5D7IE

Structure of human mr1-ac-6-fp in complex with human mait m33.64 tcr
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
200
structure length
200
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVMDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 43
structure length 200
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7iE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7iE02
3B5TA 5DS8B 3MV7A 3WLWC 4OM1L 1NMAL 2Z92A 4OGXH 5I1GH 5B39B 2AK4B 1F90L 2F5BL 3U0PB 3BP4A 4Z5RB 4R6UA 1UACL 5C0GB 1JI1A 1JWMA 3LIZH 4UINL 3TYFB 1T1YA 1NC4A 2D0FA 1K3ZA 1DL7H 5C08D 1FJ1A 1K5NA 4N8VA 3GSRB 4DGIL 4PGEB 1SJHB 3HE6B 4R2GB 2BSTA 1WBYB 4G8GD 4PJAF 1ZVYA 3MCKB 4X8JA 2CXGA 5CKGA 5HYSB 3VJ6B 3I2CH 3O3BA 4KRLB 2F19L 4YE4H 1IT9H 1BQHG 1R3HA 1ZKAA 2Q86B 2YC1B 2EYTA 1JF6A 4IRZH 5EUKA 1KCLA 1F90H 2F5BH 5F9OL 3IDXH 5FCUH 5FO8A 1RSFA 3N0PB 4HUWB 3WL9B 1WZ1H 4D9LH 1OP5K 4YHML 4TOYL 4YXKL 1LO3L 3IS1X 3SDAD 4LSVH 3SKNB 3QI9B 4LCUB 4JO4H 4ORGA 3SPVB 2R0WL 2XACC 3H3PH 3OAUH 4ELME 3EJYC 5E99H 1BGXH 3LB6D 5JW5A 3C6LC 3VW3L 1V3KA 3BZDA 5DMGD 1CD0A 4BELD 3TA3D 4N8CL 2X44D 4PJBE 4FQHB 5ADPL 3Q5OA 2F54B 1A7PL 5FHAL 5DC4B 4NNYA 3QXUA 4XCEA 3QDGE 3TBSA 4HUUA 5IFJA 3DXAA 2FJGA 2NY3B 3FB7A 4OGXL 3G5XB 3BE1H 5EU3B 3DWTA 4U33A 3JZ7A 3PGCA 1DLFL 2EYRA 3E8UH 2QSCH 2BCKA 5LXGH 4EN3B 4WFHD 4XP4H 3PP4H 3V52H 3B5HA 3NFPA 4H5SB 1F4YH 2HJKA 1PEWA 4Y4FB 1TMCB 4ZMAT 4RFNB 2XQYG 3TJHC 4NP4H 5J13C 5E8EA 3MA7A 2GJZB 4JZOB 4KK5D 3DOSA 3G04A 3IJSB 1V3LA 5F70A 3V6BR 4F7TA 3QPQC 4OJFH 2EDWA 5ANMA 3ZKMD 2MQ0A 3P3YA 4MNGB 2BZDA 1JI2A 1FO0L 4C56A 1XF2A 3UAJD 2OK0H 3AVEA 1U92B 1DQLH 2R2HB 4KI1A 5L8JB 1UWGL 2GJZA 3SGDH 1UA6L 5IHZB 3S97C 4XPFL 3MACL 2B2XL 2IBBA 2IFFH 1CE1L 5FA3A 3MREB 4XHJC 1T7VA 2GY5A 2NY2C 2IQAA 2VZVA 2XTJE 1R6VA 1D9KB 1FVEB 4NQUA 3VFRB 5EOCJ 2PR4L 4JFPB 5ESQA 1D5MB 1WC7A 5F3HA 2HLFC 2V2TB 5F6IC 2X4TA 4HWNA 2N56A 1HK6A 4W70A 4ZQKA 3VXSE 4D8PA 3HI6L 3QBTB 5I1AA 2G9HB 4H20H 4LRNL 4PJIE 4HUUB 3PQYE 2GK0B 2Q8AL 4QHUB 1XF5A 3QUZC 5B8CA 4C83A 1X7QA 1AGDA 3WD5L 3GJFA 1NBVH 1DQTA 5C71A 3DMMB 1EGJH 2WUBH 4EXPX 5ITFA 1IAII 4LFHD 5CD3A 1JZ4A 4NC0B 1UZ6F 5JW5B 3VXUE 5CEZE 1VESA 4YDLC 3BWAA 2VN7A 3SPVA 2HRPH 1JK8A 5GZOD 4LLYA 1ITBB 4N5ED 1KB9J 2PO6C 4BFGA 3Q0HA 1U42A 2CJUH 1RFDH 3LMJH 3WNOA 4JR9L 1CXIA 2M1KA 4NM4L 4Q6YA 1NH6A 3RAJL 9CGTA 4WNQA 5JDSB 3D6GA 3WNMA 3J8F7 4ZXBD 1MEXH 2FLBT 4OLUL 1MFAL 1KIRB 2VLLA 5CZKA 5EBWA 4OKDA 3TIDA 2ZJSH 5HHQA 1N64H 4NC1E 4X8JB 1O7VA 5GGRA 4JM2B 4XX1E 1N59A 1BEYH 1VFBB 3RIAK 1FVCA 1BQSA 1JPTL 3IFLH 3C09C 5IW1B 3HC4L 3TYFA 1LILA 3Q48A 4JRXA 1IZJA 5TE7L 5C0GA 1KULA 5E9DA 2AW2A 3RPKA 2RCSL 1BJ1J 2YEZB 4WEUD 4WO4D 3KPRA 4IOIA 1BFOA 3Q3GA 4UDTA 1KOAA 4EN3D 3CCHB 4PTUA 2EDHA 1S78D 4YXLL 5DR5L 4QY8A 3TLRA 5DDHA 1FYTB 3U46B 2PYFB 2J2ZA 3X3FH 4X6BA 1ADQH 1CICD 4FNLL 1TNMA 3X13B 3RY5A 3BWUC 4V1DB 1OP9A 5A16A 3IS0X 2DQTH 2BNQA 1L9NA 3PE9A 3WS6A 4Y5VA 3FQTB 2GUOA 5C9JA 2OLDA 2DD8L 4KQ4H 4NJ9H 4OCSL 5JNYB 1J1OL 1NUNB 5HHVH 5HPMB 1KCVH 2ESVD 4H88H 1QOKA 1A1NB 4PRIB 5GISH 4NJAH 3TZVC 5H35A 1ODAA 3UDWA 4K8RH 1FZKB 2DKSA 3TGXA 2CIIB 3IETA 4MDJA 1DBML 4NZTL 4PJ9A 12E8H 4XI5D 3GSNL 5E5RB 1INEL 1QEWA 5F9WB 2VQ1A 3KR3H 4NM8L 4ZOCA 3WS3B 3AU1A 2AK1H 3MOAL 4LCYB 4LSTH 1ZS8A 1G7HB 1Y18B 3V2AR 4UNTA 4XPAH 4JY4A 1N6UA 3UPAA 3VGBA 4DGVL 5KW9L 4F58H 4M6NL 3SGKC 3SGEI 2A6JB 3T1FB 4HUMB 2HTKC 5MEOA 3LB6C 4NT6B 2P8LB 1QSVA 4OSUH 4NBYB 1FFQA 3ARQA 1T1ZB 2YPVH 1OL0A 1LK2A 2A6KB 1MWAH 1MHCA 2VXSH 4OF0A 4N1CA 4EDWL 3FQNB 1C1EL 1WZMA 3ULUC 4RNRB 1B90A 5HHNB 3PGDB 4KRPB 1D5XB 2R29H 4EI5B 3AGVA 4LDEB 4JFFD 2YWZA 5T1LD 5CIPB 2JB6B 1NUGA 5F44A 2AJVL 2K7QA 4FTVE 1MJ8L 2DBLL 1DBMH 4I0CC 4NZTH 3VWKD 4GH7B 3RL1B 4M7LL 1MREL 2EDRA 3SKUD 1ZA6B 1FRGH 1B0WA 4ZAKA 3LQAL 5CCKH 1XF3B 1CE6A 1LDPH 5DVOA 4JQXA 4IJ3C 4D0CA 4DGVH 4RGNC 4W4NA 1I1RA 2DQHL 4EEEA 4BKLA 1T03H 4L8DB 4UAOC 5DT1H 2ED7A 2UZIH 1L7IH 2B4CL 3F12B 2BXYA 1A7PH 3EOTL 3MRGB 1P69B 3ESUF 1QPPA 2VSCA 4FQJH 1T83A 1H15A 4PRBA 2Y25A 2OQJA 4PS4H 4TVPH 1N8ZB 3SDXA 1BIIB 1FPTL 1KELL 4XNMA 3PF2A 1VEPA 1QA9A 2NXYB 2Y07H 1IC7H 1VCAA 3DI3B 3D85D 5I8CA 3BXNB 1V7MH 1HHIA 1U58A 1QEWB 2DQGL 1JF1B 1N4XL 2VDPH 3MRNB 4OF5A 3LCYA 4JHAL 4JPVL 4MDJB 3OPZH 2V6HA 4MZ3A 4NQEE 3ROLB 5AWNL 3FJTA 4PRNA 2VLRE 5EFIB 3CXDH 5HPMA 4NGHL 1HHHA 5DQ9B 4DUXA 3RHWF 3QXTA 2BRRH 4NSKA 5GJTH 5IR1A 4L8SB 2F8OA 5K9KB 3T8XB 1IKFL 4ZNCD 4JPKL 3BIAX 4LKXB 4TVPD 1SMOA 3KPSB 2NXZD 3CX2A 4I2XA 3BQUA 3VXSD 4X6BB 1HH6B 3PJSA 1JNHB 1JN6A 2EXWD 5D1QD 3VWJA 3CH1A 1FNAA 4F7MB 1AGCA 1KG0B 2EH8L 2QKIA 3BJ91 1BFOB 4YWGH 1NUFA 2ZOKA 1MLCA 4HMCA 4D3CH 3CSYB 3R0NA 1DSFL 3P0GB 3DV6B 4ODWB 5DQDH 2CDGB 4GS7B 2AEQL 2DJSA 4GAYA 1ZT1B 2VL5A 4PTTA 5FV2A 5LGJA 4ZFGL 1VEMA 4P9HC 5BXFA 3F6IA 1R3LA 5KG9A 1OTSC 1VGEL 3CFCH 1KIRA 2VLLB 1A7NH 5ENWB 4NNPL 1IAOA 2BP3A 3IDIA 4U6TA 5D7JB 1H8OA 5MP6L 1CK0H 4CMMA 5JA9A 4LIQL 2LAAA 4LVOB 1WIPA 4PY8J 4KK9D 5E94B 3HG1E 2QJDA 4GOSA 1KB9K 5MENA 3FFCB 1V05A 1QRKA 4P3DB 3P0VL 3HMWL 1FNEB 4NO0B 1IGIL 1EJOL 3VMPA 2EDNA 2PYEA 2KBGA 1HH9B 4LP4A 4PB0H 4Q9RH 4NQXB 3RKDD 2ITDA 4ZO6A 5HXMA 3LKRA 1MNUH 3ES6B 3SGDI 1ACYH 1CDHA 2UWEB 4WI3A 3EYSL 1JPTH 2XWTA 1FIGL 5J12C 1NBYB 3QG7L 4WFFE 2AABH 4D94A 4FFYL 1I4FA 1T5XB 1WGOA 2DM2A 1I7TA 3IJYB 1KB5B 3C8KB 5MEPB 4XB8A 1NCAL 1A9BB 1ZLSL 2IFGA 1DVFB 1NFIA 2MNUA 4OD3H 5FYKU 4X7TB 3IDYC 4R7DB 1I1AC 2F54E 1KJVB 3GI8L 2HG5B 3TT1H 4JB9L 4JFHD 5K9QI 4PJ7F 2Y4SA 4P3CH 5KVMC 3OR6A 2APXA 2HAZA 2C4FU 1ZLUK 3PXHA 2LVCA 1JHLH 5I1CH 2YA0A 5DJAA 5IHLB 4Q97A 1MFCH 2J4WH 4I48B 4MNGA 4YBHA 4BSWA 4M6MH 4GKNA 5E2WL 4Y4KC 5GHWL 4FXKA 3T77A 4M5ZL 2Q7YB 3EKCA 1OGAA 1LP9A 3EUUA 5JOPE 2IPKA 1KXTB 2DQGH 1AGBB 5A40E 1I85A 5DVLA 2BVUA 4PJDB 4ALAH 4GKSA 4IIQA 1MFNA 3K0WA 2RIKA 1J0HA 1A7OL 3DGGB 2Q7NA 4I3GA 2EYRB 5HI4C 3PGCB 4PJIA 4NOBA 3GMQA 4RGNB 3U7AA 3C6LB 4U0RC 3ZKMC 5D8JL 4K7FB 2YR3A 1D7FA 4OUUB 3V8OA 3FO1A 4BA8A 4PJEE 4IRZL 4FQHA 5D5MF 5C0AD 2VDRH 1Q38A 1NGXA 5KSUB 2F58H 5ITBH 1G9MH 3WD5H 1OP3H 4K7PL 5AEAA 5C0CE 1GIGL 5T3ZL 1RZGB 1I8MA 3HI6H 3MRHB 3LQAH 5IVXE 2AJSH 3JTSB 6CGTA 3T3PE 2XZQL 4I9WE 3BEVB 2D7TL 4QRRB 4H8WL 2IBZX 2HFFB 3VFNA 5FO8B 5M95B 1MUJB 2IPKB 1A6ZA 5DXWA 1OGAB 2DBJA 2AGJL 2Q86A 1R3HB 3T77B 3OTTA 3VXPB 2WUCL 5FUOL 3MBXH 4XNXH 4FQQA 3MCKA 5E2UL 1WBYA 1SJHA 5T1KB 4K3EL 3KNBB 3VD5A 4XH2A 4I77H 3HN3A 1FJ1B 3PV7A 1XZ0A 4FQIH 4MNHA 1NC4B 4W81A 3QIBC 5K9QG 2NY4D 1KPVA 2RR3A 3RWJA 2H3NB 1CFQB 4RMSA 5EUOE 5EU5A 4L1HA 3WLBA 2Z31C 4KPHL 4OZGE 4X7TA 3GB7A 4JCLA 3T0EC 1ZTXL 4Q6IC 1A9BA 4DWHA 2GW5A 1ZA3B 4XMKL 3L7FB 4Q9CA 6FABL 3VCLB 3ZHKA 4MB4A 4G9FD 1I7TB 3OBAA 2W65B 4WGWB 3HPJB 3DHJA 1G9NC 4CNIA 1X44A 1AFVL 2XNAB 1INDL 3B4NA 1KEMH 3EYFA 1LEIB 5ISZB 2UWEA 1IC7L 5C0EB 1G9NL 4GG8A 2XN9E 2R69H 3FQRA 3TNMB 1AGFA 1MCWW 3L1OH 3UZQA 2DTSA 3MGOA 32C2A 1HH9A 2WQRA 4X99A 1TDQA 1JPFB 4UINH 3UJJH 5FB8B 5T1LB 1GGUA 1SEBB 3AS2A 3QUXB 3NCYS 1OAKL 4NO0A 3GSOB 1E6OH 1OGAD 3K74B 1K6QL 3H6JA 1W8OA 2OM5A 3FFCA 4HGMA 4JPIB 5BOPA 4TYUA 1QP1A 3SY0B 4DKAA 2P5WB 3RX5A 1NMBL 3T0EE 4R0LA 5E8DH 3O4LA 4J4PC 3VD3A 1FZMA 4Z9KB 3MO1A 4PJXB 3KYKH 4PJ7E 1ZLVK 2G60L 3GK8H 3QISA 1QFWH 4GAYB 4WHTA 4A6YL 4Q9QH 2HMID 2F19H 1OAQL 2AVGA 4J3XA 4TUOB 3RVTC 3MGTB 1IGML 4DW2H 4YDLB 2FHBA 3ARGC 5ECJE 3ARBA 3HMXH 4LSSH 5KVFL 3V0AC 1YMMB 5HTSA 5LBSL 5DZNA 4FQ2L 2ORBH 1JIBA 1KG0A 3P73A 3BGMA 1A5FL 1AGCB 3NCYP 4OLZL 5IHUH 2D7NA 5AYUH 4X4XB 4PUBL 5D1XC 4WDIA 3OXRB 1RURH 5E08H 1U3YA 2M26A 2X4UA 4Z7WF 5CSZB 5EUOA 1JNHA 4LEXL 1S7WA 4F7PA 3GSUA 4IEFB 2OL3H 5I1KH 2AXJA 2FCBA 3I3EA 1XGQA 1WT5A 3MBEC 2B7DT 5DSCA 4M00A 3E0GA 5IR1B 5CZXD 4NSKB 3OKEB 1CLZH 2QQKH 4P2OD 5LGKA 2VXTL 2FL5B 4A6YH 5H37G 1D9KC 3C8HA 1L7IL 3BQUC 3C6SB 4V2CB 1CD8A 3DX6A 4HDIA 4KRPC 4PJEF 3RU8H 1EHAA 2OTUB 1NCUA 3S5LG 1H8SA 3VFWA 5D96B 3ULUF 1XMWA 4R8WH 3JWDC 1ACYL 1VGKA 2A1WH 1P1ZA 1QA9B 3OKNA 4ELMB 4M1GL 2W0PA 4PJGE 1RZKC 4YHPA 4OFKA 2YD4A 3STZA 3GEWB 5IIEA 5A3IC 4NN6B 1BQUA 2EYSB 3O41A 4XPFH 4R90L 1SQ2N 4ODXB 5A3ID 4WO4A 1VKXB 3H9SD 2JCCF 4OV6F 2NY6D 5ID1B 5DI8A 1XIWB 4OD2B 1NBQA 1BQLH 5IHUL 2XFXB 3L3IB 1KIUA 1CN4A 4NO3A 4X4ME 3PWUA 4FQXD 5TE4L 3VXME 4BKLB 2XG5A 1BVZA 2XA8H 3HFML 3TFKC 5DJ0A 1J18A 3BVNB 1MFCL 3WEXA 3SDXF 4MAYC 4WHDA 2WWKT 2VN4A 3RL2B 4NZUH 2R1XA 4WTZG 3WNKA 3EO0A 2HJFB 2J6EH 1TETL 4RMRA 4O9HH 4S1RH 4BH7B 2VRAA 1AKJB 4Y1AA 2AAVA 1CCZA 3QNXA 2FB4L 1I8LA 4KK5C 4HWBL 1G9NH 1HE7A 3QIWA 1YEHH 4Z7WE 1X4ZA 5CIPA 1JRHI 1GXEA 5E4EB 3RVWD 4EI5A 4QOKE 5HHNA 4JQXC 3VE0A 3ULSA 1L7TH 4QGYA 3X12B 5AG9A 2HJLA 4RIRB 1CL7I 4YDIH 1Z3GH 2EDEA 1RQ5A 3C87A 3VGDA 4PGDA 5GQBA 5F7DB 5ESVB 1WJ3A 4PFEA 4ZAKC 4YAQB 4DKDC 5GS1B 3CIQA 1W2KT 4NQCB 4LF3B 4FQ1H 2PCPB 4PBVC 5DRWA 2P8LA 3DUUA 2ZZUT 4JFFE 4NT6A 3FB6B 4I3RL 3V6ZB 1N0LA 2WSKA 3NZHL 1BWWA 1FV1A 2XN9D 5D72H 4I9WD 2NY1C 4IBLT 2A6JA 3VH8G 3IFPB 4OZIA 4I18C 2YD7A 3O6KL 5LAXB 3JUZA 3MUGA 1MIMH 3BKCH 3BUYA 4PGBB 1YY9D 5DA4A 4IM8A 2KUTA 4EI6B 1IM3A 1JZ5A 3K4ZA 3QRGL 1GIGH 4WV1A 5E2VL 1WWWX 2K1MA 4DOHE 1NFDB 1X4YA 4JAMB 3UTTB 3WCYA 3G9AB 4U1IA 3L3HB 3IB4A 1A6TA 3EGSB 1AH1A 2VZUA 1S5HB 4JKPH 2PO6B 1EVUA 5JNYA 1MJUH 3UCRA 5F7FA 2NTSP 3FQTA 1OAUH 4RWHA 2ADJB 5E70A 5SWZA 1F97A 5DJDB 5GZOC 2VXQH 3S3PA 3BYYA 3TVMB 5DHXB 3F6LA 2R1YA 1UB6B 2VZSA 1VFOA 4GLRH 1UB5B 2VDNL 3DUSA 5EC1A 4WY7L 3IFNH 3RWHB 5FUOH 5LVEA 4HGWA 3V6OC 2NLJB 3ULVC 4RSVA 4MZ2A 2VLKE 3QUML 3G6JF 1MI5A 3D39B 3GMPA 1WT5C 3KPOA 1CDUA 3MBEA 3ZE2F 4F9PA 5D7IA 1T0MA 3SE4A 4FQIL 4I18B 2IADA 1UM4H 1CGUA 2YOCA 3SDDB 1KCVL 4LNRA 4KJQD 2GJ6E 2L4OA 4M8QB 4P5TA 4ZXBA 3BPOC 3JV6A 4AY0A 1UWEL 4KQ4L 3C8DA 4RBPH 1RIHL 2NY0C 4JZJB 4S2SA 5L7XH 1RULH 5JOEA 3ET9F 4ONFH 3T2OA 3DIFB 3WNNA 4OGYH 4Y4HD 1A1OA 1K8IB 5F88B 3H3PL 5JQHC 2BDNH 1FC2D 4PB9L 2Z8SA 5FGCB 1G7JA 4JFXB 2DIBA 1L0XA 4CN4A 1KPUB 3L3DB 3ARYA 5ADOL 4WFFD 3RVUC 2D31B 1MFDH 1BD2E 4Y19D 1I85C 4HMEA 4YGAB 2OJZH 2F53E 2JIXA 2X1PA 5LKNA 2E9IA 3HFMH 2VNCA 1A7RH 2RFXA 1UEMA 1D6VH 4XTRC 4OZIE 4Z0BL 3F58L 2W0KA 3GRWL 3RZWA 1CU4L 4AIZB 1ZEAL 2EDBA 2VERN 3F5WB 3QO0A 5JMRA 3U4EB 4XI5C 1B9ZA 2VDLL 4RRPG 1JZ3A 4J8RB 4WEMB 3CFIC 4J1UA 3HZMA 4ZSOE 2L0DA 1ZVHA 3FMGL 1LD9A 2V2TA 4LARH 1KENH 3TBTB 3SDXE 4NRZB 5D70L 2HN7A 5C0AE 4FFZH 4L4TE 3ZT6A 4F8QA 3BP5B 2X1OA 3C6LD 1DCLA 3CZJA 2X42A 2ZNWA 3L5XH 4QRQA 4ETYA 5CJOH 3RNKB 3BP6B 3O9WB 3P0YL 3OAYK 1CDBA 4YFDB 1ZHLB 1SM3H 5TPWH 5DRZA 1C5DB 4MDIA 2LTQC 2D4DA 4OZFG 1RK0A 3ZKSD 3HZVA 5C2UB 2EEBA 2I5YH 5D1ZA 4JHZA 3G04B 1WCQA 4XNQB 3T2PA 2EDLA 1CU4H 4ELKA 5IQ7L 3HS0A 4O2FA 4FQ2H 4JFEA 4PY7B 3A67L 5F6HJ 2DQIH 2YSSB 3UTSB 3D3VE 1Q8MA 1GHFL 4CBPA 4DQOH 4FA8A 2R4RH 5DEFA 2XV6B 4YXKH 5D5MA 4TOYH 4OCRH 4TRPL 3IFOB 4MXWH 5SWSE 5MHSE 5D2NA 2DMBA 1F45A 4ZS6D 2X7LB 1BMGA 4LHQB 2AEPH 5IQ9A 4U1HB 1DQQA 3QFJA 5EU3A 5SX4I 3G5XA 3HB3D 4KH2A 1J8HE 3HCVA 2Z35B 2Y36L 4JFED 4PJ8B 5KBNC 2J6EA 2ARJB 4EIZC 3S35L 2C7UA 3VWKA 2WBJC 2V5TA 3S98A 2EC8A 4W4OC 2BNRB 4ZAKD 4IDJH 3MV8A 1WAAA 4N0RA 5I66A 4PYHA 1U3ZA 3HI5H 1DQQB 5J3HC 4YHKL 2OP4H 4HT1H 1EEYA 1CBVH 5EIQA 5I6XB 5D2NE 3QI9A 2DQUH 4JZNA 3NOIA 1V7NH 2BY0A 2YSSA 3O2WL 3WL9A 4JPWL 4TRPH 4UB0H 1Z9OA 1YZZA 5C09A 1CGYA 3MJGX 1DUYA 3H9ZA 4ELKB 2EYTB 4WFED 3SGKA 5I1HL 2G5BB 5DQDL 2EE2A 3VJ6A 3CMOL 3L3KA 3ZTNH 4EQ3A 1H3TA 3BZ4B 2EDJA 2E27H 2CKNA 2RCSH 5EO1B 4LK4A 2P5WE 4E41E 5SWQB 3GK8L 3C08L 3O9WA 3BP6A 3IDGB 1JWMB 3ZSSA 1IGTB 4NNXB 2JIXD 5ICZA 3BP5A 4JFDA 1X6LA 4LPWA 4OFDA 2HN7B 3KAAA 5B39A 4NRZA 1N6VA 5EOTB 1AO7E 4L9DA 4FTVD 4O5LH 3SE8L 5KSVA 1AI1H 1JGDB 3EYUL 4QEGA 4GKOA 1KCSH 5EIIB 1B4JH 1ZT7A 3V8CA 3CX5J 3G6JE 4KI5D 4FQ1L 2P5EA 2P4AB 3ZE0F 3O4LE 4U1NA 4ZSOA 3TO2B 3OG6B 5IMMA 2E6QA 4LLQB 2DN7A 1MRDH 3AREB 4Y4HA 4DN4H 1J0JA 2JKXA 3FHAA 3AS3A 3KPQB 3MZTA 4Q7DA 1IC4H 1L7TL 5A2JH 1WUNT 1CDCA 1FCCA 5L0QB 3HZYA 5I76A 1CR9H 2DI8A 3BZEB 4Z95H 5CHNA 2YD1A 1QHOA 4F7CA 2DQUL 3K8MA 4I3RH 1WBZA 2DIAA 1DFBL 5K9JH 4HC1H 1KPRA 3BHBA 1GOHA 5GS0L 3KHOA 3L3DA 5B21A 1T66C 5FGSA 1LWRA 4PRPB 4JFXA 1IKNC 4PRDB 5F89B 4PJAE 4JN1H 4P4RA 2AJVH 3I3BA 4L9LC 5C0IB 1AD9B 5KZCD 3QPXH 3QQ9D 1MI5D 3P4OB 1KIQA 2X89D 4M7LH 3E6FB 1CF8L 4DN3H 4LCIH 1CQKA 1XGTB 5GGUA 3NPSC 2X41A 3RWCB 1C8PA 1YYMH 4TNWF 5I71C 4PJHF 1FRGL 4JVWA 2AXFA 4O4YH 1IAKA 3REWB 5GGTL 4KRPD 1KXQE 1LO4H 3QEQB 2CRIA 3BZFA 2BY3A 4X0KA 1U8MA 2E7HA 1EFQA 3ECBA 1E6JH 3QEGL 5KVEH 1Q72L 4KHTL 2ZP0T 1JWUB 3PG2A 1QFWI 3MBEB 1F4WH 3GMPB 1FG9C 4GW5B 5GIRA 1KEGH 4XBGA 3NABH 2AJ3A 4LLMA 2QSQA 1UB5A 5EC1B 1BVLA 2O5XH 3SDDD 3EW3B 4NQTA 5DJDA 2ICWI 4PJCA 5JPMA 2CK2A 2QSVA 2O61B 2Z91A 5F9WC 4PREB 2XKNA 5BRZD 2EDXA 2WWMC 4L5FL 1JNNL 1OTTC 4HIJB 3TFKD 4NQSB 3S37L 1B0RA 1BP3B 1A6WH 4NQVB 3BKYH 4Z7WB 3NCFB 3R4DA 5E08L 4JCMA 5DD1H 4AG4L 1EO5A 3TCXA 1PJ9A 4KY1H 4PJDE 4HKBA 4K9EC 4PG9B 4ZS6C 4TVSa 3TH4T 3BUYB 4PGBA 3MUGB 1KTDB 5IOPA 3HRPA 3U0WH 1B0GA 1X5ZA 3CUPB 2VDLH 1IAMA 3GJEB 1FV1B 3W5NA 1BLNB 3QEUA 3CLEH 1J1XL 3OKKB 4LLVA 5C70A 3DUUB 2ATPB 4R4BA 2MFNA 5C7XH 4K94H 1D6VL 4LLDB 4PJEB 4DKEL 3WFDH 5F9OH 2PTTB 1WF5A 2HJLB 4RIRA 4PY8I 2A0LC 4PPTA 4WWKD 1IEAB 1OT2A 3GSNB 2WV3A 1DQDH 5I71B 2HKHH 3WFHA 3HC0B 1RUQL 4NRYB 4G3YL 4XBEL 4XVTH 2BVPA 2HLFD 1NDMA 4JJ5B 3VFPB 1UVQB 2NY6B 3A6BL 4MA1B 4PLJC 3WXVL 4UV7L 4DVRH 4N0FA 3SDCB 1RFDL 3BD4A 4CU7A 4XCFL 1JHTA 1NJ9A 3L1OL 2P24A 4G80B 4OCMC 4Y16A 1OB1B 1WWAX 5D1XB 2PN5A 5F72S 3RPIB 3S96A 4HG4K 4RAHA 1I7ZB 5I74B 5C07D 2AK4D 4NO3B 1INDH 2YMXH 3RZCD 4HC1L 1P7QD 3VXMA 3SQOL 1YNTA 2YUXA 5DWUH 4ODTL 1FYTD 4LBEA 5EUOF 2YBRB 3L5JA 4OD2A 3CSPA 4Q2ZB 2VLKB 1XIWA 3MRDB 3OSKA 4NQDA 5C6TH 1QACA 1RUAL 3LS5H 4GRWF 4MJ6A 4E42B 4QXUL 5I1JH 4WO4B 4F9LA 4PB0L 4G43B 4C4KT 3PQYB 2QADD 2XKUA 1DSFH 2VSDA 5IB1B 4MQ7B 3IDMA 1OWRM 3STZB 3K2UL 4JRWA 1MAKA 5CP3H 4GRLC 1G7MB 3QUZB 4G6KL 4OKVA 2EXWC 3GSQB 4NN5C 1AXTL 2GJ6B 3CVHB 1VGKB 2OYPA 3KYMA 1PG7W 3G5ZA 3HAEG 2X4SA 3BDYH 2DJUA 4DTGH 1T3FA 2IANE 4Z7NE 2OTUA 1T0NA 2IAMC 3ROOB 3D3VD 2YN3A 1KXVC 1OAYH 5EZJB 2NY1B 5IVZB 2Y36H 4RAUB 5L7XL 1Q72H 3MV11 4YZFF 4GAGL 4UZGA 3O2DH 4Y2OA 5BZWA 2FL5A 3L9RA 1MH5B 3IDUA 1FFOB 1YMMD 5J6GB 5BCAA 3MOQA 2V9RA 2LTQB 3QUMA 3CAFA 3GDBA 5D2LA 1OT1A 4ZUTA 3MRFA 1DANT 3VDCA 5DHYB 5FOBA 4PJ5E 1MCNA 5J1TC 5C0FB 2X4OB 2PR4H 3B43A 1NAKL 1UXWA 3TBWB 4XWGL 35C8L 3M1BB 1LE5A 4WDIB 3V4PL 3RWFB 1FO0A 2OL3L 4JFQA 3T0EB 1RZIB 5J13B 1KLFA 1MHPL 3S9DB 1JV5B 2BHZA 4OB5H 3P73B 1OLLA 3LQMA 2B2XH 3SKMA 5CJXA 3L95A 1YMMA 3QQ9C 5H94B 3UTZA 3FFCD 2FH8A 3O11A 5I1CL 1NBZA 5IMKB 4E9LA 3PQYD 4M7ZC 1XGUB 4AENA 1ND0A 2G75A 4WFHE 1OLZA 1JFQL 3ORJA 2NX5E 4E5XB 1FYTE 1RJLB 1U3JA 5E2JA 3NZ8B 4ZPVA 1H0DB 2AK4E 5EORL 4GMTL 4G9DA 5HSFA 1MJJA 2I60H 1FL3A 2SEBA 3WUWG 1KENL 3DARA 1FZMB 4HHAB 3I75B 2BNUB 5I16A 2H6PB 1WTLA 3N06B 1JBJA 1MRDL 1AGEB 2P5WA 3IJHB 3QQ3B 4GXVL 1A3LL 4HEME 5D1XD 4U1SB 3BFOA 3CD4A 3G5YB 2HKFH 1QYGL 3GM8A 1P4BH 5INCB 4M1GH 1IFHL 1AXIB 3MROB 1VPOH 5F97E 2NXYD 2WANA 2YD6A 4K71B 5C8JB 3QUXA 3LD8C 2QHRH 4CVXB 1NANI 1K4CB 1Q9OB 1ZHBB 5DZLA 3FQRB 2NPLX 3SQBA 5IQ7H 5KOVC 3RKPA 3T0XA 2ADIB 1A14H 2R23A 1Z5LB 4MVBC 2A9NL 2P5EE 1FH5L 2W60A 4OLYH 2EKSA 3FN3A 3EYFB 1X5AA 5CEXA 3UJIL 5BQ7A 1PVHA 3RX8A 3OJDB 4LQFL 5H2BB 3MA9H 4OV5A 3NAAL 4MD0A 5EBGA 5I18H 4EUPB 1JPSL 4NKIL 4UU9A 2E9BA 1UJ3C 2C3XA 1SYSA 3TZVD 3BGFC 4O51A 4G7VL 1UWXH 2PW2A 1P4BL 4PRHA 1DL7L 2XI9A 3QDGB 3UYRL 5ISZD 5LGHL 2VISA 3HE7A 1AD0A 2CD0A 3KYNA 4XPHH 3RDTB 2FZ3A 1S5IL 2H3NA 3QHZL 5D1QA 3VWJD 1BD2D 4FS0A 4GW1A 2VIRB 4U3XA 4IDJL 2G2RB 2WBJD 4L3ED 1NEZG 5ICXA 1ZXQA 5EBMB 3GBMH 4LASH 3UAJC 2ICWB 1HINL 4KWUA 1B6DA 4BFBD 4K8RL 5HGBB 1E4WH 3LRSB 1DEDA 3WE6B 3QHFL 3F62A 4H88L 4HX1B 4M7ZB 5HDQH 1R5WA 4ISVB 5BOZG 1GJIA 1E6JL 3WKNA 1I7RB 3GNML 1S8DB 1XF4B 3UTTD 1MUJA 3O81A 1D5ZA 2CSPA 5LWYH 3WO3B 3KWWA 2D9CA 3IF1A 4Z18A 1U8LA 4PRPD 1VEOA 2FZ3B 1Q9WA 1AD0B 1IC1A 3QRGH 4PLJD 3CSBA 5F1IA 1WICA 4I8DA 4W68A 2O26U 1CLYL 3CFKB 2F9BT 2C4FT 1X6NA 1OARL 4X7FC 2X9YA 4QOKB 2NW3B 5KTEH 2UZYB 2ZUWA 4FQXA 3TVMD 3QFJE 4NQCD 1TZGL 2R69L 4XBPB 5H2BA 3OJDA 3L7EB 3LEYL 5D5ME 2D9QB 5TFSL 3LDBC 2R4SL 3RVVD 1A1MA 4NKQB 3P77B 5KVGL 1DN0B 2XZAL 3D3VA 4LRIC 1KTLA 1E6OL 1C16B 5KVDL 4U6YB 4PJIB 1A6PA 5D1QC 3HE6C 4XMPL 4QXGH 4X6FA 4J6RL 4N1EA 5EG6C 2NR6D 2ICEA 3O3EA 4GKSB 5C8JA 2J5LC 1MCFA 4LDOB 4Z76B 3T3PF 4XCFH 1FLRL 5JORA 5ALCH 4YHLL 1RUKL 1EBAA 1KLGB 5IESL 3K7UA 4Q6IA 5C3TA 5TDPA 1BX2A 1BQHA 1WIOA 1LP9B 4LPCA 2BSED 4XP4L 2Q7YA 5C0BE 4M62H 4P23D 1CGSL 5BJTA 5F8QC 4QRPB 3RZCA 4G3YH 4XBEH 5KTEL 4MCYB 4S10A 3ARTA 3IXAA 4CDHA 3ZLQC 4BSWB 1NLBH 3RUGB 5IK3A 2EE3A 3FO9B 4KKNA 1T1WB 1U8JB 1RJLA 5FM4A 4LSPH 4GS7C 3MLPA 1ND0B 5ALCL 4ZFOL 2NY7H 3OR6B 3MODH 2W9EH 2GITB 4U6XB 2FIKA 1YA5A 3CFEA 3P40A 1KELH 4NN6C 4GBXA 3L95B 4J6RH 2J5LB 3SKMB 4XCYB 3D39E 3RWFA 1XCQA 4UUJA 3M1BA 1CXKA 4KTDH 3TT1L 2VTFA 4ODUA 1ZLVH 1GGCH 3IJYA 3P9MA 3MRFB 2W38A 1I4FB 1T5XA 3O2WH 5KANI 1EFXA 2E27L 1BECA 3UBXI 1CE1H 1JZ6A 4WVRA 2Z4QA 1CXLA 4JKMA 5I1HH 4HK0B 3L9RB 1FZJA 4LGSB 3WUWA 1NC2D 4NWUL 1GCFA 1J1PL 5SWZE 5M7QA 5E2TL 4M6NH 5DJ2A 2CK0L 3ZSTA 1GHFH 3PXJA 3DX9A 4JM2D 1T0NB 4P3DA 2VXVL 4OI9A 3VG0H 5FFLA 4OIAA 3FQWA 4GSDL 4R90H 1A7BA 5FYKD 2GJ6A 4R4ND 2GIYA 4CUCA 5IGXL 3MLZL 1OD7A 5IMLA 1G7MA 2DQDL 2NXYC 3CDYA 1URLA 3IDMB 1FNGA 1SY6A 2EZ0C 3BRFA 2FD6L 1S7RA 3HPLB 4NQDE 5I15L 3O6LH 1ZT1A 4HJJH 5GGSA 2CDGA 1GGBL 1U8OA 3I84A 2C1PB 1YN6A 1GZQA 1MJ8H 2VLJE 1SYVA 5CGMA 3WKMH 5I1DB 3TZVA 5CFHA 5DK2B 1NCDL 1EHXA 4N68A 1I3GH 5JQ6L 5LCVH 3PL6A 3U36B 1A3LH 1YEGL 2QKIB 1ADQL 1S7UB 2YK1H 2BHUA 1OSZB 3J7HA 5IVXB 4DN3L 5DHVA 4L4VA 4NHUA 1JP5A 1IEBB 5EU7C 4M93B 4S0TD 4XAWL 1RZKH 4NDMA 2FSEA 3BKCL 1D3CA 2HTLD 3CFDB 3FL7A 2B0SH 5J9PA 4MAUH 1U8PA 4YDVB 1IQWH 4R97C 3DROB 2E3VA 5CLTA 5BV7C 3EYOB 1TLKA 2OTWB 2QV2A 1ONQA 12E8L 2PTTA 3MLSH 5EZLA 4PRNB 2CDFA 1TCMA 2KL6A 4R4BB 2ATPA 5F7LB 2K7PA 1KNOA 1TZHB 4JB9H 1U58B 1EMTL 4HULB 3G5VA 3LMJL 4JHBA 4GRLB 5DURB 2PXYB 5TQ0L 1V5JA 4OFVA 1PBYA 4WU5A 4KZEH 5GRXG 3TVMC 3K1DA 4HKBB 5AD0B 5LQBL 5HJ3B 4LVOC 1I8LC 3G9VA 1CDIA 3WXWL 1J5OL 2EC9U 4NQVA 4Z7WA 4LLUB 4APQB 1ZK9A 5FYLL 1CR9L 2W9DL 1P9MC 3SE8H 4Y1AE 1RI8A 3QFDB 2DQFB 3RTQA 3REVB 3HE6D 5L8KB 1KT2A 4MAYA 3LKNA 2NR6C 1CWVA 3SKOA 3FO0H 2Z91B 4PG2C 1T2XA 2YUZA 1MPAH 2UY6A 3BSZL 5I75B 2YA1A 4YC2C 4V1DD 1G7PB 5E8DL 1CE6B 1WQVT 3FRUA 3MQIA 2J1KA 1XF3A 1YY9C 3O2VH 4MA1C 4RMTA 3THML 4Z7VA 3MJ9A 4IRJC 2DQEL 4QRUB 1LO2L 3D2UD 3RL1A 2AJ3B 4Q0XH 4Z0XB 3AAZA 3VGEA 1WISA 1CTOA 1EIBA 1MEXL 4QCIA 4XP1L 2JB6A 5EU7E 2FR4A 1BBDL 3GSVB 5DTFA 4JG1L 2CLRA 1MPAL 3FQNA 5DD3H 3PWNB 3ZE1E 5E8OA 5J6HA 1IAIH 3RRQA 1MCDA 3FONA 5GS1C 3TBYA 4F2MB 4L3AA 3BUTA 4JGUA 1UA6H 3S7GA 2FJHB 1G6RB 1R5VA 5MEOB 4CN1A 5E4EC 1EZVX 2BJMH 3HUJA 4XNZB 4KUZL 5L88H 5K93A 2WINA 4XP1H 4DVBB 2VZTA 3DVGA 4D9QE 4L3EE 5CILH 4UQ2A 1RHFA 4HV8B 3KS0J 2VQ1B 2DWDB 4J4PD 3UJTH 5KW9H 3I85A 2EE6A 3FMGH 1PKQE 1P53A 4Q0XL 5FDWB 1FG2B 1I9IL 3C2SA 1EX0A 3IETB 2CIIA 1KJ2H 3NGBC 1MFBL 1MY7A 4R96B 5EPMB 2FHCA 3MLVL 4X4ZA 1X5HA 4K3JL 4M43L 4OCXL 4AK1A 5CHNB 4YLQT 1O7SA 1R3JA 4BUGA 2C26A 4PLKD 5IBTL 2IG2L 5A16B 3L3JA 2E7LC 4M6OL 5FHAH 2PXYC 3X13A 1VSCA 4YBQC 4QHLB 1T66D 5TPWL 3SDCC 4U31A 1F13A 4YBQD 4PJAB 3GUTB 4U1NB 4JY5H 2B0SL 2CIKB 2P5EB 4HKJB 1YY8B 2NNAB 3HR5B 4PTUB 4JFHE 3CCHA 4PJGB 5EOTA 3QWOA 4RDQF 2CLZA 4IOIB 5CZXC 3DURB 3KPRB 1BOGB 5DK0A 1I7UB 4NNXA 5GRVL 1M1SA 1MQ8A 3EYVB 3OKOA 4V1DE 4XCNB 2OS7A 3F7VA 1WFNA 1YMME 4JFOB 1CDJA 2Y06L 2VOTA 1FVCB 3HHRB 1VFBA 5F71A 3MLYL 4G6FD 2GSGB 3BH8A 5CP3A 1H5BC 1NEZA 3QH3A 2C3GA 4UILH 4XPGL 1HXYA 1QQDB 5JDSA 1DUYB 2DS4A 2VITB 3GM0A 4OIIL 3F7RA 8FABA 4OB5L 1RV6X 1RJZB 4NZJA 1RU9L 3JV4A 3MRMB 1DP0A 4PB9H 4OAWA 3UP1A 1SVZA 1GGIH 4YHNB 4A6YA 4YUEL 2IBZY 3VG0L 3F65A 4YIQA 5ADOH 1MHPH 3F7YB 3RWDA 3KXFE 4X5XA 1PZ5A 1Q94B 5ITFB 4OM0H 3SDYH 4C55A 1DZBA 2ZKHH 5C0DB 5HHPA 2AXGB 4PJ9C 4PJDF 3DMMA 3QXWA 2BNRA 4UT6L 1BF8A 1A7RL 1AGDB 4GW4B 4LSRL 4C83B 4CVZA 3B9KB 1Y6NR 2ARJA 4KU1A 4QHUA 4F37K 3CFBB 4M1DH 4PJ8A 5CJ5A 2A77H 5I8KL 1MFDL 1U8HA 4YBLB 1MRFL 1LK3L 4LSQH 1JL8A 2XRAL 5IG7A 5JA8B 5CAYB 3KLAB 3D0VB 1W0VB 4WW2B 4Q9RL 1YNKL 5ESQB 5M94B 3IFOA 4XAWH 5D5MB 4LU5H 5T3ZE 5E8NB 1YUHA 4QRSB 1CT8A 2VH5L 3QDMD 4FN0A 2VABB 4RFEB 4UNVA 1ZGLA 1A6UH 3ILQD 2X4PA 1CLCA 2AP2A 3OKYA 1NFDE 2QADB 5AUMB 2FRGP 1EZVY 3VXRA 1UXSB 1XH3B 3MYJA 1NKRA 3HS0B 5LCVL 1TVDA 2A77L 5D2NC 4CL7A 5I0ZA 4U1JB 5EO9A 2ZUTA 4HPYL 3RVVC 4HKZA 1MWAL 2IGFL 2EH8H 1M7XA 5ANMB 4WW1B 3V5KA 2BRRL 4GRWE 3IKCA 2NTFA 5E24E 3NPSB 2HYMA 3ARFB 4HKZB 3KLHC 3IJSA 1OY3B 4RMVA 1C5DA 1OGAE 4Z95L 5BVJB 1PDKA 3VXRB 1ZTXH 3RNKA 1HSBB 2GCYB 4QRQB 5D9SA 4KK6D 1J12A 2VABA 4RFEA 4AH2A 1RUML 4HPOH 5F96L 2BVEA 2KH2B 4UTBL 2VYRE 4NQCE 4P2RD 3IFNL 1NLDH 4YGVB 3SBWC 1ZLUH 4K55A 1Y6MR 4U1LB 4JN1L 5C92A 3HZMB 1QLEL 1CK0L 4NFBA 1DBAH 3W0WA 4APQC 15C8H 2BY1A 3KXFD 5C0BD 4QT5B 1PG7L 3K3QA 2F54A 4CAGA 5SWZD 4U6HA 4KDWA 3T65B 3G6AA 4P2RA 4KZEL 3KYAA 3UTTE 1H3GA 1PZ5B 1Q94A 4M02A 4OF3A 2CUHA 1EMTH 1GGCL 1T2QL 2D31A 4MHHI 2ATKA 1DBAL 2NY5C 1KPUA 5TDOB 3VFUB 3VA6A 3JV4B 4ORZC 2XT1B 3PGFH 5E5MB 7CGTA 4EVNB 5F6IB 1N2RA 4V2BA 1HEZA 4S1RL 4LHUD 4LRIA 5IJVA 5B38B 3NIDE 3FT3A 1QQDA 4TUJA 5CLWA 1BBDH 2O5YH 3DIFA 1IGJB 1GC1H 3VD9A 2GSGA 3HTLX 2YD2A 1DQJB 3HG1A 1R24B 2BSTB 1FIGH 5F7YC 3LN4A 1KN2H 2E6PA 1F58H 1IM9B 1PQZA 3MR9A 1QKZL 4B50A 4X7EC 4JEGB 5DK0B 4N90D 3PIQA 1PLGL 5I9QC 1WVZA 1IEHA 1G9EA 2B5IB 2CLZB 4MMZC 4NKDB 1UKSA 2VR4A 3CMOH 4JO3L 3ZTNL 1HI6A 2Z92B 4NPYA 5DJ8A 4PGJA 3UJTL 3CC5A 5DS8A 3ZYIA 5TF0A 1W0YT 1YY8A 2NNAA 4PV8A 1YC8A 2Q8BL 4RCAA 4P5MA 2AKRA 3MRBA 1B2WL 1HCFX 3CPLB 3RUGF 1IM9D 1UB6A 3OR7A 1PX3A 1BZ7A 2FBOJ 4ETQA 4HBQA 2D7OA 4Z7UA 1KB5H 1RJYA 4MXQD 4JDVB 5DJCB 5I0DA 1K8DB 1CI5A 2I07A 2LFGA 1WFUA 4N8VG 2F8VA 5MENE 1EO8L 4XC3H 1U8NB 3GJFK 3UJIH 3QCVH 1HSAB 1S5HA 3L3GB 1BD2B 1YN7A 3QIUD 5ESAA 4OIBA 3IRPX 3EGSA 2Q76A 5SX5K 5DQJA 3V6FB 3VFVB 2DQHH 4QHNB 2XOTA 4JQVA 3LKOB 4BQ8A 1UJ3B 4X6DE 3NFNB 5LGHH 1RUQH 1JHKL 1IM3B 2XIDA 2HT3D 4MA8H 1C08A 5C0CD 5JIIA 4IDLA 1KFAL 4GRMB 3DVGB 3DRQA 4F3FB 4DVBA 1JGUH 1J87A 5JW4N 2I9TB 3QIUA 4QXTB 3D5OF 2KZWA 3WJJA 5I2IB 2J8UE 2Y06H 5HGHA 3MLTB 4DEPC 2BVYA 2PCPA 4LF3A 3RVUD 3G6JA 2R0LH 1T0PB 1LMKA 2AEIT 4GMSL 5IMOB 4OJFL 5ESVA 2WIIB 2XPGA 4K71C 3X12A 3QZWA 4LCIL 3VFTB 5HGDA 5FGBA 3OHXB 3VMOA 2BC4A 5GJSL 3H9SB 4MX7B 4Y4KD 4XTRD 1FL6A 5DJ6A 3TPUB 3LEXA 4BZYA 3ARXA 4JO1H 4U1KB 4ZFFB 4QCIB 1PYWB 1QBML 4Y1AB 4LSUH 3B9VA 4Z7VB 3K2MC 4XNUH 1EERB 3BX7C 1A5FH 4OLZH 2ZSWB 1E4XL 3DTXA 3QJFA 3RVXD 3RL2A 5JW3L 1MVFA 3VDBA 4HJJL 4PRIE 4TQEH 5HYQB 1RHHA 2DM7A 5DJ0B 5J1SC 1IGMH 1TJGL 3JSSA 1MHEA 3RI5F 4LARL 2A83A 1A3RL 1UACH 1NCWH 4MA7L 4PRAB 1KT2B 3Q6FA 4K3EH 1QBAA 5EA0H 5FYLE 5FGRA 1EGJL 5DD3L 3ZDYE 5ID1A 4HWBA 3TA3C 2OR8A 3RY6A 1TQCC 1ZE3C 2ZG1A 3RWGB 4O2EB 3T0DA 4IRJD 2XICA 3MLRH 5HJ3A 1CFNB 1MCOH 4YHZH 4AEHH 1NGPL 2PXYA 4XWOC 4PV9B 1TTFA 2A6IB 2VL4A 3G5VB 2UVEA 3VFWB 1DVFC 3M17B 3U79A 3NA9L 4XZUA 4P48A 5FKAB 5KS9A 1DVFD 3MRIA 1BM3H 3RWGA 4L8SC 1NGZB 3CK0H 5JOFB 5GS3A 4KUZH 7FABL 4TSBL 1F3JB 5DJYB 1FBIH 4DTGL 1ONQB 3SKJH 3T0BA 3SE4C 4UQ3B 3Q6FB 4GAJH 3WBDA 4NNPH 4P57B 2OZ4L 4G9FA 1JPGB 3DROA 5DUPL 5JIKA 3LN5B 5GGVH 5GS0C 2R9HD 2QQNL 1HQ4A 3S6CA 4GXUN 5HY9A 3GGWA 4NO2A 4PJXE 2E6JA 1FVDA 3DTXB 5CGTA 4CVWA 1MCQA 8CGTA 4KI5C 3GSUB 4LGPB 4P49A 1FZOB 1GPOL 1QLRB 2BSRA 4RDQG 3AY4A 4OLWH 1IEBA 2X4UB 4HW6A 4NWTL 4LSSL 5KVFH 3X3GH 3TBVA 1PYWA 2B20A 1AE6H 1OSZA 3NVQA 1YECL 2JJTA 5I30L 3LEXB 4P23C 1YJDH 4OF7A 1XEDA 4FP8L 4G8GA 4HH8A 3CDGA 4MQTB 2OX5A 3KPNB 4RGOL 3ARRA 4OFPA 1L6XA 1NCCH 2XPGB 5E2UH 2D0HA 2DLFL 1SYVB 2X6MA 2C1PA 3RFZC 3KPRD 2R2EB 1CXHA 3PWPD 2F74A 3QJHB 3C5JB 4ENEC 4F7EA 3FN9A 1SY6L 3I02B 4MJIE 3MV01 2H2SD 4N0UE 4WI8A 4OTXL 5DWUL 3W2DH 5IMLB 1R5IA 3MRRA 3PGFL 1JPSH 2XZCL 4NKIH 3T0AA 2QQQA 3CU7A 5B3NA 4K3HA 4Y5VC 3G6DL 4JPIA 4DGYL 1X5IA 43C9B 4E0RA 1AHWB 1QO3B 3BISA 3U6RB 1Q0YH 2Q76B 1T7YA 2NY2B 1WWCA 5T1LA 1JPST 2X09A 2JELH 2HKFL 2MPAH 3WFCH 4OFYD 3L3GA 1U3HB 5FYLD 1ZGLM 2C4XA 1AGFB 4HS3B 1U8NA 2O5ZL 1FZJB 2WQ8A 1SJEB 4PJ7B 3S4SB 4B7IA 4MA3B 2Z4QB 4OF8A 3UROR 5ID0B 2I07B 1LEIA 4NQED 2ZJSL 4LSDA 4UOW1 5EO0A 2MMXA 3KLDA 3KPTA 1FORH 3NIGE 4KJPC 2KQNA 3LAFA 4FFZL 4X80L 1ORSB 3S34L 4AMKL 3QDGD 5GHWH 3L7FA 4MQXD 3CPLA 3TCLA 2JJSC 1HXMA 3C5ZA 3EJZC 4M61B 3OWEA 4X5WB 1FLTX 2PW1B 5HDQL 2J6EL 1EJ6A 4MNQA 3PDDA 4N1HB 4NPYB 1XF1A 3PL6C 2H2PC 4EN3C 4Y4KA 2IF7A 5TJWK 3ARGB 1CFQA 4HK3N 1MCSA 1EXUB 1KPVB 3RWJB 2CKBA 1CD9B 4RMQA 1G7LA 4H26B 3TYGL 5L0QC 5IV2A 4MNHB 3MR9B 5HGAA 4O02L 4MMXC 1UADC 5D7KD 1J05B 1FNSH 1HWGB 3LN4B 1S5IH 2B4CH 3PWLB 1T1WA 4M6OH 4PP2A 1NFKA 1RZJH 3D9AL 1R24A 4FMFA 3HG1B 4FQQB 1TZGH 1NL0L 2B39A 2WLZA 4MCYA 5JR1L 3HLAA 2I60L 1IGJA 3U30C 5I8EB 3CH8A 1XCTA 5C07A 4IJ3B 4PJGF 1BQHB 1BX2B 3X3FL 2BRQA 3WJJC 5CJ8A 2Z8VC 3AC0A 5D96C 5JORB 4BH8A 1UM4L 4U05A 5E5MA 3BEVA 3ZTJH 5TDOA 5ETUA 1FGNL 5DYOB 4FQLL 5HYJD 2ZUSA 4JM4L 3X11B 5LWYL 1RZGA 1I8MB 2FEEL 3QFJD 4U6YA 5HYJE 4QRRD 3BPOB 3RNQA 5CJQL 1FNFA 1CLZL 3QAZB 4P2QB 5GGRY 5J4MA 1DN0A 2D2OA 3D3VB 4HLZH 1RZ8B 1YNLH 3TIEB 3TO4B 4U6HB 4JDZB 1ADQA 1WZLA 4NGHH 3S3JA 2HT2D 1OP3K 4IRJB 3TO4A 3WDHA 2AI0L 2FDBP 5HYJA 1U36A 4JKWA 3ARFD 4L3CA 2WZPD 1AIFA 4HFWA 3GKWH 1U8IA 3RNQB 4XPAL 4J23A 1OW0A 1CL7H 1F3DH 3I6KA 4MS8D 5DHVH 1H3WM 2IJ0C 5F1IB 5HDOA 4LAQH 5CBEA 2H8PB 1QZ1A 5GRVK 3QXAA 2NY7L 4BH8B 5C0AB 1HSBA 3MLXH 4BSVA 3BN9D 2P47B 5C0BB 2GK2A 2YPKB 5C07B 1XF4A 2HFTA 3BD5A 3ESVF 1C12B 1OGTB 4H1LH 4PJ8C 2OSLB 3FAXA 3HLAB 2R15A 2DOCA 4CW1B 3UC0L 3VFSA 1RIUL 2V5MA 1T2QH 4WW1A 5EA0L 3RWEA 4I48A 2ADGB 2UY7A 3O8XD 3Q5YA 4XWGH 4NFDA 4PP1C 4U3CA 3O8XC 4HCRL 1MHHB 3FB8B 3L6FA 4IRSB 4L8CA 1UXSA 2BSSB 3JBG7 3OAUL 1F4AA 4H26A 3K81A 5D1QB 1ZGLB 5D6DC 1AKJD 2EKJA 4YHIA 1N5AA 4KGLA 1NMBH 2PTVA 3HE7B 4MNQE 1EAJA 2G60H 2VISB 4Y5XC 3QDGA 3UJJL 2HG5A 4XNUL 3LDBB 1HZHL 2N7AA 3OGCA 4O51B 5GRYA 5ERWA 1F00I 4HJGA 4HWBH 4X5WA 4G7YH 3KLAA 5F93C 2Y07L 1CLOH 1NFIB 5IG7B 1WBXB 3O8XA 2CR6A 4N0YL 4DK3A 2IGFH 5L8LB 4I13B 5IM7A 2JLLA 2VWEE 3CFBA 3FN0L 3VI4F 3UPRA 1Z3GL 3HZKB 1CDYA 3GKWL 3LN9A 1KBGH 2UZXB 4ZDHA 1I9EA 4WIQA 5BQ7B 2DLGA 5FYJU 1XIWD 1GAFH 4H8WH 4ZS7L 2ADIA 1MCBA 1T04B 3EOTH 3ES6A 4NN7B 2FIRT 4ODVL 3CVIL 4X5XB 4Z78B 2V17H 1K4CA 1Q9OA 3PWPE 2ARJQ 4YHNA 5I1GL 1CGVA 4WI5A 3MLZH 4U2ZA 5MENB 4Z7OF 3FCTA 2BVQA 3IXTA 3ZKQD 2X1XR 1CBVL 1DLHA 2VITA 4CMMB 1NAML 4M4RA 2VJXA 5DJZB 5I16B 3QH3B 3BH8B 2ICWJ 4FFVD 1FL3B 1ZWIA 3I02A 4HT1L 4WI7A 3CSGA 4PLKC 4F7EB 5LGJB 1H0DA 3QUKA 3WNLA 3U2SB 2OXHA 5SWSD 5MHSD 3HE7D 3OL2A 2MQCA 4KJQC 2NXZB 1H3VA 1I1FA 2EC9T 1RMFL 4MLSA 5L6YH 1MF2H 4LCWA 3BEWB 5IWLC 4XPHL 3DHMA 1NBZB 4H8WC 1P6AB 3GJFH 4UV4L 1H5BB 2P1YA 3UTZB 4LMQE 3FZUC 1S78C 5KJRL 1HHKA 1QSFD 5DO2D 3H8NA 2EIBA 1TVHA 4X83A 3TBWA 1EDQA 5DA0B 3UYRH 2BSRB 5EU6D 4PJAA 3BQUB 5FXCH 3PL6D 4NUJB 3C5SA 4FQCL 2JF1A 4ZUTB 1F3RB 5I1EL 4NO2B 4KQ3L 1BHGA 3T8XA 1HHJB 1DQML 3NIGF 3LN5A 5IB5B 1YNKH 3QCUL 4G9FB 1P5VA 2YXFA 4OM0L 3S4SG 2V9TA 4R2GC 1N5YH 4H1LG 4IS6A 1MRFH 5FAAA 4EBQL 4X9FA 2H41A 5EPMA 2D0GA 4RAUA 2F58L 3V5HB 4XNYH 1JF5A 1SBBA 5GSVA 3V52L 4F9LC 4NBZB 5FDWA 3MRIB 1UKTA 5B3JE 1EUTA 2PF6A 2DWDA 4XZUB 4KKCD 1HHIB 3G5ZB 2XN9A 2JJSA 1TPXB 4HXAL 1G9MC 4HZLB 2HVKA 5DMYA 2A6IA 4P59L 1T20A 4ZPTB 4PV9A 3NACL 5D71H 4M9OA 2R1WA 1AO7A 1N5YL 4P2QD 1N8ZA 2DQCH 5CUSL 3SDXB 3UTPD 4DW2L 5EN2B 3GI8H 5IB1A 2OQJB 2GT9A 5FCSH 5F7UA 4K8RC 3BIKA 4PUBH 3UO1H 4F2MA 4D9QD 2FGWH 3JWNC 3VRLE 1NC2A 4RGMC 2CLRB 4BJLA 3F12A 3GSVA 2Q8AH 3EZJB 4P59H 4MS8C 4PRAA 4OLXH 1JGEA 5EU6B 3ABZA 2MWCA 1T7WA 3ZYZA 1S7TB 2NYYD 3DO7A 1F4XH 1OOAA 1WCBA 5HYQA 2P24B 1I1AB 1T22A 4JRYB 3SDCA 2EH7L 3U4BH 1AQDA 4QRUA 1D6EB 1CICA 1T1XB 4FZEH 4GBXD 1UVQA 2OXGA 4YHLH 2LVEA 2R29L 4Y16D 4DZ8A 1YQ2A 2W07A 5J57B 1GC1L 3CZFA 1ZLSH 3BN9C 3SKOB 4B53A 1Y0LA 3GO1H 3H9SA 5T1KD 5F7EL 1R3IH 5HGDB 2DQFA 3LPFA 2FECI 3QFDA 3S35X 3DX7A 3DLQR 2P8MB 2R9HC 3CXHJ 1UCTA 4LLUA 1T1ZA 3K8LA 4HKXA 1VADA 3O45B 3E2HB 3QNZB 1LO0H 1TQCB 5HGHB 4AT6A 4KFZC 2VDKH 3V6OA 2IG2H 5F7WC 5AD0A 3OAZH 1IAIL 3ZDZF 4N8PA 3KPLB 4FXGB 5L9DL 3GJEA 1QRND 4GRMA 4G5ZL 4RGOH 3PP4L 4GRLA 4G8EA 1C08B 1F2XK 4PG9A 3WS3A 1FAIL 2CLVA 2XZCH 4MXVE 3NFNA 4FOMA 4HIXL 3Q6GH 1UJ3A 3LKOA 5BW7C 3EHBC 1TPXC 3FQUA 4UMGA 4LLWB 1XIWC 4CJ1A 3VI3E 4YH6A 4OLXL 1HKFA 5ESAB 2VDKL 3GMLB 5DEGA 1U93A 1Z2KA 1MCHA 3T4YA 4C59B 5DVKA 5GRJH 3AXLB 4WJ5A 5C7XL 1A0QH 3A6CL 2KPNA 2WNGA 5FO7B 4JDVA 5DJCA 4HMDA 4E41B 2O61A 4QRPE 1OSPL 1JZ7A 3CFDA 5F8RC 1K2DB 1L9MA 5FYKH 1LP9E 4JJHA 3RUGE 1G1YA 3MOBH 4ETQB 5DFTA 1FO0H 5FYLH 4NDMB 4PJHA 3OPZL 1LE9A 4HCRH 4L4TA 2AKRB 3MRBB 4XBGB 3QIBD 4Y89A 4Z7OE 1BM3L 4I4WA 4PV8B 2AGJH 3QEQE 4TPRL 3WXVH 4PGZA 3FT4B 1JYVA 3MCLH 1QUNA 4RRPA 5CBAA 2YEZA 4QXUH 2XXCB 4X0KB 3TWCL 4IHOA 4P9ML 3BZFB 5IW1A 4KJPD 4BQ9A 1N59B 5DMIL 4JM2A 3WDJA 2IALA 2BNRD 1DQJA 5T5NG 3RWCA 5GJTL 5E7FA 2E7CA 3H9HA 3MV9B 5DO2C 4M1DL 4OCNC 1EEZB 4J7RA 5B38A 4N90E 1W72B 2E7LA 3ZHDA 1FNHA 1KCSL 5T5NF 2N7BA 4K23H 4AM0A 4HK3J 4P4RB 4PJHE 4KXZH 5EZIL 3OB0K 3L3OB 2EZ0D 1YEJL 3DX9B 3VFUA 4UNUA 1A4JA 3O3AB 3UTQB 4D9LL 3NGBB 1BREA 3P9LA 3BWAB 3HI1B 5GRZA 4TUKL 3UTSD 4P2RE 3BI9X 3WFDL 5F9JA 2ID5A 3G6AB 4PLNC 4LVHB 3T65A 5C3LD 3NH7L 3I9GH 3GJFB 3QIUC 2XWBA 2YRLA 3EDJA 1E28B 5GJSH 5IBUB 1NDGB 1Q0XH 4WU7A 3ZDXE 5CMAB 1CGSH 5F21B 1V3JA 4NC2B 3P9MB 5I1AB 1N6QH 4HIIB 1YEIL 3BO8B 4ZSOB 4POUB 4KRMB 3CXHK 3W0WB 4GXUM 5MI0C 4X7CC 1DTUA 3GMNB 4UUJB 1LO5A 2Y7QA 4I0PB 3QPXL 3QCTH 5DD0L 5BS0B 4U1LA 1FGVH 4JFPA 5I8KH 5EU4B 5FO9B 4XX1G 1IGYB 4NOFA 5DMGC 3VFRA 4OGAD 3IU4L 4NHCH 5TH2A 4OGAC 3MREA 5A1AA 3T0WA 1G0XA 3EJYD 2BOBB 1ZMYA 2VDQH 3OKLB 1UEYA 2R2HA 5SWQA 5DUML 5E03A 1JRHH 5FECA 3IKCB 3BZ4A 1RMFH 3QDJD 4N5UA 4RISL 2EDKA 4Q9QL 2Q1EA 4WWKA 2ICCA 3K80A 4ODTH 5IBLD 1A6VL 1M7DB 3W9DB 2B1AH 3SGJC 1FYHB 2HLAA 4JE4B 2XQYK 3O4OB 4O2CB 1KLGA 3ARZA 1S9KC 3NABL 1IKNA 3RI5K 3ALXA 3QIBB 3B8YA 3NFPB 4H5SA 4DKFL 1KC5H 3I6GB 3RBGA 1BOYA 3VWKC 4QRSA 2YD9A 3LEVL 5HBBA 5JO5A 3FB5A 1YJDL 3OB0H 4WW2A 3GSNH 1GGIL 1W0VA 2GFBB 1IJ9A 3IDJB 1CG9B 4HIEB 1QRNA 1U8HB 3OB8A 3KDMA 4GSDH 4RZCA 3UO1L 2FJGB 3FB7B 4TN9A 2O5YL 1WV7T 3V4UH 1J8HB 1ROWA 3B9KA 4CVZB 2C7UB 1JRHL 4XBPA 3RGHA 2QQKL 3RQ3A 4H0IA 3HCVB 1CGTA 4L4JA 4QOKA 3FT2A 5FEBA 2WBKA 4J2XA 3F7YA 3EYUH 3RWDB 3IU4H 4UI2A 4YHMH 4AL8H 5ACZA 1QG3A 2QL1A 4MXVF 4KTEL 2AS5M 1YYLL 1KBGL 1Q0YL 3GIVA 3ISWA 2EDQA 3R8QA 3WV0A 3IF1B 3N1GC 3AM8C 3PABA 3BMWA 3TV3L 1YMHB 3LSOA 1D5ZB 4HXBH 2X1QA 2CJUL 2VZ3A 2L7UA 3VXOA 2R56H 1HXYB 3GFUA 3P11H 4L29A 4ISVA 5D1ZB 5C2BL 1OQXA 1DJSA 3D69A 4U7KA 5DUBA 3RZCC 5KSBA 1ZHKA 3V95A 3U30B 4QHKI 2IPTH 3HE6A 1IC4L 4WEBL 2ICWA 4PGEA 1AQKH 2JJTC 1UWXK 3DUHA 1QFUH 5AZEH 5D4QA 1J0ZA 3NCEB 1KIPB 3NCJL 3MRKB 5FGBC 3FOLA 4NC1C 2E5EA 3KYNB 2X70A 4WWID 2AK4A 1ED3A 1M4KA 4PJGA 3TBTA 4ZNEE 4PGCA 3MV7B 5C2BH 5T5FL 2XZQH 1K4DA 2J12B 5ILTH 4RX4D 1WSST 1TETH 4JFFB 2Z31D 2HFEB 4L3EB 3U4EA 3CX5K 5C08B 3F5WA 4M7LT 3LRGA 1XR8B 1BBJA 2V2WB 1FHGA 1UWGH 2R23B 4O4YL 3O6KH 1FN4A 4JFYB 4WCYH 4X6DA 3Q6GL 1LO2H 5BZDB 4QKXB 1OTSD 3LKSA 2MOVA 3ZO0A 5EWIH 5E6IC 4DZBA 3MROA 3RWIB 1OD9A 4NCC2 1A22B 1FC1A 5E6ID 3U9UA 3C60B 3JWOL 2WMPA 1DEEA 2BXZA 4KK9C 4L8BA 3W9EA 4CU8A 5GGQL 3QR2A 4WEBH 1KEGL 1G7IB 4BYHA 2H6PA 4KMLB 1TZIB 1CICC 4Z7UE 2CRZA 4NJAL 4JZJA 4S2SB 4RAVB 2SEBB 4MA8L 1CIUA 1WWBX 3KYOB 2YPVL 1RZFL 3WDIA 2VKWA 2NY5H 5C0JA 2IH3A 3CGTA 2DTMH 4A2MA 2LAGB 2FHFA 4JKPL 1PG7X 1NEUA 3FONB 3TBYB 5I18L 1N3NB 5E8OB 1A2YB 4ODSL 4R26H 4HBCL 3FQXB 3U83A 5IMKA 3A6OA 5DMJB 1UQSB 5H94A 5TGBB 5LXGL 5E9DE 5JOPD 1F6AA 1T4KB 1C7SA 1BAFH 2OJEA 1EGJA 2HTLC 4HGWB 5EZIH 1UH4A 3AAZB 1LE5B 4TQEL 4Z7VE 3O6FA 3N85L 4KVNH 4P23B 5KSBE 5E99L 3DUSB 4NP4L 3FFCE 3M45A 3IVKB 1EUUA 4N8CH 5IVXF 3PHQA 1EAPA 4HSQA 5LBSH 4P2YA 1AXSA 1T5WB 2OI9C 3OX8B 5ELIA 1I3UA 1PEZA 2WW8A 2FO4A 1A9EA 4JAMA 4JY5L 1D9KD 1T3FB 3MNVB 3I9GL 3VXQA 1GOGA 2DQJL 4ZUSB 3KYKL 3VFMA 3KYMB 4CGTA 1RUKH 3CVHA 1S7VB 2V9QA 1ZSDA 3IGAA 4HUVA 3ARVA 4OZIB 3IFPA 3QULB 4X7DC 4MQ7A 3MLUL 4KROD 1T21B 4H1LA 4OGYL 3I6LE 2DYPA 1ZVSB 1TZHA 5ALBH 4OI7A 1JGVH 5E00B 2X4QB 4MYWB 4YAQA 3NMEA 1E27B 2XWJB 1JUFA 1LEGA 3MV7D 4WFGD 5KS9F 3QXDB 4JG0H 4Z7VF 1YNTB 2MKLC 2V7NB 5HD8C 1F6LL 2QR0A 4ZFZA 1QD0A 3HA0A 5F7NC 1RPQA 1OB1A 5ILTL 4QHMB 1CFTB 2VLJD 3FOMB 5DJXA 4WFGE 4K3DL 4GRWB 4N0FB 2C3WA 5C09D 5I15H 2FSEB 2MTPA 2FX8L 4C56E 1J0IA 5FYKL 1I3RB 2HH0L 1ZAGA 2WBJB 5IW6A 3EHBD 1LEKB 4L4VB 4NHUB 1NDMB 4DQOL 5E6YA 2C9AA 4OLUH 1QSEE 1ERNA 2Z9TA 4Z77A 1A0QL 3HRZB 4ZD3H 5CP7A 3SOBL 4TPRH 3DO3A 5MEQA 1IKFH 3KPPB 1UGNA 3L3IA 5DK2A 1KJ2A 5DFWH 5I1DA 2AJUL 1J9CT 2Y5TA 4I5BA 1I1YA 1AJ7L 5DI8B 5I73C 4U7MA 1YN6B 2XY2A 4YQXH 4JG0L 1UM5L 2Q8BH 1CGWA 1IVLA 3OJMB 3Q1SH 2V5YA 1ZVSA 1FNGB 1TJGH 5GGQH 3CMGA 5IFHL 4LHUA 4G6AD 1KJMA 5JXED 3QULA 3DX8A 5ALBL 3MPCA 3MLWH 3VD7A 5H37H 5L2KB 4QF1A 5C6WH 3AB0B 3VFMB 3ILPB 1BFSA 1NCBH 4ZUSA 1HHGA 5E2TH 3VXQB 2CDEA 5C6PB 2ORBL 3VRIB 1A9EB 3JTTA 4NQDD 3H3BC 5HHOA 3ZE1F 1B0RB 3KXFA 5FK9B 4M93C 2QSTA 5C9KA 2FATH 1GZPB 3I6LD 4RBPK 1A8JH 4HQQH 1YEEL 1EAPB 5B4MC 4OLYL 5FUCC 5JLZB 4NKMA 2R2BA 3WMSA 4UTBH 1SEQL 4ONGH 1FL5B 3MJ9H 4YR6B 4LHUG 1EFXB 1UJTA 3E6HA 4GUPA 43CAB 1AC0A 3KJ4B 4FZ8L 4ODUB 3TN0D 1J5OH 2W9LA 4H25A 4LLMB 5CSZA 1MIEL 1S7XB 3ARDC 1M71B 4LCWD 2OJEB 1N4XH 3LQZB 2WM0A 2UYLA 4ZYKA 3BGMB 3THMH 3H9YA 4KJYA 4GBXB 4UIKL 4OCYH 1QFUL 5AZEL 2OR9H 4TSCL 1Z9SA 3ECBB 3OZ9L 4MJIA 4WHYH 3MRLA 1SEQH 4ONGL 1YQVH 3NCMA 3QG6A 1N3NA 4G6MH 1NCAH 4WUUD 5JIHA 4ZOAA 5AZ2H 2APBA 1IQDB 3SJVB 4XXCC 3REWA 4G7VH 2O5XL 4FQPA 4CN6A 4G8GE 3S37H 3MO1B 2DI9A 1DBKH 5GGUB 4QRPA 3DJ9A 4M4PA 3MA9L 5JUEL 4HXAH 4DFIA 2W0FA 3W9EB 3SY0A 2NY0D 4K07A 3WLWD 5C0IA 1DDHA 1BVKB 2H2PD 3NFSL 2JB5L 4L4VD 4LOUC 1MAMH 3SN6N 1U9KA 4PRPA 5CD5D 4FXLA 4UT6H 3MNWA 4UT9L 1SEBA 1Z9MA 3EYQD 3VXNB 2DQCL 1K3IA 5D6CA 1R3IL 4G9FE 1C16A 1QKZH 5JDJA 4GG8B 3T4AB 4ONFL 3R1GH 4KDTA 5C0EA 5ISZA 1P5UA 5ABDE 2Z31A 5F1NB 1XR8A 4QNPE 1JGLL 1QR1A 3UC0H 1S9XB 2AQ3A 2D7PA 3KPQA 4JN2B 3NFSH 4L3EA 3BDXA 4P46B 4FQXB 5KS9E 4EKXA 3STBA 4XT1C 2B1HH 1W0WA 1HOCA 1A02N 5EIIA 2OMBA 3WLBB 2DQDH 3VRLF 1J1OH 1I75A 3LIZL 4YXLH 1MJ7H 3FOLB 1JGLH 3MRKA 4H0HB 4OFYA 3C2AH 1KIPA 1T7ZA 4KROB 4PJFE 1S9YA 3QSKB 3O2DA 4KROC 1K9TA 4BZ2H 3RGVB 3ZKNC 4S1QH 2NCMA 1S8DA 5EO1A 3KNBA 2EE9A 3O6ML 1EO8H 3BESR 4HX1A 5AAMA 2B1HL 3AROA 2NY6C 1CFVL 3N85H 4KVNL 2V5SA 1YEIH 4LCCC 4M9PA 2GQHA 3VXUD 5GPRA 3ARFC 1XGRB 5EBMA 4WUKL 3P4NB 1A6ZB 4ZS7H 3RGVA 4LMQI 2JTDA 4X9HA 5C09B 4LKCB 1U6AL 3WHXB 5J1AB 4TTDD 3QXVA 1QYGH 3VFNB 4KMTH 3ETBF 5AG8A 2DLIA 3IRZA 4GW1B 4M62L 4W6XB 5DLML 4OT1H 4QRRA 2OZ4A 4JZNB 1H3PL 4U1MB 1U8QB 3JTSA 4YDKL 1PGRB 4PJIF 1DE4B 4WHCA 2V17L 4QNPF 4XPBL 4XC1H 5FKPA 2IPTL 1MVUA 1KACB 1OCWH 1OSPH 1W0WB 1NLBL 1B3JA 4K3JH 3MV8B 2EEAA 1AY1H 4EUPA 1U95B 1H8NA 4WUKH 4JFZH 3HAEA 1OWWA 2DB8A 1S9XA 5GS0D 5JPNB 3JV0A 4KKLC 4G6FB 1LP9F 3SGEH 5CEXB 3MFFA 2Z31B 1FFNA 2J8UA 4RZCB 2XZZA 5JXEC 2W60B 3KDMB 4NZRH 5J3HD 4KZDL 1QRNB 2I26N 2X10A 4HIEA 3C6LA 1CG9A 4I0PC 4ZOEA 3MUJA 3DGGA 3VXNA 2GTWA 1KCKA 6FABH 3C2AL 1G6RH 3FB5B 2QHLA 4IIQB 4UV4H 1IMHC 3MOBL 3GHEH 3SJVD 4F57H 3I6GA 1JZ8A 2AEQH 3QIBA 5L6YL 3EIFA 1OAKH 5IEKB 3UTSA 5JW3H 1BVKA 4D0BA 3PP3K 1DDHB 1PX4A 1XR9B 1AGBA 3SCMA 4U1SA 4YHKH 4JFEB 4XWOD 5KSAC 3GMOA 3T2NL 2Y1VA 4WWKB 5JHLL 2BNUA 4JDTH 4FXKB 3I75A 4F80A 1KN4H 4LPVA 1JFQH 5IBTH 2X4RB 1B88A 2JJUA 4G9DB 3INUH 4ZPVB 4MDIB 5IKCA 2WK2A 1IQDA 2H1PH 3SJVA 5JZ7C 3MX0A 3OKLA 3D2UA 4XP9H 1FNLA 2BOBA 3W39A 2FX7H 2CR3A 4R3SA 5JZ7D 3TN0C 5I19L 1DQMH 5EOQH 2YZ1A 3MRLB 2QQLL 2AJUH 3VH8A 1JJUA 2YS4A 2HT4D 2IFFL 1CXEA 1PSKL 1FSKB 4YDJB 3TEUA 2YKLL 3E1F1 4ZYKB 3MUY1 5BS0A 3O4LD 3WIHA 2FYYB 3S5LB 1OARH 5HI3C 2VLJA 1S7XA 1EA9C 1UXWB 3ZT5A 4C56D 3MACH 5HYIA 3ULVL 3LHPL 3NTCH 3QO0B 3CK0L 4OQTA 3KPMB 4N0UB 5CMAA 3DETC 1RIVH 3JXAA 2AJXL 1FL5A 1OW0C 1TNNA 3STLB 3OF6D 4URTB 5I17A 2DKMA 1GZPA 3Q1SL 3NH7H 4NQXA 5FF6B 2VE6B 3P9LB 5FK9A 1P4LB 2FX9L 1A4JB 2ZUQB 3O3AA 3UTQA 5ICYA 1LQSR 5CD5C 3O0RH 5DRXA 1BGXL 2MKWA 2CDEB 1F4XL 1Q9LB 5DVNA 3P0YH 3EYQC 2YKLH 4LQFH 4OZFB 1W72A 3JWOC 1LO3H 1EEZA 4M5ZH 2EIDA 3GSQA 3PWJA 3IDIB 5GRWA 4H0GA 3MODL 4CVUA 2FGWL 5BXFB 4G43A 2DWEB 3VGFA 4N9OB 4PJ5B 1XGYL 4MJ6B 3D87B 2IAND 3LEVH 3DV6A 1I1YB 2I27N 3QHFH 4I5BB 2YBRA 4IIQC 1BPVA 1EVTC 1KTKE 4LAQL 1C5CL 3QUXC 2UUDK 5AZ2L 3FT4A 4FZEL 1MI5B 1A7QH 5C1MB 1LO4L 4G80A 1JHTB 1NJ9B 3EFDH 3LKPA 4I4WB 4IOFD 4M48H 4YFLF 2EDDA 3DYOA 5J12B 3QNYB 1X3DA 4JJ5A 3VFPA 3FOMA 2NY5L 5SWZB 1CFTA 4QHMA 4NRYA 4KZDH 3HC0A 5LG1A 2AEWA 3VFGL 2F53B 4ZFZB 1DBJL 2J88H 3MXVL 1T80A 3MLYH 5HD8D 2I24N 3QXDA 5D7IF 3OKDA 3BW9B 3GMLA 5DEGB 4U3HA 3VXRD 3EYSH 3QEQD 3L3HA 4X80H 4GMTH 3O6FC 5E8PB 2WWMD 1S7SA 4ONHA 1NFDA 4EXKA 5JW4Q 4WV1B 1EHLL 4EDXA 2CLVB 4Z0BH 4C57C 4EI6A 1AP2B 1T21A 4H1LB 3CUPA 2OI9B 2RJMA 1NPUA 2VDMH 1KTDA 2FEDC 5IOPB 5LAXA 4L4TD 3BT2L 3KPLA 4FXGA 3B3IB 4GXVH 2BNQD 4EDXB 3V6ZA 3ULUE 3IKKA 2PKDA 4AT6B 2YRZA 1I9IH 1S7SB 4ONHB 5CJBA 2H45A 1IT9L 2VXTH 5EOQL 4NKOA 4EDWH 5J7CC 3RVWC 3WHE1 1F4WL 4PGDB 3BW9A 5GGSY 4D3CL 5A2LH 1F58L 4HIXH 4ZTOL 3BJLA 1Y0LB 4BZ2L 3QUYD 4PREA 4L8DA 3P4MB 3WSQH 3G08A 3O4OC 3U4AA 4OZIF 4ZFGH 2DM4A 3CZFB 2DM3A 4YEEA 4EUPH 2W9EL 3VXRE 5E9DD 5HHXH 5MEND 1JYWA 4BZ1L 2LU4A 2FBJL 2X89A 4X9BA 2A1WL 1T1XA 4ZAKB 1UKQA 4MB3A 1A6AB 1DFBH 5K9JL 4P23A 2VDML 3FAWA 4JRYA 4UOJA 5GIRB 4X6CE 5SX5H 1JTOA 4KHXH 4HWEH 1JGEB 3NCBB 1IC5L 4RNRA 3FQXA 1RD6A 1NC2B 3NPZB 2H2SC 5DMKA 4Y4FC 4AJ0A 1JE6A 4PJ8D 2COQA 4R97B 1Z6JT 1P7QA 3VXMD 2AXFB 4XP5H 1VKXA 4R7NA 3DBXB 1MFEL 1TXKA 3KYOA 2GT9B 3BRGC 5GS2D 4RAVA 3WSQL 1G6RL 3T1FA 2EYSA 4YHPB 4PP1D 3VDAA 1TZIA 3ZZ1A 4NCDA 3EDEA 1YEJH 2HA1A 3PWJB 4ZPTA 4TVPL 1NCWL 1M6OB 1G7HA 1Y18A 3P4OA 2NY3C 1OTUD 1ZS8B 4YX2H 3U9UB 1Q9LA 3Q2CA 2NXZC 4MJ2A 5DRXB 5HDBF 4HWUA 1U8KB 4DZBB 3HMXL 5GSVB 3ZT7A 1IBGL 2VDPL 5ICYB 1FZKA 3OF6A 1P4LA 1T7XA 5H35B 4ERSH 4PJCF 3C6SA 4HLZG 4HCRA 1HZHH 1FN4B 4JFYA 1WBZB 4X6DB 2P49B 3N50A 1CVSC 3D18A 3QUYB 3KHQA 2R0WH 2GUOB 5C9JB 3RY6C 4FABH 3NZHH 1MRCL 1XGQB 5TFSH 4JHAH 2ZPKH 4V1DA 4N0UA 3KPMA 4JZJC 3N1FC 3KG5A 4HS8H 1PY9A 3AREA 3T2NH 3C5SB 3P30L 4TNWK 4GMSH 4LLQA 4ZUVA 5IUSA 1MAJA 1ZGLP 1HN1A 3FFDA 4EI5C 5E7BA 1E4JA 3U46A 1QBBA 5DDHB 1LDSA 4R9HA 5IW3A 5J56B 4PGCB 1JGDA 4LL9A 1ED3B 4UDTB 4OZGF 2X70B 1JYXA 4JFDB 5ICZB 3RKDC 3BEWA 4YEFA 1P7HL 4LCWB 2EDTA 4JRXB 3MGTA 1LK3H 4LSQL 5CJXC 1WZ1L 3ARPA 4BUHA 3W39B 3V0WH 4WHTB 3QUKB 1SBSL 1OAXL 4IOSD 1ZWIB 5FYKE 1BIHA 4PJXA 2I9LB 3D69B 5DUBB 3H0TA 1MELA 3HE7C 3H7LA 1MCOL 4XXDB 4F9PC 4R8WL 2DQIL 4Y5YB 1Q1JL 2FX8H 2PYED 2VR9A 3LSOB 5D2LE 3SCMB 2MSPA 4IRSC 5HYSG 5I1LA 1FQ9C 1IGIH 1J8HD 4CMHC 3UDWC 3ZKND 4OT1L 3UMTA 5ACZB 4WW2F 4LPXA 4LEXH 2GTWB 1EEYB 4JHWH 4Z78A 3MGOB 4OCRL 5E1HB 1LO0L 3FT2B 5T3ZD 1T04A 1G0YR 1SJVA 2MCPH 4J3TA 4XPTL 4MD5B 1NAMH 1Q1JH 3FKUS 3VWKB 5JPNA 5B8CB 1GH7A 3ARBC 4YK4C 2W65A 5TF1H 1J8HA 2Q6WB 1IFHH 1UFUA 2Z35A 4P46C 2B8OT 1VFAA 4NWUH 4D8PB 1A14L 4KVCL 4U1HA 1MVUB 2X4TB 5FKPB 2X7LA 4JRXD 4Y16C 1ES0A 5JO5B 4U4BA 5HHMB 4HFUL 5D93C 4LVNB 4OLEA 1N5AB 1FVEA 2EEDA 4U1MA 3QDAA 2AV7A 2GSIB 4XPGH 5FA3B 4O2CA 2Q20A 4MGXA 4NQEB 1XZ0B 1HQRA 1MFEH 4LAJH 3EFFB 3DSFL 1EHNA 3FO2A 4P4KC 1U92A 4XNQA 1XGRA 5DFVD 1PKOA 3QCTL 1XF2B 2FLRT 5HI4D 5I6XC 4XAKE 5T3XD 2FWOA 1ETZA 2YUVA 3DV4B 3VFSB 4F7TB 4B5EA 2BFVL 3MFGB 4P3CL 5DRZB 4H20L 1ZHLA 2X9WA 2YPKA 3MA7B 5E8EB 2ZG3A 3BKJL 3QUYC 3N9GH 3WN5C 5C0AA 4NUGH 5TH2B 5JIPA 3QXAB 4U6VH 3H3KA 3B6SB 1DANU 5FO9A 1I9RH 3LH2H 1QSFB 2EDFA 3GMNA 2DBLH 1HOCB 1U8IB 2A9MH 4Z7NF 2WUBL 4J8RA 2WP3O 4I1NB 5DC9B 5JHDA 4P46A 3TBSB 5IFJB 3TWCH 3TESA 2N4IA 3FO1B 4WU7B 1NDGA 5CIPH 1E28A 3AUVA 5IBUG 5F1NA 1RZ8A 4LPTA 2PTUA 2MPAL 1RULL 2HKHL 3O6MH 4OCWL 3T4AA 1YEEH 4XGZA 2VWEC 5FDYA 4N5EC 3QWRA 4ONOA 5TE6L 4G6AC 1GGYA 3DYMA 3BH9A 3RAJH 1CZ8L 4WY7H 5HVHB 1GGTA 3UTOA 5DYOA 1RK1A 4LPYA 3LEYH 1NMAH 4M7KH 1PLGH 4GRLD 1WIUA 2BMKA 5DURD 2AJXH 3L3OA 4GG6F 1QFWM 3T0ED 2NY4C 4HUWA 2W91A 3KJ6H 4FG6D 4EIGB 1A4KB 2W0FB 4WENB 2J8HA 3RA7H 2FBJH 4K7PH 5EUKB 3SQOH 4G8IA 5F7MC 3U9PH 4LP5A 2WP3T 3MV9A 2CO6B 4Y19E 4PJCE 4HJ0D 4ZTPL 1QR4A 5HHVL 3JV6B 1BZQK 4M8QA 4P5TB 5JR1H 1D5BB 2VR5A 1IC5H 5CGYD 3O2VL 5IV2B 1DN2A 3QG6B 3SEPA 2ZUXA 2DQTL 2IADB 4KHXL 4CU6A 1ZV5A 3QO1B 1UYWL 3FRPA 3LD8B 4HF5H 3BP4B 3ARGA 3BSZH 3GHBH 4Y4KB 2QHRL 4JGMA 5FOJA 3MBXL 5D72L 2UYLB 3MV9D 3LQZA 2PW1A 2NLJA 1O0VA 4WUUE 1QBMH 5CILL 4JPKH 5EIVA 1DVFA 4JLRA 1A7QL 2GJ6D 1LE9B 3MV9E 4Q9BA 3UBXG 3TVMA 1I8IA 1WEJH 2DRUA 1S9WA 5LJYH 1TENA 4ODVH 3D0LB 5E2WH 2X40A 2XWTB 1OAZH 4WTZA 5FO7A 3RIFF 1CDGA 1P2CB 3IU3A 4RFOL 2R0KH 3QUXD 4WJ5B 3E8UL 4QO1A 3LKRB 3AXLA 3QDMA 4I2XE 2CMRH 3MMEB 5J0BA 3BE1L 3B5GA 1U93B 3T4YB 1E4XH 2NY0B 4P9MH 1HILA 3B2UD 4LLWA 3ME0A 3JTTB 3UTTA 2BX5A 5BRZA 2VC2L 4Y1AD 3E2HC 3SDDC 1LNUB 1T89A 3LPGA 1FIEA 1HHGB