5D7KE

Structure of mr1-reactive mav36 tcr
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
241
structure length
241
Chain Sequence
VKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSPSGYQETQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAV36 TCR Alpha Chain
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 62
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7kE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7kE02
4U1IB 4X0KB 4N0CC 1S9XA 3CFKB 3ZL4H 1ES0B 4XPAL 4DTGH 2QADD 4Y19B 5GS3A 4JLRA 5CINH 3RGVB 4PD4K 3QPQC 3LRSB 2XKNA 4RFNC 4LKXB 5F88A 4ZUTB 1BGXH 3WLBB 3WJJC 2AK1L 4WY7L 4HWEH 3MBXH 4TRPL 4HEPG 3GMNA 3JWDC 4JRWA 1F11A 1F5WA 3UJIH 4X6EA 2LE9A 3UAJD 1MCNA 4JDTH 4PJ9A 1QO3B 4PGEB 3GO1H 1HQ4A 3L9RB 1BIIB 4P2OD 4KQ4L 4ZNEA 1LO5A 3NPZB 5F93C 2W9DH 3GSWA 1E27B 4OZIF 5EFIB 1MIMH 3N85H 1BJMA 5IMOA 3W0WB 2D9CA 4Z7VA 1VHPA 5I15L 4O58H 1ZV5A 3BEWB 4F9LA 4J3SA 3QUMH 3HG1A 5CD5C 3CLEH 1PG7L 5C0EB 2IH1B 1KJVA 3SKJL 3TT1L 3SDYL 2NXZB 2JIXB 5D6CB 1CFNB 4JR9L 1OTTC 4HK3J 5CEZH 4MJ4A 1RIUH 2CLVA 3WDHA 1ZT4B 2OX5A 4OFIA 4NOBA 2ICCA 3PIQB 2B4CH 3CMOL 5DD0H 5EO0A 1ZLVK 2EE6A 4HD9A 5EPMA 5B4MD 3MYZA 1T3FB 4WFFE 1TVBA 1MRDL 4LSTL 1S78D 4NQSA 3WD5H 3IFPB 3QXDA 1YEEL 2FL5A 3WDJA 2IEPA 2JKXA 3AS2A 12E8H 1AHWB 2FH8A 1JPFB 3VFRB 3VD9A 3MMEA 4PUBL 1TZIB 5DUBB 5AUMA 2FJGA 1NGZB 4XNQA 3ARXA 1K3ZA 2MKLC 1HIMH 3GMQA 1MFCH 5ADPL 1I9RH 4Z7QE 1FG2B 2P8LA 4FXGB 4OCXH 2JJSC 4ETQB 3ARFA 3ULUD 4EUPA 1UG9A 1UJTA 3ECBA 4X5XA 3D9AH 2FX7H 3I6LE 4N0YH 4O2CB 4WFEE 2CIIA 2GFBA 1HQRA 3MLRL 2DL9A 2JTDA 3DX9B 3EGSA 3MNVA 2PTTA 2IPKA 4HC1H 5C0CD 4JN2B 2WINB 4LVHC 1UGNA 4LPTA 1YPZB 2Y25A 3P73A 1MHHA 1NCWL 2BVEA 1YQ2A 3L95A 4NNXB 3SDAD 3RNQB 4FQXB 3VWKD 1RULH 2EDDA 5LGHL 4ZFGL 4L8DB 4UQ2A 3JV0A 3MV7D 3K0WA 4LHUD 5INCA 1G1CA 4G8FA 4U7MA 4FP8L 3P2TA 5HYFA 1WBZB 5DD6B 2X4SB 4L4TE 4B50A 4NSKB 5EU4B 5DJ8A 3P11L 4WI9A 4LSQL 3I02A 1VPOL 4XNMB 3OB0H 1T1WB 1LE9A 5JQ6H 5DMKA 4YGVB 1YEFH 1UWEH 5HHME 3VXQA 4V1DE 4Y5XA 1CL7I 2VUYA 1T1YA 3EBAA 5DD1H 4I3GA 3PL6D 3W9DA 1FNSL 3DURA 5DJCB 2R0LH 4FTVD 3VRIB 1QLFB 4NO0B 2GQHA 5GGTL 1WSST 1P7QA 3AU1A 5IBTL 1P1ZB 3GBNH 1LP9E 4U2ZA 5A2LH 1PX3A 3TCXA 3FOLA 3UP1A 5J1TC 1BFVH 1CTNA 1JTOA 4N0UA 1JFQH 1R3JA 1PYWA 4FNLL 1HXYB 1DBBH 4Z0BL 2LU4A 5IIEB 2IAMB 4TTGA 3MACH 5I76A 3BE1L 3BUYB 4GRWB 2VZ1A 1JF1A 4JAMB 4RGNB 4M62H 1UXWA 4KVNH 1F6AB 4PRPE 4K55A 1ZXQA 5AZEH 4TTDC 1S5IL 1QFWL 4IRJD 3FO9B 3LAFA 4C83A 1B4JH 3MJ7A 1NCBH 3VFPA 4Y2DB 1G7MA 5E03A 4XPFL 2V7HA 3NCBB 1OSPL 5D7IF 5IKCA 3WKMH 2X70A 3ZTJH 4JM2D 3D6GA 1UZ6E 5CAYB 4JGUA 4RISL 1VDGA 1CT8A 1QBMH 4O00A 4HPOL 4Y5YA 2V5MA 3CVHA 1CR9H 1Q38A 2CRZA 3DNKA 2CLZA 3P30L 4QRRB 3LIZH 5H35B 4MJIB 3FN0H 4AL8H 2A9NL 4JRXB 4M3KB 4G6AD 3BSZL 4HUWB 3EOBA 4U0QB 4MX7B 1OD7A 4OF7A 5DEGB 5JOFA 1QRND 4JQXC 5BOZG 1X7QB 1W0VA 4JB9H 4J12A 3L5HA 1ZT7A 1WTLA 4KJQC 4JDVB 5I19L 4ETYA 1K4CB 5F89B 3QULA 4OQ1A 4LLQA 1T7XA 1DEDA 1TNMA 2XRAL 3MV9B 3QCUH 4I77L 4NGHH 5HJ3B 2PYEE 4CVXA 1PQZA 3KPQA 4Q6YA 1GOHA 4H0IA 2XICA 3PGFL 2ZSWB 5F9DC 4Q9QL 3B8SA 1F13A 2ARWA 1MCPH 1CXFA 1FAIH 4MXVF 4WTZA 5IVZB 2BVPB 4W4OC 1EUUA 4DGYH 2VH5L 4PTUB 3MCG1 1INQB 4OFPA 1YY9C 5JHLL 3KVQA 1RU9L 1V7ML 1MHPL 2UZIL 5TE6H 1CQYA 2DQFB 2WUCL 4EOWL 5FM4A 4MSWA 1JRHH 1DQJB 2P8PA 5E2VH 1IZKA 4RQQA 3IYLW 3T2PA 4Q9BA 4Y2DC 1WAAA 3NIDF 4LIQH 5BRZE 2RJMA 3HNTH 4MB4A 4HIEA 3KJ6H 3EO9L 4PJHA 5C7XL 1IC1A 3ULVC 4MZ3A 4OI7A 1YNTA 1TETL 3U46B 4HWBA 4WNQA 3GJFB 4HKJA 5ECJE 2YUVA 5D93C 3VXUB 4NRYB 4HKBB 3V4PH 5F9JA 2VDMH 1MCLA 3MFFB 1Q94B 2OL3L 1H3VA 5IR1A 3KPLA 3BI9X 4I0PD 4YPJA 2C1OA 4WI2A 1F00I 1SBSL 4ZXBA 4G43B 2NXYB 2D03H 2W60B 3KGRA 1IJ9A 4QOKA 4CUCA 4WFGD 2J4WH 4NZUH 3QPXH 1J10A 1BBJB 5JMOC 2YSSA 4EN3B 3O9WD 1LDPH 4LCWD 4LASL 4XB7A 3MJ6A 1C16B 1YUHA 2RCSH 5FUOH 4YX2L 3WO4B 5BW7A 1R3KA 2R8SL 1LO4H 4ENED 3MOQA 1R3IL 5IBUG 5HGDB 4P4KD 3DO3A 3EDJA 4JFFE 3FB8A 2WP3O 1TJIH 1NAMA 4NNPL 3DVFA 3BAEL 1FVDB 3DBXA 1FE8H 3ETBF 4P59H 5IEKB 1KACB 3OSKA 2NLJB 4PRHA 1MELA 3RU8H 4AEHH 1XGUA 4BJLA 3L5WB 4I3SH 2UZYB 3IKKA 25C8L 1YEIH 2F58L 1BZQK 3N0PB 1MOEA 3QHZL 4KKNA 2R29L 5IB2A 3VA6A 4WFHE 4GSDH 5F3BA 3H9SD 1S9XB 4Q0XL 1GGBH 4L4VE 2MHAA 3CGTA 1WWWX 4JLRB 2BSED 4GS7B 2XKNB 5F88B 2UVEA 3KR3L 2CKBB 3UXFA 2CJUH 2ADFH 4KTEH 3GMNB 5SV3A 2FIKA 1WQVT 5BV7H 4YBLC 1F11B 4DOHB 4X6EB 3OPZH 5IFAL 2DS4A 3T4YA 4PJ9B 3H3KA 5CP3A 1EZVX 1HQ4B 1N4XL 4G3YL 1CGYA 3OKNA 1QSVA 2WQRA 2NXYC 1LK2A 3O2VL 1LO5B 4E41E 3WFBH 2VLKB 3GSWB 1A7QH 2BNQA 2AXJA 5IMOB 1ORSA 3QJFA 4OLEA 4Z7VB 2K7PA 4Z7WF 4P2QA 4XC1H 2I60L 3HG1B 5FUZH 2GAZA 1JGVL 3DTXA 2DIAA 5FYLL 3L6FA 1MAMH 4M8VA 1KJVB 1IGML 4XVJH 1JN6A 4RAVA 2AV1A 1KCUL 2NY2B 3AAZA 2CLVB 4JO3H 1AXSA 4RZCA 3WXVH 4OQTH 1A7RL 2LVEA 2Q8BH 5AWNH 2B8OT 1RZFL 4Y19E 1B88A 2ORBH 5EO0B 5EPMB 1A2YA 4NC2B 1TVBB 2XPGA 2J1KA 5HHNA 1OSZA 4NQSB 2CMRL 3ARWA 3QXDB 2FL5B 2VZTA 1WZMA 1QD0A 1QFPA 3MMEB 1VEPA 1LILA 5AUMB 2FJGB 1G0XA 3WSQH 4XNQB 4N5EC 5EBGA 3W11C 4YE4H 2HA1A 2F19H 4RWYH 3GMQB 1D9KA 1NLDH 1FZMA 4R90L 5JZ7C 2HTKD 2VSCA 1HSAA 2VR5A 4Y4FD 4PJ9C 5D4QA 3W0WE 3ARFB 1HEZA 3QIWD 4OCRH 4EUPB 1FRGL 1SHMA 3ECBB 4X5XB 1T7VA 2GFBB 1HQRB 4ZAKA 3DUUA 1GL4B 4XNXH 5T5NF 1OCWL 4Y16D 1JGEA 4PJIF 3EGSB 1JPSL 3MNVB 2PTTB 3U7WH 4P9HC 2IPKB 2NY0B 2X2YA 4B7LA 3KYKL 3P73B 5DK2A 4HPYL 1MHHB 1CD8A 4F9LC 3L95B 4YUEH 2VXQH 4QF1A 1L9NA 1BOGA 3ILQD 3TJHD 2VDPL 3U48A 2O93L 1GGTA 1K6QL 2NY2C 5JR1H 4UQ2B 1C5BH 3ZDYE 5INCB 4G8FB 2ZCHH 4NUGH 1WIUA 2FLRT 3NCEB 1JPST 5DJ8B 4TQEL 1QEWA 4OF8A 2VXSL 4NT6A 5D8JH 3I02B 1LE9B 3E6FA 3W2DL 2VLRA 1NGQH 5DMKB 2VOTA 3QUMA 3MRIA 3VXQB 2F8VA 4RRPG 3L3IA 5LWYL 4Y5XB 5HDBF 1T1YB 2DYPA 3B9KD 1T83A 2Z8WC 4H1LG 1HZHL 2Z9TA 3JV6A 3W9DB 3DURB 1I1RA 4U6VH 4JO2L 1OTSC 3EHBD 4F33A 2XKSA 1XF5B 4R26H 5CJBA 4R4FL 4K7FA 2VABA 1P7QB 3AU1B 4MVBC 5FYLD 5BZWA 3VRLE 3FOLB 5IWLA 5HYJD 1GC1L 4IDJH 1EO7A 5KVEH 4N0UB 1EEQA 1NKOA 1YNKL 1R3JB 1PYWB 3RX7A 1C12A 3E3QC 1YPZE 3U2SA 5FV2A 4UDTA 3BIAX 4LL9A 1NBZA 5I76B 1GYAA 4LCIH 1JF1B 3GHBH 2NX5A 1AC0A 3OG6B 4KJYA 1A7OL 5HD8D 1UXWB 5E5UB 3ULUF 1NJ9A 4FQ2L 2EIDA 5FO8A 4M6AA 4OT1L 2V17H 4C83B 5IMKA 3IAPA 3MJ7B 4XPBL 2E9JA 3VFPB 1G7MB 2V7HB 4HUVA 3AGVA 1QTYT 4R6UA 5IKCB 3IXAA 5DS8A 1GHFL 2X70B 2ZUUA 4UTBL 4WEMB 5FFLA 4QY8A 4Y1AD 1T89A 3GSUA 4EQ3A 1CT8B 1U8KA 3QWRA 4JFDD 4Y5YB 1JYWA 5AZ2L 3CVHB 3VGHA 1RUKL 3SGDH 3CMGA 4F3FA 3VGEA 2C3HA 1NAKL 2CLZB 4HC1A 4RMWA 2OQJA 5C9JA 1UACH 2XZCL 3E2HB 1X3DA 2QR0A 2DM4A 3EOBB 3TPUA 3WO3B 4FZEL 4M00A 5JOFB 4PGDA 5E5RB 5J89A 1W0VB 3LEVL 3ESUF 1ZT7B 4U49A 3FJTA 1GZQA 1QFUL 3NZHH 1FBIL 1A6UH 5KSAD 3GFUA 2OXGA 3BKYL 3RVVC 3QULB 3L1OL 4LLQB 1NGXA 2EH8L 3FRPG 1IBGH 2R23A 4GRWE 1RURL 3BT2H 2UYLA 4RGNE 4CVXB 1PQZB 1CLOH 2CR3A 3KPQB 3MXWH 4DAGH 3RVUD 2IQ9H 5K9QI 5DVKA 4LSRL 1X5GA 2HFEA 1JI2A 3DVGA 3L5XH 2ICES 4LSUH 1JF5A 5F72S 3FQTA 2X1WL 2VZOA 4GH7B 4R3SA 4LDOB 1B3JA 1EJOL 5FUCC 4LEXL 4LQ1A 2O5YH 2LQRA 5JA9A 1CLCA 4MSWB 5LBSL 2P8PB 3MRDA 4X7EC 4RQQB 3ULVE 2L4OA 3DSFL 1KPVA 1MFAL 3RL1A 5DR5H 4EJ1C 1FDLL 4QRRE 4TVPD 4MJIE 3RY4A 4FMFA 4HIEB 4PJHB 3DGGA 4K8RL 4JRXE 1YNTB 3OAZK 4Y5YC 4WNQB 1ADQL 1I9IH 4UV7L 2WZPD 1KIUA 4YDKL 4HKJB 4JM2F 4FG6D 1JNHA 4PRNA 5F9JB 3DHMA 4XNYH 5A1AA 3CK0H 3J7HA 1E4KA 2OMNA 3DMMA 5TE7H 1QFWM 3FONA 2QQLL 5IR1B 3KPLB 5J11C 3MV9E 2C1OB 2F8OA 3G6DH 4ZXBB 3IJSA 3MRLA 4QOKB 5FGSA 3VXSA 1CGXA 1A0QL 3ZMRA 3QP3A 2YSSB 3EDEA 2GSGA 1KN2H 4LVNB 3TESA 4K3DH 1YUHB 4HEME 1QSEA 4G5ZL 1R3KB 4UIKH 4MCZA 4N9GA 5GSVA 5ALBH 3AROA 1S3KL 1WT5C 5EO9A 4C57C 1F3DJ 3FB8B 4YFLI 1NAMB 2F5AH 2O61A 3DBXB 1JNNL 2VDRH 5T3XL 3SDAA 4JFXA 4DGVH 1LEKA 4PRHB 1A14H 4OCYH 1XGUB 1INDH 1KENH 4NHCL 2DJUA 2EYTB 1BEYH 3A67L 2CRMA 4FMKA 4JY5H 5IB2B 5FGBA 5BO1H 5AG8A 5F3BB 5E9DD 4XNUL 2DD8L 3VXUE 2MHAB 5F1SA 2OR7A 4K71B 3S37H 3RTQD 3ZKMC 2VTFA 2XQBL 5H37H 4TN9A 4I9WD 2J6EH 2UY6A 4KZEL 1J1XH 1QHOA 1PG7W 4MXQC 2IBZX 2FIKB 1G1YA 3LH2H 3FAWA 4FOMA 3T4YB 2DQUH 3NCYS 2XZQL 4PD4J 3LPGA 3OKNB 3PDGA 5E2WH 1LK2B 1UB5A 1Q9LA 1CZ8H 5I9QB 2MQ3A 4M7KL 4EQ2A 4ZFOA 3RWEA 2BNQB 3C09B 4UNVA 2EDYA 1ORSB 5I1KH 3HPJA 5LQBH 2BVYA 1KTLA 1CXHA 2C3GA 1A5FL 2NY7L 3TO4D 4IMLA 4P2QB 2A9MH 4I5BA 1WZ1H 2GAZB 3K2UH 2C4FU 3CSYA 3QRGL 3L6FB 2F54D 3FMGH 1MCHA 1RJLA 4UBDD 4K8RD 1JN6B 1YMHA 3VJ6A 4RAVB 5D5MA 1YEJH 4Z78A 2AV1B 3BEVA 3D3VA 5CILL 1RZ7H 1OAQL 3AAZB 3Q5TA 1AXSB 3AMKA 2JK5A 3O3AA 5E6YA 2ZSVA 3ZO0A 3H42H 4XP5H 1KPRA 5DMIH 3Q6GH 1FZJA 2VISA 4XZUA 1L0YA 4CMHB 4K3JL 2ZJSH 5C07D 5HI4D 1A2YB 3TN0C 3TPKA 2XPGB 5HHNB 1OSZB 4HCRL 4BFEA 1S7SA 4U3CA 3MLVH 2A6IA 2HLFC 4JPKH 4DKEH 4DOHE 3QISA 1F58H 4J4PD 1B0RA 5EBMA 7CGTA 1FJ1A 1J1OH 3VXMA 5DURB 2DLIA 1MRFH 3O2WH 5FKAA 4F7EA 3KDMA 4ZNEE 1D9KB 1FZMB 3FO0H 2HFGH 4CNIA 2VLKE 4BZ2H 4W81A 1HSAB 1XAUA 4Z7VE 1HEZB 4XBEH 1T0PB 5L8LB 1ZLWH 5KJRL 5T3XD 3ZT5A 4OGZA 1JIBA 2QQKH 3HG1E 4ZAKB 3DUUB 4LGPB 4UT7L 1OAYL 3C09C 4J2XA 1JGEB 5FYKE 4Q74A 3ZDXF 3KYAA 1KGCE 2VDLH 4GMTH 5DK2B 4NZTL 3BZEA 2OI9C 1CVSC 3VFGH 1VENA 5C08D 1MJ7H 4QF1B 4JM4L 1BOGB 4Z7NF 2JF1A 1IKNC 1RUMH 4UZGA 2HT2D 4ALAL 4V2BA 3MV11 2CDFA 5B3JF 2VITA 5KVDL 2GI7A 3WUWG 1EO8L 1FAKT 4S1RL 2W9EH 4U7KA 1QEWB 4UILL 5HBBA 5BQ7A 4NT6B 1KYOK 3V0AC 4OKDA 3E6FB 3TGXA 2VLRB 1R0AH 5MENA 3QIBC 2GTZA 2FX9L 3QUMB 1OM3L 3MRIB 5GS0C 3L3IB 4FQLH 1KIRA 2DYPB 3JV6B 5DD5L 2HKFH 4DEPB 1CG9A 4MQ7A 2KQMA 4S1SL 3SCMC 4F33B 3VI4F 1GVIA 3R0NA 5FV1L 4K7FB 2VABB 3INUL 1BLNA 5MEPA 4OQTA 3SE3A 1YEKL 4MA7L 5CHNA 3SDDD 2AJXL 1NKRA 1TVHA 5DRZA 5BZWB 1DBAL 4JHAH 1YEDA 2VUOA 5SV4A 1A6WH 3SO5A 1C12B 2JJTA 1H3TA 3U2SB 3ZYJA 4UDTB 1NBZB 3O6FD 2E3VA 4W6WB 4E42A 2NX5B 2J8HA 4KJYB 4HBCH 1NJ9B 1I9JL 5EZOH 5FO8B 4A2MA 1ERNA 3BUTA 1KB5H 3I3EA 2VAJA 4ZYKA 5IMKB 3DYOA 2EDXA 4FFYH 4D9QD 4HUVB 2BSRB 3IXAB 2O5XL 5DJ2A 2XA3A 4QRUA 4BQ9A 4XHJC 4QY8B 5SX5H 1ZAGA 3GSUB 1U8KB 4GUPA 5K93A 5IB1A 2OK0H 3HHRB 3MLYL 1AR2A 3ZZ1A 5IK3A 4WI8A 3ZT7A 3EO1A 1J05A 4F3FB 1IGJA 3MOAH 1I3RA 1OD9A 1QYGH 1NL0L 1MCFA 2OQJB 5C9JB 2N7BA 4KH2A 5J1AA 3RVWC 4YDJA 2QR0B 3TPUB 4OIIH 4PGDB 1P7KA 4JQIH 2EDNA 3AS1A 5SWSD 1GZQB 3THML 4XPTL 4CU8A 4N0UE 3K4AA 2WBWB 4GMSL 2OLDA 1NGXB 1HKLL 1XGPA 3SKNA 4KK6D 2YA0A 2B4CC 2R23B 3HI5H 2UYLB 5EU6A 1AQDA 5IWLC 3BDBA 3MLZH 1S7TA 2VIRA 5LXGL 5FHBL 2HFEB 3DVGB 3MJ9L 5D70L 3WYRA 1U8HA 4YWGH 3FQTB 4HWUA 3VXNA 4P2RD 4P4RA 3STZA 2HJFA 4R3SB 4HKZA 3D69A 2IMNA 5I74B 5L9DH 1IC5L 4RNRA 5D9SA 3MRDB 3HNVH 3QQNA 1NCDH 1KPVB 1H15A 1NEZG 5GRUH 4M1GH 3RL1B 3U7AA 4Y4KD 2FD6H 4XXDA 5L2KA 1KBGL 5I16A 1NMAL 5J13C 5C0DA 4LPWA 1T89C 3DGGB 4BFGA 4HLZG 1Z2KA 2EKSA 1EHAA 1OAZH 3IXTA 2EE3A 4FQQA 5FYKU 3VXRD 2QEJA 3GI9L 1JNHB 4PRNB 4QHKJ 1I4FA 1JZ3A 3C60D 3VG9B 4PJGF 7FABL 4K2UH 4Q9CA 2QADC 3AY4A 3V52L 1A9EA 1VGEL 2ESVD 1ZT1A 1N8ZA 4DGIH 2ZOLA 3DMMB 5CD3A 3FONB 3ARZA 4LU5H 4HH9A 1RZJL 1BX2A 3IJSB 3MRLB 5IM7A 3I75A 3VXSB 1W72L 2GSGB 4KY1L 1HNFA 4WWKD 5JHDD 1BHGA 4GKSA 3U0WH 1U8QA 4X80H 4BFBD 2A2QT 1INEH 1PY4A 1VESA 4L8SC 5DWUH 5MEOA 1F42A 1QSEB 4FA8A 4P2OC 5GSVB 4MCZB 4N9GB 3H2WA 4NM4L 3MR9A 1IKFL 3QIUA 2C3WA 5HHQA 4JVWA 5EO9B 4IRSD 1KEMH 5GJTL 4PJ5D 5CWSA 2O61B 1WAAE 5IHZA 5EA0L 1N0LA 2Q3AA 3SDAB 2FGWH 4JFXB 2WWKT 4MAUH 5KVGH 1LEKB 4P46D 3NFPA 5KSBA 4PJHE 2R2EA 3TP4A 4ZUUA 3MUGA 4GLRH 1BQLH 3BWUC 3ZDZE 1OPGL 1F4XH 3MBED 2LABA 4DW2L 5H2BA 1LHZA 1HH9A 5EOCL 1Z0NA 1FORL 1TENA 3CDFA 1SMAA 4XP9L 2D31A 4Z5RA 3TZVD 5E2UH 1OGAA 1A7BA 2PR4L 4ZFFA 4YHML 1CE1L 2DF3A 4QOKE 3VE0B 1G6RL 1GGUA 1IFHL 4FQIH 5ADOL 5ETUA 5JNYA 4KHXL 1NSNH 5I1HH 2OTUA 2CH8A 4PRDA 1N5YL 4XX1E 3EFFA 3RIAF 3GI8H 2YEZA 1UB5B 4PJFA 1Q9LB 2UY7A 2EDJA 4ZFOB 4KVCL 2FEEL 2G9HA 4JG1L 4QTHA 3HC4H 3RWEB 1X5ZA 5DZLA 5KG9A 2QLVB 1IMHC 4IS6A 1XF2A 3HPJB 3SBWC 1KTLB 3O3UN 3ULUC 4X7SL 4IMLB 3VWJA 4I5BB 1I1AD 3ARBD 1UKQA 3TT3H 5F7HA 3BDYL 4HWZA 3CSYB 3JXAA 3QEGL 3V6FA 5D2LA 4O2FA 1RJLB 1YMHB 3DI2B 4PRHE 3VJ6B 5D5MB 5DLML 1AE6H 3NACH 4Z78B 3BEVB 3D3VB 1EEZA 5HVHC 1DBKL 1A9BA 2ZZUT 2E7LC 1I7TA 5DK3A 3SDAC 3CXHK 2JK5B 3O3AB 4OUUA 2YPLA 2ZSVB 2FBOJ 1KPRB 4IHOA 4YXHL 1FZJB 2VISB 3BKJL 3ZYZA 4GFTB 1GRWA 2X7LA 3O4LA 2EZ0C 4L3EA 2GK0A 2CD0A 2EDFA 5E08L 5FGBC 4BZ1H 43C9A 4NWUH 1S7SB 4MNQD 1U41A 2A6IB 3EYVA 2A38A 3AS3A 1FO0A 1OP3H 3DXAD 1B0RB 1OLLA 3OB8A 5EIIA 4GKNA 1FJ1B 3VXMB 3SQOL 2BERA 4EIGB 5FKAB 1LDSA 4F7EB 1MCCA 3BMWA 3HZKA 3KDMB 1AH1A 5I18H 3TV3L 1QR4A 2XWJA 1XF4A 3UTPE 4CNIB 3PL6C 5B39A 1NBYA 2BNQE 1CXKA 4OJFL 1OAXH 3NIFE 4LVOB 1YY8A 4P2QE 4PJBA 2BNRA 1CCZA 3WLWD 1FSKC 4U4BA 2J6EA 2EEBA 1WLHA 2CSPA 4HJJH 5JIHA 1H5BA 1G9ML 1UXSA 3BZEB 3P9LA 5D2NA 5ID0A 5BV7B 3E8UL 2XG4A 2E6QA 4Z8FH 4CMMA 1OARH 2MJWA 2R69L 1GIGH 2GITA 4N1EA 3BZFA 3SE8H 2F8XC 3NPSB 1Y6MR 2CDFB 2VITB 4U7SA 3B2VL 4IRJC 5GGSA 4XMPL 1DQDH 5BQ7B 1MFBL 4KKCD 4YQXL 2Q7NA 4JM2C 4XP4H 5MENB 2GTZB 1EFXD 3G9AB 3I50L 4KI5E 4LNRA 5GS2H 1KIRB 1UC6A 3L3OA 5E6IA 5I6XB 5F7WC 3GRWL 4Z7UF 1TJGL 3G9VA 4MQ7B 1WCQA 4L5FL 1DDHA 5E8OA 4PLNC 1KCRL 3G5ZA 1BLNB 5MEPB 1MWAL 2P5EA 5CHNB 4G6AC 4LRIC 1VFMA 2B2XL 1IGIH 1TVHB 4JHBA 5DRZB 3ZKSD 1ZA3A 1JF6A 1YEDB 4XPAH 5DQDL 5IW3A 2C26A 5FA4A 4F58L 1ZVYA 1IRAY 3T0VA 5D1QA 2AK1H 4WY7H 4E42B 5ITBL 3X3GL 3RBSA 3C5ZA 4M9PA 1KCSL 5DFVD 5ITFA 2N4IA 1E6JH 4GXUN 3JSSA 4XCFL 32C2A 5DK0A 3AM8A 1ZHKA 2AW2A 4WFFD 3O81A 4ZYKB 1Q9OA 3N1PC 4KQ4H 5C0AA 4X4YA 3GBMH 4NP4L 5DJ2B 5HGHA 4KK5D 1QKZH 3NPSC 4QRUB 4OM1H 4OB5L 3DVIA 2VLRE 4N8PA 2BRRL 3VDCA 4M1CD 5D96B 4GUPB 3U82B 4GRLA 3GB7A 5I15H 2Q8AL 5IB1B 1LO0L 5A3ID 2NY5C 5IK3B 3EO1B 1J05B 4DKDC 1IGJB 4AMKL 3NBNA 1I3RB 2VQUA 1Z9MA 4PJEF 1PG7H 4NPYA 4IMKC 3SKJH 3SDYH 5J1AB 1AO7A 3GMLA 4YDJB 2E7HA 2KH2B 1ZANL 1TITA 4X9GA 2APTA 1P7KB 2XTJB 3I6LD 4U1NA 3NOIA 4WFED 1X4ZA 1I1CA 2X44D 3CMOH 1EFQA 4FQPA 3SE3C 1XGRA 1XGPB 3SKNB 1AY1L 4PPTA 2AJUL 1MRDH 2PKDA 4LSTH 4GKZA 3NCYP 5EU6B 2LTQC 2NX5E 1AQDB 3PDDA 2AJVH 1S7TB 3LS4H 3MLXL 2VIRB 2DWEA 3MQIA 3CFJA 1U8MA 1N2RA 4UOW0 4PUBH 4MQSB 3EYOA 1U8HB 1MFEH 3O9WC 4YO0A 3VXNB 4P4RB 4Y4HA 2HJFB 3HB3D 3STZB 3QEUA 4L4TD 5ADPH 5EUOF 4HKZB 3D69B 4ENEC 4MDIA 3ME0A 4RNRB 5D9SB 3NCFB 3ZE2E 3WS6A 5DVMA 5HYSG 4P4KC 4FFWC 4XP1L 2AQ1A 5HHMD 4X6DF 1H15B 4NN5B 1PEZA 4V1DD 3LKRA 5F7EH 1DLFL 4XXDB 5L2KB 4FFVC 5I16B 2IPUK 4PGJA 2VXVL 5C0DB 4ZUVA 5EZIH 1T2QH 1P6FA 3W39A 3MLTA 2EKSB 4PJ7F 5AD0A 5K59F 4M7ZB 3IXTB 4FQQB 1RIHL 3DWTA 3C6LD 3JWOL 1I4FB 5I8KL 2YR3A 5K9JL 1KB5A 3P4LA 1A9EB 3GIZL 4BQ8A 1ZT1B 5TDPA 2ZOLB 5ALCL 5CD3B 1UADC 1BPVA 4OGYL 3O8XD 4FP8H 5GZOD 1BX2B 4U6HA 5IM7B 3V6OA 5DVOA 3I75B 1A1OA 4DFIA 4PRPD 4OD3H 3J8F7 5F21B 4UB0L 3ROOA 4GKSB 1CD0A 1MSPA 1U8QB 2Y07L 4LCCA 5MEOB 4RIRA 1FNSH 2JB6A 3MR9B 4GJTB 4KRPB 3QIUB 2VDQL 1Y18A 1AC6A 5HHQB 5T3ZH 4I1NB 5C3LD 4DFHA 5CWSB 5GGTH 4OZ4A 2OYPA 4DN4L 2R0ZL 5IHZB 2WIMA 5I30L 2A1WL 1HHKA 3NFPB 5KSBB 4I48A 3RIFK 1J0HA 2R2EB 1E28A 4ZUUB 3MUGB 4MLIA 4BSVA 2VDKL 3BE1H 3B9AA 3GSNH 4HIIA 1S9WA 1EEUA 4CDHA 2Y72A 2WLYA 4ISVA 1HH9B 3IDJA 3JWDL 4L9LC 4J3WA 1I7RA 1QFWH 3ULSA 2D31B 2EXYC 4Z5RB 4HIJA 1OGAB 1IL1A 3LV3A 4CN1A 1OL0A 5CJQL 4ZFFB 3FB5A 2PYED 3HR6A 2X89A 5ETUB 3VXSE 5JNYB 2BOCA 2OTUB 4FN0A 4PRDB 3REWA 4J3VA 2PW1A 3HUJF 4D3CL 2JCCA 3T0EA 2BSTA 3EFFB 4HPOH 1YMMA 2YEZB 3TWCH 4PJFB 3TNNA 1QSEE 3RZCD 3NFSL 2G9HB 4QTHB 3VD3A 2IBGA 4QRPA 5KG9B 5J12C 3GJFK 4IS6B 1T1ZA 3RL2A 1XF2B 2HTKC 1X6LA 2A9NH 1HHHA 4KK8D 4LSSH 4IDLA 3BSZH 5E4EC 4DN3H 3FT3A 3VWJB 4R9HA 1HHIA 4HWZB 3V6FB 1O5DT 1F4WL 5D2LB 5BRZD 4O2FB 1DLHA 3SKOA 1GAFL 4Y16C 2IBZY 5I19H 3PXHA 4NCDA 4YHKH 3KHQA 4XNZB 4XVSL 3GJEA 3LS5L 1EEZB 1EPFA 4EBQL 1A9BB 1I7TB 1BD2A 5HSFA 3CZFA 4PJAA 5EOCJ 4OUUB 4XBGA 2YPLB 1TVDA 3MLSL 1S8DA 2BY1A 3ILQC 4Q9QH 4IHOB 4OM0L 1YNLL 3TJHC 2X7LB 1T7ZA 3O4LB 4L3EB 2GK0B 4R4NC 3V9FA 3D2UA 3LB6D 3CU7A 43C9B 3EOAA 2VH5H 2AERT 5HHPA 1UVQA 3EYVB 4H5SA 1U2CA 4EI5D 1FO0B 2Y06H 5C0NC 2XZAL 5JHLH 1RU9H 4D8PA 4PJDF 4EOWH 2WUCH 3NVQA 5EIIB 4GKNB 3DVNA 4LIQE 1KTDA 4GAJL 3HZKB 4URTB 5M95B 3B9KC 2XWJB 4MB3A 1XF4B 3MA9L 4QXGL 1F3DH 5B39B 1NBYB 4YEFA 4UMGA 3RBGA 3EHBC 1ODAA 1XEDA 3EO9H 5C7XH 2FBJL 1YY8B 4JFFD 1TETH 4C56A 4PJBB 2CQVA 5M7QA 2BNRB 3BPNB 3WE6A 2IGFL 3KG5A 3NTCH 2EDKA 5D5ME 4WHTA 1H5BB 3F7VA 3D3VE 1UXSB 4JFEA 3P9LB 3IDGA 5D2NB 3VWJC 3QPQD 4C54A 5ID0B 3FRUA 2OL3H 4Z95L 4JFYA 4KK9D 4WFHD 4M6ML 3H0TA 3GIVA 4CMMB 2AXGA 4L4VD 4HQQL 2BFVL 5HD8C 2GITB 3BZFB 4NQEA 5I17A 3C6SA 4K3GA 4WWID 1JZ2A 1MCQA 4BQBA 5E99L 4LBEA 5GGSB 5EU7E 3QB7C 1MCBA 1G7PA 3RKPA 4YX2H 3VMNA 1N6UA 3UX9B 1J1PL 3PWUB 4TVSa 1R3IH 2N7AA 1J11A 4ZUSA 4E9LA 3DV4A 3VXME 1V3LA 1V7NH 5HI3C 2B5IC 4LNRB 4P2CG 3L3OB 5E6IB 3ARGD 4JJHA 2HAZA 3U9UA 5BMFH 3LEXA 4E41D 5I75C 2PCPB 1M7DA 1DDHB 5E8OB 1MNUL 3G5ZB 1KYOJ 4O4YL 3S35X 3O11A 1A3LL 25C8H 2P5EB 4XXCA 2F58H 2X1QA 3F62A 4HZAA 3QHZH 1OTTD 2R29H 3VGBA 1ZA3B 3KNBA 1HNGA 2IFFL 4Q0XH 3IAQA 4GXVL 3MODL 5FA4B 4JVPA 3ARPA 2G5BA 2J5LC 4F7CA 4G8EA 3MRFA 4J8RA 1KXVC 5FYJH 2QSTA 5D1QB 1G0DA 3SGJC 3C5ZB 5ITFB 3G6JA 3H7BA 1JHKH 3IS0X 1ZVHA 3RVUC 4LHJB 2RR3A 2JJWA 5IFAH 32C2B 2W07A 4Y19D 5DK0B 5DUMH 3RGVD 1RZKL 1ZHKB 2PETA 1KLUA 2BJML 1N4XH 4G3YH 1Q9OB 1RMFL 1I3VA 4IRSA 4GXUM 4UU9A 5C0AB 4X4YB 3EW3B 1QRKA 4YHZL 5HGHB 4OBSA 4HXBL 3FKUS 1MHCA 1RJCA 5MENE 2OZ4L 4WI4A 4P46A 3NGBC 3GB7B 4GRLB 1J9CT 4JO4L 1CDHA 4NJ9L 3HR5A 3RWIA 3V7AG 2I60H 1JGVH 3T1WA 5EOQL 1H8OA 3IFOA 4NPYB 2YD2A 5FYLH 3OXSA 4YBQC 1IGMH 3EYUL 2BY0A 1AO7B 2FHBA 3W0WD 3GMLB 2VN4A 1FPTL 3FN9A 3T77A 2YPKA 5E6IC 4U1NB 3M17A 2L7UA 2J88H 1A7RH 4NN6C 1GC1C 5EUKA 2AK4A 5FAAA 4FG6C 3ZKND 3BP5A 1RK1A 2NXZD 1LK3L 1XGRB 2JIXD 4NO2A 4U33A 4NUJA 3HKFA 1PKOA 2IPUG 2CMRH 4GKZB 2DBLL 2LU3A 1T04A 3K4ZA 3ORJA 4PY7A 3M8OL 2DWEB 3CFJB 4G6KL 1U8MB 1N2RB 4JANA 2C4FT 4DKFL 5EG6C 1RIVL 3EYOB 3ZKXB 5D1QC 1EHXA 4YO0B 5T1MA 3IFLL 3UTSA 3VXOA 1A7NL 4ONFL 4Y4HB 3QEUB 2L0DA 4M7JL 1KN4L 1UWXK 4R90H 1KSRA 1PLGH 4MDIB 4OLVL 1LEIA 1K5NA 1AD9A 4F80A 3IS1X 3JTTA 5JXAH 2X9YA 1FNFA 2A83A 3UJTL 3LKRB 4K9EL 3ULVL 1FLRL 1WC7A 2VC2H 3RJDA 1OCWH 4ZUVB 1MQKH 4M7LH 1P4IL 1JHLL 3L3DA 3QFJA 4GRLC 3W39B 3KYKH 2V6HA 4HPYH 3MLTB 4KC3B 5AD0B 2XTJE 3CFEB 1SJEB 3S3PA 4UIMA 1EMTL 1KB5B 1K6QH 5TDPB 2VLME 3MGAA 2P42B 4TTDD 1KB9K 4Z7QF 5CKAA 3H9HA 2XXMB 2OBGA 5EU6E 1IC7H 5C86A 1FGVL 4FQXD 4U6HB 2CUMA 4OSUL 2FSEA 1A1OB 2VXSH 3PWPE 3V79C 3QXVA 3W2DH 3ROOB 1NANH 1F02I 4LCCB 1Q9WA 3QQ4A 2YRLA 5DMGC 4RIRB 1HZHH 2JB6B 4H1LH 5EU5A 1Y18B 5MERA 4X98A 1N26A 3T3ME 2Z31A 2AVGA 2IG2H 4OZ4B 4I3RL 4JDZA 1WUNT 3VU2A 1EHLL 4ODVH 5L2KE 4NRZA 1DFBL 5KSVA 4X7FC 5TF0A 1HHKB 4G7YH 4NO0D 4UBDC 4I48B 4PLKC 2O5ZL 3CU1A 3MCLL 3GHEL 1E28B 5KN5A 2Z91A 4BSVB 2EDHA 3DYPA 4HIIB 1S9WB 2JJVA 2HT4C 2P7TA 2ERJB 4RA0C 4FQ2H 5DJAA 4ISVB 3IDJB 3MRCA 3QHTC 4OT1H 3ULSB 4HIJB 2IAMD 3UJJH 1IL1B 4XPBH 3LV3B 5FO9A 4RGND 1VEOA 3FB5B 1YY9D 2BOCB 4J4PC 3BH9A 5GGRA 3REWB 2PW1B 1LP9F 4NWTH 3T0EB 3ARQA 2BSTB 3PXJA 3CZJA 1YMMB 3PQYA 5AZ2H 3TNNB 2IPTL 1DN0A 3V6OC 4XVUC 1NAKH 4Y2DD 2CK2A 4QRPB 1BAFL 3KPSA 3GSVA 1IAIH 1T1ZB 3RL2B 2DQTL 1HHHB 1X5KA 4U6XA 3ULVD 3FT3B 1TTFA 2W9LA 4FZEH 3NN8B 1I8LA 2YD4A 1HHIB 4KUCD 4ZO8A 1DLHB 4QRRD 3SKOB 4E5XA 4MJID 2H8PA 5KSBE 2EE9A 3GJEB 1MLBA 4JRXD 2EH8H 3EFDL 1BD2B 3CZFB 4PJAB 2X9XA 4XBGB 4KKAC 1U8IA 2W65A 1UZ6F 1S8DB 15C8L 4I4WA 3CNKA 5DD3L 3VGAB 4FQCH 2HT2C 4FZ8L 1PG7X 4LSRH 4H0GA 3FB6A 4UOW1 3D2UB 3EOAB 4NKQB 1SMOA 1OGAE 2D7PA 5HHPB 3MV9D 1UVQB 4H5SB 4CU6A 4WUKL 4KU1A 4R0LA 1PVHA 4JJ5A 1EJOH 5J0BA 3CXHJ 4LEXH 4D8PB 5ABDE 1R5VA 1FIEA 3I2CL 5GGTA 2CO7B 1WBYA 2AEQL 5LBSH 3DVNB 4FRWA 3RDTA 1KTDB 1MFAH 4PLOB 4PJFE 1ACYL 4H8WH 1A3RL 3V5KA 3SGEH 1EDQA 1FDLH 3I9GH 2QQNH 1HHGA 4LAQH 1P5VA 2Q20A 3OJMB 1WFTA 2H1PL 1JWSA 4OF5A 2EEDA 4FQ1H 4D9LL 4C56B 3GSNA 1FC1A 2FZ3A 5FDWA 4P9HL 4UV7H 5GPRA 4YDKH 1O7SA 2PUQT 1DVFA 3WE6B 2VZSA 5D2LE 3BXNA 3WIFA 4AZ8A 5CZVL 1RSFA 2ZWLT 4WHTB 2C3VA 3F7VB 4JFEB 4HZLA 3IDGB 4P3CH 1OY3B 2CRYA 3FRUB 4JFYB 4QXUL 2QQLH 3NABH 2H2PD 4ERSL 4KPHL 3RI5F 2YPLE 2R0KL 3GIVB 3H0TB 3O6FC 2JLLA 2EDEA 1E4XL 2X4QA 1EAJA 2AXGB 3VXUD 3X13A 4AH2A 4NQEB 3OJ2C 1TTUA 3PV7A 5I17B 3C6SB 1LMKA 3O4LE 4L3EE 3LEYL 3BPOB 1HCVA 4LBEB 4YHOL 1G7PB 2Q1EA 2BK8A 3VGAC 3ALPA 5JXEA 2NXYD 3HE6A 4AEIL 5FGRA 4ZUSB 1EX0A 3DV4B 2UWEA 3CAFA 2HWZH 4EN3D 2GY7B 2I5YL 1M71A 1P6AB 1JNNH 3GM8A 3U9UB 4LVEA 5T3XH 3LEXB 1M7DB 2WK2A 4GRMA 3W5MA 3IAGC 5IJKC 3U1SH 4NHCH 3O11B 4EUPG 3A67H 4PJBE 4OZIE 3GKZA 3QEQA 4XNUH 3KNBB 2BNRE 4CJ0A 4WEBH 2DD8H 4WHCA 3FFCB 4L1DA 2FLBT 2G5BB 5I8CA 2AKRA 4F2MA 2AS5M 2VDNL 4F7CB 5D2NE 4G8EB 3MRFB 3MRQA 4J8RB 1OTUC 4KK6C 1A1MA 1FNGA 1N59A 1TCMA 4WV1A 3G6JB 3H7BB 5DRWA 5GRJL 5AAMA 5I71B 1UM5L 3SO3B 1KLUB 3MLUL 2A77H 2XZQH 4KJWC 1I3GL 3LHPL 2BVUA 4N5ED 3W11D 4UU9B 4TUKH 4LLYA 4TULL 3C08L 3CIQA 5JZ7D 1MHCB 3MA7A 4JFQA 4PJ9D 3I6KA 1A5FH 2NY7H 4RMQA 3NAAL 4B53A 1DQTA 3HR5B 3RWIB 5IJVA 5TPWL 1BM3L 3VXTA 3IFOB 4X6CA 2VLKD 3QRGH 3OXSB 5T33L 5LJYH 4MA8L 1J8KA 2OL3A 3T77B 2YPKB 3KWWA 4G7VH 5CILH 3QCVL 2P5EE 5FM5O 5T5FL 1JNJA 1VACA 1OAQH 2M8XA 2WANA 3FTGA 1AR1D 4YIQA 3HG1D 3M17B 3DUSA 5EUKB 2AK4B 5EDXA 1KIPA 3BP6A 3PHSA 3BP5B 3C60C 5FYKD 1RK1B 1KGCD 1OQXA 4NO2B 1U95A 2NY2D 4NUJB 4NQVA 3NH7H 2V5RA 4YEEA 5HI5D 1T04B 5C71A 1NCTA 1D7FA 2CK0L 2QTEA 3H3BC 4JANB 5TQ0L 3WHXB 1NDMA 5T1MB 1AI1L 2VDOL 3UTSB 4WWKC 4ODHL 3VXOB 1SVCP 1KC5L 5C0AE 5I71C 3QH3A 2VXTL 2OTWA 2BDNL 1LEIB 1K5NB 1AD9B 3HI6L 2QKIA 4R2GB 5CS7A 3JTTB 4IRSC 2OJZH 3IDXH 5GGSY 2A83B 3RHWK 5KJRH 4LDEB 1WC7B 4PRIA 5F9OL 1NC2A 3CVHL 2E27H 4P46C 1AO7E 3L3DB 3QFJB 3ARFD 4B5EA 4YNYA 3LCYA 3OV6A 1JPGA 1NCAH 4JM4H 3Q5OA 4OD1L 1QUNA 2PO6A 4UIMB 3LZFL 4LEOA 2NY0D 3MJGX 1OVZA 5I8OL 5JPMA 4PG2A 1TQBB 2CPCA 1BFSA 5KVDH 1T2JA 3D48R 3H9HB 2ED7A 3GMOA 3L7FA 3TZVC 4LARL 4S1RH 2FSEB 2V9TA 4R97B 4UILH 2DQDL 4DWHA 1ZMYA 5C3TA 1SYSA 2NY4B 4WTZG 2GJZA 1OM3H 2IJ0C 1IC4L 1Q9WB 3QQ4B 1TPXB 1JYXA 1UA6L 5SX4I 5DD5H 3RGHA 4K3EL 4OF0A 2HJLA 1MJ8L 5EU5B 5F7NC 5MERB 4X98B 4C58B 4P5KA 2Z31B 4QHMA 4W70A 3INUH 5T1DH 3S88L 2DTSA 1PSKH 5HDQL 2D7TL 3BKML 1YEKH 4JDZB 4MA7H 4X5LA 4OFDA 3SJVA 4X6FA 2XFXA 3U9PL 1I1AC 1DBAH 4NRZB 3NZ8A 5KSVB 4F37F 4YJZL 3ZDYF 5K9KA 5KN5B 1P7QD 2Z91B 5ILTH 4WUUA 1CL7L 4N8VA 4HWBL 4WTXA 1IAII 2P7TB 1I9JH 1EHNA 1Z3GL 5DJAB 5E4IA 1CI5A 3DYMA 1OWWA 3MRCB 5T1LA 1X4YA 2AJYL 1KFAL 4YFDB 2VO5A 3I84A 3UO1L 1MCOL 4NC1C 4QRSA 4GAGH 1UEMA 1ZOXA 3V6OE 3D5OF 2Z8RA 5I1GH 1B9ZA 3BH9B 5GGRB 4E41A 3D39A 4QHKI 2AXFA 1M7IA 3VRLF 4OFYA 3REVA 2X4TA 4XX1G 3PQYB 3PABA 1DN0B 4KTDL 1YPZF 3KPSB 3BW9A 2A0LD 3GSVB 1MCWW 1S9YA 4MD5A 4U6XB 4XCCL 4CRPA 1NAML 3FHAA 2D4DA 5IT2L 3K7UA 2DDQL 3THMH 4XPTH 4E5XB 1K2DA 2H8PB 4LNVA 4A2LA 1AJ7L 3MNZA 4DZBA 2Z31C 1MLBB 3RNKA 1HKLH 4HFWA 4U1HA 3VG0L 4U1MA 3C2AL 4O5LL 2W65B 4M6OL 4FABL 2FB4L 1GGIL 4I4WB 5DQJA 2OM5A 4OGAD 3MRJA 5IQ7L 5LXGH 5FHBH 3FB6B 3OAZH 4UV4H 3V0VA 3QDJA 3FHQA 4G6MH 2G5RA 1A47A 4R0LB 4JJ5B 4D0DA 2WWMC 5I1IL 1R5VB 1G7QA 1QA9A 1LO3L 1IC5H 1KXQE 1WBYB 1YA5A 3T0EE 3RDTB 1WFUA 5I0DA 1YMME 4ZQKA 1OOAA 3ABZA 3V5KB 1CGWA 1KBGH 4QRPE 1HHGB 2R39A 2UV3A 1XCQA 4P9ML 1NMAH 2YD6A 1PKQA 3VW3L 5ESQA 4GRWF 3QFDA 1JWSB 3UYOD 3F7RA 3GSNB 2FZ3B 5FDWB 4P2YA 5DJZA 4HLZH 2GHWB 4NQCA 1RK0A 1SJVA 2F15A 1Q8MA 3BPLB 3TNMA 1DVFB 5D72L 4Q6IC 3BXNB 3WIFB 7FABH 5CEXA 1DTUA 2C3VB 3D0VA 4PY8J 1VGEH 3OTTA 3ZKMD 4N68A 1SEBA 5ELIA 3LMJH 1I8LC 1T7WA 1BD2E 1DL7L 3O6LL 4JFHE 4PJAE 5F8QC 4OZHA 3L7EA 2X4QB 3X13B 1RZJH 3S97C 5J4MA 5DFVC 2OTPA 1OP5K 3T09A 4AH2B 4KHTL 1BQHA 3ULVF 1W72H 5KW9H 5HHVH 1DQML 1RD6A 1U9KA 1S7XA 3C8KA 4KUCF 4NO3A 5CJOH 1YEHL 4PIRF 1E4WH 5E7BA 3S98A 1CLZL 4ZXBD 4NM4H 5GS0L 1JYNA 4QOKD 3HE6B 1IKFH 3H7LA 1S9VA 5I73B 2AQ3A 1JPTL 4KK5C 2UWEB 4IJ3B 5GJTH 1DUYA 3O4OC 4M1CC 4ZG1A 1L7IH 1M71B 4Z7OE 4R0LC 4WW2A 3D0LA 2HFFA 5D71L 1AGBA 1NC4B 3BHBA 1R3LA 4HT1H 2J12B 4GRMB 3FRPA 4OLXL 4C56E 1BBDL 3WXWL 2J8UA 3OX8A 4ONGH 3MUJA 3QEQB 5C6PB 3ZL4L 2XY1A 4DTGL 1PX4A 4PRHD 5I8CB 5CINL 2AKRB 4JFEE 1BGXL 1FORH 3MRQB 4NO5A 3ZLQC 4XP9H 3CSGA 3S34L 1A1MB 3C5JA 1FNGB 1N59B 3WJLC 5DT1H 4UT9L 4WV1B 1FNAA 1OT2A 2PR4H 3P9MA 4PJ8A 2P47B 5DRWB 5IHUH 3UJIL 1HH6A 5DJXA 4DQOL 2HLFD 5ADOH 4NQEE 2R15A 4KHXH 1CDIA 5KVMC 1N64L 1DP0A 5D1ZA 3MXVL 1FZOA 4NQTA 5DVNA 2XWBA 4KVCH 4JG1H 4QHNA 4LLYB 1P4BH 4PB0H 3RWGA 5EIVA 3MA7B 3PNWA 4JFQB 1ZGLP 4LKCA 3TC9A 3MRPA 1CIUA 3I6KB 4O58L 4X7SH 3QUML 5IJVB 5E8DL 2P24A 3HE6C 4XP6H 3VXTB 5LAXA 4X6CB 3UTPD 3AREA 1X5IA 2KL6A 2BNQD 1UZ8A 3KPRA 5DLMH 3P4OA 2OL3B 2HP4A 4Z9KB 4ODTL 5I1JL 3KWWB 1DBKH 1VACB 2BNUA 1RIUL 3FTGB 4P2QD 4YIQB 3WUZA 3OGOE 3DUSB 3JUZA 2B4CL 1KIPB 3BP6B 3FFCE 2NZ9D 4JFZL 4WO4A 1VADA 2Z93A 5ACMA 4YXHH 5E70A 3BKJH 2HTLD 3EOYG 3BQUA 1BF8A 4HAFA 1U95B 4NQVB 3VH8G 4GBXA 3WD5L 3O8XC 4JQVC 4N8CH 3G6JE 3UYRH 4RFEA 5JUEH 4JKMA 12E8L 2R2CA 5IBUB 3L5IA 3U4AA 3O0RH 5CBAA 1K85A 3DETC 1C08A 5F3HA 1FCCA 5D1XA 3RVXD 3SKUD 4HV8A 4WV1C 1HIML 1MFCL 3QZWA 4HKXA 3QH3B 1I9RL 4ELMF 2OTWB 3K2MC 5DJDA 4OJFH 1HYSD 2QKIB 3UDWA 1BP3B 1BFTA 1K8DA 1TZGL 5DURD 1T66D 3N1FC 4OCSH 4KI5D 3D9AL 1XH3A 1CU4H 1ZSDA 1D9KD 5GS1A 4PRIB 2CGRL 1NC2B 5HDBE 4HC1L 1QQDA 1FVEA 2Z8VC 1CE6A 1GOFA 4YNYB 3RWDA 1JPGB 2D7MA 5ICXA 3E8UH 5TE4H 4X83A 4ZAKD 2PO6B 4AEEA 2AK4E 5F7FA 5LCVL 3Q1SL 4GQPH 4LEOB 4P5TA 3KLAA 1JGLH 5JPMB 1BQSA 3B2VH 3GMOB 3L7FB 4XMPH 3UZQA 1BIHA 5T5NG 4Z7VF 3TO2A 3N50A 5CJXA 3UC0H 4YQXH 5DO2C 4KJPC 5JQ6L 1SYSB 1UWEL 2GJZB 3I50H 1B6UA 3UTSE 4KQ3H 2ZUYA 1J88A 3C2SA 1A4KA 1KB9J 3GRWH 5F97E 1TJGH 3RZCC 2HJLB 2R0LL 4ZD3H 1ZLSL 4L5FH 4P5KB 4OLWL 1FH5L 2VLRD 4QHMB 3HMWL 4M03A 1PW3A 2X42A 4ORZC 4YXLH 4KK8C 1MWAH 5JDJA 2B2XH 3SJVB 2DYPD 4X6FB 2XFXB 3NCJH 1OQOA 3NZ8B 2DQCH 3O6ML 1BFVL 1FV1A 4KXZI 5IQ9A 1C8PA 3TBSA 3B5GA 4BSWA 5K9KB 1MF2L 4F58H 3RA7H 3QFJE 5J6GA 2OS7A 3MACL 4MJ2A 4NCC1 1FCGA 4WUUB 1A6TA 2XT1B 4N8VB 3X3GH 2NW2A 5I1AA 1KCSH 5A16A 4KVNL 4PJ7A 4GG6A 1KT2A 5T1LB 4J6RL 4XCFH 3RP1A 4RX4A 3QUYA 3KS0J 5CUSL 4MD4A 4QRSB 5GGUB 2PO6C 1KCLA 2NX5D 2ZKHL 1XCTA 3ZTJG 1C16A 3B8YA 4EI5C 4NP4H 2DIBA 1D5BB 4E41B 2BRRH 3D39B 2AXFB 1UB6A 4GQ9H 1M7IB 1QBML 4HULB 3REVB 2X4TB 4Q2ZA 2Q8AH 1LO0H 3PABB 4KDVA 4IBLT 3BW9B 4M43H 3FN0L 2LFGA 4N5UA 4DK6A 1S9YB 3AFLA 4MD5B 3QWRD 1ZANH 5JDSA 4W6XB 1AGCA 1EEYA 3FQUA 4U1SA 2C4XA 1K2DB 2HFTA 1H9VA 4X5WB 3MNZB 4DZBB 4AIOA 1CF8H 3MLWH 1YEGH 3RNKB 4HFWB 4U1HB 1B2WH 1AY1H 1UWGL 5KZCB 4U1MB 2AJUH 3WUWA 1L0XA 4KKLC 4J23A 4KK9C 4XRCA 2Y36L 2CKBA 4WVRA 5DQJB 3OJDB 3S36L 4LHUG 4PJCA 3MLXH 3MRJB 3V2AR 5F6HI 3QDHA 4GW1A 4I18C 3WN5C 4PB9L 3V0VB 3QDJB 1RV6X 5I66A 4PLJC 5B8CA 4DGYL 4A6YH 4F8QA 3QO1A 2HKHH 1GPOH 4JZOA 5EBLA 1O7VA 4D0DB 4X7CC 1AGFA 5TE6L 1G7QB 2V7NA 5SWZA 1QA9B 1JUFA 5ID1A 3FQWA 2VLKA 2K7QA 2AJZA 5E2VL 5JTWA 1DANU 4XP1H 1T1XA 1IAOA 3PQYE 4ZQKB 3V6ZA 3LQAC 1HK6A 4L9DA 1DLFH 3ARGC 2C9AA 3KPSE 1XCQB 3HNTL 5K9QG 2XNAA 1PKQB 4ZFOL 5ESQB 3KJ6L 3QFDB 2JELL 1XGQA 2DQHL 4K23H 4TNWF 4QYOA 5DJZB 4NQCB 1RK0B 4NBXB 1Z9SA 3TNMB 3V4PL 1RIHH 3JWOH 3VA2C 3S3SA 5CEXB 3EUUA 5K9JH 3D0VB 2FNBA 3GIZH 1SEBB 8CGTA 2EYRA 5EULV 5EZJA 2X1PA 5IB3A 2HRPH 4OZHB 2ADIA 3L7EB 5D6DA 4S1QL 2D03L 5DDHA 5JPNA 4Z18A 2J4WL 2RFXA 1BQHB 2UVFA 3QPXL 5DJ0A 2HVJA 3KYMA 1S7XB 4UB0H 1MVUA 3C8KB 3RGVC 4NO3B 3DMMD 1RUAH 5FUOL 3ARYA 3LPFA 3UTQA 2Y07H 3QDAA 3C8DA 3F12A 5T3ZE 1S9VB 2VDQH 3VXSD 1CGUA 1QSFA 1DUYB 2EYSA 3VFNA 4PJDA 2LU7A 2BP3A 4DN4H 2R0ZH 3HFML 3NCMA 4WW2B 1FE8L 3D0LB 1UYWL 2HFFB 4Q9RH 1QSED 4LP4A 4P59L 4NOFA 5I30H 4QT5A 1AGBB 5DQ9A 4JHWL 4RMVA 3BHBB 1R3LB 2JB5H 2KKQA 2PW2A 5GGRY 4I3SL 1UCTA 3STLB 3WKNA 2WQ8A 4PFEA 2J8UB 3OX8B 3MZTA 2JJUA 5J3HC 1VERA 1GGBL 3STBA 3HE7A 3ZKNC 3GNML 3JWDH 2NXZC 4HGKC 2EZ0D 4NO5B 3C5JB 4NFBA 2ADFL 4KTEL 5GRWA 1U3HA 2IWGA 3P9MB 4HMCA 4PJ8B 5CJQH 5BV7L 1HH6B 5DJXB 1ZHLA 2YRZA 4NBZB 1FFQA 5MEQA 4OZFH 1WAAF 4RGOH 3EZ8A 5D1ZB 3MGTA 1NEZA 3WNKA 5D7SH 2YD5A 1FZOB 2COQA 3C5SA 4PJHF 2XWBB 3NFSH 4N0FA 4QHNB 3RWGB 2NY5L 1CDBA 5GGVY 3PNWB 3ZDZF 4LKCB 1AHWC 3JBG7 3QRFM 2UWEE 3MRPB 3KAAA 1U92A 4S1DD 1AKJA 4OKVA 1XF5A 5E7FA 3TA3A 5TH2A 4QO1A 5FUZL 1TJHL 5DMYA 2P24B 1SM3L 5FHAH 5LAXB 5AEAA 3AREB 2P49B 4ZTOH 4XVJL 1UZ8B 3KPRB 4EZMA 3P4OB 4LPYA 1YECL 3KLHD 5GGQL 4XVSH 3LS5H 4P99A 3C9NA 4WW2C 2BNUB 4LRNL 4RA3A 2FATH 3QEQE 4OQTL 1IGFL 1MCRA 3X11A 4WO4B 1VADB 2Z93B 3BN9C 4OM0H 3CUPA 4HJGB 3BQUB 3WCYA 3D3VD 3GMRA 2YKLL 3UPCA 4GBXB 3F58L 1W0YT 1WEJL 3QXTA 3QUXA 1A6VH 3UPAA 1U8OA 4RFEB 4FQXC 4BFIA 4YXKL 1RZKC 5CBAB 3RKDD 5EBWB 5BXFA 2QSCL 3SKMA 1C08B 5F3HB 3WSQL 1H3WM 5D1XB 4PYGA 4HV8B 1OLZA 1W8OA 3RIAK 4PJ8C 1KULA 3A6CL 4P23A 1NLDL 3QZWB 4HKXB 4YPGA 3VCLA 3MA9H 4QXGH 5DJDB 1UENA 4Q58C 1T4KA 2PXYA 1X44A 4OCRL 3H3PL 5D1ZC 1K8DB 2ADJA 3VXMD 3TFKD 2Z4QA 4FXLA 4JO1L 5FM5M 2YD7A 4XAKE 1XH3B 1ZSDB 5MI0B 1ZEAL 3SQBA 2YA1A 5GS1B 4XNXL 4X6CE 4YK4B 2NR6C 3N06B 2IGFH 4S10A 4PRBA 3V8CA 5C0GA 1QQDB 1FVEB 3P0YH 1CE6B 3UZVB 5KVFH 3RWDB 1LD9A 4O9HH 4MQTB 3Q2CA 1A8JH 5ICXB 4Z95H 4YUEL 5TF1L 5ANMA 4M6MH 3AREC 1U2HA 4GAFB 5CBEA 1IGCH 4HQQH 2BFVH 2ZG2A 4ZNCD 4P5TB 2XA8L 3ARTA 2A74A 3KLAB 4ELKA 1YN7A 2ZNWA 1GOGA 1LO2L 2ZCHL 4IIQA 5HTSA 2IAMC 1FG9C 4LSPL 3NIFF 3PP3H 4WO4C 3K74B 3TO2B 4RGNC 3WIHH 1XFPA 2CUHA 3CCHA 3BJLA 4OZGA 3FT2A 3G08A 1WGOA 1NGQL 1D6EA 2GYSA 4GBXC 3SDXA 3PG2A 3VGDA 4O2EA 1J0KA 5B22A 1A4KB 4U6VL 3ARDA 4Y8AA 4R26L 1GGCH 3LKPB 5D1XC 5MEND 2FGZA 1KJMA 4O4YH 1NEUA 4KDTA 1I85A 4K9EC 4Z0XA 4FS0A 1D6VH 3LRGA 3RQ3A 4PRIE 5ESAA 1FV1B 2IFFH 5IQ9B 5F9AC 3TBSB 3WNLA 1ZTXH 4BSWB 5J6HA 3F5WA 5FYJE 5J6GB 2XOTA 4H25A 1CVRA 4LCIL 4Z77A 1A6TB 4OI9A 2NW2B 5I1AB 5A16B 1K3IA 5CEYA 4PJ7B 3H9YA 3EKCA 4KI5F 4GG6B 1KT2B 1J8HA 3QNXA 3QUYB 1P84K 2V17L 5TFSL 1N6QH 2BJMH 4MD4B 1RMFH 2Y23A 5F8RC 1XCTB 4QXWA 2VXUL 4TSAL 2G60L 3MUY1 4P5TC 4YHZH 4HXBH 1TZHA 1UB6B 2OZ4H 4KRNA 1XF1A 4Z6AT 4Q2ZB 4BYHA 4FFWD 4NJ9H 3VI3E 3N9GH 2GIYA 1Y6KR 5CJXC 2R4SH 5E2JA 2H26A 4FFVD 3VDBA 2FR4A 4HGMA 3EYUH 4ZS7L 1L6XA 1KJ2A 4MA3A 1FPTH 4UNTA 5JDSB 2HH0L 1AGCB 4JFPA 3SJVE 1EEYB 1X5AA 5JMRA 5L0QB 2EYTA 1RUQL 4PS4L 3FQUB 4GOSA 4U1SB 3NZHL 1VB9A 2DLGA 1A6UL 5HDLA 1E6OH 5FXCH 5SX5K 5I2IA 1LK3H 3QWQB 2VE6A 4DCQA 2LAGB 3WUWB 2XTJD 4K7PH 4WUUE 3OKDA 2DBLH 2H2PC 4XRCB 4PBXA 3AVEA 3CVIH 1A3QA 3M1BA 4PJCB 3PUCA 4GW1B 3L5XL 4WCYL 2VLMD 4K94C 4AENA 5I66B 1KNOA 5B8CB 1JMZA 3IFLH 4RSVA 3QO1B 3FN3A 4JZOB 5EU6D 4HAGA 4JKPL 1A7NH 1Q0XL 4ONFH 5EBLB 1FYTA 1KN4H 1AGFB 4AEFA 2V7NB 2O5YL 5SWZB 2CKNA 1JUFB 5ID1B 3FQWB 3QUYC 2F5BL 1UM4H 3D39E 4POZD 2AJZB 4R96A 3VRJA 4PJXA 4EN3C 1T1XB 1IAOB 3V6ZB 5E0QA 3WFDL 3UJTH 5DR5L 3ULVH 1VFOA 3RHWF 1D3CA 2D7OA 1WV7T 3WO4C 3QYCA 2AEWA 2XNAB 1J0YA 2FEDD 1RZ8A 4MWFA 4B7IA 1P4IH 1JHLH 2BCKA 1XGQB 3D25A 2QHRH 4QYOB 5JLZA 3QHFL 5L2KD 4RMRA 3CX2A 4J7RA 4KI1A 3P77A 3CK0L 4BKLA 2EYRB 5F7MC 3KPNA 2OR9L 5EZJB 3BRFA 5IB3B 1MPAL 4AIXA 1ZWIA 5L0QC 4JG0H 2ADIB 3G6DL 2EXYD 1A6AA 5EN2A 5DDHB 5JPNB 2IALA 3ZE2F 4OSUH 3QNYA 2RFXB 4G6FB 4ZPVA 4AQOA 1W0WA 1BQUA 5DJ0B 2HVJB 4YLQT 1A21A 3KYMB 4OGXL 1MVUB 2X05A 3QDJE 4GS7C 1GH7A 4D9RE 3UTQB 2HN7A 5DSCA 5GRVK 3HMXA 3F12B 4LQFH 5DMJB 4YAQA 1FO0L 1QSFB 5JOPE 2EYSB 3VFNB 2F5AL 3AB0B 3OR6A 4PJDB 4DUVA 2XN9A 2VDRL 4KUZL 3HNSL 4ODSH 2X1XR 2WM0A 4QT5B 5DQ9B 1DFBH 4QLRA 1F2QA 1VEMA 1PKQE 4KRPD 3QIUD 5B39G 2PW2B 1KENL 4NN7B 3PWLA 1BEYL 1I3UA 4NQCE 3P0VH 1SJHA 1AR1C 1MEXH 2KQNA 3HLAA 5FYJU 4O02H 3HE7B 1CDGA 3S37L 4YBHA 3TH2T 1ROWA 1NFIA 3HC0A 5LKNA 2J6EL 5DUPL 4YHLL 1L6ZA 4A6YA 1CDJA 4UT6H 4R4ND 4OZHE 1W8NA 1U3HB 3ZTNL 4H26A 3ARUA 2XKUA 5HI5C 1LVEA 1ZHLB 5F7YC 1P69B 4KMQA 2E8ZA 5C0ND 4I8DA 2FJHA 5MEQB 5HYSA 3VFTA 3R8BB 2DQUL 1R5WA 4JY6A 3RRQA 5L7XH 4XTRC 3MGTB 1NEZB 5FCUL 4TSCL 2IMMA 1OGAD 4NKDA 3C5SB 5F96L 2IPTH 1CZ8L 3HC3L 5A40E 4N0FB 2YXMA 3RVTC 4CGTA 3CFCL 3MTRA 1K4DA 5C0RH 1L9MA 1URLA 2DQTH 1EUTA 5I1KL 5LQBL 2GCYA 1U92B 1AKJB 4KAQH 4OKVB 4TVPL 3TA3B 2A9ML 5TH2B 3K2UL 3L3GA 3K8KA 3HCVA 4NJAL 2RBLA 4KGLA 4JCMA 4UOJA 3AB0C 1QPXA 3ARFC 5C2BH 1RZ7L 3C9NB 2J8UE 3EFDH 4F7MA 3VWJD 3SDCA 2IFGA 1NGYA 1OP9A 1GCFA 1HCFX 4XP5L 3X11B 5DD3H 4MQXD 4P3WA 4MXWH 4NFDA 3CUPB 2ZJSL 3BX7C 4FZ8H 6FABL 2NY0C 3GMRB 3MSPA 3G6AA 4X7DC 1RZIA 3WIIH 4X7TA 1J5OH 2B0SL 2F53A 3QUXB 1YYML 2YPLD 5KBNC 1U8OB 3HE7C 4WUKH 4BFIB 1JYVA 1ETZA 1MHEA 5CZXC 1X5JA 3I2CH 4OUOA 5BXFB 1G9EA 2EDTA 2BSRA 3O4LD 1J1OL 2AEQH 4L3ED 3SKMB 3O2WL 3SY0A 5HI3D 5CGYD 1U3HC 3CXDH 1SVZA 5E24E 3OAYH 4P23B 2VKXA 2OSLA 4YPGB 3S9DB 2HFGL 1TDQA 3HI1B 3VCLB 3GM0A 2EDLA 4BZ2L 3ES6A 1NGWA 1BVKA 1T4KB 2ED9A 5INDB 3ET9F 2PXYB 4XBEL 1CIDA 3TH4T 2ADJB 2H1PH 2Z4QB 3MOBL 4P9HH 2QQKL 5HGBA 2QQQA 3WJJA 2BY2A 4Y5XC 3A0OA 4RFOH 1OP3K 4PRBB 2KDGA 3KPRE 5C0GB 4NC0B 1CYGA 5HHOE 1JRHI 1LD9B 3VFGL 5E8PA 4NHUA 1DEEA 3U30B 5ANMB 1WZKA 4KPHH 1WISA 4XI5D 4HXAH 2XIDA 2BNRD 4GO6B 5CBEB 4OZFA 1QR1A 4BQ6A 2A74B 1J0JA 4ELKB 1YN7B 3LEYH 2CR6A 3T08A 3DX7A 3K80A 1CGTA 4WENB 4YHOH 5DF0A 1E4JA 4IIQB 5F7KC 3KLSA 5JW4R 1MRCH 2WMPA 2VERN 2W9EL 5IG7A 3CCHB 4KROB 3RPIA 1ITBB 4OZGB 3FT2B 5ICYA 3G08B 4WTWA 1CFQA 2J7LA 3HA0A 1D6EB 5GRZA 3UTTA 3IU3A 3T04D 2E9BA 3SDXB 1PZ5A 5I1CL 5HGGS 4O2EB 2I5YH 5D5MF 1ONQA 2HKFL 1F97A 3G5YA 3FT4B 3ARDB 3QDMA 5AG9A 2A0LC 1U8NA 5FO7A 1DE4A 4YBQD 3KHOA 4BUHA 3NFNA 2XY2A 3P40A 1KJMB 5L8JB 1JZ7A 1H3PL 4P23C 1ULVA 4Z0XB 1KJ3L 4M5YL 3DV6A 2P5WA 5E6ID 3A6BL 5ESAB 1XF3A 3MC0A 3PP4H 4JHAL 5TQ2L 4BH7A 5KTEL 5J6HB 3QWOA 4GW5A 4HWNA 3F5WB 1I7UA 2WBJA 5DVLA 4H25B 2WV3A 3E2HC 4CKVX 2WP3T 2DI8A 2P5ED 3CJJA 4GKOA 3UEZA 4Z77B 4ZTPH 1FGNH 3AXLA 4QHLA 4HBCL 5CEYB 3UROR 1ZA6A 5GRJH 1NUNB 3JUYA 2DWDA 4OGAC 1J8HB 3L3JA 1XIWA 1UM5H 3M45A 3QNXB 1IVLA 4ZPTA 1KB5L 3BGAA 3MLUH 4M48L 4WHYG 3U30C 3IDNA 3I6GA 5D1QD 4C4KO 3LHPH 4FFYL 1HN1A 3C5ZD 2D9QB 5CLWA 4LAJH 1QNZH 3UTOA 1TZHB 3RX8A 3QQ9C 3LN9A 5EWIL 3DJ9A 1Z9OA 4MHHG 3NAAH 4Y2OA 1BREA 4E0RA 1T6VN 4YFLF 4KROC 5C0AD 1BM3H 1QG3A 1QYGL 2VKWA 3QA3A 1KCKA 2H26B 4LLAA 2DLFH 5T33H 2FR4B 2EXWC 1KPUA 4MA8H 3PWJA 4CAGA 2EC9U 1KJ2B 4MA3B 3HS0B 4GRLD 4Q7DA 4OV6F 3QCVH 4OIIL 5T5FH 4JFPB 4JQIL 4H88H 3SE9L 3ARDC 1UWXH 4ZO9A 1GXEA 2BHZA 1AO7D 1RFDH 5I2IB 3K3QA 2MNUA 1I85C 2VE6B 4DCQB 2NTFA 3HI5L 3WIHA 4ZUWA 3OKDB 1TQCB 2CXGA 3NIGE 3M1BB 4PJ7E 4GG6E 1NUFA 3VE0A 1T5WA 4AENB 4LCUA 1EGJH 1KNOB 2MPAL 2V2XA 1AI1H 3SHSA 1FYTB 2ED8A 3BGMA 5DMGD 3CH8A 4R7NA 4ZXBC 2VXTH 3V8OA 3W81A 2BDNH 1DQLL 4NQUA 5L9DL 3VFWA 1JZ5A 2X4PA 1JNLL 1NPUA 4NZRH 3HNVL 4HS8L 4R96B 3VRJB 1CTOA 3PHOA 4PJXB 3QUZA 1NCDL 4LVNC 2G2RA 5GRUL 1G84A 2FD6L 2BC4A 1YN6A 4Y4HD 5SWSE 5BW7C 4LP5A 4U0RB 5IW1A 4N1HB 3TYGL 4YDIH 4BSJA 3DPBA 3GZKA 4POYA 1RZ8B 2VZVA 4MWFB 3AC0A 2BCKB 3D25B 4PLKD 2YWYA 4KKBC 4AG4L 5JLZB 3KXFA 5GRVL 5E2TL 2ENSA 4M4RA 5EZLA 1ZLUK 2AEPL 2LV4A 3P77B 4K2UL 2HT4D 3O2DL 4BKLB 3KPNB 5DZNA 1ZWIB 2OP4H 1A6AB 3OZ9L 4LARH 1FP5A 4TYUA 3O3EA 5EN2B 2IALB 1PBYA 3QNYB 4Y7MA 3MUHL 4PJCE 1F4YL 4ZPVB 2OZ4A 4K71C 1W0WB 3KS0H 5BS0A 3D85A 5A2FA 1T03H 1TQCC 3GUTA 5E1HB 1IC4H 2HN7B 4XCYA 1HI6A 3KPPA 5DSCB 3M07A 2PTVA 2VZ3A 3T8XA 4JQXA 3OF6A 4K3EH 2MCPL 3QG7L 2H2SD 4XVUD 4YAQB 5SWZE 3AS0A 1KEML 1OAUH 3PE9A 2AGJL 3OR6B 3S88H 1X4XA 2XN9B 1QOKA 3U9PH 4L8BA 5GSRA 4MAUL 5I9QC 1VKXA 6CGTA 2EC8A 3PWLB 4RGMB 2MFNA 1DSFL 1BQLL 3S4SA 1SJHB 1F4XL 3R1GL 3MX0A 1I1YA 2NZIA 3HLAB 4KKAD 1NCCH 1Z3GH 1FL6A 2NZ9C 1NFIB 3HC0B 4A6YB 2AJYH 2HTLC 4L3CA 1PZUB 1WFNA 5E2UL 3SGKA 4F15B 3UO1H 4PBWD 4H26B 4RBPK 1IEAA 4FQIL 2W1NA 3DRQA 2FJHB 4OCWL 1NSNL 5HYSB 3VFTB 4CMHC 2NY1B 1R5WB 2C3XA 2GEEA 4JY6B 1QVOA 3RVXC 4NKDB 1I8IA 4KTDH 1LE5A 4XWOD 4F8TA 4L4JA 5AAWA 3HC4L 2XTLA 5F9WB 1K4DB 2X89D 2H41A 4LGRB 1ZGLA 1QSFE 2GCYB 4JHZA 1HYSC 3S96A 1IT9H 4QRTA 3T0ED 4PJDE 1T66C 1YMMD 4MCYA 4KI5C 5CCKL 4XCCH 3L3GB 3HCVB 1NAMH 1D9KC 3LN5A 5IT2H 4QRPD 2DDQH 3S7GA 1AJ7H 2GKIA 1FFNA 4MS8D 4F7MB 2NNAA 3SDCB 1NGYB 4FABH 2AJ3A 4ZAKC 3SGDI 5JW3L 1V8HA 2BZDA 3D18A 3OWEA 3K1DA 2H45A 4CADA 3G6AB 2DKMA 1PEWA 4ZSOA 1RZIB 1UJ3A 4X7TB 1BD2D 4JFHD 3U7YH 5BVJA 2F53B 1IE5A 4ZDHA 1ETZB 3K1KC 1MHEB 5F7LB 2C7UA 5I1LB 4F9PA 3N1GC 3ISWA 3GSOA 4QXTA 4HJ0C 3EZJB 3D2UD 3SY0B 2YXFA 2OSLB 5KSBF 2APBA 2ZOKA 5I18L 4QNPF 1IQWL 4PP1C 3ES6B 1NGWB 4K7PX 4HBQA 3B2UD 4P9MH 3UCRA 1OAXL 1BVKB 3VW3H 3DGCR 5HGBB 1CBVH 3WDIA 4NQDA 3OGCA 4M5ZL 1IM9A 4AY0A 1T83C 4XMKL 5F9WC 5D72H 4ZS6D 4BK5A 2EECA 5T1KA 5CSZA 4DEPC 4HJJL 4X4ZA 5HYIA 3PV6A 3FZUD 4C56D 5E8PB 3OKYA 4NHUB 1XGYL 2Q86A 3O6LH 1DEEB 1DL7H 2X9WA 5C09A 1OTUD 3UZEA 3MFGB 1DANT 4OZFB 2D0HA 1QR1B 5CIPH 4OD2A 3T4AA 4KHTH 1EV2E 3SE8L 4AJ0A 3T0BA 4PJFF 4JFED 1DQMH 1WWCA 3DX7B 3PWPA 1B6DA 4LLUA 2BXZA 1YEHH 2FX8H 1DQDL 4KJWD 3PGDA 1CLZH 5IG7B 5GS0H 3RPIB 2MOVA 5ICYB 4NQED 3BGFB 1CFQB 4MYWB 3UTTB 2APFA 3IU3B 3FO1A 3TIEA 4R4BA 1PZ5B 1QBAA 5C0JA 4OIBA 1BZ7A 1G7JA 2DM7A 3U6RA 1ONQB 3G5YB 1YJDH 5D71H 3QDMB 1JJUA 1U8NB 5FO7B 1KEGH 1DE4B 1F90L 3NFNB 2WIIA 1MLCA 4ELMA 2Z8SA 4JZJA 2VQTA 4OLXH 1REIA 3TVMA 1HXMA 1BBDH 1U3YA 3WXWH 1IGIL 3DV6B 2P5WB 1XF3B 2CUIA 4G9DB 1FIGL 2BHUA 3IDIA 4BH7B 5MP6H 3QWOB 1S5HA 4GW5B 1I7UB 2FJFA 4YHIA 1MY7A 2WBJB 1Y6NR 2E7MA 2C1PA 4FQJL 1WWAX 3S34H 3AXLB 5ANME 3TH3T 3RI5K 4QHLB 4UT9H 1CD9B 4MNHA 1ZA6B 1E6JL 4DQOH 3FFCD 2CDGA 1U91A 1UCBL 2DWDB 3L3JB 4G8IA 1XIWB 4ZPTB 4WW1A 1N64H 3S35H 1CK0L 3IDNB 3I6GB 3MXVH 5ERWA 3BESR 3GBML 3MV8A 4ZMAT 1NMBH 4OZGE 1QKZL 3JZ7A 1QHPA 4OM1L 4PJBF 1R3HA 2P45B 4LVHB 3SDXE 1X5FA 2V2WA 4KZDH 1P84J 4E0RB 5FEBA 5E8DH 5HDOA 3QA3B 2RAMA 3BGFC 1KPUB 3PWJB 5C70A 4LMQE 3GGWB 5I74C 4G8GA 4ODTH 1FFPA 2L7JA 5I1JH 3RUGA 5FECA 2DKSA 4NM8L 2Y4SA 1T22A 3SOBL 4XPGL 3D1MC 5D7JD 2X4OA 4JFZH 5EC1A 1RI8A 3RY5A 4RMSA 2DQGH 5D7LA 3GSXA 2NTFB 5HPMA 3GMPA 2H3NA 4TSBL 4ZUWB 4Y0GA 5CKGA 4LK4A 3HN3A 2AJVL 1T21A 2AK4D 3LS4L 5GISL 3EAKA 2WBJC 3IB4A 4JKLA 3VG9C 1J8HE 4NZJA 3X3FH 1T5WB 1MFEL 4LCUB 4H0HB 1E4KC 2V2XB 3OL2A 4WI7A 1JZ6A 3DMMC 3LPWA 5IVXA 3BGMB 4CN4A 5L88L 4R7NB 2I9LA 4HW6A 1XIWC 3VFWB 5B38G 2X4PB 1U8PA 3HRZA 5C0BA 5GS2D 2FECI 3PHOB 1TZGH 3QUZB 1G9NH 1D5ZA 2G2RB 1TMCB 3UTSD 4OLUL 5F7EL 2BC4B 1YN6B 3WFEL 3E1F1 1Z9LA 1JGUL 2CGRH 2YD3A 5KS9A 5IW1B 4HH8A 2VWEE 5EZIL 4FHBD 1T2QL 4R2GD 3QQ3A 4X4MA 1P2CA 1NFDA 1LNUA 1A7PL 2XWTA 3KXFB 3ELAT 4XWGH 3BD5A 5J56B 5EZLB 1U0QA 3DHJA 1UH4A 2QHLA 1I75A 4YHPA 5LCVH 5E56A 1F4AA 3Q1SH 1EZVY 3MZGB 3QFJD 2DTML 2ZG1A 4XGZA 3OKEA 1X5LA 5A43C 3IGAA 3E0GA 1GZPA 2X4RA 3Q0HA 3O3EB 3S5LG 2R0WH 4EXKA 2DN7A 4OD3L 5BS0B 2PN5A 1H3UA 3D85B 5GGVL 5TDOA 2RIKA 3GUTB 4XCYB 3UBXI 1HI6B 3KPPB 5F6IB 2VYRE 3IT8D 4KDWA 1FYTE 3T8XB 3ALWA 3CH1A 3MRHA 1ZLSH 4MB5A 2V5YA 4OLWH 5T3ZL 3PHQA 1FH5H 4WRLA 1SY6L 3HMWH 2NY4D 2YS4A 4PJXE 4S1DC 3QEHA 4N9OB 1F8TH 4L8BB 3KYNA 5DC9B 5GSRB 4EI6A 4OZIA 3O6MH 1IGYA 1MREL 1RHFA 3U0TA 2ITCA 1VKXB 2IBBA 5GRXG 1MF2H 3QUZC 3KLHC 2Z31D 3LKNA 3S4SB 3ZSTA 4HUXA 1CN4A 3LRHA 1MCEA 1MFNA 2YUZA 3CFBA 3GSNL 4YDVA 1I1YB 2DLHA 4QGYA 2JE8A 1CD1A 5BVPH 1WIPA 1FL6B 1WF5A 1EGJA 2R4RL 5DA4A 4J6RH 5JA8B 4HHAA 2FWOA 4L3CB 5CUSH 3GKWH 4Y8DC 3BVNA 2DQJL 1SEQH 4OAWA 5IVNA 1IZJA 2ZKHH 1IEAB 2BVQA 2OCFD 3DRQB 2WWMD 3BIBX 4XPHH 1EVUA 3PWUA 1CFBA 1KLFA 4RWHA 4S0TD 3RKDC 1QVOB 1I8IB 1KCVH 1JTPA 3TWCL 5EU7C 5EORL 1LE5B 3ULUH 3CC5A 5D93B 3CDCA 1ZGLB 5HGAA 2PCPA 1JHTA 3BRGC 4LSSL 3S96B 4QRTB 4DN3L 3TFKC 5F6IC 2XN9E 3PQYD 4MCYB 3MJ8A 3F8UB 1NLBL 3LN5B 3KPSD 4F37K 1I7ZA 5TDNA 3DLQR 4YHKL 4N1CA 1FFNB 4GT7A 1T5XA 2AABL 4LVOC 2NNAB 2ZP0T 1MCKA 1UWGH 1KV3A 5IVOA 2AJ3B 2Y36H 1HILA 3S36H 3B5TA 1CGSL 4TRPH 3D18B 3OKKA 3I3BA 4CADB 2VL4A 1WT5A 4PB9H 4ZSOB 1UJ3B 4BUGA 3O6KL 5BVJB 2VSDA 5BV7C 4M02A 1Z5LA 4ZDHB 2Y06L 1SBBA 2NCMA 5IBLC 2C7UB 1N0XL 5MHSE 1RJZA 1JZ4A 5AYQA 3H6JA 3GSOB 4QXTB 3SGKC 3B3IA 1CQKA 2ZOKB 4JCLA 1IILE 4LSVL 1MY5A 3IU4L 3MGOA 1OP5H 5T3ZD 5IESL 1BF2A 3R06A 4QTIL 5GJSL 1CS6A 3QCTL 4ZOEA 4NYLA 5CJ5A 2JELH 2DQHH 4NKOA 3TT1H 1CDCA 1J12A 5CEZE 3UBXA 3RDTD 1VFBA 2VAAA 4NQDB 3OGCB 1IM9B 4JR9H 5I6XC 1JK8A 5T1KB 5CSZB 3OMZA 3V0WL 4YBLB 3NTCL 1XT5A 3LQMA 2Q7YA 2X09A 3MNWA 3PV6B 5C6TL 3LDBB 2Q86B 2NMSA 4CVZA 3IFNL 5C09B 3VFOA 1JWUA 4S1QH 1DVFD 2YUWA 4LLDA 2YZ1A 4OD2B 3P4MA 3T4AB 1JWMA 1XR9A 2JCCF 1N6VA 2K9UA 1YEEH 4CU7A 2JJTC 4U1GB 3PWPB 4LLUB 4EVNA 2F53E 1VFAA 3PGDB 3DX8A 5FOJA 5DHYA 4X99A 2KZWA 1V7NL 3FO1B 3TIEB 1UJ3C 4R4BB 3CFIC 3HAEG 5C0JB 1BZ7B 1G7JB 4Z76A 3HFMH 5D7IA 3U6RB 1HYRC 1UYWH 5BMFL 3HPLA 5JXED 4QWWD 4BM7A 3ZE0F 1OAKL 3HE6D 4JHWH 35C8L 4F9PC 8FABA 4PJAF 3MLRH 2WIIB 1MLCB 4ELMB 1BECA 4JZJB 4I2XA 4AK1A 3TVMB 1HXMB 1SYVA 5D96C 3TN0A 5K9OA 1NCWH 5TGBA 3IDIB 1NC4D 3Q5YA 1S5HB 5E8EA 3CFEA 2FJFB 1SJEA 4YHIB 5F7UA 3GSRA 4HIHA 3GNMH 2C1PB 5LGHH 2V5SA 5FYJL 3WFZA 1G7HA 4ZFGH 3VMOA 3QEQD 1EA9C 2GT9A 3X12A 2XTJC 4MNHB 1JHKL 2CDGB 1U91B 1X6NA 2E6PA 4G8IB 1CFVL 5DUML 4Z7OF 4WW1B 3LDBC 3P11H 4WI6A 5C1MB 4LSQH 3DETD 1VPOH 4GLRI 5ERWB 2E9WA 1HWGB 1RPQA 3MV8B 1L7TL 2NY5H 3FOMA 1R3HB 4U1GC 4DJMA 3UTTE 1MI5A 4POZC 3RAJL 1N3NA 4OCLC 2V2WB 4KMLB 1TJHH 1TNNA 1SM3H 5IBTH 2EDWA 3QDME 1IKNA 1YECH 2FEDC 4G8GB 5GGQH 4WGWB 1FFPB 1Z0MA 2UUDH 3RUGB 5FECB 4P0DA 4LRNH 2W92A 4FNLH 4XAKD 5CIPA 4Z0BH 2P5WE 5J06A 1T22B 2NY3B 2AEIT 4NN5C 2J88L 1IGFH 1CDUA 2X4OB 1IGTA 5EC1B 5C0FA 2HVKA