 1PG7X 3KR3H 3PQYB 4J3WA 5IOPA 4LCWA 4QNPE 4GW1A 1NCWH 1MRFH 2F8VA 3DX7B 5KSBA 4OM1L 3B5GA 2NX5B 4GAJH 1F13A 2HH0L 4MB3A 2CK0L 2EYSB 4UU9B 3IXTB 4OTXL 4LSVL 1MRDH 3IT8D 3WS6C 1ZGLM 4OLWL 4GBXC 3O8XB 4NQXB 2DQHL 4LSPL 2PW1B 2G60H 1NH6A 2FJGB 2EXWD 5IHZA 2H1PL 5L9DH 3KXFB 3EYFA 1B2WL 3VFWA 1UJ3B 4PJHE 1AGCA 3P3YA 4YDJA 5DR5L 5HGHB 4P4RB 4YDKH 1FORL 3V95A 4Q6YA 1QLFB 3L3IA 1C5BL 2B0SH 4XGZB 1HIMH 1JV5A 4FQXD 2IAMC 4P2OB 5GQBA 4FHBD 2ZUYA 3D39A 4OCYL 4MZ3A 2FECL 1NDGB 2WSKA 4APQB 1GH7A 4CBPA 2KL6A 2JF1A 3EYQD 4I77H 4U3CA 1S7RB 2EDOA 2X70B 2EE6A 4XZUB 4DCQB 1IEHA 2H3NA 1QRNB 1NBZA 5K9OA 3JWDL 3MLVL 1VACA 5D5MF 1I1RA 4RA3A 5I9QB 4GAYB 1A6AB 3O3UN 4MWFB 1FZOA 1OCWH 1UQSB 3QDGA 2EDBA 5CJQH 3GBNL 4A6YH 2ARJB 3ES6B 5ITFA 5FM5M 5I19H 5EU4A 3P4OA 4ONHB 2Y5EA 3BDYL 4NKIL 1T4KA 1F11B 1MCOH 3NIGF 1F2XK 4N0RA 5BQ7A 1ZA6B 3EHBC 1FNEA 4WGVB 5D8JL 4LU5H 5JIHA 1YC7A 4O2CA 4K3GA 1KCLA 2YR3A 4HC1H 3SDCA 5DC4B 1NBYA 3NBNA 1UWXK 5JW5B 3IFPB 4EI5C 1GZPA 5JXED 2A1WL 2FATH 2FHFA 3CMOL 3IDMB 4Y5YB 5ECJE 3KPQA 3U0TA 5TGBB 5IQ9B 4HC1A 2RCSH 3QWRA 1JGLL 1HWGB 1KBGL 1MUJA 1ONQB 1AGDB 1H8NA 3NZHH 4WNQA 2R9HD 1XF4B 3LIZL 5DLMH 5IJVA 3O11B 4XNYH 1FL3B 2OZ4L 4PR5A 1RJZA 5C0CB 4PJAE 1NEZB 1OD9A 3PP3K 4AT6B 3S6CA 1NJ9A 2VDPL 3QG7L 4HT1L 2O5YH 5JW4M 4YHPA 4DVRH 3PHSA 3TWCL 2VDQL 5L0QB 5HHME 5DJCB 1CBVL 3S35L 1KLUB 4EBQH 43C9B 2P5WB 3MRMB 1IC5L 2B4CC 1F3DH 1JZ2A 1FG2A 1S78D 4Y5XC 2XOTA 4M5YH 3VXUD 2F19L 2DQGL 2R2EA 2P24A 3MV11 3TCLA 1MCNA 3I3DA 5MI0B 1AC6A 1EFXD 2BSED 4X4YB 1JZ8A 1A7RL 3SKJH 1NCCH 4UZGA 3WDHA 3GEWB 2I5YH 2DM3A 3D1MC 3ZYIA 2YD7A 1RZ8A 3DMMD 2NTFA 2F5BH 3KYMB 1PEWA 1X5XA 2HAZA 2CDFB 1FFRA 5HHOA 2GJ6B 3BP6B 2Q7YB 1UXSA 2BXZA 4UAOC 2VLRE 5HTSA 3C5JB 2YPVL 1S9VB 1F6AA 3MV01 3BQUA 3HNSH 5LKNA 1FZJA 2IG2L 5I76B 1Z9MA 3DBXA 4ZOEA 3ULUE 4TSCL 2Z93B 5BMFL 3DRQA 3OB0H 2W0KA 1NLDL 2ZUTA 5ESAB 5AYUL 3PWUA 3NAAL 5J06A 5IMKB 1U8KA 3KLSA 3ROOA 3PJSA 2XQBL 4LAQH 4XP5H 4R0LC 5E1AB 1XIWB 1FLTX 5C0BA 4WHYH 2MFNA 1RU9H 3KPSD 1DE4A 1B0WA 3LS5L 3IKCA 1ZANL 4OGAD 1KEMH 4LKCB 5I1KL 3R8BB 1HQ4B 2CMRH 5DD5L 3CXHK 1LK2B 1CFSA 1DUYB 4WWKB 5AUMB 3WFBH 3G9AB 3LN4B 3C5SA 3CFCL 4NO0D 1Y6MR 3E3QC 3MLUH 3AFLA 3SY0A 4QRRA 4Z7UF 2UV3A 5C0EB 4JY4A 1X5KA 4LLWA 4L3AA 5EO9A 5F89B 1Q0XL 4B53A 3OXRA 2YPLB 4TOYL 4NO5A 4WW2B 1DDHA 3ULSA 3P0VH 4TQEH 4M1DH 1U8MA 1WFUA 5HGDB 2CO6B 1VCAA 4DZBB 3RVUD 2NY1B 4HJGB 2EYTB 5CZVL 2ZSVB 1H5BC 4NUGH 1C7SA 3GBLA 3OTTA 4D3CL 3CFKB 3GGWB 5EBLA 5JDSB 3C60B 1PZ5B 1S5IH 2DQFB 1QSEA 2CLVB 1FVEA 1V3JA 1T21A 1Q9WB 1YPZB 3L9RA 1MHPL 3OAUH 3WJLC 4GG6B 5D5MA 1LEIA 5DJDA 1VKXB 1FL6A 4XP4H 1GZQA 1LEKA 3RUGF 2Z91B 4JREB 4FQHA 3QYCA 4GW5A 2EKSA 2OJEA 1EA9C 4R6UA 3WO4B 1F8TH 3EDFA 5EU6B 1A9BA 5C0DB 3B6SA 4Z0XA 4FFYH 3KAAA 3RI5F 5E8DH 3B5TA 3H3PH 3TIDB 2DDQL 1GGBL 2RHEA 2IGFL 2I9TA 1MQKH 4HIIB 3V6OA 4KDTC 2J88H 3LN5A 4ZSOA 3MJ7B 3LKOB 1JWSA 5LXGL 3HCVB 3S8WA 4PTTA 1GC1H 4RRPA 5C0IA 3RZWA 3X3GL 3L3DA 2AJVH 2EDRA 4IM8A 1YEDB 4GXVH 2FX8L 1MRCH 4PGDA 1F5WA 1G0YR 1LP9E 3S5LA 4KPHL 1I7TB 1ZGLA 3MLSH 4KK9D 3GMMB 4JRYB 1G9MH 3FQNA 4LPUA 4HMCA 4PG2A 5DK0B 1JNNH 2EDWA 1MOEA 5KBNC 5KVFH 3GSRB 4Q9RL 4RIRB 5FV2A 1OAYL 5LBSH 2E8YA 2BZDA 5ITBL 1P4LA 4PREA 2BVPA 4NSKB 4FQ2H 5EUOF 3HNVL 4HGWA 4Y16B 3MREB 4OV5A 4PJCA 4Y19D 5DJYB 5E00B 1DQQB 4MJ4A 3U4BH 1ZSDA 4Q7DA 1E0OB 4TVPD 2PTUA 4WFHE 4JN2B 4X4XB 3F12A 1X5LA 1FYHB 5J12C 2NY6B 4GBXD 1X5HA 5I9QC 4HIEB 4NC2B 3QZWA 3OPZH 3DVGA 2DKMA 2JB5L 3LKNA 4KQ4L 2XZQL 3MLYH 4XCYA 3QDJB 1GGYA 3BPCA 1HYSC 4UI2A 5JXAL 2DIJA 1SVZA 1XF2B 4WU5A 3RA7H 3P9MB 1N4XH 3VXNB 1SYSA 2IAMD 1K4DB 2C5DC 4XX1E 4FQIL 4QTHA 1MF2L 1T83A 5I18H 1P4BL 3F7QA 3LQZA 4ODTH 4Z7OE 4KTDH 2VRAA 5DYOB 4CVZA 3TZVD 2XN9A 4QHLA 3BO8B 5D2LF 2GAZB 4N0UE 2LV4A 2C26A 3I3BA 4K8RL 5F1SA 3WUWB 1VESA 1FPTH 1LO3H 4YXLL 2MPAL 3ARDA 4WO4A 1MFNA 3SJVB 1YEGH 1VGKB 4QRUA 3HC3H 5EIVA 5HHVH 1JNJA 4QY8B 5ERWA 4A6YB 1CXIA 1HEZB 5A3ID 3I84A 3QUXA 2AABL 1RZ7L 3DO3A 4YEFA 1IVLA 3IDXL 4I3SH 4TSBL 4XCCH 4UT7H 3OG4B 5H8DA 3AAZB 1NFDB 3BGMA 2JJTA 2ZCLH 4ZUTB 5IMOA 2VE6B 3OKOB 5CILH 4M4PA 1QVOA 1JGDA 5HPMA 5AWNL 2YZ8A 2XRAH 4BH8B 4X6BB 5DTFA 4F7PA 5D1XD 1U8IB 3VRLF 4PLKC 3AMKA 1AR1D 3STLA 4P2CG 2LU4A 1FNSH 4FTVE 4U0RB 3G5VB 4R8WH 5GGTH 2OSLA 2Q7NA 3GSXB 4XXCC 2XTJC 5F71A 2NW2B 3QUYB 4I48A 3QUZB 4XBEL 4UTAL 1FH5L 4MJIA 2P44B 5GGTA 4C4KT 1NUGA 1WC7B 1Z6JT 2BDNL 4PRID 4RZCB 1IL1B 3WN5A 2XI9A 2QQKH 2AEPH 1KTLA 5GXBB 2K3TA 3L7FA 4PJ9D 4X5XA 3IFOB 1G0DA 4XX1G 5AZ2H 3IDYB 5JO5A 5DDHB 1PLGL 5E7BA 4PRHB 2VN7A 4KRPB 4TUJB 3UTOA 5CEYA 2ORBH 1SY6H 3V5DA 5L2KD 3QEQB 3RUGA 4TTGA 4MAYC 1RULH 5KVDL 3QA3A 3EOAA 4OF7A 3CVIH 5D93C 1J5OL 3DV6A 4HKXB 1TPXC 2P8PB 4HCRH 3O6FC 1WIUA 2LABA 1HN1A 2BSSB 3VXRD 4HUVB 4LPWA 4S1QL 1LILA 3ALXA 4KY1L 4QXTA 3EDEA 4PRPB 1N5YL 1FJ1A 2FR4B 4X7CC 4HCRA 5FO9A 5I1LA 2QQNL 1M7IB 1FLRL 4HV8A 2UYLB 3X17A 5DUPL 3F8UB 4WWKC 4WFED 4CVXA 1UM4L 4GRLA 2OI9B 2W65B 1Q38A 3C8DA 3WFHB 1P4IL 1EH9A 2X9YA 1QQDA 1ZLVH 4N0FB 1RZJC 2M8XA 3LMJL 5DMIL 1R24A 4HXAH 1ZLUK 1I85C 3G6DH 1U93A 5KS9F 1MQ8A 4Z7NE 4DGYH 1P7QA 3KR3L 2ZUQC 4Q9QH 1TNMA 2NXZB 1G1CA 4YBLB 3S35X 1QSFD 4EXKA 1NCWL 4XXDA 3FONB 1AKJA 1MRFL 2C1OA 4KTEH 4ZOBA 5EUOA 4YJZL 4MNQD 3NN8A 5ILTH 4GAJL 3KPOA 4D2NA 3AMLA 3REVA 3GUTA 2DQIL 1PKQB 3PWLA 1MRDL 2AJSH 5H94A 1MHEA 2ITDA 4GKSB 5D9SB 5C9KA 2H8PA 2HFFA 4P2QA 5A2FA 3UTZA 3TA3C 4RDQG 2FRGP 4NCC1 4QHNA 3BPOC 1CE6B 4Y4FA 2XWJB 1KT2A 3QHZH 4TSAH 1HILA 4YDKL 1JZ5A 4EDWH 5GZOC 4G3YH 3SO3C 3TO4A 4ODWA 1LD9B 2B0SL 2R1WA 3D2UA 1HIML 3WLBA 1C12A 3MRDB 1UKSA 2HJFA 4B5EA 4XPFL 3SPVB 3TVMB 4U1GC 1CE1H 2YEZB 3FB5A 5TDPA 5ADPH 4UIMB 4X7FC 2X4UB 1OLLA 2JJWA 2A9NH 2L4OA 4I77L 1QFWI 3BFOA 1L4IA 1ORQB 2HVKA 4M62L 3BP7A 4U0QB 5JORB 1IGFL 5K9QG 3GRWL 3BAEL 3K8MA 4O2EB 1RURH 1JN6A 3IFNH 1ZXQA 2GFBA 2H26A 1FNGA 3PUCA 1CI5A 2V2TB 4FMFA 1OCWL 1KCSH 4RFOL 3U46B 2ENSA 5CGYD 1U8HB 5CJQL 2A73B 1EXUA 2MQ3A 4N1EA 4LMQI 3UTTE 4A6YL 5HI5D 1MCHA 5I19L 1RIVH 2CLZA 1HHJA 3ZE1F 1KPRA 5E1HB 3SE3A 1T04A 3EO0A 1KGCE 3DUSB 3PQYD 5IVOA 4NQDB 4M3KB 4PJFB 1IARB 3N1FC 4X8XA 3C09C 2G2RA 5J11C 1OP9A 1DVFA 2DQTH 5B39B 4J4PC 1WBYA 2EDLA 4OGXH 1GHFH 4HKBB 4Y16C 2FATL 3E0GA 5F9JB 5FXCH 2NX5D 4YBQC 2D0FA 1N6QH 2EDQA 4GMSH 5IQ7L 2VDMH 3ULUH 1BIIA 5KG9A 2HTLC 2VLRA 2NY6C 3O8XD 3I6KB 3NZHL 3S3PA 1YDPB 5JHDA 2LVEA 5DLML 4W6WB 1NL0H 4XNYL 5FYKL 1N2RA 5HHNB 3TN0C 1Q9LA 1OAKH 3WEXA 2EEBA 1Q9KB 4WHTA 5F21B 1CN4A 3P0YH 3VH8G 3QWOB 2O5YL 2VLLB 4YFLI 4PD4J 4DVRL 1DBKL 3W81A 3ARFC 5IFAL 4NDMA 1FNFA 4L1DA 4EBQL 5IVXA 4XVTH 5K33A 1DBMH 3H0TA 5EORH 3ZT5A 1S5HB 4PRNA 3C08H 2WANA 4NUJA 3VXQA 1O7VA 3PL6B 1AE6H 3NCBB 3HI5H 3ARWA 1QRND 3RJDA 4M5YL 4IIQA 2WIMA 4MAUL 4X9HA 4UTBH 4ELME 3D0VA 3RKDC 3VFOA 1LWRA 4LF3B 4HPYL 4WI6A 1IT9L 4P5TB 3JVGC 2Z9TA 3EZJB 1CGXA 1NCCL 1Y0LA 2HVJA 3MGTB 4YDVB 2AXJA 2I5YL 5CJBA 2F5BL 4UDTB 4HWEH 3UTQA 1OLZA 1MCFA 5CSZB 1EEZB 4D0CA 3MNZA 2X4TA 1W8OA 4Q6IC 3J7HA 3SDXA 4EN3B 1VHPA 4Z76B 3MUGA 2YS4A 1L9NA 5D6CB 3V7AE 4D0BB 1OARH 1OP5H 2AJUH 4NQEB 2H2SD 3KPRA 1B0RB 5GIRB 4LQFH 5C07A 5KJRL 2KZ1B 4B0MM 3DYMA 1D7FA 2JIXB 4XHQA 5IB3B 4XC1H 3SOBH 4Y8AA 2RBLA 3VFUA 5C0JA 3RWGB 5KS9A 5C0CD 3X12A 1AD9A 4CMHC 4OBRA 5FOJA 1YYLL 2W1NA 3PWPA 3MOAH 4H8WH 1RU9L 2P8LA 3DI3B 3I75B 2D3VA 4TUOB 4Z7VF 1T3FA 3VWKA 4YFEA 2A9MH 3B9KC 2R1XB 3MV8E 2P5WD 1P69B 2CK2A 3IDGB 4NZUH 2FEEL 1AGBA 2CMRL 4ZFGH 1YC8A 1OTTD 2NNAB 3MLUL 3VFPB 4FABL 4NQCB 4ZD3L 5I74B 3SKUD 5DJAA 5DVOA 5D1ZB 1T20A 4MNHB 4F15B 2XTJD 3HZYA 1K3ZA 1JI2A 4TQEL 5T1KB 2F54A 1ZT4A 3LDBB 1WT5C 4HHAA 3THMH 4KK5C 4XI5C 5INCA 4NWUH 3LEYH 4NUGL 1FDLL 1A1OA 4NNYA 5GGQH 3U4EA 3QH3B 3TBYB 2OS7A 4JQVA 2ENYA 1S5IL 2OTUB 2HJLA 3IYLW 2GJ6D 4LIQL 1NFKA 3IXAA 2EC8A 4AY0A 2PXYB 5EO0B 1CCZA 1T1YB 2Y9RT 4JO4H 5IFHH 1OSPH 5LGJA 3G6JF 3QXAA 4FP8H 5LCVH 3OAUL 1DN0A 2MKLC 4MNGB 4X6DB 4ODVL 3KLHD 4NNPL 4XP4L 3T4YB 3V7AG 3EYOA 2MSPA 2ZCHH 5HHQB 4UOJA 4HSQA 3AROA 4EUPB 1CIUA 3UTSE 1KXTB 1F8TL 5FM4A 3ZZ1A 2A74B 3O6FD 3CPLA 1ZHKB 4NP4H 2FIKA 4KKLC 5E8DL 4HGKC 4LDEB 3H3PL 3OKNB 4U2YA 3P11H 3QJFA 3BRDA 3H7LA 1FN4A 1MQKL 5D7IE 3H9SE 4JO3L 2J88L 3G6AB 1M6OB 3SDDB 5IROC 1T80A 4MCZB 3CSYA 4OKVB 4H1LB 2ARWA 5JLZB 2GTZB 2COQA 4WWKD 5TQ0L 5JW3H 1GC1L 4LL9A 1KULA 4AZ8A 3FFDA 4ESKA 4JFYA 3AB0C 1MFEH 5GRZA 2AJVL 3PIQA 3ZKXC 4DEPC 1VFAB 1MRCL 3MQIA 1YMME 4WU7A 4OQTA 5GGUA 2ZG3A 4NRZA 2YPLD 3CLEH 4XRCA 3JV6A 3GMPB 5L8KB 5SWQA 3P9WB 2NPLX 4P5KB 5GRWA 3L3KB 4PP1D 1U92A 4K23H 1JNNL 2R69H 3O4LE 3K0WA 3O4OB 5KVFL 3QULB 5EB9A 3CDFA 3C60D 1NCNA 1GAFH 1D5XA 3DX6A 4FQ2L 5FHAH 2WK2A 1G7LA 3GSVB 1H9VA 5J6HA 1J1OH 5D72H 2BHYA 3TBSB 2X89A 3LKSB 3W0WB 4LSRH 5IKCA 1WIPA 3MA7A 4F3FA 3TA3D 4NNXB 1AHWB 2DMCA 1OAZH 2PO6C 1OW0C 3SE9H 1EBAA 3BPNC 1IAKA 3OPZL 5FOBA 1VEOA 2BNRA 3FN3A 4CVWA 4Y2DB 5DF0A 3HI6H 1OPGH 1VSCA 1TJHH 5GHWH 3KHOA 2XT1B 4LCYB 1U3HB 2OR9H 5GZOD 1AQKL 3PDOA 2ZNWA 3RA7L 1D6VH 4JKLA 1QACA 2F5AH 3TO2B 1ZVSB 3L3HB 5B22A 4X80H 1LEGA 4CU6A 5EOCJ 3I6LE 4RAUA 3HAEA 3IAGC 4FFWC 5T1LA 3OWEA 1CXLA 2R4RH 3KWWB 3DHMA 3V6ZA 3C9NB 1IGTB 1LO3L 1AI1H 3BH8B 4N0CD 3TIEB 2YWZA 2W0FB 5BRZE 1YEGL 1I8LC 3PGCB 3HC3L 1BVLB 4PJIB 2VUOA 4MD5B 1JTOA 4G8GB 3VE0B 4MYWB 4IMLB 3FL7A 3CDCA 2NYYD 5D70H 4CUCA 1RK0A 4R4NC 3X14B 1G7PB 3LH2H 1XF5A 2CUMA 5C0AA 3CH1B 2X1QA 5D7JA 4J4PD 4X4MA 4BFIB 4Y16D 5D96C 1I7UB 3S34H 5CILL 4BKLA 2EDEA 4LVNB 2XRAL 3C5ZB 1LE9B 5I71C 5I1HH 1JIBA 2NY6D 4M6MH 1FNSL 5F1KC 2VLKA 1YNKH 3HNTH 4ZFFA 1HH9B 2GKIA 3QI9B 3OXSB 3WFZA 4W4NA 2BP3A 2VXQL 4HKJB 3IS1X 4R4BB 5E6IA 3KLDA 4OZFA 2VLME 5KN5A 4Z78A 1NC2A 4B7IA 4XMLH 3T77A 4AM0A 1EHLH 1BQLL 3MX0A 4HUUA 1JP5A 4IOIA 1ADQH 3HI1B 1E4XH 1PX4A 4ODXA 3RWCA 5KAQF 2GSGB 3ARFD 3SCMC 4JDZA 3BESR 1GGCL 1IFHH 1LO5A 3KYNA 5D7LA 3HG1E 2VISB 3H3KA 3MRQB 4JG1H 1Q8MA 2Z92B 1J18A 5HDLA 5C09D 5CD5C 3ZSTA 3ARBC 4NO3A 1SY6L 1CD1B 4LHUG 2YHGA 1RZKH 3VGDA 3LV3A 3MROB 1QPPA 2NY0B 1RULL 4E41B 4P9HH 2Y7QB 3RVTC 1NCTA 1ZHNA 3OB0K 3NH7H 2VC2H 1XGYL 2G9HA 3F5WB 2L7UA 4Z77B 2GIYA 4JY6B 2YA0A 5B8CC 4Z7UE 5J6GA 3RDTC 5LQBH 3JV4B 5E0QA 3VH8A 1QR4A 3V0VB 4PJDB 5M95B 4UILH 4GLRI 3CVHA 4X6CF 1QFUH 3GJFH 1LO2H 2OM5A 4XH2B 2ILLA 3L3GB 3VJ6A 4NHUA 1BAFH 2AEQH 5E8PA 1Y6KR 4B41A 5EFIA 3EAKA 3UXFA 4K71C 1MFBH 2VLJA 3GJFA 1QLEL 4RSVA 2EIDA 5EZIL 3E6FA 2XY1A 4L3EE 5E2UL 4P23B 5I74C 1RJYB 4HW6A 5E99H 5BZWB 1KIRB 3IVKA 2A6IB 1R5IB 3U30C 3I2CH 3TBWB 1FZMB 3LDBC 5LGHH 2R1YB 4CVUA 1JFQH 4JZOA 4IRJB 4Q9QL 4Z7WB 3ILPB 4OFYD 4KQ3H 4QRQA 4PJXB 4KTEL 4L8BA 3DARA 3B9KD 4DW2H 1DQLL 4IS6B 1NDMB 1BECA 1MVUA 5KVGL 12E8H 2J5LB 5ILTL 5BV7C 3B4NA 4P9ML 3WE6B 3HN3A 5DRWB 4PRHD 3L95B 3QPXH 3KJ4C 3RPIA 1IE5A 1D9KC 1CIDA 2E6QA 5GRUH 5CCKH 3BE1H 2FD6H 5MERB 4Z5RB 5JQ6H 3FO0H 3QEQD 3CDGA 1TVBA 1IGCH 2OL3A 3MJ9H 3MUY1 2IPTL 3MV7E 3QHZL 4TSAL 3FQUB 4LLYA 4G3YL 3PP4H 5JUEH 5ALCH 5FDYA 2PF6A 2X05A 4ZUSB 2CRYA 3GMRB 4OUOA 2BERA 3VI4F 1MI5B 4DUXA 1CE1L 4PRPD 1QYGH 1I75A 5DD0H 5F7MC 3ZYOA 4EI5A 2R0ZH 4Y4KB 2A9NL 4TNWF 5HHPB 3QO1A 3U36B 5IB4B 3SDDC 2Q6WA 3PF2A 5I8EB 1G7HA 1NC4B 2R0WH 1RHHA 4CDHA 5FGRA 3K80A 3C6LB 3NABH 2IANA 2IPKB 1KCSL 4G6ML 3V4UH 2IMNA 4LLVB 4JFDD 1FL5A 4ONFH 3CIQA 3V5HB 4QF1A 2E27H 2IC2A 1IGMH 5IIEA 1UWGH 3U9PL 2VQTA 4M7KL 4KHXH 3T0BA 3O2DH 4GS7C 5ICXB 3I6GB 5T33L 1VFBB 1HI6B 4KKLD 4U1JA 4OF6A 2NXZD 5CGTA 4R90H 3MUHL 1J8HD 1GYAA 3O2DA 2DQTL 4X8JA 5IVNA 4W68A 2FX9H 3BEVB 4OGXL 1GHFL 2AI0H 4Y5XA 4HXBH 1AP2A 4HKZB 4JFQB 1V3LA 3T1FB 3UTPE 1X5GA 3QR2A 1N6QL 1J7VR 4GMSL 3ZE0F 3ULUL 4NQVB 3MV9E 4ZAKC 2VZUA 5TF1H 2DLHA 2HT2C 4PJEF 3KPPA 3WYRA 1W0VA 2H32A 4U33A 3BP5A 4KFZC 1N64H 2WLZA 3RY4A 3RWIA 5DJZB 4E5XA 1OAKL 4JPIA 1JGEA 1U3HC 2O5XH 3VDCA 4KI5D 1WCBA 3SQBA 4M93C 5CP7A 1Z9OA 4L9LA 4G80A 1QTYT 4C83A 3EBAA 4FRWA 1MWAA 2WBJB 1FFOA 4FG6C 4HIHA 5INDA 1YY8A 1DBML 3K2MC 3UPRB 5CEZD 5EORL 2MHAB 1FYTA 3QQ3A 4G8IA 5DJ2B 4FQPA 3OR7B 4ZS6D 2IH3A 2DJ4A 1JPGB 4L8DA 4F7CB 3HI5L 5MEOB 4UTBL 3Q5YA 1FAKT 2LU7A 2WUCH 1CICB 4LLQB 4JFEB 4OD3H 1W72B 1JVKA 5TE6H 2EDXA 4R0LA 1NGWB 3P4LA 3QAZC 3VRIB 3U6RB 2F15A 4JZJA 2AXFB 3LD8C 3FFCE 4XBPB 4RMQA 1X44A 4OAWB 4YK4B 4MHHG 2DL9A 4IEFB 3QFJA 4NQDD 3GHBH 4P2RA 4LRNH 3IF1A 4ZQKB 3ZL4H 5C7XL 5BVPH 2XZCH 3UBXG 2AKRB 4MNQA 2DQDH 4X6CA 3WLWC 1CR9H 1CFNA 5IVZB 2BVEA 5CSBA 1IM9A 5I30L 1FGNL 1OARL 2FLBT 3VCLB 4OZ4B 1RIUH 2AJUL 3KPTA 3ORJA 1TQBB 1U8QB 2V5YA 4IJ3C 2O61A 4IRZH 2CIKA 2X7LB 3O45A 3C2SA 1UADC 1P1ZB 1DQTA 5JZ7C 4XC1L 3SOBL 2V9RA 4KMLB 1JYVA 1H5BA 1I7RA 4R4ND 1QG3A 1QA9A 2IQAB 2QR0B 3ZKNC 1E28B 1S7XA 1BOGB 1QEWA 2PYEB 1WBZA 4H8WL 4XP6L 1SJXA 3UMTA 3OX8B 3DXAB 1BEYH 4NZUL 1TIUA 3HZKB 1DJSA 1L9MA 4XTRD 3Q1SH 1AO7B 1TCRB 3MLWH 4MA3A 2M26A 4DTGH 1P7KA 1MHCA 1I4FA 2QADC 2F53B 3OKKA 4UQ2A 3OF6D 3GMOA 2WZPD 1T89C 4PGCB 1A5FL 3EFDH 2D03H 4PJ8B 5ANME 1BQHG 5D7IA 35C8L 4G9FB 4P5TD 4YUEH 2F8OA 3GK8L 3IB4A 4QCIB 2H41A 4QKXB 2Q76B 3OKDA 3T3ME 5I8CB 4PFEA 1JUFA 1U8LA 1OSZA 4NWUL 3LEYL 5GGQL 3VXOB 1H0DA 1ZLSH 4C56B 3S36H 3SCMD 1JHLH 3NPZB 4EOWL 5E8OB 4D9LH 1DP0A 3IDNB 4LEOA 5TFSL 4JANB 4ZUVA 1VGEH 2W9EH 4JO4L 5CGMA 5IFHL 1OSPL 5MENB 1OL0A 1XR8B 5HVFB 3GMNB 4OZGA 4L29B 3CX5J 2DLGA 4FP8L 3MRHA 1FNAA 3LSOB 3OKLB 3HRZB 1S7VB 1BZ9B 3FHAA 2ZCHL 4BSWA 2FO1A 3MRCA 4P23C 3RVTD 1DQJA 4KZDH 2JIXD 5CJXC 1YEEH 1ZEAH 4G8EA 4N1HB 2NMSA 3HFMH 2WUBH 1ZLVK 3RL1B 1TVDA 1X5FA 2NZ9C 3RDTD 1EGJH 3MYJB 5HD8C 1AH1A 4GMTL 2AXGB 2EDNA 4BFGA 3B2UC 4D8PB 4OCRH 2HT3C 1T1XB 4ACPA 3LB6C 1M05A 5I1EH 5HPOA 3P11L 4P3DB 1FO0H 3MRNA 3BXNA 1EGJA 1EHNA 4RGMC 3S4SB 1MFAL 1MFDH 1DUZB 2V9TA 3BJLA 5IOPB 4LCWB 2GTWA 4K07A 4GW1B 3OKEA 4N0YH 4NQCD 4LLDA 2D0GA 1MFEL 5A16A 4MZ2A 4LHUA 2VITA 1A4KA 1OWWA 3BWUC 3B9DA 4PJEA 1HHIA 4M02A 3CLEL 5GZND 2X6MA 4XPAL 1UZ6E 2DKSA 5T1KD 3K74B 4GRWB 4X7TA 4K23L 2R69L 1IEAB 4ALAH 1KCVH 1KB9K 1A6TA 5GS2H 2EC9T 2RAMA 5IHZB 4U1NA 4M61B 4JRXB 3G08B 5GGVY 1LO0H 3EYFB 4O4YH 2R29L 1G9EA 1GAFL 2GUOB 4YDJB 3SDAC 1NGYB 4J3VA 2J1KA 2PXYD 2D7MA 2DWEB 3L3IB 4JO2H 3GIZL 3DJ9A 1JV5B 2ADIA 4XNZB 4OLVL 4URTB 3ARXA 1D9KD 3D39B 4GXUN 4JDVB 4JM4H 4N5EC 2NY2C 3OGCA 4MD0A 1MCIA 1OAZL 3SE9L 3VMPA 1MJ8L 1UFUA 1K8IA 4PJGF 4DFHA 2BHUA 5D2NC 5IHLB 4Y4HA 3HI6L 5HY9B 2ADFH 3LKRA 3TPKA 1NBZB 3VXUE 1INQA 5K9OB 3WSQH 2P47B 3ZYZA 5C2BH 4NKMB 3WIHH 1FZOB 1IEBB 3P9LA 4JM2A 1KNOB 7CGTA 1T0NA 2F5AL 3MLZH 4NC1C 5ITFB 3QIWA 2BC4B 1VFUA 4X80L 5EU4B 2VL5A 3P4OB 3AS2A 3MBEB 4HZAA 4AYFA 3D9AH 1T4KB 2OK0H 3SDDD 2R4RL 5BQ7B 1X4ZA 4EIGB 5ISZA 1R5VB 3BZ4A 4NO2B 1AI1L 1TZGL 3CGTA 3L6FA 4O2CB 2A6KB 2W60A 4P5MA 2ITCB 4ELMB 3SDCB 1KJVA 1NBYB 3HUJF 5EZOL 3BOVA 3HG1A 3CU1A 2BRQA 4HUWA 4RISH 4JDTH 4XXCA 3RZCB 5HYEA 4ODHH 4ZOAA 3KPQB 5D70L 5HVWA 1LQSR 4QOKE 5JNYB 4EZMA 4MJ5A 3LH2L 5TPWH 1J0IA 3TYGH 5IJVB 2ZWLT 5ICYA 4N8VG 1RJZB 3OJ2C 2CR6A 5DGQA 5T5NF 2HT4C 3LQMA 4GFTB 3CFDA 4EI6A 3KPSE 3T2QA 5BVJA 5GS1A 3TT1L 2N1KA 3W0WD 3FB7A 4OCLC 5KTEH 4MAYA 4M3JA 4CRPA 3GKZA 4M6ML 5JW4R 3W39A 2WWMD 4AJ0A 3K4ZA 4FZEH 2P46B 3QXTA 5J13B 2K9UA 4WI8A 4Y2DD 4H88H 2XPGA 2VN4A 4JPWH 1HNFA 4ISVB 1R3KB 1U3HD 1FVDA 4OGYH 4POUB 4XMLL 4JKWA 4KZEH 2DTMH 5E9DB 3TCLB 4L3EA 5DURB 5E5RB 2FYYA 1ADQL 1E4XL 1DEDA 1JI1A 1XGRB 1PEZA 5F3HB 1BWWA 1EJOH 1IFHL 4FG6D 4YHNA 4HDIA 4TYUA 2M2DA 2NTFB 4J3SA 4C4KO 3M8OH 4JG1L 4L9DA 3V0WL 4QEGA 1CGUA 5EN2A 5MEQA 3QQ9C 1UXSB 3ZDZF 3UYOD 5EOQL 1MIEH 3SKNA 2VXVH 5GSRB 5KSAB 1F6AB 5GS0D 4P4KA 1OP5K 4HAFA 3BQUB 3TBVB 2OQJA 2FSEB 2J4WH 1I85A 4W81A 1KTRL 3NH7L 3FQXA 4R4FL 1QFWM 3DBXB 2GITA 4X9FA 3BMVA 2MQ0A 3MNWA 3DRQB 3KLAA 1CL7H 3PWUB 3FHQA 4YHOH 1FC1A 1N3NA 5SWSA 3LQAH 1MPAH 2Z31B 4UV4L 3MV7A 1U8KB 3QHFH 4UILL 3WLWD 1P5UA 1LO2L 2ED7A 3K7UA 4PJBA 1IKNA 1BAFL 2V7NB 4NN5C 3T0DA 4I0PC 2AEQL 1OGAA 3RVVC 1ZLWK 5C0BB 5DZOA 1NAKH 1MFBL 1E4JA 1DE4B 3C5ZD 2CKNA 1K9TA 3ILQD 5DVMA 4ERSL 1BJ1J 4K7PH 1X6LA 3U7AA 1CK0H 2P5EA 5I0DA 3T3PF 1S9KC 5E99L 3PWJA 2CXKA 4Z8FL 3C5SB 3G6JE 1QZ1A 2R15A 5FECA 3SY0B 1TDQA 3ZKND 4QRRB 1BFOA 3VGHA 1FNHA 4LLWB 5D7SH 4DAGH 1JPFA 5EO9B 4KQ3L 4D9RE 3OXRB 1F3JA 1A3RH 3ULSB 1DDHB 3MLRH 4DW2L 3R4DA 4YGVA 1U8MB 4JG0H 4QWWD 1T7VA 2IFFH 2XA8H 3GSWA 2BMKB 3TC9A 3DOSA 3TT3H 4OT1H 4RNRA 2KBGA 1T2XA 5EBLB 3QPXL 3UZEA 1RUKL 2QSQA 1AC0A 1QSEB 4Y19E 5F44A 5GRUL 3BE1L 5CCKL 1CZ8H 1FVEB 2FD6L 5JQ6L 3FO0L 3GSOA 2Z4QA 2JE8A 2NY0D 4TVPE 4WHCA 1T21B 3U4AA 4PJGA 4E41D 1IGCL 3MJ9L 5I2IA 3HPLA 4U1KB 5F7KC 3INUL 2EC9U 5D5MB 3PP4L 3MV9A 5DJDB 5JUEL 3RBSA 3A6CH 3B5HA 1XR9A 5HYSG 5F9WB 3V6FA 1DQMH 4GW5B 2EKSB 4HLZG 5DUML 2OJEB 2FEEI 5I16B 1M71A 5C0NC 5JIKA 1QYGL 3MLXH 3HE7B 2R0ZL 4QRPA 3VGEA 4HWBH 4LCUB 3P2TA 1OAXH 5I1IH 3MCG1 2ICWB 2P4AB 2UWEE 2HRPH 1HK6A 2DJSA 4ETQA 3AS3A 3NABL 3IAPA 2I9TB 3V4UL 4WI4A 3WKMH 4P23D 3WO3B 4ONFL 1CGSL 4ZSOB 4K7PY 3TN0A 4CMMB 1DQDL 1JWSB 2E27L 1IGML 1ZVHA 1UWGL 3FO9B 4OFPA 4KHXL 3EOYG 2NZ9D 4MDJB 1A7NH 5HD8D 3IDUA 3L3DB 2D7NA 5FIEA 2HT3D 4IRJD 5D6DA 3BKMH 5DUBA 3CDYA 4PGDB 5HGBA 1LVEA 4R90L 2OMBA 3S5LB 3VXPA 1C08A 1A3QA 1ZGLB 2VDKH 3ZHLA 2ICES 2FX9L 4AH2A 3FFCA 4FQCH 3FQNB 1AJ7L 5L2JA 2AI0L 4HXBL 1ACZA 25C8H 4I3RH 3ARYA 3S98A 4HEME 3U82B 1P4LB 4PREB 2BVPB 1DLHB 3JVGA 5TF1L 4NZTH 4OV5B 5EBMA 4MDIB 4PGEA 1ZSDB 4M48H 4AG4H 3F58L 1LNUA 4NGHH 1N64L 3TYFA 3F12B 3QO0A 1WAAE 2ED8A 3LN9A 3FCTB 2RIKA 3QZWB 5EBWA 4Q6IA 5F7WC 4G7YH 4XPTL 1C5CH 1MI5D 4XCYB 3BPCB 4WU5B 4V1DA 4MXQD 3FMGL 4OB5H 4QTHB 1WLHA 3LRSA 5AZEL 2NY2D 2DJUA 1HXYB 2DYPA 4CVZB 2WUCL 2XN9B 4QHLB 3C6LD 4OD3L 3VI3E 5TE6L 2VERN 1NUFA 1T7ZA 2PETA 5ETUB 5IEKA 3ARDB 1CTNA 4WO4B 5L2KE 4KI1A 2EZ0D 3O9WA 5ACLA 5GRVK 4QRUB 5ANMA 5CBAA 3SE4A 5ERWB 2PYFB 5FO7B 3GHBL 4B7LA 3QUXB 5BVPL 2XZCL 1UWEL 3GJEA 5DFVD 5I1DA 4Q9CA 5E8NB 3VXRE 3Q6GH 5E4EB 4UV7H 3VGGA 1RIUL 2YD2A 4GRMA 5SWZD 4QRSA 2CRMA 1LDPH 4IRZL 1FFPB 2IH1B 5CZKA 5DO2C 3NFSH 3RU8H 3HE6A 3VWJC 2FL5A 1OB1A 1PY4A 1QVOB 1JGDB 2E9IA 5HPMB 1WT5A 1D5ZA 1B4JH 3HR5A 4HFWB 4WFEE 2Y6SD 5DFTA 5DTFB 2WNGA 4F7PB 1FE8H 3V52H 3Q5OA 2QKIA 3STLB 3ZE2F 4Z7UB 1B88A 1NGQL 3VD3A 3PNWB 1PBYA 2BSRA 2OSLB 4OM0H 1BEYL 2HT4D 3QRFM 3LPGA 4I48B 1CFTA 2EDHA 1QSFE 4MJIB 3Q1SL 1QBBA 3U0PA 1NCBL 1G6RA 5ABDE 3EFDL 4OUUA 3BKJH 4L8SC 2D03L 5T3ZH 3AU1A 1KTLB 3ISWA 4JY5H 3L7FB 4X5XB 4JFED 4XVJH 3BQUC 5JO5B 4F58H 1MCRA 3DO7A 1J11A 5CEYB 2WINA 3OG6B 2A77L 1UH4A 5FUOH 4C59B 1ODAA 5I1AA 3RUGB 2AK4E 1ZLSL 5IB2A 3S36L 5DMYA 1JHLL 3DLQR 4D9LL 2JJVA 1WEJH 3GHEH 4OLUL 2SEBA 4XAKD 2YSSA 3DV6B 1CGYA 4NQSA 3CZFA 1VGEL 2W9EL 3OJDA 5CLWA 5FUCE 1BGXH 4OKDA 1FJ1B 4HUKB 4Y1AD 2APFA 1Y18A 5I1LB 1S7WB 4N8PA 4OZHF 1E27A 4LLMA 1JPTH 4HV8B 4KZDL 3MGOA 5KAQG 3VXMD 1HHHA 4QHUA 1IC4H 3VD4A 2AAVA 1YEEL 3BIBX 1JHTA 3QRGL 3M07A 4IDLA 2CLRB 2ZJSL 2QSCH 4K94H 4CVXB 4GRLB 1IKFH 4POZC 1JGUH 3FRPG 1QQDB 2XFXB 2PYED 4MA7H 5I1EL 1R24B 2X4OA 2R2BA 1FO0L 4YHML 3DXAD 4MMXC 1U93B 3RWJB 4Z18A 4H0IA 1P7QB 3WFCH 1F02I 3BSZH 1MFDL 3PQYE 2VB5A 4YC2C 3RVVD 1AO7D 3PWNA 4XP9H 4U1SA 2BOCB 2F53D 2PO6A 1AKJB 2C1OB 2VQUA 4N0YL 4HS6A 3MZGB 4I2XA 5EUOB 4PJ8D 1RAMA 2NX5E 3PGFH 3NN8B 4G9FD 3KPOB 4JFFA 3REVB 3GUTB 2FBJH 5K9KA 5H94B 3SGJA 1KPUA 1RJLA 1MHEB 3T0WA 2H8PB 2HFFB 4P2QB 2YXFA 3N85H 3WDJA 1KCVL 3I50H 4R97C 2JJSC 2XA3A 43CAB 1JHKH 1LO0L 3QG6A 1C16A 1KT2B 3E2HB 1X5AA 3RY6C 4S2SA 4LASH 3SO5A 4HMEA 3Q48A 4QOKA 3VW3H 1TVHA 3OR6A 4JO2L 3D2UB 5MEND 4KMTL 4KK6C 1C12B 2AV1A 2HJFB 1I8LA 2WV3A 4JHAH 4JM4L 4DFIA 3FB5B 5TDPB 3V4VH 5D2LB 3UJJH 1EHXA 3MUJA 2VJXA 5EOTB 5DEZA 4DGIL 3CK0H 3MA9H 1QRNE 3FQRA 5F6IB 5MHSD 3WSQL 5C2BL 2EO1A 2GFBB 1FNGB 3ZE0E 5MEPA 1EVTC 1SMOA 2QSTA 3JV0A 4LAJH 3WIHL 3PP3H 1EXUB 2GW5A 4TTDD 1XGPA 2JKXA 3EYVA 4X9GA 1GC1C 1J1PH 1ZS8B 3TP4A 2CLZB 1HHJB 1KPRB 5DHXB 3BKYH 2OK0L 1T04B 5AD0A 3PABA 5IJKC 4LCWD 2AJYH 1RK1A 2G2RB 4DN4H 1KB5H 1DVFB 4LSSL 5JQHC 1G9MC 2AJZA 1WBYB 3N1QC 4ZFOA 1CQYA 4ODHL 4R26L 3MRJB 4WUUA 3NIDF 3AREC 3QUKA 1U91A 4KRNA 4Z95L 3DSFH 5HYFA 1BIIB 5KG9B 3RAJH 1VA9A 2CKBA 1YECH 2VR9A 4LQ1A 5EWIH 5TPWL 3KYOA 4OLYL 5JHDB 5IHUH 5IEHA 2APTA 5C0CE 1N2RB 1Q9LB 4PRDB 1BJMA 3ARBA 4EDXB 3QUMA 4M6OH 3RPKA 2PN5A 4BYHA 4Z6AT 1P6AB 2FJHB 3GSNA 3STZA 2NY5L 4AIZB 1T83C 3D39D 4JFPA 4YX2H 5KTEL 2P5WE 2R23A 4PJ7A 3DX9B 3H0TB 1S7SA 3FT2A 4K7FA 4NUJB 3VXQB 4H88L 5TDNA 5B8CA 3EFFA 2G5RA 2YUWA 4IIQB 4M7ZB 3HPJA 3D0VB 3WKNA 4WO4C 5DT1H 4KZEL 2DTML 4GKZA 1E4KA 3BD3A 2NY4B 3QDGD 1QFOA 3LKPA 3BZFB 2EDKA 2Q8BH 1D5MA 1NAMH 2HVJB 1EJOL 3BX7C 5KVEH 1T2QH 1KPVA 3HHRB 3SGDH 3M8OL 2EYRA 1KN2L 1TTUA 5LAXB 5A1AA 3D0LA 3T0EC 2GJ6E 1JRHL 2DBLH 2R2CA 3MNZB 2X4TB 3F7YA 2A83A 3EDDA 4UQ3A 1MIEL 1ZA3B 3SDXB 1TQCB 4OD2A 3SDCD 2VXVL 3RTQC 3MUGB 1DN2A 5EU7E 2J4WL 2QJDA 1BD2A 1WUNT 4NJAH 2ADGB 5HGAA 4LSDA 1NLBL 4TVPH 1NSNH 3KPRB 3AS1A 3MJ6A 4I4WA 5I6XC 4PRBB 2A6DB 3QWRD 5TE4H 5C07B 1I9JL 4YHZH 4U3HA 3CCHB 3LQAL 1MAKA 2LU3A 2Q8AH 4GW4B 1AXIB 5FA4A 1Q72L 1F4WH 4ZO8A 3QHFL 4M8VA 1TENA 4XCEA 4JZNA 5C0JB 5KS9B 4XWOC 3VMOA 3X12B 5DMGD 1AD9B 3VXTA 4CGTA 5KANG 1BPVA 4U2ZA 5IFJB 1T22A 5EU5A 4HQQH 3ZSSA 3PWPB 4ORZC 3PHQA 1NAKL 3WN5C 1NEZG 4Q9BA 1T3FB 4YH6A 4ZDHA 3W11C 1UEMA 1Z0MA 2YC1A 2MCPL 1AGBB 5FUZH 3ZTNH 4C55A 1K3IA 4F37K 4JRWA 2IQ9H 2YD9A 3EGSB 2BX5A 5DJAB 3EYUH 4XPBH 5D7SL 4DK3A 1N59A 2WBWB 5DURD 2YPLE 1U3YA 1R3HA 4JLRA 3PWVB 3HZYB 1A3RL 3QIBC 3T65A 3MLRL 5ID1A 3NGBB 2F54B 4JG0L 1ZT4B 2IFFL 3BEWB 5C08A 4HHAB 2XA8L 1YEJL 2PTTA 1KYOJ 4OT1L 1IAIM 1A1OB 4NNYB 1JE6A 4OIBA 3U4EB 2MQCA 1B90A 3GIVA 5HHOD 2HJLB 1DR9A 1J0HA 4KDVA 3W9DA 3IXAB 1HQRA 5BOZG 3GB7A 1CZ8L 4KKNA 4OM1H 5CLTA 4H5SA 1I1FB 2MJWA 5IW3A 3BQUD 1EO8H 2HH0H 1YPZE 2CK0H 2FZ3A 4JN1H 3BVNA 2R0LH 5LGJB 2J8UF 4OTXH 3KPLA 3QXAB 4GG6E 1DN0B 1NCUA 3N1PC 4OLWH 1HDMB 1XCQA 4LSPH 3A6CL 3EYOB 3CSPA 1TTFA 2H1PH 4PJ5A 1MY5A 3QDMA 2CDEA 3NIFE 3P4NA 4DWHA 1FORH 5EU6E 4Q2ZA 2AJ3A 1WBXB 4WJ5A 4HWBL 1C5BH 3T4AA 5I1IL 2FIKB 1RQ5A 3O3DA 4NIKB 1CT8B 4ZAKA 5C0BD 1RUAH 1K4CB 5HYJA 2CGRH 4PB0L 2HRPL 5LWYL 3QJFB 1I3UA 1FN4B 1J05A 4WFFD 3WKML 5KSUA 1X4YA 4ZS7L 3CSYB 4JQIH 4LPTA 3MLVH 3GKWL 4FNLH 3NFPA 5J9PA 5I73B 4FFVC 1A7NL 3W2DH 2ZSWB 3TPUB 1CVRA 4QRRD 3T2OA 3PIQB 2V2XA 3VGAB 4FQQB 3Q0HA 3BKML 4YFDB 5GGUB 1LHZA 4NRZB 4LK4A 4XRCB 3JV6B 4Y4FC 3DMMB 1NANH 5E70A 3BDYH 5SWQB 4NKIH 4G6KH 4ZPVA 3E2HC 3L7EB 4FQCL 4PLJC 1GCFA 1U92B 3M1BA 3A67H 3TO4C 25C8L 2YOCA 1J88A 3P73A 3OJVC 1L6ZA 1D5XB 3DX6B 5F7DB 1G7LB 4UUJA 1QSED 4NZTL 2A1WH 2BY3A 3CMOH 5J6HB 4M48L 4AG4L 3EOTH 1R3IH 4NGHL 3CFEB 1A9EA 3R06A 2JCCF 1CGVA 4LPXA 4F3FB 1CS6A 2YUZA 3S36X 3IJSA 3HUJE 1IAKB 5FOBB 1MCKA 2J12B 5ACZB 3LIZH 2J7LA 4G7YL 4PV8B 4C58B 1YA5A 1C5CL 2OZ4H 5CUSH 3QDJE 2FCBA 2RFXA 4JFOA 4CW1A 1JBJA 1MJJA 4PB9L 1EV2E 3OHXA 4HT1H 4ORGA 2OZ4A 1YY9D 2FHCA 4MSWA 1LEGB 1ZKAA 4RAUB 1DVFC 3HAEB 2B5IC 2FJFA 2XIDA 5T1LB 4XNQA 1GOFA 1T5XA 4GLRH 3G5ZB 4NO0B 3AY4A 4OCXH 3KS0H 5SX5K 3V6ZB 4F9LC 3TFKC 3D3VA 3LRGA 4WVRA 5IGXH 2DQGH 15C8H 1L0QA 5LVEA 2VYRE 1AQDA 1UYWH 4ZO7A 1IRAY 4HF5L 4L5FL 1FSKC 3N1GC 1MLBA 1MY7A 1CDHA 3ULUC 1J8KA 1UCBH 3LZFL 3Q6GL 1DBAH 2AK4A 4UV7L 5DJ8B 1T89A 1XF5B 1F4HA 1NFDE 5C0AB 4U1HA 1NMCC 1F00I 1AFVH 4Z7VB 5J1AB 4O5LH 4P3WA 4U6YA 3GSQA 4PP2A 2C7UB 1HXMA 4WY7L 5HYSB 4FOMA 4PGBA 2AEWA 5DHVA 1FZKB 2NZIA 1FE8L 3ESVF 3V52L 1FVCA 4M03A 5AYUH 4M7LL 5JOFA 1FHGA 4TNVF 3QCTH 4X98A 2VLKB 4R9HA 5FYKE 3IJHA 1QLRB 3BMWA 4R7DA 4OM0L 5E6IB 1V3KA 1HHGB 5KN5B 4Z7QF 1NC2B 2HJKA 3QNYA 3T77B 4AM0B 1R3LB 3QEHA 4HUUB 1DFBH 2H9GB 4IOIB 5K59E 5F1IB 2YBRA 4ODXB 4BJLA 1HCFX 3RNKA 3LS5H 4JDZB 1FIGL 2JB6A 3BKJL 1LO5B 1ZANH 1QO3A 4JY5L 2XN9D 5D7LB 3KDMA 3FRUA 5FGBC 4XVJL 4AQ1B 4PRHE 3RI5K 3CFCH 2ED9A 1Z2KA 2J8UA 3G6JB 3B43A 2Y1VA 4NO3B 3ARDD 5HBBA 3AUVA 1ZLUH 4WO4D 4WRLA 3DX7A 3QEQE 1VPOH 5K9QI 2AK1H 3WUWG 3RWHA 3MODH 3H9HA 1ZHNB 1QNZL 3C8KA 1WEJL 3GHEL 2G9HB 3QUXD 2Z8VC 2YRLA 5CZVH 4Y88A 1CF8H 5J6GB 4D3CH 3KXFA 2Y07H 3RVXC 1T0MA 5HYQA 1UJ3A 4KV5E 4PRPE 3PGDA 1BGXL 3UYRH 5H35B 5HGHA 3I02A 4P4RA 2XKUA 3CVHB 2W92A 2YZ1A 1QLFA 3K8KA 3VWKC 1S7TB 4XGZA 4NHUB 1IC7H 1JPTL 5F72S 3CSGA 1R6VA 4XHJD 4P2OA 5E8PB 3TH4T 1IC4L 4H8WC 5EFIB 5C0GB 4CADA 4GBXB 3GO1H 1E4XI 2VLJB 4APQA 2QSCL 3ZDYF 1IKFL 1U8JB 1G9NL 1QFPA 1JGUL 3ZLQC 1CFBA 1K6QL 4LVHC 4X7EC 4ZFZA 3SDAA 2Q87A 3IVKB 4NRXA 1G7MA 4GAYA 3U48A 3VXSA 4EIZC 3BDXA 3KPNB 5E6ZA 1UQSA 3BSZL 2IAMB 1X5IA 4MQTB 4MJID 3HR6A 2HKHH 2Y36L 1J8HE 2YKLH 4XP9L 3JUZA 4JQVC 3W11D 4NN7C 1N0XH 4L8BB 1BFTA 2RB8A 1MVUB 2P7TA 1XGQA 1PKQE 3SHSA 1HCVA 3RPIB 2JCCA 4TRPH 3X3GH 1A2YB 3RKPA 5JW5A 1IBGH 3I50L 3V7MA 3IDMA 4M4RA 1JHKL 5TGBA 2OL3B 5IQ9A 1CG9B 3MRKA 3SKMA 2WWKT 4LLYB 1ONQA 4KI5E 2EIBA 3VW3L 4Q9RH 4LIQE 3BJ91 5ITBH 3O11A 1FL3A 4JHAL 4YHLL 1DSFH 4G43A 1FFNA 3HNVH 1DCLA 4EI5B 5CEZE 3V4VL 5KSBF 4L4TA 4XNUH 1A7QH 3UJJL 1YEHH 3QO1B 4AEFA 3CK0L 2I26N 2Q6WB 1G7HB 2YUXA 1UKTA 5DJCA 1RHHB 4J7RA 1KLUA 3BYYA 5I73C 3UPCA 2IANB 4GRLD 1Q94A 5FHBL 3D6GA 1KENL 1FL5B 3M17A 4PGJA 4LP4A 2ID5A 3EYSH 3HA0A 4NHCL 2EIEA 4PRAB 1Q1JH 4JAMB 4QF1B 3VFTA 3DETD 1A02N 1J1PL 5BS0A 3F62A 5JXAH 3BKYL 4G9DB 3QJHA 1P7QD 4BQ6A 4PRIB 4NQDE 2EXYC 4PJFE 4FQIH 1WITA 2AJYL 5IBUB 2BNQA 1LO4H 2ADJA 2DQUH 1G7QB 4BH7A 2DWDA 1BIHA 1AKJD 2P45B 3L1OL 5EUKA 2E7MA 3B8SA 4PY8I 4QRTA 3D87B 1E6JH 2EE9A 4K8RH 4DN3L 4JHZA 3F7PC 4WV1C 4J1UB 4Y5XB 2PKDA 2MPAH 5ESQA 1QOKA 1S9VA 4OF5A 5BW7C 4OD1H 4P2QD 4N68A 3BGAA 3S88L 1JL8A 5DZLA 5IHUL 1G1YA 4Y4FD 2H32B 1DANT 1ITCA 3RWIB 4P48A 3D85A 5ESAA 4JPIB 3IDXH 3CZJA 1RUPH 1WCBB 3TO4D 3D2UD 5DD1L 5CP7B 4G80B 3NCMA 4UAOB 5TE7H 4C83B 4F7MB 2C3VB 1MWAB 4NWTH 5E1AA 3BZEA 2XY2A 4HIHB 5INDB 1XIWA 4S0TD 1YY8B 3P4MA 4N5UA 1FYTB 3RX5A 5C3TA 2IH3B 3JBG7 2O5ZL 5IHBA 1FP5A 3X11A 4LKCA 5DT1L 4Q74A 4K9EL 4P46C 4X83A 4HH8A 1JZ3A 2Q8BL 2E6JA 4R0LB 4YE4H 5CJ8A 3BIKA 1KJMA 3G04B 1T2QL 3W9EA 1ZMYA 2DN7A 4I0PA 4JZJB 4LPCA 5C0EA 4W6XB 4ODUA 4X0KA 3ZE2E 2EDJA 1LE5A 3VG9C 3QFJB 2DBLL 1J1XH 4WW2A 4P2RB 3IF1B 1JWMB 3RWDB 1EFQA 3HS0A 3QCUH 5HGDA 3DROA 4MNQB 1DVFD 4X6CB 4TPRH 5FYJD 5D7JC 2ZSVA 3CVHL 1TZHB 1CFNB 2X44D 3SKOB 1IM9B 4NJAL 4NQEE 5JDSA 5C6WH 1NSNL 2R56H 3FO2A 1PJ9A 4JKKA 1SBSH 5TE4L 2O61B 5J57B 4Y5VC 4DZ8A 2VLRD 2CIKB 5KVDH 3O45B 4NZDA 1NQBA 5EO1A 1PFCA 1F4WL 2QHLA 1J5OH 3UAJD 5JHDD 2CRIA 1KF9B 4OFDA 1H5BB 1I7RB 1QA9B 1S7XB 2VR4A 4HQQL 3GMQB 1WBZB 4S1QH 1NKOA 3QXDB 2VZTA 4YGAB 3P30H 2D0HA 5EU6A 1DEEB 2QQNH 1FLRH 4L3CA 3REWA 4RWYL 2FWOA 5DUPH 3DIFA 3ZTNL 3GI8H 1P7KB 1MHCB 1I4FB 3OKKB 1QR1A 4NQCE 1KJ2A 3GMOB 5A43C 1P4IH 3EYUL 3NCJL 4OZHE 2EH7H 3MJ7A 3LMJH 1OP3H 3HCVA 4OLXH 1DBBH 2OL3L 4JFZL 2UZXB 3OKDB 2OCFD 3U79A 3IS0X 1RZKC 3OGOE 1OSZB 3WS3A 4YO0B 4OZIF 2GY7B 4P9HC 2EIZA 1I7TA 1SEBA 4G6AD 4DVBA 2ZG1A 4GKNA 4JRYA 3O2WL 4LEOB 5DK0A 2J6EL 3NTCL 4V2BA 3EJJX 1EO8L 2DQIH 4JN1L 4HBCL 4OZGB 2R0LL 1RZIA 4UBDD 1A21A 4MNGE 4YPJA 4X6DE 3KPRD 4NSKA 4MGXA 4PY7A 5C71A 2HFTA 5DJYA 5C07D 1H3UA 3RNQA 4BSWB 3MRCB 5I66A 5H2BB 1PW3A 2AQ1A 4YAQA 1SYVA 4G8EB 3L5WB 1I7ZA 4LVEA 4XC3H 5C6TL 3WIFB 1IGYA 3RVXD 4XPFH 3PWPD 1RUAL 2CGRL 3QDJA 5LGKA 2L7JA 1FAIL 3MRNB 1XF3B 3BXNB 1XF2A 3VWKD 3P9MA 3O6LH 3VXNA 2B4CL 2VZSA 3MFFA 4M62H 3V0AC 1IGFH 3GRWH 4JQIL 3BAEH 2GTWB 5J12B 4ZXBC 4FNLL 4ZYKB 2Q3AA 3W2DL 3NPSC 1TETH 4RFOH 4LLDB 5A16B 3GRWA 3NFNB 3ARTA 5DFWH 4PJEB 1HHIB 3ZKMC 1Y6NR 4DKFL 4G6KL 3SJVA 2F54D 4NCDA 2AEIT 5FKPA 3NVQA 1AD0A 4OBSA 4X7TB 4A6YA 3A67L 3STBA 4WHDA 3B9VA 2Q3ZA 4EVNA 4WTZG 1UXWB 1YJDC 4J3OC 2Y25A 4PLOB 1XGUB 4PUBH 3ZYJA 3W0WE 3FAXA 3EOTL 3UDWC 1R3IL 4J3UA 2UZIH 5IQ7H 4ZUTA 3OGCB 1BBDH 2I9LB 3EJZC 1DANU 3TBTA 4MD4A 3ARZA 3IFLH 5CUSL 5FYKH 4X6BA 4WFHD 1INQB 3NCYP 5EC2A 1JJUA 5IP4A 3G5VA 3P9LB 5FKAA 4EUPG 3EJYC 1JYWA 4JPKL 1T0NB 2GK0A 1DBKH 2QLVB 2X4SA 2NW2A 5IFAH 3QIWB 3QUYA 4ZUUA 3UC0H 3QUZA 3VWJA 4PJCF 3IU3B 1WC7A 1IL1A 3MRLA 5IW1A 4OCXL 2VUYA 5ISZB 1B0GB 3BZ4B 3K1KC 1MFCH 4MAUH 1KCKA 4ZUWA 2AVGA 4BK5A 2W38A 5IGXL 4P5MB 4HPYH 5F96H 1IT9H 4PJIE 3IFOA 3KYAA 4H1LG 4OCWH 15C8L 4G8GE 2XTJB 3O0RH 5DDHA 1A1NA 1UYWL 2J8OA 3DNKA 3ET9F 4P3CH 3U1SL 4W6YB 3S37H 2DI9A 1WGOA 5BZDA 4Q58C 1UCBL 1NGZA 1OAQH 4I3GA 1A7OL 2BSTA 3R8QA 1DBAL 2X1XR 2XZZA 3MFGB 3RX8A 4F7TB 3U9UB 2V2WA 1EZVY 5F1NA 4L8SA 1YQ2A 1UH2A 4L9LC 4XB7A 4HKXA 5ICYB 1AFVL 2GJJA 5IT2H 4O5LL 1N6VA 1S9WA 5TF0A 3MRGA 1B4RA 4EI6B 5DQ9B 3OZ9H 5BVJB 2X89D 5GS1B 5EZJA 4CJ0A 1N0LA 3L5XH 3AM8A 5KJRH 4MAYB 3QCTL 3W39B 5D93B 3O3EA 2BNRD 5LG1A 5IB5A 4YHKH 1TPXB 4S10A 3O6FB 5FYKU 1FVDB 3PXHA 4JZJC 1YYLH 4OZIA 1DFBL 2ZOLA 2FYYB 4FTVD 4NT6B 1CLOH 4BFEA 4HK3N 1N6UA 4YHNB 4HDIB 1M4KA 3WNLA 5DRZB 1S7QB 2IALA 1OM3H 4C57C 1BBJA 5T1LD 1MCWW 3MLTB 5HI3C 1IJ9A 3FONA 4QXUL 5EN2B 5A40E 5MEQB 3FKUS 4FABH 1S9YB 5IBTH 4ZD3H 1VPOL 4UDUB 3SKNB 2AK1L 1Q0YH 4E41E 2ESVA 5DK3A 1F97A 3MODL 2OQJB 3K81A 1KTDA 1PKQA 1WFNA 4WI7A 1OQXA 2ZUQB 3MJ8B 1YN6A 4NN6B 1CF8L 2I27N 1FDLH 3KLAB 4Q0XH 1CE6A 1N3NB 1B6DA 2Y07L 3D69B 2XWJA 4PJDE 1RY7B 1A47A 2BOBA 4LIQH 4IRSC 5C0AD 4WUKH 3UYRL 3QNXB 2KQMA 5D7JD 5DQDH 1YUHB 5CMAB 4PJBB 1LD9A 5CEZH 4AL8H 1IC7L 2NXYC 2X4PA 1R3JA 3I3EA 5B21A 3JUYA 4QNPF 5T3XL 5DHYB 1OGAB 1ZHLA 2Y06L 3SPVA 1A1MB 3TVMA 3GO1L 3TA3B 4ODVH 5D7KD 3PDGA 4NNPH 4WDIA 4L4VA 3WNOA 2JJSA 3BPOB 2VLKD 3IJYA 1AXSB 2P5EB 5JORA 1H15A 2D31A 3RY6A 1TCMA 1V7NL 2NY3C 3LKQB 4O2EA 5E6ID 3SO3B 1SEQH 1HHKA 5FECB 4J2XA 2VDLH 1NC2D 3U46A 1BFOB 1U8HA 4Z7WE 4MX7B 4KKBD 4U1GB 1JPFB 2HKHL 4PJXE 2FBOJ 1KIPA 2YKLL 4PJHF 4U1MA 4LVOC 1F3JB 3QCVL 1P7HL 4YDLC 2EKJA 1N0XL 3QQNA 3GSUB 3VGBA 4F8QA 4PS4H 1RVFH 3HLAA 4JO3H 5D7LD 4P49A 3DRTA 3DUSA 3GSWB 4YZFE 4RNRB 4R2GC 5TQ0H 1CL7I 2ATKA 1S8DA 1NKRA 4G7VH 5JW4Q 3W5NA 4X4ZA 2KZWA 4TRPL 5B39A 1IBGL 1I1AC 2XACC 3GSOB 1SJHB 2Z4QB 3MO1A 4KJYA 4KXZH 4PJGB 5DVNA 5I2IB 1EVUA 2DKUA 1L0XA 1JGVH 5HI4C 3QIUC 1YNLL 5IJKA 8CGTA 3C09B 1HZHH 1YDPA 5J11B 3V6FB 1MI5E 4X9BA 4I0CC 1M71B 5HHNA 1DSFL 4YXHL 4XNUL 5EU3A 1Q9KA 1A7QL 4MHHI 4XNXL 4BELD 4QRPB 1YEHL 3AREA 5DC0A 5JHLH 4S1DC 2ZUVA 2A6JB 3UBXI 1WZLA 2E5EA 4U7MA 2BCKA 2VLJD 4DOHB 5IK3A 3S9DB 1WSST 5D2NE 1S5HA 3RWFA 3HUJB 5F88A 3MACH 5I17A 2R39A 3PL6A 3TN0B 3EYSL 5DJ0A 1Q1JL 3RL2A 3ARGC 1AQKH 1K2DB 4BSVA 4NC1E 3RGVC 2UY7A 3ARFB 5DUBB 1HSAA 4HIJB 1V3MA 5DK2A 5E2VL 5HGBB 1LO4L 4LKXA 2DQUL 1NGPH 4PJAF 3VXPB 4KK8C 3Q5TA 1KUMA 1E6JL 2W07A 1A4JA 4LLAA 2G75A 3RFZC 3BUYA 5CSZA 5C09B 1EEZA 5L2JB 5SWZE 1KGCD 2YRPA 4GUPA 2DMKA 4LFHG 2R8SH 5SX4H 3WMSA 4EN3A 3JWNC 3OJMB 4OD1L 2E7LC 3ARSA 3KYKH 4D0BA 1CXFA 4HZLB 5EBMB 1EEUA 3D18B 4PGEB 3ZTJG 3ZKMD 4NQEA 3L3OA 3NACH 4R3SB 4JB9L 1B0RA 4OGZA 4Y4HC 5DMKA 5GJTH 3QO0B 4M7JH 4ZNCD 3T0EA 3EHBD 1RUPL 2VOTA 4MJ2A 4RQQB 4Q6IB 4JM2C 5EBWB 4JJ5A 5FF6A 5TE7L 3RTQA 4XWGL 4Z0BH 4NWTL 2YD4A 1MEXL 3QIWC 4EI5D 5E24E 5C86A 5F7FA 3SQOH 1INEL 4UINL 4V1DB 4D0DA 3PG2A 1MCPH 3I75A 3FT3B 1AGEA 1G7IA 4M8QA 4YNYA 3LRSB 2WM0A 1RV6X 2DYPB 3EO1A 4JFEE 4MCYA 3IDGA 3EJZD 2IAND 5F7NC 4F8TA 4JKMA 2VXQH 1RZJL 3WIIH 3ULUF 4YE4L 2NNAA 1J0JA 5IEKB 4M1CC 4CMHB 4PG9A 5D1ZA 1BQLH 1BX2B 3F7VA 3HTLX 5T1MA 4MNHA 3FQTB 1GGIH 1J1XL 2L0DA 5KOMC 5IVXF 1P53A 3B9KB 4XAKE 1GGCH 3QCUL 3GJEB 4TPRL 2LTQC 1P84K 1PSKH 2X4NB 2R56L 1GGTA 3IDJB 4GRMB 5GS1C 4QRSB 1ZT1A 4LRIC 1SBSL 3FB8A 2EEAA 5EO0A 1QBLH 1I1YB 3PDDA 3QIBA 1ULVA 5CD3A 1XGYH 3DHJA 1T1ZB 1SY6A 4EUPH 1D5ZB 3HR5B 4X6DA 5EH1A 2IADA 1P2CB 2PYEE 3HMWH 2IBGA 4YQXH 4NC0B 4I9WD 2ZP0T 1T0PB 2BSRB 4PJHA 3DXAE 3P30L 3SDXF 1RI8A 3DVIA 1PQZA 1HKFA 4FXKA 4O58L 5A2LH 1CFTB 3DGGA 1AO7E 3WNKA 1KEGH 1FYTD 2F53E 4H1LH 3GI8L 5EULV 1QLEH 4I1NB 5EZIH 5E2UH 4JFDB 4G9FE 2AQ2A 4TNWK 1M6OA 4MCZA 2EH7L 3WL9B 3ZDXE 2ZKHH 5JLZA 2QL1A 4P4KC 1QP1A 3BPLC 1J86A 3BT2H 2XWBA 4OLXL 1DBBL 3DO7B 2VR5A 1OAUL 2LAGB 3LOWA 4NN6C 4C56E 3K46A 1UJTA 5DVKA 2XQYK 1J8HB 5IB2B 3QFJD 2YA2A 1C5DA 3GMPA 4P2RD 5KOVC 1DQLH 5E2TL 3TGXA 2YSSB 4P5KA 5KVGH 4LSTH 4O2FB 1ZTXL 3CZFB 5MENE 4P9MH 1U8PB 1IKNC 5HI3D 1IM9D 1NUNB 1Z3GH 3LQAC 3VFVB 4L8CB 3AB0B 3ZKXB 4DEPB 4G42B 2X40A 1Y18B 2D4FA 5B3NA 1E27B 4LLMB 5MHSE 3H2WA 3MGOB 1VENA 1HHHB 2IPTH 3QT2A 4QHUB 4HG4J 1OTUC 2X1WL 4NNXA 1KLGA 2VIRA 4XC3L 2OX5A 1U58A 4JEGB 3T2NL 4M9PA 5ICZB 1RZGB 3WJJA 1LP9F 4FQJH 2NW3B 4LCYA 2X4OB 1QUNA 4YXKL 4YHYC 3A0OA 4JO1H 4PJAA 5C0FA 5EC1A 3GMLB 1XH3A 3QQ4A 3O6LL 2P1YA 4LCWE 5B4MC 3TO2A 1ZVSA 3L3HA 4NOFA 3VFMB 2PO6B 1TETL 3BPNB 4KRLB 4G6MH 2P8MB 4HS6B 5I8KH 4I2XB 5KSBE 1U6AL 5E95B 5GS0H 3KWWA 3C9NA 2OMNA 4JFFB 2VQ1B 3U9PH 4GRWE 1T66C 4M7KH 1YMHA 3JWOC 4LNVA 2G5BA 2EEDA 4OLZL 1KPUB 1RJLB 3BUTA 5T33H 4G8GA 3FO1B 4JRXE 2DM4A 4IMLA 1FG9C 4FS0A 4PGZA 3QG6B 3EOBB 3FOMB 1MCDA 1WZMA 3QISA 4S2SB 3H6JA 3OKYA 3X13A 1BM3H 4PUBL 1TVHB 4F9LA 4OI8A 1CFQA 3LY6A 3OAZH 3FN9A 4M1GH 3D39E 4AEHH 3CH1A 4Z7OF 2UZIL 2HG5A 2D9CA 2YD5A 3GFUA 1BBDL 1CLYH 1I7UA 1SJVA 3L5IA 2H2PC 4HMDA 3CFJA 3IFLL 5CZXC 1FGVH 3FQRB 1PYWA 5HI4D 5AG9A 4JFHD 5MEPB 5IM7A 3QDGE 1HH9A 2OTWB 3QI9A 3OXSA 5J3HC 1JF6A 1ZVYA 4KJWC 3DX8A 3TJEH 1IZKA 1XGPB 5D6DC 4ENEC 1CDJA 5ENWB 3EYVB 5D96B 4MA1C 3UC0L 5CIPB 3JZ7A 3GDBA 5DSCA 2HLAB 2EE3A 2YPKA 3FJTA 5T3XD 1REIA 4RMWA 5AD0B 3PABB 3DTXA 5I71B 4BZ1L 4PLNC 1MFCL 1RK1B 2ERJC 5CHNA 3EDJA 2JLLA 5CAYB 3C2AL 3S4SG 2I24N 1GOGA 2XTLA 3X3FH 1BF8A 5F1OB 5F96L 1ZAGA 2OYPA 2AJZB 3MRQA 4OCWL 3OMZA 4LHUD 3RRQA 3O0RL 1F6LL 4S11A 5D1QA 4QXGH 4WUUB 2BY2A 4XMKH 1HYSD 4P3CL 3S37L 1NCDH 1CD1A 4IHOB 4HS8L 1KXQE 1OAQL 2C3GA 1C1EH 4UNVA 3SCMB 2CKBB 4PPTA 1DBJH 2X4RB 5C7XH 3ZHKA 2FH6A 2GI7A 3F5WA 5IEHB 4Z77A 5FGBA 1KV3A 4LDOB 4JY6A 5IT2L 1KIUA 3KNBA 1Z9SA 2DTSA 2R2HA 3GI9L 1ES0A 5I30H 1FGNH 3ARBB 4CKVX 4U1IB 3QUMB 3OZ9L 3BN3B 3V0VA 2YWYA 4PJDA 4YWGH 3GSNB 3STZB 3L5XL 4JFPB 1E6OL 3L3GA 4RDQF 4PJ7B 1S7SB 1PD6A 3FT2B 4K7FB 5EG6C 4YHKL 4Y4HD 3OB8A 1IM3A 3EFFB 1B6UA 5B8CB 3Q3GA 3RDTB 2OLDA 5E9DE 5FB8A 1CLZH 4GKZB 3O9WC 4KDWA 4JM2D 3MR9B 4XP6H 1WICA 1CLOL 3LKPB 5BZWA 1KIRA 3LRHA 3SE4C 4AIXA 1D5MB 1R5IA 1ZLWH 3QIWD 1QFWL 3TBWA 1KPVB 1AR2A 1OM3L 3P40A 4QYOA 2PCPA 2EYRB 1U95A 1KOAA 4K71B 3MRBB 5ISZD 4PLKD 4X6EA 1JTPA 3ZTJH 3F7YB 1A5FH 2A83B 2GJZA 4G6JH 5IBTL 1NDMA 5J0BA 1EEYB 1CD0A 1L7TH 35C8H 1Q0YL 2KDGA 3HG1D 4OZHB 1A6PA 4BZYA 1W0WA 3GK8H 3HE6C 4U6VH 3U30B 4FQXC 5HGAB 1ETZB 4M1CD 5MP6H 2JK5A 2I60H 4IDJL 3DURA 4Z5RA 4I18C 4Q0XL 3EYQC 3O41B 2DF3A 1LP9A 4EOWH 5FA4B 3FQUA 4WUKL 5CWSA 3EDKA 3BD4A 4Z7NF 4XP1H 4XCEB 5TFSH 5DQDL 4JZNB 5BV7B 5CEZL 4AL8L 3KPMA 4ZUSA 3VXTB 3S96A 5JDJA 4YR6B 5C0BE 4KROB 3KJ4B 1D9KB 3PHQB 5B38B 2DAVA 2FH8A 4Y4KA 3WFEH 4MAYD 4F7EA 4QO1A 5JW4N 2YC1B 3U36A 1EUUA 1JF1A 3SGDI 5I1GL 1NC4A 1UACL 3TNNB 5F6HI 3CFBA 3BH9A 1SEQL 4QRRE 2VDLL 1MNUL 4Z9KB 4GMTH 1OP3K 5IMMA 3D25A 4LLVA 5JXEC 1JWUA 4L3ED 1MJ7L 1R3HB 4JLRB 3T65B 1OY3B 5ID1B 1FNLA 2APWA 5SV4A 1MFAH 1RVFL 4PS4L 5C08B 3S97C 3VFRA 3TLRA 4YPGB 1HI6A 2PTTB 3H9ZA 3QWQB 4BQ8A 5M94B 4G8FA 4WENB 4O51B 3GIVB 4G7VL 5DGRA 1QSEE 3B9AA 2X1PA 2GY5A 1RMFL 4NQUA 1HQRB 3GB7B 4N0UA 4P4KD 5IF0A 4HKZA 5DD6A 3T1FA 4HGMA 2FZ3B 4WEBL 3BVNB 4XPAH 3AS0A 4GS7B 4OF0A 3KPLB 1JGVL 5D5ME 1A8JH 4NQVA 4LLUA 3DUHA 1XCQB 5C1MB 5I75C 4M6NH 5F3BA 4LSUH 1HZHL 5GGRB 3MOBH 3V9FA 1PVHA 4PJ5B 5SWSD 2R29H 4MLIA 2WWKO 3M45A 2WMPA 3P4NB 3WHE0 3MV7D 3L5HA 4K94C 1EERB 4Q2ZB 4WV1A 5JHLL 2AJ3B 4WJ5B 3NIGE 3GIZH 2VWEC 5A2KH 3T4AB 4OLVH 1H3GA 1OGAD 2B7DT 4ZAKB 1QRKA 2VNCA 5BW7A 5HYJB 2WBJA 3E8UL 3WXVH 1MJ8H 3UPRA 1J05B 3V6OE 5F7EH 3SGEH 5KSUB 3DVNA 3PE9A 4ZSOE 3MACL 1BOYA 1W72H 3UCRA 2P5ED 1JPGA 2YD3A 4F7CA 1T7XA 2RR3A 5MEOA 1SM3L 1CICA 4LBEB 5HYIA 4M93B 3SGJC 4FTVA 1MELA 3NA9H 1Z9LA 1NGWA 2CKBL 4KUZH 3VRIA 5E8EA 1NGPL 1CFVH 5DA4A 5B4MD 1U8OB 3M1BB 2ICCA 3SGKC 1TZGH 2R8SL 3P73B 4P46A 3GSNL 1V8HA 5EZOH 5IVZA 3KYKL 1CXHA 3QAZB 4OZ4A 2ZUSA 3NACL 2XV6B 3G5XA 1T66D 3LD8B 1DL7H 1A9EB 1U8QA 3R06B 1YYMH 4RMUA 3SBWC 5GJTL 2CIIB 1HKLH 2GCYB 3LCYA 2FECI 2XG5A 4M7JL 3MV9D 3IJSB 3QNZB 3O3AA 4EKXA 1X7QA 1UB5B 4OFIA 2EECA 5FO8A 2V5MA 4JFOB 1MJJB 4Z0BL 2UUDK 1IQWH 1IC1A 4N90D 3OHXB 3SQOL 1E28A 4QRPD 3MRRB 4YBQD 5TDOB 6FABL 4ORGB 1MCPL 4RMRA 5LJYH 3TT1H 1M7XA 1P6FA 4IJ3B 2HTLD 1RZFH 4MSWB 4Y5VA 2XN9E 1BZ7A 2BY1A 3JTTA 3HZKA 1NANI 1TZIA 4DUWA 2FJFB 3RVUC 2H2PD 3BGFC 1CDYA 4U05A 3WIIL 1T5XB 2CJUH 3TN0D 3MZTA 1UZ8A 1WZ1H 4L4JA 4ZMAT 3MMEA 3D3VB 5J3HD 3VG0H 5DVLA 2UY6A 2NR6C 4QHMB 5B3JF 2DI8A 4KJWD 2Y5TA 4KC3B 1HSBA 5CP3H 5IV2A 1GGIL 4ENED 1AQDB 4RRPG 4QCIA 3OBAA 3CH8A 1KCUL 4ZPTA 3ZT7A 1MLBB 4LEXL 1PSKL 1ADQA 5FFLA 3FFCD 5BV7L 1F45A 2QADB 3VXOA 4NKDA 1CDCA 3V0WH 4MMZC 3S5LG 1MCEA 4C56A 5JA9A 2VXTH 1HNGA 3RKDD 4OCMC 3CD4A 5EOQH 4MB4A 1JPST 1QBLL 2QEJA 4LGPB 4NBZB 4U6YB 3GSQB 4PP2B 2HTKC 2FLRT 3UO1H 2OTPA