5D7IE

Structure of human mr1-ac-6-fp in complex with human mait m33.64 tcr
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
200
structure length
200
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVMDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 43
structure length 200
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7iE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7iE02
3O6MH 4GG8B 3U30B 2CLRB 1D9KC 2P1YA 4WIQA 3RKDD 1IEHA 1TVBB 4HQQL 4KTDL 2DLGA 4NCC1 1O7SA 4K94H 3V4PH 3HAEA 2YPLB 5IHLB 2VB5A 3HUJE 5DI8B 4NO0D 4J3WA 5T1LD 4P9ML 2UWEB 2VLKB 3QDJB 2C7UA 1FVCA 4Y5YA 3SDCA 5JDSB 1WVZA 3RBGA 2VAAB 1BEYL 2IPKB 1MAMH 4MB5A 1CGSL 1P6AB 1W72A 1BOGA 1A7BA 4RAUA 3MRLA 2WBJD 4APQC 1OARL 1UGNA 1E27B 2L4OA 4UNTA 4H5SB 3L3JA 4OZHF 5DD5H 3MGOA 1KTKE 3LQZB 4PJBF 3PL6C 2A1WH 5BVJB 1T1ZA 4X6CB 5IB4A 2CDEA 4LLAA 4M7LL 2LU7A 1CGWA 4W81A 1SVCP 1BD2B 3CUPB 5EIVA 3JWNC 4OCLC 3KDMB 3NIFE 4WDIB 5DHYB 4ODXA 5C09A 3NZ8B 4LNVA 4U1HA 3QEHB 2D03L 3UO1H 3HE7C 3P0VL 5JLZA 3M1BA 4JPIA 1FVEA 3BUYA 4X0KB 1FFOB 3QG6B 4PJGE 3SJVB 3AVEA 1HIML 2EYSB 4V2BA 4GO6B 3OKLB 4N0YH 5E70A 4MD4A 4YDVA 5D7LE 5KVDH 1D5IH 1XF4B 1KGCE 4DKFH 2X9WA 3FCTB 3RUGF 4H25A 4WWKA 4HQQH 5DJCA 1KT2B 1YJDC 1BZ9B 4L3CA 1T80A 4OCSH 4CBPA 1BOGB 1Q8MA 3DUHA 1I3GL 5DZNA 4X6CF 4EEEA 3REVA 1KJ2H 3GM8A 5FK9B 4MYWB 5DO2C 5CGMA 4HS8H 3CK0H 4NHCH 4OGXH 3S97C 4I8DA 3QI9A 5DD0L 3LHPH 1GZPA 5KSBF 3VFWA 4X0KA 2R9HC 1XIWC 4DCQB 4LSQL 4U6HA 4UTBL 1ORQA 1K8IB 5EU6B 3DO7B 3EOYG 2PW1A 1PSKH 3G9AB 3EYVB 3KPNB 4JPVH 5EORH 4D94A 1LO0H 4LLWA 4ZS6D 3U30C 4RX4D 5J1AA 1MI5D 4EUPB 2PUQT 1G6VK 3H8NA 2B0SH 3GSXA 4KUCD 4EUPG 5CZXC 1MY5A 3TIDA 1O7VA 1HSBA 1QVOB 2H9GB 1RIUH 4Y5XB 3BW9B 4L3EA 4OI7A 3CSGA 3E3QE 3CSPA 4G9DB 1FLTX 3R8BB 4HGWA 3V4UL 1MRDL 5GIRB 1CFQB 1QFWM 4K9EC 2DI8A 3GI8H 1WWBX 2CPCA 2R0KH 5JNYA 2QHRL 1QSFE 5C2BH 4DVBB 4NWUH 4L8SA 2UZYB 4NO2A 5F89A 4GBXB 3WIIL 3EBAA 4O2FB 4RBPK 5IHUL 4IHOA 4MXVE 1D5XB 2IFGA 1MFEH 3QFDB 3NCBB 5DR5H 1FG9C 3EKCA 3OZ9H 4APQB 4NC2B 5JW5B 2DICA 4CJ0A 3C6SA 1YQVL 2XWBA 1P4LA 5IKCB 4Y4KD 4ZNEE 4JY6B 4HJGB 2QQLL 2RHEA 4GRWF 5D7LB 1KYOJ 2EKJA 4OIBA 5ACZB 4JFFA 3U1SL 4J1UB 4X9HA 4ZFFA 2VC2H 1OGTA 4QTHB 2VISB 2XN9E 1FSKC 3AM8C 3TNNB 1XIWA 5I8OH 1NGWB 1HHJA 3QNYA 4I5BB 1UXSB 5DMKB 4G6AD 3PGCA 5CBEB 4S2SB 1IEAA 5B38A 3QQ9D 3M45A 2ZUSA 3WJLA 1DQLH 1PJ9A 4ELMA 4U3HA 1F4YL 5KSUB 4Z8FL 4JCMA 3GBNL 4QRRA 3CMOL 4BFBD 3KPNA 2WUCH 3EYUH 3SOBH 5I8EB 1QLRA 3BZ4A 4P0DA 3QQ9C 2EDDA 4MCYB 1NGQL 3NIDE 3RGVB 4J12A 5EU3A 1C1EH 1KIPA 3MA9L 5T5NF 5J1TC 2I9LA 4OT1L 4TPRL 5IT2L 4OZIF 3TJHD 1KB5H 2OR9H 3AXLA 1Q94A 1PBYA 3IXTB 4XTRD 3OKDA 4LEXH 4JFXA 4WWKB 4O2EA 3KDMA 4NJAH 5KZCB 3ULUC 4XP1H 1T1WB 1A4KB 2VXQL 4PJIB 2BVOB 4PJEE 4XNXL 3H6JA 4YHMH 4GAJL 3E0GA 3VRLE 2HLFD 3U2SA 5INDA 2I60L 5A2JH 4JLRB 1A1NB 2BFVH 1KPVB 5F6HI 5I2IB 4JY4A 1TZIB 3TPUB 5FUCC 3T0EA 4KI1A 1T03L 5F7EH 2E7LA 4R2GC 5EOQH 3DXAE 1BAFL 5FUZL 3SDCB 3KR3H 3QEUB 1KNOA 3QXAA 1HHKA 1NUNB 2Y06L 5E8EA 4K3EL 1N64H 3DYMA 4NSKA 5CJ5A 5D7IA 1FPTH 1T03H 4QRPB 3L3JB 4U1SA 1IFHL 4X6DE 1WCBB 4HUVB 4BQ6A 4MJ5A 1OOAA 5EBMA 1DSFH 2JELL 2JJUA 3MLXL 1OTSC 2Y5TA 3EYQD 4XI5D 2QKIA 1DBJL 2XKNB 1MI5A 4GRLD 3EDKA 3KPRE 4NN5B 4U3CA 4DTGL 1K2DB 1MLCB 3VA2C 3MROB 2P8LA 1ACYL 1KJMB 4F9PA 4HDIA 3QCTL 2HN7B 1ZHLA 4KQ4L 5HHMD 3S4SA 2DKMA 2EH7H 4R7DA 3QAZB 4K7FA 3QJFB 4OM0L 4FXGB 1BX2B 4LVOC 5K9JH 3QUXD 1FNFA 5CIPB 2XY2A 3V5KA 1R5WB 5CJ8A 4FQIL 2GTWA 5IHBA 4CRPA 1KB9K 2F8VA 2P24B 3TYGH 5BOZG 1PY4A 1H3WM 1MNUH 3O3EB 1XR9A 3C8DA 5T1KD 4KKLD 2O5ZL 1W0VA 1MHCB 1UQSB 5CHNB 5C08A 1X5YA 3H3PH 3QUYD 4EI5C 1TETH 1RIVL 1MSPA 3CMOH 1A1NA 2V5SA 2AGJH 5LXGH 3GMPB 3MOQA 3PV7A 4L8CA 1SJEB 4OLUH 1M71B 5IW1A 3RZCD 1BZ7B 3A0OA 3PWPD 2O5ZH 3P0GB 4K8RH 5EU6D 2I5YH 1J1XH 3VGEA 1NBQA 4M61B 4YDLB 3QA3A 1VSCA 3T0AA 2YUZA 1MFDH 4JKWA 3GMLB 2NY1C 4F80A 2EIDA 32C2A 3TT3H 1IAKA 4F33A 2FJGA 1AGDB 5BZWB 1AGFA 4UMGA 1NGZA 3VRIA 1UENA 5I73C 3U1SH 2WP3T 1MI5E 4OTXH 3TVMB 3O6LL 2C3VB 4LPTA 4GRWH 1IL1A 2IFFL 4ZUVA 1EFXD 3LEXA 1OAUL 3QNXA 4U1NA 1RUQH 3ALWA 3VFOB 3ZT6A 2I24N 4HH9A 3HZKA 1OWWA 4BUHA 1KB5A 1T0MB 1JHTA 2A6IB 2EIEA 2OK0L 3IETA 1WAAA 1UM6H 3SDAA 2AJZB 3V6OC 3S5LB 4OKVA 3FO0L 5FOBB 3H0TB 4D0BB 2FYYA 3BT2L 4XCCL 4QCIA 5CP3A 1QVOA 1H3TA 1FL3B 2H9GA 4RZCB 2VZVA 1QFWL 4M9PA 1HWGB 2HT3D 4PJEA 4M43L 1EEUA 4NM8L 4KJQD 3F65A 4PJCE 4F2MA 4LMQI 2G5BB 4GS7C 4KTDH 4Q2ZB 5BJTA 3ZE2F 4RFEB 3MNWA 3JV6B 2DQIL 4NNXA 5D7LA 4AEHL 3OF6D 5D7JA 4OQTA 4GQ9H 3F7YA 5E8DH 4N1CA 1N4XH 1YY8B 4XCNA 5FA3A 4NZDA 1KJ2B 3VFVB 3TYFB 5EZOL 1JPGA 4P23C 1VB9A 2FO4A 3WXWL 3JV4B 4LEOA 4XGZA 2H32A 1X6LA 4KQ3L 4PP2A 3MV7D 5T1DH 5EO0A 1DL7H 5C0FA 3WIHA 1CFTB 4K3JH 3I3DA 4I9WD 2NY7H 5J8OA 4YDKH 2HWZL 4Y19A 3QIBA 4LNRB 3OKNB 3BP4A 4QO1A 2WMPA 3GMMB 3MRIB 5CGYC 5KVDL 1NMCB 2V2XB 4X4XA 1U8IA 5E08L 1G9NH 2DQJH 1BVLA 1FFOA 5MP6L 2AKRA 2H2SD 3KYMB 3BRGC 1J1PL 3VGHA 1Z5LA 1IAMA 2LTQC 1B0GA 1U92A 2IBGA 4LLDA 4PJXF 2IADA 2APWA 1BIIB 5FIEA 2X70A 4LU5L 1XGUB 1CFNB 2BOBB 1MIML 4WDIA 5L9DH 5CUSL 1PZ5A 4PJIF 1H5BA 1C5DA 3FO1B 1FZJB 1TJIH 1VERA 1KJ2A 4HJ0D 5D1QD 3AS2A 3MRGA 3WFBH 1I1AB 4F7PA 5A2KH 1RZKL 4UTAH 3AU1B 1J11A 1G7JB 4CVZA 3GBMH 2CJUH 2Z8WC 1A1MA 4LSUH 5I1AA 1S7SB 4X98B 2D7QA 5IW3A 1EZVY 4X6DA 2A9NL 2VXSH 2FB4H 2JB5L 4LARL 4H25B 4M48L 4NZRH 3QULA 1YJDL 5T3XE 4QXUH 4EI5A 5GRYA 1YY9C 3OAUL 4XH2B 3BEWA 5IP4A 5EN2A 4XWGL 4G8FA 5HHMB 3Q1SH 4Y16C 4XBGB 1MRDH 1UH2A 2Y1VA 1G1YA 4K23H 4J3VA 3FFDB 3HAEB 1GRWA 5D72L 5K9OB 4F3FA 5ALCL 1AGCB 1SY6A 5E2WL 5GZND 1JPTL 5CEZD 4HGMA 5E2VH 1F00I 3G04A 1QHOA 3LEXB 5ISZE 4OLZL 4ZUVB 5ANMA 2B0SL 2JCCF 2HRPL 4Q9BA 3O41A 2EYTB 3EIFA 3QDMB 5IVZA 5F7LB 1BQHA 1M4KA 4G6JH 5F8RC 4GT7A 3HCVB 3OGOE 2Q8AH 3OKOA 3NOIA 3INUH 5HJ3B 3TT1H 3JUYA 1T2QL 2J8UA 3TWCH 4KRPD 5BVJA 3MJ7B 3FOMA 2GFBA 4R97C 5B22A 3LB6D 2DD8L 5E9DB 2AJ3B 3K4ZA 4L29A 1KPUB 3T1FB 4W68A 5IR1B 3HMWL 2Q8AL 3QFJB 2X9YA 3VJ6B 1L7IH 3EFDH 1U3HA 1MWAB 4DW2H 2XYCA 5ILTL 2OZ4H 3HKFA 4P59H 4KJYA 3C08L 1ZA3A 1N7MH 4M5YL 1YEJH 1I8MB 4HS3A 5EZIH 1MH5B 1MHCA 3EDEA 4PJBB 1PYWA 3VXRD 2LU4A 1DQQA 2G60H 3OPZL 3VI3E 1Z2KA 2X1XR 1CICB 1T7ZA 2BNRA 2DWEB 1TVDA 1WBYB 2BNQB 4HC1H 4HHAA 1BFTA 1F3RB 1MCWW 4PJ5A 1QZ1A 1NCDL 1FGVL 5T5NG 3DSFH 3SQOH 4JDZA 4X7CC 1A7QH 3MOBH 1I3VA 4WNQB 4Z8FH 1JPTH 4ZXBA 4GQPH 4ZOCA 4FQPA 2BHUA 2B1AH 2BXZA 3WKNA 1NCNA 1ZVHA 2BC4B 1UEYA 2EO1A 2AKRB 5F88B 4YPGA 3BGFB 3QXVA 1IGFH 4MDIA 3QDJE 5I19H 1A4JB 5HGHA 1I1CA 2FJFA 4MNQD 1WTLA 3RUGE 2HT4C 4I2XA 4HWEH 1EAJA 5C3TA 1MWAA 4ODUB 5EO9A 4ONGL 4N90D 2QADD 5K93A 1LEGA 1B3JA 5LGHL 3QUYB 4PS4H 4JFFE 5D1QB 5GS0D 3MZGB 3CDGB 4G9FD 3OMZA 1HINH 1JUFB 5T1MA 2NZIA 43CAB 2EDJA 3CSYB 1I1FB 2OXHA 3ZZ1A 4DGIH 3WNNA 3MRPA 1AJ7L 2F8XC 1P7QB 3TZVA 4PGCA 1RZ8B 4UIMB 3MRQB 3MNWB 4B53A 2EIZB 1U8KA 4NDMB 3RWFA 3S36X 3C60B 3SO3B 3TBTA 3W0WE 3CDCA 4NQEA 4H8WH 4ZDHA 1ZGLB 2E27H 4XNZC 2CKNA 3T4AA 3BO8A 3O8XC 5JORA 2NY2D 5J06A 3UROR 4FXKA 3KS0J 1NUGA 2X4TA 5LG1A 3NFNA 4ZFOB 5KSUA 5DJ6B 3P77B 2RFXB 5C0BD 3IDNA 1TITA 4W4NA 2J1KA 2VE6B 5SX4H 4NC1C 1UXSA 4I5BA 3BT2H 5J9PA 4GKZA 3BP6A 1CFBA 2K7PA 3IS1X 1QFWH 1N3NA 1FHGA 3O45A 2WWMC 1FVDA 3O4OB 2PXYD 4LL9A 1G0DA 2I25N 2EO9A 4P59L 4WFHE 3DIFB 3PNWB 3DURA 1KEGH 3L3HA 2FBOJ 4PRID 1YEIH 1VENA 4JG1H 4MS8D 4RMVA 3T0BA 3V95A 1PG7L 3ZHDA 3HR6A 5F9OL 1ERNA 2YKLH 1BOYA 1ZGLM 1CDJA 1HDMA 5I18L 3QNYB 5IVOA 4WI2A 5D93C 5EIIB 2VR5A 3RVXD 2FH8A 4OCXH 4QXTA 2GQHA 1YMMD 4JKMA 4OV5B 3O0RH 3BDXA 3I3BA 4Q9QH 2H1PH 4OLYL 3QIWD 1UM4L 1WFUA 4LLMA 4CN6A 4ZD3L 3WFDL 5IMMA 4NQCD 1XMWA 2JIXA 4LSVH 5FM5O 1UWXH 3QPQD 5ADOL 3RKPA 3KPSA 1EO5A 3OXRA 2ATKA 3MUJA 4G3YH 4YHOL 1NC2A 4NPYB 2ZUWA 1NAKL 4YH6A 4EVNA 3ULSA 2ZCLH 4C4KO 4R4NC 3GSXB 4P46C 1S7RA 1UZ8B 5D4QA 1R3JA 4UU9B 3HI1B 4G8GE 3O4LE 3S35X 2XPGB 4TNWK 1T04B 3VXUA 4FQXD 5CIPA 3HC4H 3BN3B 3FN0L 4OZIE 2WIIA 4YHOH 4YDLC 1VGEL 2F5AH 4FNLH 5GIRA 3PIQB 1CFVH 4OZGF 1MCEA 3ROOA 3SE3C 1CFNA 1YECH 1CF8H 5CEZE 3MV01 4WUKH 3S35H 1IGMH 3QUZB 5B8CB 2FZ3B 1E4KA 5C71A 1MI5B 3M8OL 3O2DA 4ZNEA 5I8KH 2KQNA 1RK0B 2Z31C 3EYSH 5J0BA 4FQIH 1M1SA 2R23A 1QUNA 5CLWA 4GKNA 3D69B 3SQOL 5KW9H 3BRFA 5FYLL 4UOJA 2FJHB 5JPMB 5E9DD 4UZGA 4LOUD 3RWJB 4DGVL 3MJ9L 5C0EB 1SEQL 4JDVB 2ATPB 4H1LA 4ENED 4KQ4H 2J12B 2HFEA 4PJ8A 3LKRB 5HHXH 3DBXA 3PUCA 2APFA 1EO8H 3TZVB 4XP9H 4ZAKB 1IGCH 5MP6H 2DL2A 4P57A 5IESH 3OKKB 5C0IB 3WXVL 5EDXA 5JPNB 1FLRH 3VXNB 2X4UB 4XVSL 4L4TD 3ARUA 3FOLA 6FABH 3T09A 5LAXA 3CUPA 1I1YB 4U05A 3BXNA 4PRIA 4Z78A 5TE7H 4DQOL 1KCRL 5F9WC 4ZSOE 4RX4A 3VRJB 3MRJA 1FE8H 4DUVA 1T7VA 3KGRA 4TYUA 3DUUA 4XCCH 5IM7B 5T1KB 2NW3A 1KN2L 2PN5A 4EXPX 1JFQL 3QIBB 5CINH 3RTQA 5LKNA 1CI5A 1LO5A 1E4WL 1UVQB 3CFBA 5SX4I 3RIFF 5FHAL 5AUMA 2XG4A 5E99L 2AJSL 3AY4A 3SQBA 4GSDL 3QO0B 4YNYA 4OCYL 4JR9H 3HUJF 2X9XA 5DJZB 2WBWB 4H8WL 2FL5A 1KCSL 3RIAF 3QIBC 2VLME 5A43C 1BFOB 2W0PA 5MEOA 4RNRB 1JTPA 1SJXA 4EDWH 4A6YA 1KIRA 5BV7C 2FEDC 4CMHC 3MFFA 5MERA 5D96B 1NMAH 3DOSA 3PQYA 3ARYA 5K9QI 1II4E 3QUXC 5H8DA 1CLOL 2NXYB 2WIMA 4HFWB 1MJJB 3WNLA 5C0RL 1CQYA 2QQKL 3DX8A 4XP1L 1U3YA 3V5HA 4HFWA 4P46D 1H5BC 3MACH 1GGYA 4WW2F 2ZUYA 4U1MB 4J3SA 2XKNA 1RZKH 2P5WB 2NXZB 3JVGA 4N0YL 1P7QD 3MXWL 3PDOA 1G7QB 3MRKB 3W11C 4Y16D 1JNLH 1KUMA 1XCTA 5H37H 3BGMA 1KENL 3ECBA 4FHBD 3GIZH 3T77A 4GW5B 3BESR 2NY5C 4GUPB 2BNUB 3MV8D 3C2SA 3OKYA 2EDTA 1FL6B 3B2VH 3MLSL 3P9LA 2NY5L 5EB9A 4GMSH 5FHBL 3U0PB 5L2KB 3QWOB 2Q7YA 1N5AB 1QP1A 4LRNH 4OF5A 3WD5L 1OT2A 5CEXB 4I18B 1E6JL 3D85B 3PHOB 4ZUTB 1XGPB 3IVKB 3NFSL 2BVUA 2WV3A 3ZDXE 2VLRE 4MJ6B 1LO5B 1KCLA 1Z3GH 5GRWA 5GSVA 2CK0H 3FOMB 4HBCL 1MCPL 3O2DL 1HZHH 1M71A 5B38G 1J10A 1S9XB 4QRSA 4Z7VB 3CZJA 4QOKD 3PG2A 3CNKA 4XP6H 4RSVA 5DSCB 3SO5A 2JTDA 2EDNA 4RGNC 4P46B 3EJZD 3W39B 3Q3GB 5GGSA 2AXGA 3MX0A 4XAWH 3CH1A 3LD8B 1KIRB 2OTWB 3TBWA 4NWTL 1KJ3H 4P57B 2C5DC 1AGCA 5C6PB 1JGUH 3WV0A 2B20A 2HJFA 4Y4HA 4PJ8C 1BAFH 3BQUB 2FATL 4M6MH 3QWRA 4RBPH 3RWIA 4NKIL 3MLTA 1T7XA 4NO0B 3UTZA 1FIEA 4FQHB 4LIQH 4JDVA 4GRMB 1I8KB 1RI8A 2J7LA 4HUWA 3VMPA 1HI6A 2D7MA 3C9NA 1RZ7H 1VGKB 4XVJH 4UT9H 4B41A 3VMNA 4ZPTB 1ONQB 4DZBA 1KPVA 1L0XA 1IC7L 4MXVF 2IGFH 3W81A 2PXYB 4JPWL 5I15L 3SE4C 3BISA 4DGIL 1LE9B 3UJJH 4ETQB 4HUMB 3V4VH 1XGTB 3OR6A 2LVCA 4Z77B 4HUUB 2B5IC 4YZFF 4IRJD 3HE7B 4QOKB 3TO2A 5JXED 1M6OB 1PZ5B 4F7TB 2APXA 4ZFFB 1KNOB 3QXAB 2E27L 4O4YL 3PHQB 4BFEA 4X9IA 1Q38A 3JWDC 3RNKA 5L88H 5IG7B 4KRNA 3HC0B 4LCCC 2HYMA 3FAWA 1NGYB 3VH8B 1YYMH 3MV11 5BXFA 4MQTB 1DTUA 2F54A 5HY9A 2HVKB 1XF2B 1NGQH 3KPSB 4XBEL 4K3HA 1NCTA 3W9DA 3DMMA 2GJ6B 2FECI 5DJYA 5IEKA 4UTAL 1Q9KB 2AABH 1X5LA 2F53A 3JV6A 2VDQL 5FYJU 1GAFL 3H9ZA 1OSZB 4ZUWB 4UV7L 4MA3B 4JFDD 2WBJB 3TJEH 1UKSA 5HDOA 1CD1A 1UB5B 1KFAH 3DARA 5KN5A 4XC3L 2FX9H 4PLJD 3THML 4PGBA 2CMRL 3P4MB 3BW9A 4L3EB 4XC1H 3U4BL 3H2WA 1HSBB 2VDMH 4PRAB 1UC6A 5FM5M 3PIQA 3GRWA 3O4LA 4G8GA 4JZOA 1MQKL 5T33H 4PJAB 1PKOA 5HYJA 3IU3B 4EOWL 3RHWF 1IMHC 2ZKHL 5DUMH 4PRHB 2Y72A 3IU3A 2MCPH 3EYFB 3QIUA 3OZ9L 1UACL 5FAAA 5INCA 5CJXA 2C9AA 4YXKH 4MCZA 4KK8C 5CD5D 4DEPC 1HXMB 1KG0A 1T66C 2AQ1A 4IOIA 3HUJA 3B9EA 4M1CC 2R4SH 3C5SA 4LCUB 3D0VA 4G3YL 1BF2A 1X5FA 1IKNC 1WT5A 1YPZA 2NY6B 5C0DB 3PWUA 2NY7L 5DO2D 3IFLH 3UTTE 3BSZH 4HUXB 5D5MF 1NCAL 2VITA 3BQUC 4WENB 5HYJD 1QQDB 1GL4B 4GSDH 4F33B 2CK2A 3PABA 5EO1B 3LN5B 1RVFL 3FQUB 1RIUL 1LNUB 4ODBD 1ULVA 3T2NH 3FRUB 3EZ8A 5EIIA 3ARBB 2QQNL 3MV8B 5JUEH 3L5JA 4KMTL 5F1NA 2ZOKB 4JFEA 1NC4D 4M6NL 4MD5B 3GSQA 5IV2B 2CR3A 1A9EA 3NCMA 1IAKB 1NC2B 1S3KH 4NPYA 4HIJB 5DHYA 5DQ9A 3CFKA 5FGCB 3VFRB 5DD0H 2HFFA 4MAUL 2QEJA 4PJ9B 1A6UL 4OQ1A 1INDL 1A7NH 1IQDA 3QPXL 3IFOB 3TBSA 2VZTA 4YHLH 5E2TH 5JOEA 4M3KB 4IDJL 3ARVA 4P2QA 4RWYL 1TZHB 3MLZL 3KR3L 3AREB 5FK9A 3BZEB 1A14L 1SMOA 4I0KA 3ZTNH 4ERSL 2ED7A 4NN7C 4PP1C 2EXYC 3W0WA 3CLEH 3DO3A 3QNZA 1KF9B 3FO2A 1FFRA 2XWJB 5L8KB 5JIPA 1JGUL 2AW2A 1BZ9A 3D3VD 5DJCB 1XR9B 4D0CB 4GBXD 2QKIB 2D2OA 3PE9A 4WI8A 2NNAB 1WT5C 1KPRB 4QRQB 2VR9A 1QO3A 4RAVA 1QRNA 3PHQA 5MHSE 4LLWB 2D0GA 5D2NC 3IAQA 5F72S 5A2FA 1CDBA 5IQ7H 3WUWB 4N1EA 4JQXA 3FQTA 2VH5H 1UB6A 3CDYA 3ZE1F 1WITA 2BVQB 3BKMH 3QRGH 3WJLC 5IF0A 4O58H 1JNLL 2BY2A 4YNYB 3HRZB 2ZJSH 5ACLA 4M93C 1OPGH 2ZNWA 1FGNL 5JXEA 2X2YA 4HX1B 4P3CL 1U42A 1MH5A 4JN1H 1KLUA 3QJHB 1BPVA 4QXWA 1I8MA 1IGIH 5BRZD 4N8CH 4OGAC 5CSBA 8CGTA 3ROLB 3G6JB 3HI5L 1DSFL 3ARFD 3UDWA 2F54B 1ZS8B 2R2CA 1K85A 1R3HB 3DETD 2D7NA 1S5IH 3KLDA 3DRTA 4Z78B 4OZFA 2KUTA 4LCWE 3D85D 3SE9H 4G80B 4QHKI 1T1YA 3V2AR 4FXLA 3RP1A 5I1LB 1A7PL 4NKMA 5TFSH 1JRHH 2QLVB 5TPWL 2EH7L 4ODXB 1GGCL 3G6DL 5C09B 2A1WL 4JB9H 3OKKA 5C0IA 2QQQA 2YA1A 3KPLA 1P7HL 1AE6L 3QDGA 4QHUB 4YR6A 1JYXA 1NSNL 4NJ9L 5HYQB 3L7FB 2IQAA 5IHZB 5F9WB 2R1XA 1HKLL 2YPLD 2H6PB 1RURH 3HNTL 3QUML 4LSPH 3CH8A 3G04B 1R3KA 2QSTA 3ZYIA 2VLRD 2MFNA 3ZL4L 4LPVA 2OL3B 3GNML 1LEIB 5FHAH 4C4KT 3VI4E 1CU4L 4YFLI 4PV8A 2YWZA 4GRLB 5TE4H 2R4RL 3QJHA 5D9SA 5GS3A 3LKNB 4G6ML 2V9RA 1DP0A 2E7LC 3I6LD 5EU7E 2YUXA 1MUJB 4R96A 2XZCH 5FYKU 3MRHB 4XP4L 2O61A 4I3RL 1MCRA 3RZWA 4YJZL 4XAKD 1QBLH 4I1NB 2DBLL 3B5GA 2DKUA 4OZ4A 1CT8A 1MELA 3UBXB 3ZKNC 2VLJB 1BECA 3MV9D 1P4IH 3EJJX 2R15A 4JANB 1FNAA 2W92A 2CKBA 4N9GB 4Z95L 1F6LL 3FB7B 3DI3B 1YUHA 3CFKB 3V0WH 4JHWH 4JM4L 2YRPA 4Y89A 3ZMRA 5F3BB 2NY1D 5I0DA 2HVJB 5C70A 1DBBL 4XB7A 1RUKH 2ICEA 2OSLA 3MRKA 1TJHH 3P3YA 3SGJC 5JHDD 3IJSA 5DJXB 3A6CL 4ZOAA 1RMFH 4X8JA 5FYKD 5J1SC 1EJOL 4KU1A 2PO6B 4P2YA 1IE5A 1F2QA 1OAUH 3SOBL 3C6SB 1LILA 3MBED 3OJVC 4WUUA 1MJJA 3TN0C 3UC0H 5FYKL 2ARWA 1GGCH 1WTGT 1RV6X 4J8RB 1T6WA 3MA9H 2P5ED 1CXFA 3STZA 3IGAB 3I75B 1CK0L 5HHQA 4L4VB 1JZ6A 4FG6C 2VQ1B 2VN7A 3VXPA 3BN9C 1TNMA 1CTNA 1X6NA 4XH2A 2QQKH 3NTCH 4UQ3B 1ZAGA 5TF1L 3S35L 3WE6B 2JJTA 3HE6A 4ZOBA 5JW5A 4MXQD 1BLNB 3WS6A 5GGRY 1K8DB 3DX7B 3FQNA 4A2LA 2VDQH 1OD9A 1EHAA 5L2JB 2NY0C 1D6EB 4WY7L 2GI7A 4P9HL 1KV3A 1RUPL 3V8OA 2FX8L 4UINL 1EUUA 2X5PA 5GGRB 4GRLC 1DR9A 1HNFA 3BD5A 1CN4A 4U1IB 2FX7L 2HG5A 4F15B 2FR4B 1YY8A 1AKJA 3R8QA 3L5WA 1VESA 3FFDA 2ARJA 2Q86A 5T1DL 5DK0B 1A3QA 3WNMA 1EAPB 4YHPA 5CWSA 5C0CE 3UZVB 5BS0E 2F54D 3UTQB 1EHNA 2ZSWB 3ARFC 4KKBD 5F6IC 3QUKA 4X6DB 2IWGA 3FJTA 1A9BA 5ISZD 3V52L 3S3PA 1MJ7L 4EN3B 1H15B 5BRZA 3OKNA 3KXFA 1U8KB 1VADA 4J6RH 4UUJA 1NLBH 3CZFA 1HN1A 1YEDB 3LRGA 3MLRH 3HZVB 4PJGF 4UDTB 3GSOB 1DCLA 1KEML 5C9JB 3FQNB 4U1LB 1J0ZA 4JEGB 2XZCL 5HHNA 1YMHA 2XFXA 1S9VB 1GSMA 3B9DA 4MNQA 4P99A 3VXQA 1I9JL 4BQCA 2ZCHL 4OGXL 3ULUD 1JBJA 4L5FH 1VA9A 3W2DL 3D3VE 3I2CL 3L5XL 1S9KC 1KEMH 1OP5K 2CRZA 1T0NA 2JCCA 4JG1L 4G5ZH 4ZXBD 4XPTH 3GK8L 2ED8A 4FQLL 1ND0A 1BBJB 2P48B 3K8LA 3RPIB 3NCFB 1IKFH 1FL3A 4OCWL 3ALPA 4U7KA 4YHML 1VDGA 4PJHA 5CSZB 4XZUB 4NO3A 4YAQB 3LHPL 4OZGA 1U8PA 1NPUA 2VDML 5JHDB 1JVKA 3HZVA 1FFNA 5F7DB 4XRCA 1YMMA 4MMXC 4TN9A 5HVWA 1B0RA 4A6YL 2O5XL 2Y07H 4PGEB 5FB8B 4NZUL 3VWJC 4RMTA 4NO5A 1I8IA 3QQ4A 1DQDH 1R5WA 4OGZA 1OCWH 4LLQA 1OQXA 3CFDB 3T0ED 1RUAH 3IGAA 1S78D 3I9GL 3WL9B 3BAEL 4TUJB 4LDOB 3CAFA 5DURB 3DPBA 5BZDA 1ZHLB 3PP3K 3MOAL 5FO8A 1UWEL 2E9BA 3LH2H 2PO6A 1X5AA 1CGSH 4S1QH 3ZKQD 2R0WH 3OXSA 3VG0H 1RUAL 4FQHA 3FFCA 4JRWA 3BQUD 1AP2A 1ED3B 4NUJB 2NR6C 3BAEH 5AAMA 4YHKL 1NCCL 5HPMA 4ORZC 1IZKA 4P2RA 3FQWA 4RWHA 4V2CB 4PREB 1F4WH 5CHNA 2WP3O 3BD4A 3OKOB 1HYSD 3S98A 1N0LA 2N1KA 3H9SB 3UPRB 4U2ZA 5F1SA 4NN7B 3Q6FB 1DUYB 1RZJC 3MRHA 1KOAA 1BGXH 3FT3B 4M6OL 4FG6D 4FRWA 1AXSB 4AMKL 3ARDD 4HKZB 1NKOA 2PTTB 4L4VA 1FFPB 1IAOA 4BSWA 3MLPA 1JZ4A 3QQNA 3FQRB 3IDMA 2Y23A 3RRQA 1J8HD 1YEIL 5FUCE 5B4MD 1S7XA 3CSBA 3BP5A 5KJRL 3GKWL 4HX1A 1RHFA 4P4RB 4OIIL 4ODVL 2FD6H 3HPJA 3D25A 1MLBA 3H9SA 3UPRA 4NQED 2JELH 5EUKA 5GRXG 5FGCE 5GISH 4PJHF 3QDGE 4GAYB 4P5TD 5ENWB 4AYFA 3SKMA 5DJAB 1OP9A 2E8YA 4E0RA 3VXTB 5TDPA 1QOKA 4Y1AA 4Y5VA 5J12B 5DLMH 1J1OH 4Y16B 3SE8L 4QRTB 1WAAF 2DLFH 4Y88A 1QO3B 4RAVB 3G5ZB 4LDLB 4XXDA 2DQIH 4NRZB 1RU9H 3BZ4B 4HMEA 4LCIL 1BMGA 2YPLE 4YEFA 3AAZA 5EOQL 3RI5F 2ADIA 3HPLB 4PG9B 2K7QA 3JZ7A 5HI3D 2J88H 4NQCA 1CFSA 4TUOB 2AK4B 4W70A 2IG2L 5E5UB 1QLEH 2H41A 4MWFA 5IB5A 4MNHB 5TQ2H 3RY6C 5KVMC 15C8H 3VA6A 1CFVL 2Z8VC 5TDPB 2DLHA 3NAAH 1BFOA 1OSPH 3RWGA 2ZUVA 3NACL 3T0WA 3VFNA 3LV3A 4AQ1B 3IRZA 4HUNB 4OD1L 5T5FL 1F8TL 3FHAA 4M02A 3V0VA 1OPGL 4MLIA 3EW3B 4LHUG 3SJVD 5HHNB 3D2UB 1V7NH 1AH1A 4K23L 3BI9X 1LMKA 3TA3A 3QQ3B 2WBJC 5IVZB 1WK0A 2D03H 3NIGE 5FGRA 4PJ8B 4WUUE 3RVTC 3T8XB 5DVMA 1MQKH 3G6JE 4K7PX 5GRJL 4RMSA 5DS8B 5L9DL 2BMKA 4TTGA 4WO4B 3N06B 4JLRA 3G5VA 1RJYA 3RGVD 4JFPA 1PDKA 4Z0XB 2EEDA 3BPLC 1OP3H 2YA2A 4RGND 3Q48A 2VDLL 5EBWB 3V6OA 4HIEA 1JK8B 2VL5B 4HGWB 4HPOL 3E6HA 3UAJC 1LEKB 1KELH 1TETL 1ZOXA 2NX5D 4Y0GA 3IAGC 4HMDA 2XFXB 2P8PA 2NXYC 2YD7A 4HCRA 1KJVB 2X4RA 4JRXE 3BRDA 3IJSB 2DQGH 4JJHA 4KMQA 1IARB 3PQYD 4PP1D 4U1JB 5J3HC 3FZUC 4UUJB 3C8KA 5FF6B 1Y6KR 2DWEA 5FOJA 5C7XH 1R3LA 4OFYA 5EZIL 4PJBE 1AI1H 3IYLW 1AQDA 3PV6A 4WV1A 4KI5E 2J6EA 3GJFK 4O4YH 4XPTL 3VXSD 2UZXB 2HFTA 1BIHA 1T5XB 5MEPA 2VQUA 5E8NA 2ATKB 3VDBA 3V4PL 1LEKA 3QIUD 3RL1A 4FZEH 3MO1A 3GSVB 1ZVSB 1I9IH 4LIQL 4PJCB 1BVLB 5F7HA 4XBPB 5BS0D 3MLXH 4N0FA 2FIRT 4HSQA 1GGIL 4OLEA 1AKJB 3BPOC 4WI6A 5C2BL 5SV3A 2ZSVB 5GRUH 4NQEB 4OLWL 4PD4J 4MQ7B 1LVEA 1S7TB 2AJYL 1FYTE 1TZGH 3GSQB 3P11H 4TNVF 5C0FB 3D39E 1EFQA 1ZSDA 3I6GB 3HCVA 1KJVA 2X4RB 1VFAB 1RURL 2YUWA 4JPKL 5DRZA 1BM3H 4LHUD 2OSLB 1EEZB 1NANH 5ETUA 4Y7MA 4OLVH 4J3OC 4Z7WA 5CJQL 5DFVD 5CEZH 4HS6B 3TN0A 3RL2A 1L0YA 5DUML 5TPWH 4Q9RH 3KYMA 4WU5B 3OR6B 5JQ6L 1P84J 4FQ1L 5SX5K 1UACH 4ZFZA 5C0AB 3MNZB 3AS0A 3FRPG 3W0WD 4MWFB 1W2KT 4JFEE 5FCUL 3ULUH 3K7UA 2DMCA 2K9UA 2O26U 1ZVSA 3NPSB 4U4BA 4EN3C 4U6TA 3L6FB 1W8OA 4U3XA 1DQTA 3X3FL 3LS4L 1JI1A 5ICXA 2F19H 3BO8B 4PJDB 1MFDL 4WY7H 3JTTB 1C12B 5C0GA 3AAZB 5FA4B 3GSRB 3S36L 3TN0D 5FO7B 2H32B 1A6VH 4XNQB 1U3ZA 2F15A 4PLJC 1LO2H 3VCLA 5AD0B 3RY6A 1TJIL 4BELD 1FNLA 1QFUH 2GK2A 1KB5B 5TF1H 4G8EA 1FV1B 5I19L 5ID0B 3X13A 4EIZC 1ZEAH 3O9WD 4NCDA 4NNXB 3AB0B 2ZNXA 3K3QA 4KQ3H 5IQ9A 5F93C 3TVMA 1CD1B 5KN5B 1W72L 1HH9A 3T3ME 1NEUA 2I26N 2AEWA 4UILH 1HK6A 3HFMH 4LQFH 4QTIH 1P4BL 4JVUA 3FO2B 3T3PF 1RIVH 4PJXE 1YMME 3HN3A 4KZDL 3GMRA 4NT6B 1EXUA 1K5NA 1EEYB 1PG7X 4RWYH 4EI5D 4A6YH 1E27A 3MGTA 1KLUB 3MRCB 4EDXB 5GJTH 4Y1AB 4Y5VB 4E42A 4XHJC 1HHHB 4L1DA 7FABL 2GJZB 2A9MH 1MREL 3RQ3A 1K4DA 5TE4L 4HWZB 4WW1A 5IB3B 4I4WB 4WFED 3L3OA 1RUKL 1KLGA 3CXDH 1OQOA 4MMZC 4LASH 1X44A 3U82B 43C9B 2WNGA 3S6CA 4U6VL 3LEVH 4WHTB 1HILA 5HD8C 1BVZA 4ALAH 3H9YA 5KJRH 3QUMA 5HPMB 5B8CC 3UTSD 2OR8A 1LEGB 2DD8H 4KRPC 4GG8A 1FYTB 2PXYA 3HHRB 4DZ8B 1CGTA 1UKQA 1TZGL 4WV1C 3KLHD 1LO0L 4PJBA 1JIBA 3B3IB 2XACC 5KSBA 2W0FA 4N5ED 1SJEA 3DUSB 5I1IH 3K46A 3QI9D 3U7WL 2W0LA 4G6FD 3BIKA 4P9HC 4J4PA 4XXCA 3EGSA 3HRPA 3KXFE 1INEL 3QDJA 3DYOA 1AIFA 1T3FA 1FNEA 5MERB 2W60B 5DRXB 1FRGL 5E2WH 1VFOA 4WEMB 4XAKE 1DBAH 3H9HA 1RUML 3MBXH 2B7DT 2GJ6E 1GIGH 2VLLB 2JB6B 2MMXA 4MDJA 4EUPH 2VLJE 4FS0A 4YHKH 3VRLF 1Q9WA 4EXKA 2I07A 1DLFL 4JANA 5IV2A 5DUBB 4F9LA 3CIQA 5JIKA 4R7DB 1U2HA 4HXBH 1XH3B 2H2PC 2NX5B 4WI4A 4KV5F 1JGLH 4NNYA 4ZPVB 1EO7A 3MV8A 3R06B 1P5VA 4CU7A 2ORBH 3AMKA 2IMMA 2NW3B 3WUWG 3AREA 1HH6A 3PGDA 4LLUB 4CADB 5IFHL 2I9TA 4DKFL 3WFHB 4JFED 3F6LA 4UNUA 4IMLB 5KSAC 4PRIB 1KCVL 3QCTH 5LGHH 5JW3L 3C5ZB 3EO1B 2AXFB 5E1HB 5TDNA 5D8JH 1CIUA 2XNAB 1F4XH 3O3DA 4V1DB 5EBGA 1UYWH 2FIKA 2BY1A 4IJ3B 3MTRA 3IFPB 3O3EA 1EVTC 4PJ7E 5C3LD 2H8PB 2ZZUT 2HTLC 5CAYB 5IQ9B 1KIPB 3I9GH 3QI9C 5KS9F 4OFPA 4C56D 1D6VL 4Y4FA 1FRGH 1QR1B 3QDJD 3SO3C 4WTXA 5IW6B 3WKML 4CAGA 5DDHB 5AZEL 4YPJA 3A6CH 1Y18A 1CL7H 1ZLSL 3K1KC 2E7MA 1OM3H 1T4KB 4F9LC 1HCFX 1NCBL 1K2DA 1A4KA 4WTZG 3FAXA 3WYRA 5FA4A 4U6VH 2GITB 5HD8D 3LMJL 1GGUA 4POYA 5D1ZD 1SYVB 1A6TA 1INDH 3O4OC 3VXME 5KSVB 1P1ZA 3LOWA 2CLZA 3H0TA 5EWIH 4B50A 4G7VL 2J5LC 2OTPA 4YC2B 1Q9LA 4M1CD 4XMPH 3GKWH 4MD4B 4Q9CA 3MREB 1CGYA 3LKRA 5GS0C 3RAJL 5MEQA 2F53D 3HI1A 1LK3H 1MCHA 1L6XA 3PQYE 4PJFB 3ARRA 4MAYB 5I6XC 4PJDF 1CVSC 4KZDH 3QEHA 4R0LB 3KNBB 2D31B 2HT4D 1FORL 5DRWA 2GITA 4NNPH 1NAMH 3LS5H 4ZTOL 4G7YL 3GRWH 3BHBA 1YN7A 5GJTL 2R1WA 5CWSB 1AO7A 4PGJA 5I75B 1QNZH 4R9HA 3IT8D 1KTDA 3B2UC 4NGHH 1BGXL 3GMLA 4OUOA 4HT1H 3GMMA 5HHPB 4CW1A 1E4XH 2BRQA 1D6VH 2R4SL 3TV3L 4QHMB 5T3ZL 2BHZA 2VDLH 3L7EB 4HV8B 2NW2B 2G2RB 3B9KD 2YD5A 1WZKA 3P73A 4OKDA 4LSRH 2HFGH 4W6XB 5D70H 5C9JA 3M07A 4HJGA 2YBRA 1AGEB 1FVCB 4DOHE 5H94B 3RZCB 4DJMA 1FG2B 2W9LA 4X6DF 3QUYC 3ARFA 2OX5A 3QXTA 3VGFA 2GKIA 3PXJA 4R3SA 2FX9L 4MQ7A 4QOKA 1HZHL 3SDDB 2H32H 5MEND 4OZIB 2QADB 4XCNB 5FA3B 5F7MC 3AMLA 3VXPB 2W91A 4X4ZA 3D48R 4ZO7A 5I9QB 1A6VL 1KCVH 2QQLH 2CLRA 4LSUL 3BKYH 4M8VA 4X6EB 3RX8A 4KKNA 4YHPB 2BNQD 2CUHA 2GY5A 1G7IA 2R56L 2WINA 4WGWB 5KOVC 5GGVL 3QXDA 4BFIA 1YYML 1XH3A 3WEXB 5C0NC 3FCTA 4NQCE 4PLNC 5DJXA 4PJ5D 5DTFB 4EUPA 2KDGA 2R0KL 5D2NE 3X14A 5HYQA 4H0HB 5HPOA 5HHVL 1CDCA 1TMCB 4N9OB 4JO2L 4K3DL 2P45B 3PF2A 1Z6JT 2Q7YB 5E8OB 1X5JA 3QIWC 4HXAL 3QWOA 2VLJA 4JO4H 3T0EC 2WLYA 3I02B 2A6DA 1NAMA 4P46A 1Y0LB 4GAGL 1XGQB 1XGYL 2OJZH 3BIKB 3REVB 3GIVB 4D9LH 4X9GA 4IJ3C 3MRNB 4NM4H 3K81A 1WISA 3H9SE 4P23B 1INEH 3HZMA 4NQXA 4QHMA 3OR7A 3HNVL 2NLJB 4YE4H 4O2CA 4LGRB 4WTZA 5GGUA 4I9WE 2OQJB 4WEUD 2BHYA 4NCC2 1XF2A 2LVEA 3KPRB 4Q6IB 4QKXB 5HXMA 2P49B 3OKLA 1OF2B 4NP4L 4R90H 2IQ9H 5CKAA 4U1KA 4CL7A 3NFPB 4NRYA 4ZYKA 4WVRA 5IOPA 3G6AB 5DWUL 3NZ8A 4U1HB 3MCLH 5E99H 4F7CB 4W4OC 4NM8H 4X4YB 4XNYH 2Q6WA 5BVPL 2Y4SA 4HPOH 1DANT 2HLFC 3HLAA 4LPWA 4OLZH 3H3BC 1TFHA 2R4RH 2DKSA 1D7FA 4JGJA 1RK1B 3PP3H 1JGEB 1IC5L 3BMVA 1TVBA 5F70A 3BKJL 5BMFL 4M4PA 4OSUH 2YS4A 5AD0A 3KPQA 4L8DB 3QI9B 4MA1B 3OV6A 3QHFL 5KOMC 1MRFL 1A8JH 1CDIA 1NFDB 1Q9LB 4NKOA 3UTSE 4HK3J 2IF7A 3VWJD 1CFSB 1IM3A 4TUOA 4P2CG 1IILE 1IAIM 3A6OA 1S5HB 2AEQH 4CVXB 5IT2H 2CIKB 2Y9RT 4H88L 5DRNA 3CXHK 1OWRM 3TIEB 4JVPA 3ZKSD 5J89A 3RX5A 4PRPA 5AZ2H 4WUKL 2VO5A 2F9BT 3Q6GL 4YQXL 2ZUUA 5I8CB 1KPUA 4IRSD 3EZJB 4GMTH 4U31A 4QRPA 2VABA 4N8VA 4QGYA 5IB2B 3GJEB 4OCRL 3SKMB 1O5DT 2VISA 5TGBA 5HHOB 3LN4A 4HLZH 4L4JA 4Y8DC 4HKJB 5ESQA 5AZ2L 4GMSL 1FH5L 4MAYD 2R56H 2YD9A 2J2ZA 5C9KA 2LTQB 4XPAL 1PAMA 4PRPD 1NFDF 1NCCH 2ZOKA 3MACL 2DMBA 3LSOB 1YN6A 2V7NB 3O3BA 4JRXB 4Y4HD 5E95B 3IU4H 1JGVH 2YC1A 2OMNA 4APQA 3FT2B 4Q6IA 1TZIA 3TPUA 4PTUA 2ATPA 4KI5F 2Q7NA 4M7ZC 3RPKA 2QR0B 2IPUG 3PGFL 5D2LF 1B88A 5I1JH 1INQA 5L88L 3NMEA 5IJVA 3FB5B 4Y5VC 5DFWH 4XX1E 5E5RB 5I30L 2VITB 3QHZH 2GEEA 5JXAL 3WCYA 4P9MH 4DKEL 3W82A 4HS6A 1HEZB 1QRKA 5DJ8A 1MAKA 3O2VL 2NZ9C 3MLYH 4MX7B 1SM3H 3LKOA 4K07A 3BPCB 5ICZA 1YEKL 2A73A 5J6HA 4HZLA 4JQVC 1F42A 3CPLA 2WUBH 1UH4A 2E6PA 3GSWB 3FL7A 3PWPA 4QRRD 2NY4D 3BE1L 4M5ZH 3K4AA 1F11A 1NC2D 4J1UA 4PRHA 1V7MH 3KJ4C 4DWHA 4LRIC 4LVNB 1QRNB 2DBLH 3OKMB 2XKUA 3FRUA 5C08D 3H9SD 4XHJD 5HDBF 4WGVB 1IGJB 2DM3A 3U9PL 1JFQH 1JCKA 5K59E 3HNSL 3GHEL 4RFNB 1NLBL 3TT1L 5JHLH 3O6KH 5EU7C 3VFGL 4LCCA 1WZMA 4DKDC 1J88A 3D3VB 2L7JA 2ITDB 1UJ3A 5IVXB 1MHHB 3L3IB 4RNRA 3ZKMD 4HIIA 2AJUL 5GGTL 3CJJA 2IBZY 3GB7A 3LEVL 5D6CA 2ZCHH 1DVFB 2DQDH 4AG4L 1IGTA 3F62A 5TE6H 4XRCB 1A6PA 1T0NB 2JCCB 4XP6L 5IROA 2VXQH 1W0WB 1NGYA 3DNKA 2VDRH 2DLEA 4HFUH 4PP2B 3CC5B 4D9RD 1CR9L 4RMRA 2FCBA 4FQXC 4NBZB 1EMTL 2EDKA 4S1SH 3S37L 4MA7L 4E41A 5EG6C 4PRHD 2KQMA 1BVKA 2C1OB 3LPGA 4CW1B 5IFAH 3HI6H 1SM3L 3WN5A 2Q20A 4L4TE 4MA3A 2GJZA 2QSCH 1XAUA 2PO6D 4G8IB 1U8IB 1XGRB 1T21A 1LE9A 1YEDA 5GS0H 2VDKL 3G5VB 1IGTB 3G08A 2ZKHH 3QIUC 1RZKC 4NC1E 1IGML 1I7ZA 3VXRE 1TVHB 2VUOA 5TJWK 3T0VA 3VFPA 3RVUC 2P5EB 1CLOH 4YBLB 5SWZA 1TVHA 3TA3B 2DQTH 1V3LA 1QRNE 2R2EA 5F9JA 4HUWB 3THMH 3FFCE 2F74B 2IANA 5D7JD 5HGAA 1J0IA 5CILL 4H26A 1XR8A 4L9DA 4RISH 3QUZC 3U6RA 2UWEE 1A1OB 4F7PB 4JGUA 3MXVL 1M7IB 3FN9A 3HG1D 4BH7A 5EFIA 1C5BL 5DMGC 3VD3A 3I50L 5JDJA 2NXYD 1LWRA 4M8QA 1UXWB 3GJFB 2DWDB 2JK5B 2NY2B 3FONA 43CAA 3O6FC 1C16B 2BCKB 4LFHD 5JW4Q 3CX5K 1NEZA 3MJGX 4TUKL 2IAMD 4R6UA 3DVIA 4YQXH 2A77H 4X6CE 2EH8H 3VRIB 5FYJD 4R26H 4U0RB 2CRYA 3HB3C 4JN2B 4BQ9A 3P30H 2OYPA 3VGBA 4JFPB 4Z0XA 5L7XL 2LQRA 1FL5A 4Q9RL 4X8XA 1CL7I 1OAXL 5DJ8B 1TTFA 4NUGH 5M7QA 4MNGA 3K0WA 4NRZA 5I18H 3TCLA 1L7TH 1GIGL 3QG7L 3SY0A 2EDOA 3VFTA 5ILTH 1JNJA 4IOSD 1BBDL 3BPLB 5EOTB 1PX3A 3I75A 3VXTA 5HHQB 2W9DL 2NY6C 1XGPA 3IXAA 4WW2C 1EHXA 4H1LH 1D5ZA 3WFEH 1WZ1H 3FZUD 3WO4B 1E28B 1KC5H 3ULSB 4V1DA 4GW4B 4M43H 2XNAA 2P7TB 4PV9A 4UQ2B 3ZE0F 1T20B 1CXLA 3TYFA 4ORGA 3LKQA 2MQ0A 1FL6A 2CUIA 1N4XL 3JWOL 2C4FU 4JKPH 5J11C 1BQLH 2WANA 1G7LB 1LK3L 2UYLB 4NJAL 3NGBB 1YEFH 4RFEA 1P6FA 2Q3ZA 4UI2A 5CZVH 4KKAD 3MLRL 4PJ9C 4AL8H 4JFDA 5I1DB 2DTSA 2YD4A 1NFKA 2ITCB 4XCEB 5ITFA 4DKAA 1MHHA 3L3IA 1ADQH 1NUFA 4RAUB 1HDMB 4HS3B 4OF8A 5EN2B 5GS1B 4YDJA 4DOHB 3DGGA 2NY0D 1OAQH 5D7KD 3P4LA 5FKAB 1N5AA 1OW0A 1ZLUK 5DMGD 5DI8A 4X7EC 1MAJA 1S7SA 1IM3B 4XC3H 1YUHB 4FFVD 3P4OA 2Y6SD 5C0CA 5EC1B 5GJSL 2W60A 5DRXA 5DYOA 4PRNA 1U8LB 5HHVH 3QEUA 5A40E 1HINL 2BSTA 1DN2A 3RY5A 4HZAA 3RVUD 2DIBA 4P4RA 1ETZB 1G6RB 3HG1A 4KVCH 4UV7H 3DX9B 4LFHG 5DT1L 4PJ7B 2MHAA 3IDIB 3PWJB 4QRSB 1JGDB 2GSIB 2MKLC 1K6QL 2EICA 4OM1H 1ACZA 4OF7A 5DZLA 5HHOA 5TGBB 5I1DA 5E2JA 3U4BH 4U1KB 2VLRB 3QFJA 5EBMB 1ZV5A 2H45A 3DWTA 5SWQA 1QRND 3GI9H 3ZTJG 4OZFG 4PGCB 5M95B 4HJJH 5C6TH 3JWOC 4RFOL 1J86A 5DS8A 1NBYA 2C4XA 4O58L 5MI0C 3MJ7A 4O02H 5CZVL 3LRHA 3HI6L 1A6AB 3ES6B 3VFSA 4IBLT 4YZFE 3I6KB 1S7WA 3LB6C 4XPGL 1MCWM 1N26A 3AGVA 3LS5L 4N1HB 2CUMA 3O3AA 2E6QA 4OZGE 1DE4B 3JUZA 1Q9OA 1F3JB 1XCTB 2ED9A 2MPAH 4K94L 5SWZD 5T3ZE 3VG9B 4ODUA 5JO5A 3B8YA 1FZJA 1CDYA 1N6UA 4GLRH 4PG2C 2D4DA 4DGYH 3T0EE 3O6FA 4BH7B 4L3ED 3NGBC 2HMID 3B9VA 5INDB 1E4XL 4N0UA 1VPOL 1XGYH 2OJZL 1G7MB 3LIZH 3CFJA 3OJDA 5GSRB 5C07B 5IMLB 5F9OH 3MSPA 1I1YA 2NMSA 4K3JL 4KMTH 2FWOB 4QEGA 5EBLB 3UTQA 2DTMH 1UADC 4XVSH 5DJ2B 1MEXL 3N0PB 1ODAA 1ZA6A 1JMXA 1X4ZA 3L3GA 1R5IB 3SKUD 2Z93A 1FZKA 3JWDH 4AMKH 1NCAH 1MF2L 2LFGA 4LAQL 5IJKC 2F5BL 4TSBH 1TZHA 4JO3H 1NFDE 1RFDH 3SDAC 4XX1G 4S0SD 4H1LB 2ERJC 2B4CC 4R2GD 4WW2A 2EXWC 3LDBB 3VXMA 3E1F1 4R97B 4TULH 2BOBA 1H8NA 3QUKB 4OZFH 2M1KA 1WC7A 3KYOB 5E2VL 1VFBB 1A6ZB 2LU3A 5IM7A 4IHOB 2FZ3A 3X14B 3QRGL 4YDJB 1QA9A 3SE4A 5C7XL 4ZFGL 5FEBA 2BVOA 2IH1A 5ALBL 3QH3A 4K9EH 3RWCB 3RVVC 4Q7DA 5T1LB 1IAOB 4BSWB 2WIIB 4F57H 4E41B 5JOFA 2CRIA 1S9VA 4IRSA 3RFZC 1FN4A 4TSCL 2VXUL 3LPWA 1UZ8A 4QYOA 1MHEA 1D5MA 3TA3C 4ZAKA 5FYKH 1IT9H 4OB5H 2BSTB 1UQSA 4ZO8A 4HWEL 5EU3B 4BZ2H 2ZPKL 4CMHB 3RGVA 2J3SA 5HDBE 5M94B 2UVFA 4AH2A 5SWSB 1FJ1B 2X4OA 2CXGA 1A3LH 4ODHL 3ZDYE 4WW2B 3IJYA 1F4XL 2VUYA 1R3LB 1UWEH 5CUSH 2FJHA 2E3VA 2OZ4A 1IGYB 5JPMA 1BJMA 2YD3A 3I3EA 2NY5H 3TA3D 5F96L 4DVBA 2VE6A 1YNLL 2ENSA 5CMAA 3ARXA 3NIFF 3UTPE 2Z93B 1CLYL 4GKSA 2B4CL 4JRYB 2NW2A 1XZ0A 4WTWA 1NJ9A 3UBXG 2P5EE 4JQVA 2HT3C 1UB5A 2AEQL 5C6WH 2HKHL 3DIFA 3ILPB 3PNWA 4HF5H 5AEAA 5L6YH 4HT1L 2IPUK 3ULUL 2NY3B 1RU9L 1F11B 3DRQA 3S3JA 3ZDZE 5EZOH 4M7JH 5CJXC 4YBQD 4GH7B 3SDDA 1H5BB 1QBMH 4W6WB 3T8XA 3STBA 3MRBA 4RMUA 3RWDB 2A0LD 2D31A 1FCGA 4KDTA 4RMQA 3VH8A 4U1GC 1X5XA 1SJVA 4Y5YC 4F37K 3ABZA 1EERB 4U6YA 5DQJA 3JTSB 1JYWA 3KWWB 3TNMA 1TPXB 1NFIA 2DIAA 1FAKT 4IEFB 4CUCA 3N1QC 3RPIA 5EO9B 1WUNT 4KKCD 1EX0A 4TVPL 5C0JA 2I60H 4GRWE 3HNTH 3QUMH 4LSPL 5FGBA 2HN7A 5BV7H 3GSNA 3ETBF 3ULVD 3PXHA 2B2XH 4WFFE 3ULVF 3FT4B 4QHUA 4MJIA 5AZEH 4QHNB 1T2XA 2P5WE 1CXIA 3VE0B 1F97A 3VXQB 2ZUQC 3LN4B 1KFAL 3ZYJA 1HXYB 2NX5A 2XZQH 3DJ9A 4Y19D 2P24A 4D3CL 3HE7A 2VKWA 4X5WB 1H8OA 4P5MA 5FYLH 4PJ5B 5D1QA 3OB0H 1I4FB 1C5BH 3MCG1 4LHUB 2YEZB 4QT5B 4HIXH 1XR8B 1KPRA 2VH5L 2NY0B 4DZBB 5BRZB 3S4SB 1TQCB 4M4RA 4YBLC 3LPFA 3HPLA 3PDDA 4KZEL 1FGNH 3VFPB 1F4WL 5F88A 1FIGH 3NFPA 4AIOA 2C3HA 4PJIE 2X1QA 4BJLA 4L3AA 5EZLA 3GSNB 2Y07L 1Y18B 1XGRA 5SWQB 3IFOA 5JR1L 3QCVL 2FR4A 4YDKL 4F58H 4DZ8A 4E5XA 4D0DA 3TVMD 4LVNC 1SY6L 4GXUN 1HQRA 3N9GH 3PL6D 2C3VA 1YYLH 1ZT1A 1WBXB 2ID5A 7CGTA 2Y7QA 1MNUL 2IANE 3FT3A 3IVKA 3PHOA 4ZUTA 3K8MA 3F7QA 4OV6F 3QDMA 2UUDH 5D70L 4HPYL 3MRMB 5KAQF 3FQRA 3TESA 3QFDA 4WI7A 1DVFC 5CCKL 4N0CC 2W38A 5GGVY 4HWUA 4MA1C 3NIDF 3CX2A 3DSFL 1A21A 1CBVH 2GK0A 4Y4KB 3MA7A 4KKAC 3OAYH 4ENEC 3KJ6H 4YHNB 3LKSB 4HLJA 3GRWL 1YNTB 3O0RL 2ZOLB 2F58L 5CD3A 5ID1A 1NGWA 5GQBA 5TE7L 1BD2E 3VD7A 2P46B 3OF6A 4CVZB 2Z92A 1MFCH 2BXYA 3K8KA 1WBXA 1EHLH 1HQRB 4GG6B 5I1GL 3C6LA 1PSKL 4PJAA 5D1ZC 2N7AA 2HH0H 4M8QB 4U6HB 5L7XH 4OZHA 3OG4B 1Z9MA 5D72H 2MOVA 2XWBB 5ESAA 2WW8A 2V5MA 1DEEB 1RJLA 4G7VH 4FQCL 2WK2A 4H26B 1UA6L 4DN3L 4XXCC 4BK5A 3ELAT 2CXKA 1XEDA 3U9UA 4BZYA 3IAPA 3I6LE 5GS1A 1PY9A 2VXSL 4LARH 4P2QB 1S9WB 2GK0B 4Y4KA 3RWEB 2ICWB 3UTTD 4I77L 5DC4B 2AJ3A 1F58H 4HK0B 4Q6IC 3DV4B 3SPVB 2JLLA 2X7LA 3ULUF 5D7IB 5CEYB 1EFXA 1MVFA 1CIDA 3GMRB 5BRZE 5I1CL 1NFDA 3W5MA 1OAXH 2ESVB 3QDHA 5HI5D 2DQCL 2G75B 3C5ZD 3MJ9A 2XI9A 3EDJA 4BKLB 3F7VA 3RNKB 4KZEH 2E9JA 3OAZH 4RGMC 2BNRD 2C26A 1AKJD 3J8F7 1OP3K 3C09B 3KYKH 3FONB 1G1CA 4H0GA 5D8JL 1K8IA 1BBJA 5EU6A 3DO7A 3OB0K 4ZQKB 1F90L 2GSGA 4HGKC 5EH1A 1NUDA 4LSRL 3BMWA 4XCYA 3OSKA 5D2NB 1N0XH 1R3IL 3ZT7A 5KSAA 3LY6A 3WHE1 4Q2ZA 4MSWA 1U3HD 4NFBA 3BEWB 4RA3A 4B7LA 5EUOA 1I8LC 1EXUB 3TIEA 1DQLL 4PJXA 2N7BA 3PWPE 1T66D 1DN0B 2EEBA 5ICXB 3RWEA 5LWYH 2NTSP 5CD5C 4GKSB 2XN9B 1I1AD 3S88H 3C5JA 3DHMA 5C8JB 1MCIA 2YSSA 4NYLB 3SBWC 4OAWA 5I1HL 3SKNB 5EBLA 4NKOB 15C8L 2VOTA 4J4PD 2AS5M 1G6RL 3JWDL 4I13B 2AJUH 5GGTH 1OAQL 1I4FA 1CD8A 1QSVA 1F3DJ 2D3VA 4RCAA 3U46B 4JKLA 3WN5B 3TO4A 1P4IL 3B9AA 1QLRB 3K80A 1U8OB 3F7YB 4XMLH 1UFUA 1H0DB 1SYVA 1JI2A 2DM2A 3MV7E 3G5YA 4P2QE 4GKNB 4RDQF 5LGJB 2EDWA 4IM8A 4M6AA 2AJYH 2LV4A 3GSRA 3SCMB 3FT4A 1K8DA 2F58H 3BPCA 1TJHL 2PYEB 4IDLA 2P44B 3W2DH 2X1WL 1RIHH 1A7NL 2R0LL 3L6FA 3ZKMC 3KPPB 1M7DB 1G7PA 1LO3H 2JJSA 1CG9A 3TM6A 5J6GA 3BWAB 2JKXA 1VEMA 3EUUA 4N0FB 2I9TB 4P3WA 4L9LA 4LPYA 3LQMA 3GSUB 2R1YA 2J8OA 1BLNA 4GOSA 3SKJH 3BH9B 4Z76B 1ITBB 4Y5XC 2AXFA 1FG2A 3VWKD 3IJHA 4JDTL 4RISL 3MLYL 1I7RB 5DSCA 1VFAA 5A16B 1T2QH 5EZJB 1J8HB 1YPZE 2GTWB 2BNUA 2CDFA 1XCQB 4HWBL 5ECJE 1MJ8H 2J6EL 3DVNB 5B3NA 2X44D 3MJ6A 4C57C 5D6CB 4LSTL 4M9OA 4BZ1H 3CFCL 5AG8A 3DI2B 4NZRL 1CTOA 2ICWA 5I8CA 2IALA 4RGMB 3V9FA 3LKSA 2XQYK 4FFVC 3NN8B 3HC3L 2VXVL 4JN1L 2IAND 5GS1C 1MPAL 2CKBL 3GMQA 2F19L 3DXAD 5JW4M 4NBYB 3DVGA 5F3BA 5I1KL 2VZOA 1YEGH 5IJVB 5J57B 2W65A 3OWEA 5LCVH 2BMKB 4R0LC 3QYCA 1T89C 1IAIH 2EDXA 2VLLA 2QTEA 2JJSC 3W9EA 3EYUL 5LBSH 3CVHB 1AR1D 2GCYB 2UYLA 4OJFL 5FFLA 3OBAA 4LPUA 4OLYH 1FDLL 4P5KB 3Q3GA 5GGSB 5TE6L 4AIZB 1NMBL 1AGEA 3MOBL 1TCMA 5DJAA 5D7LD 4MGXA 1NGXB 2HFGL 4AT6B 4K9EL 4NQDE 3S36H 1BWWA 1NANI 5ADOH 3D9AH 1KYOK 3MROA 4PV8B 4PJXB 1KXVC 5DEGB 2DL9A 5DD6A 1G0YR 4MA7H 5D1ZB 3PQYB 4PRDB 2BX5A 1LE5A 4Q0XH 1G9NC 4GG6F 3GMPA 3KPRA 2IQAB 1GPOH 3N1MC 2GUOA 2PXYC 2NY6D 2WWMD 4IDJH 5E08H 3KPSE 3E2HB 3KLSA 1J05A 4WWKD 4P23A 4CVXA 3GSNH 3L3DB 1W0VB 3C5ZC 1QBLL 1CD9B 1ETZA 1G6RA 3HG1B 4OBRA 3V7AE 4FTVA 1A7RL 4M1DL 3TH3T 3W11D 5E0QA 1OW0C 1MCLA 2X41A 3O6ML 4ODTL 5DK2A 2IBBA 2NY2C 2X4PA 4L3EE 3O2VH 1M6OA 3ROLA 4E0RB 3LCYA 2VABB 4N8VB 3TH4T 5D7SH 1T89A 4R8WH 1HXYA 5EU6E 2A9ML 1JPST 1S9YB 3IDGB 2LAGB 4F7CA 4YXLL 4PJIA 4KK9C 1JV5B 3FTGA 2RCSH 4KTEH 1I7TA 2R2EB 5I1GH 4I0PC 5DD6B 4TNVK 1KCRH 5DRNB 5C2UB 3HMWH 3UPAA 2EKSA 3SGDH 4XP5L 4MNQE 1S7XB 3EO9H 4N0UB 3BUTA 4NIKB 3FQTB 1NKRA 1DDHA 5EULV 4QLRA 1Z9OA 4D8PA 4KJQC 4AIZA 5J13C 3SDYL 1QHPA 5D5MA 5LGKA 1JWUB 2K1MA 4JFFB 1MIEL 3T65B 2X05A 1GOHA 5B21A 2R0WL 3TBSB 3HI5H 5C0CB 4JZNA 2VIRA 4QRQA 5C09D 4Q0XL 4BSVB 1S7RB 3IF1A 3KYNA 2JB6A 3X12A 4C83A 4AH2B 2YPVL 4JFHD 4PJDA 1YMMB 2YK1H 3RX7A 3RWDA 5HYEA 2ZUXA 1MCOH 4WO4D 5EPMA 1RQ5A 1NEZG 4WJ5B 5BS0A 1KENH 1JRHL 3CC5A 1Q0YH 1LP9A 4WI3A 3NA4A 2ZWLT 3SHSA 4Y2DD 1UWGH 1N6VA 3G5XB 2O5XH 5DD5L 2AGJL 5LXGL 3ZKXC 5C0ND 3D18A 4HULB 3WD5H 3ZKXB 5F97E 2DI7A 2ZUQB 3DVNA 5FO8B 3B6SB 2OL3L 2GAZA 3RDTD 2P8MA 2FHFA 3TNMB 4PJ7A 3MV9B 2VYRE 3DX9A 4X99B 5HYSG 2WSKA 1YN7B 3LKQB 5E6YA 4JY6A 1SBSL 3DURB 3IJHB 1T5XA 5D96C 3VWKC 4X80H 2E6JA 1WIOA 5E8OA 2R8SH 4KV5E 1S7TA 2DYPB 2NY1B 2DQHH 4N90E 2NTFB 4OCYH 4BSVA 4XVUC 5DK3A 3V4VL 3U46A 1N6QL 2DYPA 4O2FA 2EE3A 1HHHA 1DLHA 4XBGA 3TYGL 3MLVH 4LLMB 3SDYH 2KZ1B 3KPOB 3MNVB 3HE6D 4BYHA 5D6DC 4YK4C 4NQDD 4ELMB 1X7QB 1P1ZB 5CJOL 3C5SB 1ZT7A 3MYJA 3DECA 1U8JA 2IBZX 5JOFB 2AJVH 1CE1L 2NY4C 1CE6B 1JK8A 2VL5A 4LMQE 4I0PB 2C3WA 1BQLL 5DR5L 4JFDB 3NPSC 1RZFH 1F45A 3GK8H 4GW1A 1YNKL 2E8ZA 1MCFA 1T04A 1RJYB 1VCAA 3QG6A 3SJVA 2X1OA 4HCRH 3O9WC 4IS6B 4WFGE 2X4PB 4PRAA 1OAKH 4BQ8A 1ZHNA 4MZ2A 1OTSD 2NY4B 1JWMA 1QLFA 4KVNH 4MNQB 4PRPE 4G6KL 4M62H 3QQ3A 5AWNL 2AEPL 3VGGA 5EO0B 3CXDL 5C0AD 1CBVL 2UY6A 3P77A 4PJFA 4PLKD 1EGJH 2WAHA 3F7VB 3DXAB 3ZSSA 2VWEE 4RFNC 4PJHB 1IM9A 1RUQL 1MFNA 1K4CB 1T5WB 2PCPA 4EDXA 1DN0A 3KG5A 4KI5C 3WE6A 2VSCA 3MRIA 4MVBD 5B3JF 1ND0B 3GSNL 3Q5YA 5K9KB 1KJ3L 4HKBB 2V2TB 4YDVB 1RVFH 1ES0A 4YPGB 1I85A 4ZUSA 3MRPB 3U7YL 2DQUH 1C8PA 2R29H 4Y5YB 2V9QA 1VFBA 5J1AB 3KYOA 2CIKA 4PJDE 1PZUB 2HKHH 5I1JL 1ZLUH 1A2YA 4G42B 1K9TA 1KN4L 2NPLX 1R3IH 4GKZB 4OCNC 3JVGC 3S5LA 1B2WH 4Z77A 4XPFH 1TCRA 4ELME 5JR1H 2H2SC 3F6IA 4Z7UF 3CVHA 5IB4B 4L4VE 1WBYA 4JO1H 3RWHB 3U0WH 3IDNB 5JOPE 3HZKB 1HIMH 2F74A 2IANB 1Q72H 4I2XB 4XMKL 5E94B 1I8LA 5FDWB 5HGAB 3UEZA 5LCVL 1FZOB 1UWXK 5MENA 3O8XD 4IOFC 4K71C 5FM4A 1QNZL 5HI5C 4OSUL 3U9UB 1MIEH 3L1OH 5HYJE 2X4SA 4FQCH 2VTFA 5T3XD 4GLRI 4Z7VA 1RZJL 1S9XA 5D2NA 1JYNA 2EYSA 2VRAA 1OAYL 3GGWB 4Z7OE 1IGYA 5IFHH 4HH9B 2FHCA 5DHVB 2OCFD 3NH7H 4HKXB 1OLZA 4U1IA 2FEDD 2D4FA 2Q76A 1JPSH 1YEHL 3LQAH 4AM0A 4XT1C 4YUEL 4K7PL 3MRFB 3TF7C 1GVIA 1DBKL 1FYTD 3WIIH 4JKKA 2VDPL 5BS0B 1U95B 3U36B 4N5UA 1DZBA 1JJUA 3R0MA 2CDEB 4Z95H 2COQA 4WEBH 5LQBL 1WZ1L 1U2CA 3VFMA 2B39A 5DWUH 2AQ2A 3LAFA 3OXRB 3OTTA 2Y06H 1EPFA 4UV4L 4NM4L 1YQVH 3X3GH 5IB2A 3RWCA 3WHXB 5F7NC 2BSRB 1J87A 4WHDA 3UDWC 2A74A 4PB9H 3E6FB 3FRPA 3UTPD 3FB5A 4M5ZL 4L8SC 1A14H 4XMPL 3HR5B 1AD9B 4JAMA 4PRPB 1TJGH 2X4SB 1MQ8A 5H2BB 2O5YL 1RIHL 1ZKAA 4NQDA 4TTDD 1J9CT 4Z7NE 3ZL4H 2IALB 3PDGA 1DBML 3RIAK 2VR4A 4R26L 1U95A 2DOCA 4XWGH 4XNZB 3MUY1 2FGWH 1AQDB 3PV6B 3DROA 3HNVH 4QWWD 3HG1E 2EZ0C 4UB0L 5ESQB 2X89A 1MREH 1WWAX 4DGVH 3IFLL 4PJ7F 1WF5A 5E6IA 5KVEL 3O2WL 3PDOB 2M2DA 4K2UL 1NDGA 5I76B 3P0YL 3SDDC 1IVLA 3AUVA 1OAYH 4XHQA 5EFIB 5EIQA 2XN9D 1YC8A 1NMBH 4HDIB 4XWOC 4C56A 1YZZA 4Z76A 3DV6B 3NFSH 3KHOA 4J3XA 4JFZH 3K4DA 1CICC 2YBRB 3S88L 1SYSA 3BYTA 2QSVA 4OT1H 1GZQB 3DUSA 4ODHH 4PY8I 3PP4H 2VXTH 2AV7B 2EIBA 4PY7A 3VD5A 1EZVX 2ITCA 5ITFB 1G7PB 3O2DH 3DUUB 4RGOL 3U0WL 2LABA 3LEYL 4ESKA 3HZMB 1AHWB 3F58H 1LE5B 2VLJD 2VSDA 3MXWH 3LSOA 4JRXA 1MHPL 4LKCB 2BVTA 5T3ZH 2QJDA 2VDKH 2FO4B 2XQYG 3KAAA 1WFTA 3B2UD 3CFEA 1C1EL 2XY1A 4GAYA 4OFYD 4Y2DB 2AVGA 1FH5H 3JV0A 3L1OL 2BVQA 4BZ1L 1HHIB 3UJTL 4WCYH 1E28A 1NGXA 4R4ND 1EEZA 1JTTA 2A83A 4HC1L 4KUZL 2BRRH 4NRYB 4ZYKB 3IFNH 3CDGA 2DQJL 3GSOA 1GGBH 4X9BA 4M3JA 3X11A 3V0WL 3WLWC 5I9QC 4PRDA 3EOBA 4Z0BL 3ILPA 5F7KC 3GMOB 2XQBL 3G6JA 2X7LB 5FO7A 1A47A 1JZ8A 3SPVA 2YSSB 4NYLA 1CGXA 4F37F 4H88H 4OCXL 3GFUA 1QQDA 2P5EA 3IXTA 4FQJH 3UMTA 3WS6C 1CLZH 1JF5A 3QNZB 3ESVF 3GIVA 1FZOA 4HK3N 3SCMC 2YD2A 2PETA 4KHXH 5FKPB 1PEZA 3EO9L 1RK0A 4XVTL 3MV9E 3Q6FA 5I1IL 5C0AE 4X7TA 1P7KA 5EA0L 3SKOA 4ONFH 5B38B 2IC2A 4G8IA 4LHUA 1I1AA 4TVPH 2Q86B 3HUJB 1TCRB 1UJ3C 4HJ0C 4QRPE 3S8WA 3PL6B 1TXKA 2SEBA 1Z0NA 4OCWH 1WQVT 3S9DB 2XA8L 3M17A 5HSFA 2R39A 1BREA 2A6JA 5D2LE 2A38A 4OIIH 1YEEH 2ZSWA 5L0QB 2A0LC 4J7RA 4LLDB 4KRMB 3ARGD 1U92B 4KUCF 1YDPA 1I3UA 1YPZF 3PWLA 5F9JB 5AAWA 3V6FB 5AG9A 2VERN 1CXKA 2ADGA 4YEEA 1KEGL 1U91B 1S8DA 2ARJB 2QHRH 3L5WB 5BO1L 3IDXH 1DVFA 1ZTXL 3MBEA 3ME0A 3QZWG 2F8OA 4KVNL 5F9AC 4F7MA 1RAMA 5L2KD 5IBLC 3WN5C 4X6EA 4L9LB 1JNHA 5DMIL 4K7PH 4M00A 4PIRF 1KTDB 3IKKA 3WNOA 3CVIH 3MRRA 1HOCB 1AXSA 4DKEH 3WSQH 1T0MA 4M1DH 4HBCH 3MUHL 5LWYL 1FQ9C 4Z7WE 4K8RL 3F12A 3N1FC 4P23D 5JOPD 4OGAD 3OQ3B 5MEPB 3S3SA 2WUBL 3QDAA 2P7TA 4PV9B 4UQ2A 5HJ3A 1SBSH 4P4KA 4UQ3A 2HT2C 4EOWH 3SCMA 4X80L 3L3HB 4TSCH 4KXZI 5DUBA 1CS6A 1LD9A 5KS9B 4IRSB 4LRIA 1QBBA 3A67H 2OJEB 1IAIL 3MREA 5I8OL 4OFIA 4DN4H 4WHYH 1R6VA 4KMLB 1LK2A 3CMGA 2CJUL 2NXZD 2P8PB 1FL5B 3L3GB 1H9VA 4ZXBC 4PGBB 4MHHI 1HEZA 2DQFB 4U0RC 9CGTA 4JG0L 3UTTB 1WSST 4KPHH 4R96B 3MNVA 1FC2D 4XPAH 4PR5A 4Y4KC 2OP4L 1LDPH 5DC9B 4FABL 2DI9A 5F1IB 3ARDA 2C3XA 1HI6B 2R2HB 3OX8B 3LS4H 3LH2L 1J1PH 2HRLA 4PRHE 5KSAB 1QYGH 2FDBP 3VXUE 4JCLA 35C8L 2QSQA 3KXFB 1MHEB 4PYGA 5J56B 1KBGH 1ZK9A 1DDHB 4OUUA 2HWZH 2XN9A 5FUOL 1S7VB 2AK1H 1C7TA 4Y19E 5H37G 5IVXE 3VE0A 1MJUH 4DW2L 1IBGH 2IADB 4K8RC 3CFEB 2YK1L 1YEJL 2OXGA 2GUOB 2IPTH 4P49A 8FABB 4CJ1A 2EDFA 4RDQG 4G7YH 3CGTA 4ODSL 1RZGA 1QA9B 4R8WL 3UZQA 4JKPL 3IDJA 2VDOH 1N59A 3O9WA 4M7KL 5E00B 5GSVB 3KPLB 4NP4H 3TFKC 3MV8E 3CDFA 4CGTA 5HY9B 5DVOA 5E8DL 1E4JA 2R9HD 2W9DH 4FFYH 3ARGC 3E3QC 5C0BE 5IEHA 4FTVB 3BFOA 3BPNB 1N7ML 4M5YH 1KC5L 4P5TC 4WHYG 3MCLL 4U1LA 5DVNA 1BQSA 4G5ZL 4U1GB 4JZNB 3MYZA 4QHLB 1CDHA 1NBVL 1VFUA 1YEKH 4Z7VE 1D5BA 3RI5K 3VFGH 2MQCA 2VWEC 1AQKL 1CCZA 5D71H 4FFWC 4ZAKD 3NBNA 5A2IH 4TOYH 4F7TA 1VADB 4IRZL 3GB7B 3MGOB 3VFVA 1JE6A 1CE1H 5EU5B 4LVHC 5B3JE 2BERA 4HK0A 5GPRA 4MA8H 4GG6A 4XVTH 3BN9D 3EDDA 3GNMH 5DJDB 2ADJB 5FKAA 3INUL 4ELKB 1MRCL 4GS7B 2JJVA 4XNQA 1JPSL 1YEHH 2OL3H 2X6MA 5JW4N 2VLKE 1IC1A 3EGSB 4PJEB 4LCWD 2G9HB 3MODL 2YXMA 1FBIL 3Q5TA 5CP7B 2H26B 4PBVC 2YPKA 3MBEC 1MCPH 4LLYB 3ZE0E 4YX2H 5ANME 1FAIL 1IQWL 1UWGL 3FB6B 1MJUL 5GGVH 4X8JB 3UCRA 3RNQA 5GS2H 1GXEA 1G7LA 1XFPA 4OF6A 1PVHA 2RB8A 1T7YA 3VH8G 1RK1A 4NOBA 3GI9L 5L2JA 2CDGB 3DYPA 4P5TB 2X4OB 2Y6SC 3PWPB 1WLHA 4AEFA 3CPLB 5ALBH 5C09E 3V5DB 2MJWA 1A9EB 5JMOC 3G6AA 4ZO6A 3C5ZA 3G9VA 3IXAB 4M93B 3RVWD 2DDQL 3EJYD 2OLDA 5DUPL 4OFDA 4D3CH 3L7EA 1EH9A 4HV8A 3RGHA 1Z0MA 2DBJA 4ZFOL 3E8UL 3TCLB 1CK0H 2QSCL 3OXSB 2R69L 1W8NA 2E7CA 4HIJA 1UCTA 5E7BA 3MLZH 5D1XC 3OKDB 5CGYD 3ALXA 3BH8A 3NTCL 3WFDH 4ZD3H 5JQ6H 3D1MC 5K9JL 2P5WD 3QUMB 3H3KA 1S78C 1EGJA 3A67L 1YDPB 4EI5B 2MSPA 1PLGH 2Q87A 2ICEB 5LGJA 1TQBB 2VXVH 4JFYA 5H35A 2GCYA 4F9PC 4JHWL 3UJIH 2YWYA 5HGBA 4PJFF 2SEBB 4QWWC 1T2JA 4EKXA 2EDEA 5BO1H 1R5VB 5FF6A 4R3SB 2CO7B 2HT2D 5EU4A 3P9MB 2YMXL 5EOTA 2W59A 5J7CC 3NCJL 1SBBA 4LCIH 2F5BH 1L7TL 1UCBL 4OF0A 1T3FB 5J6GB 2BDNH 4FTVE 1DBMH 3C87A 3CVIL 4LASL 5F44A 4G42A 1C5CL 1F2XK 5AWNH 5CLTA 4G6AC 1IEAB 1KGCD 3D69A 1KG0B 1F6FB 1JHLH 4X4MA 1EVUA 2EH8L 3MLWH 4DQOH 1S7UB 1HH9B 2PYFB 4TOYL 4ZUSB 5IF0B 2IAMC 2HJLA 5ACZA 1QSFB 1TJGL 4XCYB 1WFOA 1AGBB 1I9IL 4NQVA 1J8HA 3HTLX 5IK3B 1FYHB 1MY7A 2ZG3A 3HB3D 5LQBH 5KW9L 2QBWA 1A2YB 3UXFA 1HHGA 3MLWL 1RSFA 5F7DA 2YR3A 1A1OA 5DJ0B 2Z91A 1IKNA 4ZUUA 3HC0A 1K4DB 5DQJB 3JV4A 4LEOB 4XGZB 4K94C 1I7UA 4S0TD 2JB5H 4M48H 4Z7QF 4ZUUB 2ZG1A 1A6AA 2G75A 5MENE 1OF2A 5GRJH 3GUTB 2XWJA 3R1GL 3ARTA 5KBNC 3S34L 1EUTA 2HFEB 3HMXL 1JWSB 1A7OL 4DFIA 2OTUB 3QUZD 1SY6H 1JGVL 3IU4L 3MPCA 3LDBC 2EDRA 3S7GA 2R2HA 3IDJB 2NLJA 1UJ3B 1F4YH 5ALCH 1J1XL 1T5WA 2PCPB 4CN1A 1MWAL 5FM8A 1L6ZA 5FO9B 4U6XB 3ZLQC 4LLUA 4CADA 2BVEA 1YECL 4JPIB 1DFBH 2R0ZL 4M1GH 4I0CC 1S7UA 4PRBA 4Z5RB 5D7IF 3QHZL 4NQCB 5JXAH 1T83A 2XTJE 3S96A 5IBLD 2BCKA 4OCMC 3OAZK 1UB6B 3Q5OA 1S7VA 1YMHB 1AO7D 5DDHA 1WEJH 1BD2D 4K7PY 3ZT5A 1LP9F 1K6QH 2H3NA 3GM0A 4XC1L 1I8KA 1ZANL 1WZLA 3CVHL 2ERJB 2UZIH 1ADQA 4O51A 1M7IA 1F6AA 4RIRB 2N56A 5E8PB 4NZUH 2Z92B 1WWCA 1LO2L 1Y6MR 4ZODA 2H8PA 3P9WB 5I71B 4L4TB 4OAWB 2YD6A 5J4MA 4ZPTA 2VXUH 3V8CA 1OSPL 1XF5B 2CKBB 2HA1A 4P4KB 1KULA 3ARSA 3O2WH 1FAIH 5F1IA 5IFAL 5FCUH 4QF1A 1BM3L 5EC2B 3P2TA 1ZT7B 1R0AH 4UAOC 4I2XE 4LCCB 4I48A 3VMOA 4LBEA 4PD4K 1OARH 4QYOB 3BVNB 4PUBL 3HNSH 2VLKA 4HLZG 4HXBL 1BFSA 2C4FT 5CZXD 2BOCA 3ORJA 1R24B 4IOIB 4MLSA 5IB1B 5DMKA 4NZJA 3BUYB 4DEPB 5DMIH 2AJXH 3RTQD 4XPBH 3ARZA 2J5LB 5D71L 1JMZA 1VACB 5F8QC 4MNGE 4WUUB 3D39D 5DVKA 1CICD 3C8KB 3FT2A 4B7IA 3EFFB 4L8CB 1MFEL 2AK4D 4G43A 5EOCL 4HG4J 3WFCH 4XP5H 5JUEL 5IGXL 4RA0C 4I18A 1JHLL 4WFHD 3VDAA 1A6ZA 2IJ0C 1C08A 1HKFA 4W4OA 3B6SA 4NKMB 5DURD 4I3SH 4OFKA 1G6RH 5HHOE 1SEBB 3IF1B 5I71C 5J9PB 3RWGB 1HCVA 2UWEF 3VFNB 3WFCL 1E0OB 4IMLA 2HLAB 4FZEL 4FTVD 5EA0H 5D5MB 4RRPA 2X4NA 4TTDC 5CSGA 4HAFA 5JDSA 5DJ6A 1CFQA 2DJUA 3RL1B 5DHXB 3R06A 1A4JA 1AI1L 3NZHH 1WC7B 1J0KA 1KBGL 5D9SB 4JN2A 5KZCD 3HFML 3WJJA 4LGSB 5IFJA 3BKCH 1DQMH 4NHCL 2BJML 4Y1AD 3X12B 5F96H 2IFFH 5IG7A 5HHXL 2W1NA 3D87B 3BEVA 3RKDC 2D9QB 1T22B 1D9KD 5DJDA 4C59B 1WGOA 4JHZA 1ITCA 3SGKC 1I8IB 3QQ4B 4G6JL 5IHZA 3SEPA 3RY4A 1GGBL 2VZ3A 4GXUM 2PW1B 4RQQB 4X7SL 1QYGL 3LQAL 1HILB 1I9EA 4U7SA 5DMJB 5TDOA 5HVHB 3GBML 5CP7A 1URLA 4M1GL 3LD8C 4U33A 1A3LL 2WZPD 3O3AB 1P7KB 1E4KC 3QISA 4XPFL 4OJFH 1P4BH 4NO3B 4MJIB 1CF8L 4LK4A 1JZ2A 3STLA 3ULVE 1WWWX 3UC0L 3EO0A 1YNLH 3SGEI 3ES6A 3VFSB 3M8OH 4Z18A 3PWNB 5IMKB 2UZIL 1WCBA 1HSAB 3QZWA 4KGJA 4U1SB 2NCMA 3CX5J 3WO4C 5IW6A 1E6OL 1F3DH 3ZDZF 1UM5L 1HSAA 3QZWB 2FL5B 1FFPA 3VRJA 3KPQB 4L8DA 2IAMB 1B4RA 3OPZH 4LAJH 3OAYK 2VLRA 1U93A