5D7KE

Structure of mr1-reactive mav36 tcr
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
241
structure length
241
Chain Sequence
VKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSPSGYQETQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MAV36 TCR Alpha Chain
total genus 62
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7kE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7kE02
3N06B 2ATPA 3LN4B 1OQXA 3VFMA 3WFHB 1UEMA 4V2BA 4ZXBC 1YEFH 3SY0A 3QEHA 3VFGL 1HE7A 3MFFA 5GS1A 5DUML 4EBQH 1I7RA 4BM7A 4QXTB 4ZFGH 3IFPA 4LQ1A 2P5EA 2DQJL 2C4FT 1TZIA 1KTLA 3WHXB 4W4OA 2WBJB 4WUUB 4JFDB 3FL7A 4NHUA 1RUQH 1O7VA 5F9WB 4XMLH 1KLGB 1UH4A 3I9GL 3MRBB 1UZ6E 3H9SE 1JPSL 3O3DA 4UNVA 1HEZA 12E8L 3H3PL 4LIQE 5SWSA 1D7FA 1NC4B 4N1EA 1JPSH 3KLDA 4UQ3A 4HKJA 3FMGH 3X13A 3L3DB 2QQKH 3U1SL 1P9MA 2ICWB 1IZKA 2Z8WC 3VWKD 1UB5B 2HRPL 3MNVB 4MMXC 3N85L 1P4LB 2WWKT 4I0PC 4ZFGL 5GSVA 3U9PH 2HTKD 1NCCL 1YN7A 2AJUL 3SDAD 3HN3A 2NY7H 1GPOH 2ICWI 3IU3A 5ALBH 1FNGA 4G9FD 2FATH 1QYGH 1Z0MA 4OB5L 5B8CA 5DVOA 2DQTH 5KAQF 3SDDD 3MFGB 3TBSB 4ZUTB 1U3HC 3WYRA 3OAYK 3QUZB 1YQ2A 2DMKA 2Z0BA 4GXVH 3T0EA 5A2JH 4ZOCA 5D2LE 3MCKB 1CD9B 2DQUH 2XFXA 4MAYA 4XH2B 3RWEA 5IMKA 3OJ2C 1I7UB 3GMMA 2V6HA 2X89A 4WFGE 3OB0H 4OCXL 4Y1AD 2ESVA 3CMOL 3OKDA 2JCCF 1FNSH 3QPXH 4G43A 2EE9A 3I6LE 2HLFD 3U0TB 2NY3D 4L8SA 2VN7A 5CEZE 4R7NA 3T4YB 5L7XL 1GSMA 3IAQA 1S78D 3TH2T 4Y2DD 4GG8B 2UZYB 4QHKJ 5EOQL 3GRWL 4OFYD 3RVTC 3H6JA 4HLZG 2GKIA 4JRYB 2APBA 3IU4H 3KPNA 3ORJA 4Q7DA 4WUUE 1FAKT 3ILPA 1J86A 2NTFA 4ZTOL 3DV4B 4WVRA 5L8LB 1JGUH 1TVDA 3FOLB 3QCUL 2YPLE 4XMPL 4LDLB 2EYTB 5ADPH 1S5HB 3SE4A 4N8CL 4H1LG 3MJ6A 3D48R 4PJ7B 4UV7H 3T65A 5I1AB 3C2AL 5FO7B 1BEYL 4YHKL 1U8QB 5LGJA 5HHOE 2OP4H 3LKSB 3B2UC 1T5XB 4KHTH 1BHGA 2IQAB 3MRIA 1F5WA 4YDKL 5D70L 2I25N 4OGAC 4OBRA 4QRPA 5CEXA 3T8XB 3ECBA 3QHTC 3L5WA 5ENWB 1UM5L 2YD8A 4LLVB 1VGKB 3CPLB 4N0YH 5C0CB 2OSLA 1QO3B 3MMEA 5F7FA 5BQ7A 3IXTB 1TIUA 1E0OB 2XG4A 1U8NB 3BSZH 4LEOB 4NKDB 4QRTA 1UWEL 3G6JF 2FJGA 3QDGE 4OZGF 4DQOL 3VI3F 3P4MB 3LSOA 4PTTA 3EO0A 4P5TD 3EDKA 3UTSE 1GOFA 1X5ZA 5DJXA 5LWYH 5EU3B 2Z93A 3F7PC 3S96B 5DHVH 4Q2ZA 4WI4A 1XEDA 2P8MA 3HMXA 1KSRA 1FYTE 1UQSB 5J12B 5SWSD 1AY1H 4M9OA 1C1EL 5DA0B 3DVFA 4XNUH 5EC2A 4BH8B 4GRWH 4XP9L 4KRNA 3DLQR 3QQ3B 1CG9A 3BWUC 4MA3A 4Y16C 4TTGA 1AGEA 4PJFF 2CRZA 1MVUB 3EOTH 1LE9A 4X6DB 3OKKB 3TZVA 3VFVA 1ZT1A 3RPKA 4KK6D 4ZOBA 5MERB 4OSUH 1QLEH 3B2UD 1GIGH 1E4KA 2VXTL 1MRCH 3GMPB 2KUTA 2WZPD 2K1MA 3QAZC 4JVUA 2DM3A 2CDEB 4KQ4L 4PJEF 4XCFL 2YWZA 1UQSA 4MVBC 3U4EB 4KVNH 3EDEA 4GAFB 3KJ4C 1N59A 1FNEB 3B9AA 5CUSL 4YHPB 3PL6C 4EI6A 2AJZA 4BQ9A 5HHXL 1EGJA 3T8XA 2AJSH 5TQ2L 4DCQB 2H1PL 4JREB 1E4WL 2DM2A 2GTWA 5CMAA 4QT5A 2AS5M 1BAFL 3B6SA 1ZSDB 3RIAK 3QH3B 4I77H 3MC0A 3RNKA 1MFAL 3U4BL 2VB5A 3WO4B 4GAGL 1X5KA 3MBXH 1NMCB 2BSTA 4H0HB 2ZUXA 2O5YL 2QADC 4W4NA 2ED9A 3D1MC 1JWMB 2XPGA 4OZFB 4ZXBA 3GSQB 4HIHA 1DBAH 1A6UL 4H0GA 1QO3A 3MMEB 5KANG 4KUZL 4PFEA 4NBZB 1L7IH 3QQ4B 3O6KH 2UVEA 2IH3B 2B39A 1UYWH 2CDGA 3REVA 4JFQA 1S9WB 2ICCA 3U82B 1Z6JT 1KJ3H 1UXSA 3LKPB 4CU6A 1Q0YH 1NSNH 5SV3A 2G75B 3G6AB 2NY2D 1R3JB 4U0QB 1AKJA 2AV1A 1GL4B 5ID1B 1T0MA 4U7KA 5ELIA 3DTXB 3QDJE 2VISA 1V05A 1LP9A 1D9KB 3FQTB 3FQWA 3HI6H 4O2EB 3TNMB 3RL2A 4ZFZB 3WMSA 5HVFB 2B1HL 3RVUD 1AQKH 1U8IA 1V7NH 1CF8L 3D85A 3KPNB 4PR5B 4UAOB 4JJHA 3SO3B 1TCMA 3DO3A 1X44A 1SMAA 3VG0L 3ZE2E 2EO9A 1PZUB 4MNGE 5KVFH 5CJXC 2FX8H 1KJ2L 5C07D 3MGTB 4UMGA 5DJYA 5C70A 1K2DB 1KTRL 2FH8A 1J5OH 3PWVA 3QYCA 4NO5A 5KSAB 4U6XB 2D9QB 4WUKH 4UDUA 5FUCC 2C9AA 1JGLH 5GRUH 4RAVA 4PJGE 1QFUL 2X7LB 2D4DA 3GSRA 5T1KD 2LU4A 2V5MA 4OF3A 3V0AC 4G43B 5D71L 4XPHH 2XXMB 5HHOD 4DZ8A 2XICA 1XCTA 3TA3C 3OKNB 4BH7A 3C2AH 4GBXD 4R4BA 1U8JB 4NRZA 1F4YL 3WHE0 3ZYZA 2APXA 1AQDA 4NUJB 4X7CC 3OJVC 1OM3H 4KI5C 3GUTA 3WJJC 3CX5J 2APTA 3CFEA 3DX9A 2A2QT 3CPLA 2XWJB 5E5MA 5I76B 4FN0A 4B41A 1R5IB 5FYKU 5KZCD 1T7XA 3B2VL 2W0PA 4NQSA 2XV6B 5EOQH 2GUOB 1DN0B 2ADFL 1I85C 3UBXB 2CQVA 1CT8A 1BFOA 3QCVH 2F5BH 1JL8A 3MO1B 1UZ6F 3WUWA 4MSWA 5LGJB 3I84A 2X4RB 2PYEB 4HG4K 2GYSA 2A9NH 2X9WA 4KHTL 3UJJH 1MFBL 1F3JB 1KJ2B 3X13B 2RJMA 2HJKA 4MJID 3STZA 5KTEL 3CNKA 4JRXD 1MQKL 3O4LA 1U58B 1VADA 1JGLL 4S1QL 2VLJA 5GRUL 3B9KB 3EJYC 1S9VA 1UC6A 2R69L 1ZLVH 3QZWA 1IFHH 4PRBB 1X5FA 3L1OH 4L8CB 5E8DL 2WLZA 3WN5B 1I7ZB 4G9FB 4LCCA 3VGFA 2X9XA 3UJTH 5C0FB 1NFDE 1OAKL 3P11L 3REWA 3GRWH 3AREA 4JKMA 3EYSL 2C4FU 5T5FH 3AY4C 3ABZA 3DI2B 2J8OA 2HT2C 2JTDA 1S5IH 2FJHB 4QHNA 5HGAB 3EUUA 4M5YL 4ZUUB 1XIWC 1MCQA 1E4KC 5DSCB 4LRIA 4CW1B 4KK8D 5JLZA 4PJIB 4ETQB 1S7VB 5IJKA 2ZCHH 4HWBA 4PJAB 4X5XB 4YBQD 1IC5H 2IPKB 5DF0A 2YXFA 3I85A 2ARJA 1QTYT 3H9HA 3NCYP 3WFDH 5FFLA 5IR1B 2P5EE 3NIDE 4L5FH 4FHBD 5IROA 5CZVL 5F1NA 2XQYG 3ZT5A 2HFFA 3DYOA 1QEWB 5GGSB 3K2MC 4LRNH 1AHWC 3WBDA 3FO9A 5D7KD 2VDLL 5CIPH 5DJZA 2Q86B 4WO4A 4ZG1A 3VXPA 2D2OA 3WNPA 2D03L 5HGBA 1O5DT 1OGAE 3BPLC 4PLNC 3EO1A 2L0DA 5F3BB 4I48A 4JRYE 3QHZL 4LSSL 4UBDD 2X4UA 1BWMA 4A6YA 4NN6C 4NRYA 3MNVA 4KHXH 1W0VA 2H32B 5KTEH 1FNAA 3DMMA 1YY8B 2CSPA 3L3IA 3PWPA 2OMBA 4YEFA 1NCBL 4DKFL 5E9DA 5IHUH 4OQTL 1G6RA 1C5CH 1NANH 2IMNA 1URLA 1SJEB 1XGTB 2D31A 3UO1L 3WFBL 5HVHC 4WI3A 3VWKB 4XZUA 1RHFA 1A02N 4OLVL 5BW7C 4LF3A 1IAOB 1F4XH 1RVFH 4JHZA 1V8HA 2YZ1A 4Q9RH 1IGIL 1IQDA 3U0PA 7CGTA 5FB8A 4LOUC 5D7JB 1JGVL 4QXTA 2WBKA 3H0TB 5GGTL 4ZMAT 1F42A 5GS1B 3SY0B 5J7CC 1EEYB 3HMXL 4M93C 5E9DB 4GBXC 3OKLA 4O9HH 5F9DC 4P46B 2NR6C 8FABA 3GJFA 4MJ5B 3TIEA 1P4BL 1KIQB 1CWVA 4S0SD 5EDXA 1TMCB 3ZMRA 3O2WH 5C0BB 3AGVA 5ITFA 5E6IA 4MHHI 4MWFB 1CK0L 2V9TA 5SWZD 4M3KB 3VI4E 1CZ8L 2B2XL 1A6TA 4QY8A 1NAMB 2EEDA 5BS0A 1HHGB 4XVJL 4UTBH 1Q9KB 5E24E 3TO4A 2AXGB 2GSIA 2X1OA 5DO2C 4IM8A 5FYKE 3TJEH 2NY6C 3MA9L 2ZKHH 1OTSC 5DJDB 1F6AA 2BRRL 2ARJQ 1RZKH 1CL7H 5J89A 1U8HA 3HAEH 3KPSA 2ZKHL 4KDTC 4PTUA 4KTEL 4N5UA 4RGNB 1L7IL 3RDTA 3SQOL 3QIWB 3HG1B 4R96B 1DDHA 1AP2B 3IJHA 4K9EC 5DO2D 3H9HB 1U36A 2WUBH 5HDQL 5K9KB 1R0AH 2DQTL 1D6EB 5CEZH 3D39E 2VDML 3BXNB 5DHXB 4LVOC 3AMKA 4RX4D 1CFNA 1F00I 4C57C 3VD9A 1NEUA 3DJ9A 3V95A 3KLHC 4I77L 1I3RB 1TJGH 3V7AE 4CMHB 1XF3A 3DGGB 5HGBB 1IAIL 3KPSB 4JDZB 5GRYA 1VFUA 1ZXQA 2J12B 4U33A 1U92A 4LP4A 1I8KA 3VWJB 2YPKB 2C1OB 4GMTH 4HUXB 4AY0A 3P4OA 1XGPB 4O2CA 3X3GH 5HI4D 5BCAA 1UACH 4Y4KB 1FH5L 1FVDA 2KKQA 2VLRD 1I4FA 1AJ7H 3ZKNC 3U79A 1X4XA 5A3ID 4PJ8B 5D1XA 2BOCA 2QTEA 1DSFL 4QOKB 3AB0B 4HPOL 3DWTA 3I2CH 5IHZA 1H8SA 1KV3A 3LH2H 1GXEA 4XPAH 3CLFH 2X4QA 4LCWE 5D7LB 5FB8B 1A2YA 3MV11 3QHZH 1EJOL 4LSPL 3P9WB 2H41A 4LIQH 2W9DL 5T5NF 4H20L 4N1HB 4KV5F 2AJVL 3WN5A 1WC7B 2YOCA 3E6FB 4POZD 1CGUA 1FV1B 3CFEB 1ZLUK 4LLMA 5C0BA 1JVKA 1OT1A 2EDXA 1U2CA 15C8H 3STZB 4OCXH 3ELAT 5D2NA 3MJ9A 1OTTD 1KCUH 2HFTA 1U93A 15C8L 3MLVL 2VH5L 3HUJF 4LSQH 3UYOD 2B5IB 1FN4B 4ZFOA 1P7KB 3KNBB 3DGCR 1MFCL 4JFDE 4ZS7L 3SN6N 3QO0B 3WLWD 4YFLI 4DZ8B 5EZLB 1J88A 2R1WA 3QT2A 3VA2C 4M6MH 4R0LB 1UWEH 1RK1B 1NLDH 4MCZA 5CP3A 2GEEA 2HG5B 3I02B 1IQDB 1UCBH 1NGQH 3PL6B 4ONFH 3C5ZA 3HI1B 4HBQA 5KS9E 5C07B 1EDQA 1CGSH 5E5MB 5I76A 3HCVA 3DO7B 2V2TB 4PJ5E 3QWRA 4NP4L 2R1XA 1PKQB 1XR8B 4HXAL 4GUPB 4C56A 4EUPG 1DSFH 1YDPB 1ZS8B 1QFPA 2BJML 2X4PA 3PHOB 1CICA 3A67L 1BEYH 3D9AL 4A6YB 5I73C 5HHME 3QUMA 2DYPA 2DI9A 5ALCH 4Z7OF 3KHQA 4NQCD 1MFDH 5IHBA 3FO0L 4AEIL 1FORL 1B0GA 1ZLWK 3GM0A 1D5XB 1S7TB 4GAYA 4R0LC 2NPLX 1IVLA 3VH8A 2F74A 1XGQB 4R3SA 3LRGA 4L8BA 4XRCA 1A1NB 1EERB 4XCYB 4JFQB 4RMWA 4PBWD 4RMUA 1KLUB 3UPRA 4L8CA 3D25A 4BZ2L 3LS4L 3QRFM 5DRWA 5I1KL 2XTJE 4R4FH 4YBHA 2JJTA 3P0VL 4LCYB 3ARED 1A0QL 1RPQA 3RL2B 4ODWB 3O8XB 2J3SA 3V4UH 4JDTH 4X4YB 3DTXA 5HGAA 4NJ9H 4K7FA 4E41A 3FN3A 2YEZB 2FJHA 3MLUL 4X5LA 2DMCA 1R3HA 4YHIB 1XR9A 2BC4A 3VJ6A 1CL7L 3NCEB 4X7TA 3J8F7 3HE6D 4OIIH 3TN0B 4EDWH 5IT2L 4GG6A 1JWUB 2AK1L 4ODXB 1RZ8A 4KJQC 5D1QD 4LCCB 1KIRB 1KJ2H 3DXAA 1UA6H 3LQZB 5F9AC 3NIGF 2JJSA 5BZDB 4BJLA 3V5DB 5KSVA 3L3GA 3O2WL 4AQOA 1KBGL 2L4OA 4N0UE 5DR5L 2R2HB 4AIXA 4K3DH 2BSRA 4F37K 2VDMH 4HUVA 3MV9E 5EPMA 3DOSA 1FNSL 3QPXL 5LQBH 2EIEA 2DIBA 5JR1H 4R4ND 2OI9B 1ZWIB 4N8PA 4ZPTB 1ZA6B 2BVUA 3H2WA 5DFVD 2VUOA 1UYWL 1FL6A 5ABDE 3ZKQD 2CO7B 3FONB 1F4WL 5FGSA 5LAXA 1AE6L 1MJUH 4YO0B 1N59B 1PLGH 4KGLA 3I9GH 1YEHL 1YPZA 4JDTL 2ITDB 4P2CG 4OAWA 3ISWA 2N4IA 1A9BA 5HI3C 1UH3A 3MRQA 3SKJL 3QPQD 4NO2A 4XVSL 2KZWA 4Z7VF 4ZSOA 1MFEL 3CZFB 1HXYB 3LEYL 4X8JA 4GAGH 4PR5A 3LH2L 4HC1L 5EU6A 3ZL4L 4EOWL 5J9PB 4UNUA 4OZGB 3G6JA 2AJ3B 3VFTB 1KG0B 3FN9A 4P3CH 6CGTA 1D9KA 3FQTA 1NDGA 1T4KB 5IVNA 5ID1A 5GGTH 5FDWB 2X7LA 3GSRB 3SKMB 3THML 4DKAA 3IDIA 3SPVA 5KSBE 4KQ3H 2XXCB 1WFNA 2DI7A 4EN3C 3MRQB 1DP0A 1EO8H 4XWOC 5ADOL 4FQ2H 4YGAB 4TNWF 2CDGB 1FIGH 4OGZA 4HEPG 5D7LE 5KBNC 3T0WA 1PBYA 3GSXA 4HJGB 5I74C 1P6AB 3CFBB 1T03H 4PLJD 3V7AG 4HX1B 4EVNB 3TCXA 3PNWB 4JFED 5IB1B 3GSQA 2VLKA 2XZQH 4Z7UA 2B5IC 1F8TL 3MBEA 5C7XL 4Z8FH 1MREH 4L8DA 4ESKA 3ROLB 4M43L 5I9QB 5J6GA 3O81A 4WI9A 3FFCE 1KLFA 5DUPL 1ZSDA 4J23A 3VDAA 3DV4A 1UXSB 4HIJA 4YX2H 1ADQL 1SJXA 3LCYA 3KR3L 5KSVB 3N0PB 3P3YA 4GS7B 2Z31B 1TCRA 3BZ4A 5SX5H 3EKCA 2J4WL 4YHNA 3FAXA 1Q9OB 4XPFL 4AIOA 5HYJE 1KEML 2BOBB 5JQ6H 2EECA 3FTGA 5KVGL 1FVEA 1WZMA 2J7LA 4WW2C 1DQDH 1MJJB 2F54B 1UM6H 2AJYL 3D0VB 2A9MH 3BPNB 1CS6A 1T2JA 1R3HB 1CD8A 2IBBA 3QXAA 1UEYA 3DBXA 4IJ3C 4OCWH 4UNTA 4JN2A 5IB3A 2DICA 3BSZL 4NC2B 4E5XB 1KACB 3WL9A 3OKYA 2R29L 3EO9L 3S88L 2ZNWA 4KRPC 2AVGA 4HMCA 5H37H 4ZYKA 2WIIA 1FNEA 4G9DB 5HI3D 1NL0H 4X5WB 4L9DA 4Z7VE 2D7OA 4CL7A 1EFQA 1QP1A 4PREA 1YJDL 4KY1L 3CVHL 2P8MB 3SGDI 4J3SA 4LVHB 5HHVL 1HNFA 4NPYA 3H7LA 3LHPH 4L29A 3S3PA 3TVMB 2F54D 1CGVA 5FKPB 1P4LA 3H42H 3SKUD 1UXWB 2LAGB 2CGRL 2YUWA 3JUZA 5DMKA 4XH2A 3RWEB 4OLYH 1GGIH 2X4PB 3CVHH 5GQBA 3EIFA 1N7ML 4CVXA 1JGUL 4H5SA 5DD3L 1NFDF 1QBAA 1T7VA 4OGYL 2ICEA 2Z92B 3D3VE 2HJLA 2IADA 3Q6FA 5IESH 1CFSA 1RSFA 4YXLH 3K4ZA 4PRHB 2EDOA 5SX5K 3NFPA 1MH5B 2LABA 1V7MH 3C5ZB 2DLGA 4N8VG 1CFQB 1F11B 3CSYB 1DQJB 4Y0GA 3LN5B 4IDJL 3LKSA 1RAMA 3X17A 5I0DA 4NZDA 3PGDA 2R1YB 4OCWL 4HWEL 4M93B 2VZ3A 3SE9L 2MPAH 4AM0A 4NOBA 3UJIL 1FRGH 3CMOH 4HZLB 1I1AB 3QUML 1ZK9A 2V7NB 4UI2A 1KJ3L 2BDNH 2DKUA 4HV8B 3HRZA 1YNKL 5DJCA 3IDXL 3CH1B 3E6FA 3MOAL 4NO3A 4BZ1L 2FHFA 2D7NA 4R4NC 4WUUA 3VFRB 2AW2A 1P4BH 5EU7C 3RDTD 2BNQB 4FNLH 2IANB 5D1ZC 1CQYA 4OF5A 1A5FH 5FYLE 2VLKD 5D6DA 4NCDA 1JGEA 3CSBA 4JQIH 1CF8H 4NN7B 1RY7B 3V6OE 5L88H 3RIFF 1X3DA 3W0WA 5FHAH 2VQTA 1ERNA 3S3JA 3BP4B 1TZGL 5MEPB 4NQEB 2NW2B 1QSVA 4MAUH 2HRPH 2P8LA 4OT1L 4K3HA 4MJ4A 4OLVH 3ZKSD 3MCKA 4MJ6A 4HF5L 5M95B 2DBLL 2CKNA 1ZS8A 4XPBL 5DD5H 3TH4T 3ARZA 2R8SH 5CBAA 2AK4D 5F7DB 3VWJA 2MQ3A 5DC0A 1BQLH 1QSFA 5E99H 5JPNB 1HWGB 4H88H 3GSUA 4RDQF 3EYFA 3VFGH 3LY6A 4R7NB 1QA9A 3R06B 4L8SB 4LL9A 3VXSD 1T7YA 3F12B 3QIUD 1RK1A 4JE4B 2VDRL 2VNCA 1J1PH 4AEEA 4HWZA 4HS8L 2YR3A 2EYRB 4Q6IB 2SEBB 3RQ3A 2GAZB 1JYXA 4DN3H 2VLRE 3IKKA 3B9KD 4ZFOB 1KXTB 1JTPA 5ANMB 1WCBB 5HY9A 5IBTH 4CRPA 3CVIL 1WT5C 4NWTH 3G5XB 2XQBL 3VXNA 4NN7C 1YDPA 4XPHL 4OM1L 4JANB 3MLZL 4KKLC 1MRFH 4GS7C 2PYED 1OAUL 3SGDH 3TJEL 4FQJH 5MHSD 1OARL 3DX6A 3MV01 5JUEH 1LO0H 4YGVB 1JMZA 4Q6YA 5GGVY 5A16B 2WP3O 2EKSB 2Y06L 1NEZA 3DUUB 5JW3L 4YDVB 5KZCB 3QG7L 1WJ3A 3WO4C 2JB6B 3V0VB 5B39A 3UDWA 2V9QA 5F93C 4F7EA 4UU9A 1FGVH 3RWGA 1W72L 2UWEF 3GMQB 4X6DE 2DQIL 5I8OH 4MB4A 4MAYD 3WS3A 2F19H 5KG9B 4NQDD 4UB0H 4IMKA 4K7PX 2CLRA 4S1RL 5HHQA 4NM8H 1IM9D 1JTOA 2AJXL 5J06A 1JIBA 4IRZL 4HUUA 4HK3N 1MELA 4Y5YB 3VRJB 1NAKH 3PHQB 4G80A 4C56D 3EGSB 2ZPKL 1I8KB 3BH9B 3Q3GB 5AAWA 5IOPA 2MPAL 1WIUA 3CXHK 3N9GL 3FQXB 4FTVB 4J3TA 1NCBH 2I07A 1PD6A 5I1DA 1A6PA 1DQQA 4O58H 2ITCB 5MENE 3IDGA 3F6IA 1KJVB 1YEEH 5I18L 5E7FA 1FFPA 1EHNA 3UTSB 3EYOA 5EBWB 1CTOA 1VPOH 3TO2B 4I3GA 3P77A 3U30B 1IT9L 3MJ7A 2EICA 1T22A 4HH9B 4NGHH 3NIFF 2O5YH 1UVQA 2FD6H 4POUB 1LO4L 4RWHA 3LS4H 1DDHB 1RZFH 2HH0H 3IJHB 4P5KB 1QRND 2CD0A 1IQWH 2JELL 1G7PB 2V5TA 4FFVD 5BRZE 3PL6D 1MHCB 3VXPB 3T04D 4NRXB 2FLRT 2NY2B 2QSTA 1QR1A 3BH8A 4U1HA 3DHMA 1P7QD 1MCKA 1ZE3C 1QEWA 2VTFA 5IK3B 1XF3B 3DGGA 5I17B 1KCRH 2ERJB 4NZUL 1L9NA 2OP4L 4G9FE 4MAUL 2QSCL 4EUPA 1DUZA 1JK8B 3ZHLA 2Z31D 5FUOH 5GRVL 2BERA 4Y5XC 4BSJA 3SDCA 4ERSH 3BE1L 3A0OA 4MDJB 4PV8B 1KIQA 3W2DL 5DSCA 1KGCD 2YPLB 3I50H 4YHOH 2F9BT 2KQNA 4HQQH 1BJ1H 3QULA 4HAGA 1INEL 3V52H 4GBXA 3LN9A 5KSUB 1U8HB 1DFBH 1KENH 4LSUL 3KXFB 1UWXH 4LRNL 4NO0B 2OQJA 3EHBD 5F70A 2BNQA 1C1EH 4JPWL 2JJSC 1YEDB 32C2A 1G6VK 4K8RH 4S1QH 3BDXA 4M7KH 4PJFA 5TGBB 1JI1A 3MUGA 3O8XC 1DUYB 1CXIA 2GK0B 3QDME 2W07A 4TUKH 1LO2L 4JFOA 3B9KA 4JLRB 4FQXA 4RMSA 3T77B 3QWOA 4E42B 2WP3T 4NYLA 3P4NA 4NNYA 2N56A 3MLWL 3OL2A 1NMCC 2BSSA 3OZ9L 1Z3GH 4ZOEA 3AMLA 1BOGA 2X1QA 4XGZA 3DECA 5LWYL 2YA0A 3IDGB 3P4LA 3UAJD 4RIRA 1ZHNA 4ZS6C 3V6FB 5GZNC 4MZ2A 3MUY1 5CJBA 3V0VA 3MZGB 4JDVB 3CFDB 4JO1H 4YE4L 1H5BC 5DFVC 2Y36L 1CN4A 3MJ9H 1ZT7A 3UBXA 2ZSVB 1C5BH 2XNAB 3BFOA 2WWMC 4KXZH 3GFUA 4PRDA 5E2VH 1QPPA 3SDAB 4U6YB 2FWOA 1RJYA 1HH6A 1KOAA 3GSVA 4QXWA 1FCGA 4KZDH 2W0KA 1GAFL 2IADB 2YD3A 3HE6C 2ICEB 2Z92A 3ZKXC 4LMQE 1FH5H 1J87A 2VDQL 5GGRB 3T4AB 5IWLC 3TF7C 4M9PA 1L0QA 4LCWD 3GJFK 1NAMH 3WIIH 4JZJA 4P3DA 5IF0B 3VXTB 5DD5L 4NZTL 2VZOA 4LHJB 1LVEA 1NBZA 1N8ZA 5JNYB 1VFBA 3BZFB 4JZOB 3FO1A 4P2QB 2GQHA 4I48B 4P4KD 3GNML 1CE1H 4KH2A 4BSVA 1UADC 2PN5A 5EIQA 4HKBA 3IU4L 1AI1L 1NUDA 3ZKMC 3GSUB 4XVUC 4KQ3L 2W60B 2W65A 3QB7C 3TA3A 1HDMB 4GW4B 1RUQL 3F8UB 3REWB 5HVGB 1M7IA 1Z0NA 4LLDB 5F21B 4HAFA 4CJ1A 3L3JB 3TA3D 3CU7A 1DQTA 3ZL4H 1MY5A 1SHMA 2YUXA 4EXKA 4XP1L 4K8RD 1DBJL 4BKLA 1VADB 3QDHA 3O41A 2GAZA 4PJIA 3SE8H 5HGHB 4LVEA 3D2UD 4NQVA 4PJDE 4ODTH 1A14L 5H35A 4ZD3L 3NTCL 5HHNB 5JUEL 3DBXB 1BIHA 2WUCH 4HWNA 4K3EL 4Q9CA 1EK3A 4QRPD 4KV5E 3EYFB 4M1GL 4JHWL 3IVKA 3NA9L 5JO5B 4C56E 3H7BA 3WUWB 4JFYB 3P73A 3LMJH 2VSDA 5IFHH 1BVKA 4FFZH 3VXUD 3IRZA 1FVEB 3NA9H 1CLYL 1RZJC 5EZIL 5KW9H 4QXGH 1ZEAH 2XTLA 3RY6C 3UBXG 2JCCB 5C0GA 1M05B 1I85A 4PRBA 3HC3L 3QZWB 5JIPA 1CZ8H 5DUPH 3O3UN 1T1XA 1QYGL 4FQIL 4NHCH 2QHLA 2V7NA 4WHYH 5HGGS 3MGOA 1LILA 1K8DA 2JE8A 4JZNB 4NCC2 3OAUL 4X7SH 3W0WB 1F3JA 1KJ2A 2CK0L 4Y19D 1AGBB 1PFCA 3T09A 3CJJA 2Y7QA 1UM5H 4I3RH 2RAMA 2HFEA 3GK8L 1FDLL 5HHXH 2X10A 2CGRH 3RJQB 1FFNA 4QTIH 3BPCA 3MLZH 4HKXA 4WHCA 3UO1H 2IG2H 2ZUYA 4Y4HA 2AGJH 4X7FC 3IAGC 1T1WA 3KPSE 4ZTPH 5K9JH 2VL5B 5ACLA 5B4MC 3TWCL 3VFOB 5BZWB 3M8OL 5DHYB 5IVZA 2XZAH 2GJJA 2ADIA 4LMQI 4HFUL 2H26B 4KROB 4Z77A 3QIWC 4IMLA 5AD0A 2R1YA 2FX9H 3PGDB 3VFVB 4UIMB 4ZFZA 1S7RA 1SY6L 3MBED 4K94L 4M48H 2W0LA 1AGEB 4IRSB 1NGYB 3L3KA 5F7EH 4N0CC 4XAWH 4X80H 1GGTA 2GSGA 3OXRB 2AJSL 2K7PA 5DDHB 2EEAA 4X98A 5EC2B 4PREB 1U3HB 2G75A 3G6AA 4HMDA 5I1IL 3BKJH 5C71A 3OAYH 4KVNL 4MNHB 3WDJA 2QSVA 1BX2B 4ZS7H 3KYKL 4MXVF 3GSNB 1KYOK 3MYZA 1A1MA 3VFUA 1W0WB 3D2UB 1UGNA 3WFDL 4Z78A 5C07E 3ARTA 4EDXA 5DMKB 1ZHBA 2YUZA 3S96A 3D85B 3AS0A 2FEDD 5DEFA 2Z93B 3AY4A 3O3AB 5I71B 3HAEG 4Z7VA 4Z5RA 1FFOA 1WSST 2G9HA 3PE9A 5E8PB 2VERN 3DXAD 4RGMB 1AKJB 4TPRL 4U1JB 1KYOJ 4TVSa 2CRIA 3KYOB 4L3ED 3QJHA 5TF1L 4MD0B 4BFEA 3HNTH 4HS6A 3LEXA 4S1DC 1Z9MA 4HS3A 5ESAA 4TTDC 4GKOA 5EFIA 1HHKA 4F7MA 4X6FB 5FA3B 1FSKC 1X7QA 3BEWA 1FVCA 3ARGA 1KPVB 4DOHE 4JPIA 3K2UH 1NLBH 1PX4A 3LKQA 5BXFB 1JZ3A 5IFAL 2PW1B 3V4PL 4ZXBB 3B9DA 5GJSL 3FJTA 3J7HA 3MRFB 2R9HC 1G7LA 2IPUG 2AABL 1YMMD 1U8OA 2NR6D 3SGKC 2G9HB 1PYWA 5E8PA 3WFEL 1NGWA 5C1MB 1OCWL 1G7LB 1FBIL 4CDHA 3T0BA 1U0QA 3B5HA 5MEQB 1BBJB 5I73B 3MBEB 2IALA 2F54A 5EO1A 3HTLX 3RKDC 3CGTA 5E0QA 1NFDA 1XF1A 5DK0B 1K3ZA 1KCVL 3ARGB 3G5ZB 43C9A 3GSXB 4HJGA 5FF6A 1LK2B 4GXUM 4OLZL 1GJIA 4K3GA 4M6NL 1NCUA 4LPUA 5HDLA 4Z7WA 3ULUL 5CHNA 5CSBA 4I3SL 2APVA 4AENB 3DROA 5FYJE 1KB9J 3IDIB 3SPVB 1E4JA 5FGRA 2OR8A 5J1SC 5I8EA 1QBLH 3BPOB 5IBUG 1MIMH 1X5GA 3DYPA 2JJVA 1FZJB 4RAUB 4S2SA 1MF2H 5IQ9B 4HPYL 3RUGF 1ORSB 5HYJD 3CZFA 5I8OL 4XVJH 1KPUA 3NZ8A 4K23H 1A1MB 3WN5C 5GRWA 3WXVH 3NCBB 3KPLA 1BJMA 2I9LA 4NOFA 2ITDA 2Y07H 1BF8A 1CU4L 5ENWA 1BJ8A 3O3BA 4JB9H 5B4MD 3VG0H 5CEXB 5BJTB 5DD1H 3T0EC 2EEBA 3GKWH 2J6EH 4FQQB 4Y19E 1R0AL 3C6LA 5F7NC 1MWAH 2WAHA 2GJ6B 2XG5A 3LKRB 3RP1A 2R1WB 4QRQA 1BZQK 5CCKH 1L4IA 1FG2A 3VI4F 5LXGH 4JEGB 5FO7A 4OCRL 4B5EA 1AGBA 1YEKL 5B3NA 4K8RC 2VXUH 1I1AD 3T2NL 5J11C 3C5ZC 4I2XB 5C09D 4RNRB 2R2HA 5F88B 4K3EH 3OXSB 1ADQH 1FYTB 4MQ7B 5I6XC 2M26A 4N9GA 1T1XB 4OD3H 1T5WA 4H1LB 1T1WB 4YO0A 3SDYL 5C0AB 3IETB 3FQNB 1M7XA 1PEWA 4CU8A 43C9B 1UFUA 3OG6B 5TDPA 1IM3A 2GW5A 4HPOH 4GFTB 4HS8H 1U8QA 4NNPL 2GT9B 4QEGA 1Q9WB 5AZ2L 5IW1B 5SV4A 1B2WH 4PJ8A 5D1XB 1RFDH 3NPSB 1G9MC 4FTVD 4PG9B 2AQ2A 4YDJB 5DWUL 4R97C 3LS5H 4P5MA 3BKCL 3SGJA 3BO8A 4Q9QH 4L9LA 5AEAA 3ARQA 4JVPA 3KXFE 5DWUH 1FVDB 1X7QB 3BEWB 4JPKL 5DVLA 1DQLL 2HFGL 5EOTB 1MAMH 4ZAKB 3BQUA 3MX0A 5IEKA 5DD1L 1A7RH 4P23A 3MNZB 2DRUA 2JF1A 1W72B 2Z4QB 3TBWB 5EO0A 3MOBH 1K5NA 4TSCH 4YAQB 5DMIL 1ES0B 2ESVE 1YNKH 3N50A 4J12A 1YEJH 4P5TC 5GSRA 3K46A 3UTOA 3QEGH 4AMKL 1SVZA 3BGFB 3PJSA 1G7JA 1JPTH 3KDMB 4M6ML 2UWEE 3G08B 4OJFL 4S0TD 1AH1A 4D9QE 5GGQL 3I50L 3T0EB 3HB3D 5I19L 1LEIB 3L95B 4F2MB 4CN6A 4PGJA 2J88L 5D4QA 3BE1H 2V2TA 1XFPA 4XTRC 5EN2B 1D5XA 3V4UL 1CE6A 2FWOB 4TNVK 5B3JE 1R3IH 1RULL 4IIQA 2WMPA 1V7ML 3CUPB 1NC2B 1BP3B 4H8WC 4Z76B 3L3KB 2DJUA 4QY8B 1NQBA 4QRSA 3BW9B 4BZ2H 1CGXA 3MV7D 4WV1B 5D7SL 3HMXH 2VE6B 1ZHNB 4PJHB 5ICZA 4X7DC 3TZVC 1LP9F 2I60H 1N5AB 3U9UA 2YPLD 1RZFL 2HH0L 1AD0A 1CD0A 3MV7A 3IGAA 1SEQL 3BUYA 2I9TA 3PDGA 5M7QA 3AVEA 4JFOB 2X2YA 2F58H 1RURH 2NXZB 1INDL 1RVFL 2ARWA 1H0DB 3WO3B 3PL6A 1AGDA 1EVUA 2HLAA 2X4NB 5TDOB 5TE4H 4R0LA 1DL7H 5EZOH 1S8DB 4FQLL 4LCWA 3FCTA 2DKSA 4KWUA 3ZE0E 3FFCA 1EBPA 4BFIA 5IIEB 4G6KL 2FIKB 5E8NA 2EDFA 4K3JL 3QG6B 4X4XA 1JGDB 4YHMH 4TUOB 5TDNA 4PY7A 4FQXB 1W0VB 2FECL 4PRIA 4GRLD 2OL3B 5C0CD 3I6GA 4WEMB 5E2WL 4P2OA 1SYSB 3LV3B 1YNTA 4WW1A 2LU7A 4CDGC 5D8JL 4XBEL 1WT5A 4QRUB 2A74A 1C08A 5JXED 3VMPA 5IB5B 3TPKA 5HHOA 2ATKA 5FO8A 4KTEH 1I3UA 3RVXC 1AFVL 3EOBA 1ORQA 5D7IA 2VDPH 3FZUD 5EOCL 1Q72L 3S34H 3MACH 5DUBA 1NC4D 3GSNH 3IRPX 4WHDA 1JV5B 4KJPD 3UEZA 4XC1H 1MCDA 1JNHB 1WBXB 4UOW1 4WI2A 1JNJA 3EYOB 1Z5LB 5B38G 3WKMH 4UQ2B 3D5OF 5AUMB 1X5JA 4XP1H 4WW2B 5C7XH 4Z8FL 3OMZA 3O2VH 1EBAA 2BXYA 3QI9C 4GAJH 1UG9A 5IB2A 5IWLA 2OTWB 1MHCA 1EFXB 2EO1A 4NQCE 3KYNA 4J1UA 4UT6H 3TVMD 5FECB 1IBGH 3TBVA 1KN4L 3GMLA 1JNHA 1UJ3C 1WBXA 4DZBB 2DYPD 1TVBA 2YD6A 1E4XI 3GI9H 2AGJL 2E7MA 3K4DA 4Z7QE 4D0BA 1AO7A 3CVHB 4R96A 2DD8H 5D7IB 3UPCA 4LIQL 4IRJD 5I8CA 1RIHL 4LKXB 4N0UA 3WDHA 4U1LB 2DQFA 4KVCL 2K9UA 3NACL 1EO8L 5ADOH 1ZVYA 4PGBB 2HYMA 4O5LH 2PKDA 2E9BA 3QUXA 1RZ7L 2EKSA 1WZ1L 4OZHB 1OP5H 4A2MA 1EAPA 1TJIH 2FGZA 2RCSL 4QTHB 1DEDA 4ENED 5HYSG 2ZUTA 4HC1H 3BVNB 2BNUB 1K6QL 3A6BH 5KN5B 4YC2C 1KB5H 1AD0B 3GHBL 3I6KB 4L3EA 2BZDA 1LDSA 1FYHB 1LO3L 4G7VH 4AL8L 5D96C 1RIUH 4ALAH 4NRYB 4XX1G 2N7BA 4LLQB 4FZ8L 3ZKXB 3TV3H 3QBTB 5DURD 5FGCE 3QO1A 1CD1B 2IJ0C 4S1DD 5D1XD 2OLDA 3F12A 3DRQA 3O2DH 4WUUD 1XIWA 3OX8B 3HKFA 4X7SL 4X83A 4YGVA 5FA4B 4JFHD 2KPNA 4OGXL 2EYSA 3QHFH 1BFVL 2NY6D 1ACZA 4H26A 4FFWD 2FZ3B 3QULB 3MGTA 2XZCH 4YFLF 4O51A 1A5FL 3W0WD 4M7JH 1MHPL 1QBBA 1G0YR 2HLFC 5DGRA 4FABH 4JM2A 5ICZB 3KDMA 2NX5D 3HPLB 4G8GE 4LLWB 4FQPA 3TT1L 3D0LB 2C3XA 3NH7H 1IGIH 3RZCC 3O3EB 3OBAA 4GRLC 3FQWB 1NBYB 3UZEA 2GI7A 1LP9B 2BMKB 5HJ3B 3HC0B 4TULH 1YYLL 3C9NA 2B4CL 3EOBB 1HSBA 3D39A 4XAKE 3VI3E 1OVZA 4IIQB 2OXHA 5BVPL 4OD1H 3OKMA 3WIHL 4Y2OA 5IB5A 2XWTA 4FXGB 1U3HD 4MNGA 3TCLA 2CUIA 3RVVD 4E9LA 4JO3H 4ZAKA 3AB0C 2F5BL 1KIPB 4E0RB 3CH1A 2R4SH 3G08A 4PGZA 4XVTL 4KROD 1X5YA 4ELME 2O61B 4YXHH 1YZZA 4QYOA 2EXWD 5JXAH 3E3QE 4WJ5A 1SJHA 1N26A 1EZVX 4JO1L 5IESL 4PG9A 2OX5A 3DURA 4R26L 5IIEA 4ZUUA 2I60L 5D9SA 2AABH 2Z4QA 3TBWA 3EO9H 3GNMH 4JFEE 3DIFA 3VWJC 1RUML 3MXVL 4QT5B 5L7XH 4JO3L 5C0ND 2X09A 2DQCH 1OW0C 4G6JL 5IB4B 3SO5A 5IVOA 1CFSB 2J8HA 4NQTA 4DAGL 3FRPG 5J12C 4PJCE 4RGOH 4YDIL 1H5BB 2BVOB 5HGDA 4KRLB 5CS7A 1H8NA 2J88H 3IGAB 3QFDB 2Y9RT 1MJ8L 1ZVSB 1LO5A 2VL4A 5K33A 3TT1H 5TFSL 5KJRH 4AM0B 3ULVF 3EFFB 3PGCB 3MA7B 4MD4B 1T1ZA 1CGTA 5EUOA 2X4RA 2MNUA 4P9HC 1FG2B 4QNPE 2AEIT 5H94A 3WXWL 3MO1A 4NKOA 2EXYC 4MDIB 2C5DC 3G6DH 4UT7L 3VFWB 2VLJE 4ETYA 1YMMB 1QSED 5CSZA 3VXUB 2R4RH 1AGFA 4FFWC 1ZANL 3IETA 5GGSY 5TE6L 1A4KA 2XZQL 5HDBF 4GOSA 2A6JA 2HJLB 5J3HC 3N85H 2OXGA 5EC1A 4AEHH 3VDBA 1LHZA 1AXTH 4Y8DC 5BOZG 4OCLC 5D7KE 1KPUB 3F58H 5E7BA 4R4BB 1F3DJ 4JFDD 4ACPA 3JV0A 2ZOLB 4OKVA 1S7SA 4LNVA 2FX7L 3JZ7A 1IMHC 1J8KA 1WFTA 2E8ZA 3C08H 3SCMA 5SWZB 4R7DB 1AKJD 3UJTL 2PYFA 4DTGH 4OTXL 4YK4B 4Z18A 1MCEA 2A1WH 3BMVA 2RCSH 1B90A 4XNQA 3MLRH 1OB1A 1UENA 4QRTB 1MJJA 1VACB 2ZUQB 3MBXL 1VCAA 3MRCB 4Y88A 1ZGLA 3KPPB 4WENB 1A7OH 1KCSH 4ZUVB 5BRZB 2ORBH 1S9WA 5D70H 4YDKH 4PBXA 5INCB 1F8TH 1JE6A 1XZ0A 1Z9SA 3HS0A 2Z31A 2G5RA 1QR4A 4LSTH 1KCLA 4M8QA 1B88A 2NX5A 1T03L 3VFPB 1F3DH 4WGVB 3N1PC 4OZFA 1M6OB 4F37F 4G5ZH 1FZKB 3KWWB 1JPGB 3QXUA 1IKNC 4X9HA 3RA7L 3CCHB 4RQQB 4X6CA 3RUGA 2XN9A 2JB5H 3G5YB 5C2BH 5C0AE 2CRYA 3RVXD 1KB9K 1L9MA 3QRGL 4Z7WB 1CBVH 1IM3B 1DJSA 1AHWB 2BOBA 1VFMA 2XZCL 2XN9D 3ULUF 2NX5B 1GZQA 1Q9OA 1QRNB 2Z35A 3QDAA 4JB9L 3E3QC 3UTTA 5ESAB 1KCKA 5E2TL 3OKOB 4U1IA 4MQXC 3TH3T 1U8PA 1J05A 4E41E 3MRCA 3KPOA 1N64L 2YK1L 3DSFH 3LB6C 4CJ0A 3DXAE 4U6TA 1IAKA 3BN9D 1CYGA 1H15A 2AJYH 1UM6L 4PJBA 1TDQA 2MOVA 4TVPH 1IC4H 1KULA 4GW1B 4X6CB 5CD3B 4EN3D 3RVUC 1MCLA 4WIQA 4AL8H 4HULB 5F89B 2OJZL 1DVFC 2IBZY 1OF2A 1I1YB 1DQJA 1I1CA 2EDWA 1S7SB 3L3OA 3B9VA 2RBLA 3UXFA 5AYUH 4DCQA 3LIZH 4LFHD 2EDTA 1CIUA 1N4XL 4YX2L 4BH8A 3R8BB 1MLBA 5EFIB 2DF3A 3IXAA 5DJ0A 3VDCA 1A0QH 3JWNC 3KPTA 3LZFH 5DD6A 3BZEB 2Q87A 2C26A 3TBSA 1JI2A 1T1YB 1KNOA 1R5VA 3O4OB 1G6RH 2C3VB 4LLUB 3NCFB 4IBLT 4U1JA 4ZSOE 2J8UF 3U9PL 2Y25A 5T1MA 2W91A 2VLRB 4Z95H 4DKEH 2V5RA 5L8KB 1XGYH 3SCMB 5D2LB 1OF2B 3BN3B 2AAVA 5D2LA 1CDCA 5AD0B 2NY0B 5F9JA 3NBNA 1YYMH 1VGEH 3MLSL 1BVLB 4CADA 4ZSOB 1U91A 3L3DA 4FS0A 1L7TL 1LO5B 2P46B 3ARBC 3RPIA 4U0RB 3S36L 3A6CH 3BZEA 1QLFB 2F53D 2VL5A 3WCYA 3PQYE 5EUOF 1I8MA 1WTLA 1F2QA 4OQTH 1N5YH 2H3NB 4CKVX 4ZAKC 2NNAA 5F7UA 1KB5B 3BOVA 3V5HA 2C7UB 5I1KH 4JFDA 2D03H 4NHUB 4XP6L 1JCKA 3U46B 5MHSE 1MCNA 3NFNA 5EZJB 1Y6NR 3TM6A 4XWGL 1BBJA 4HUNB 1YC8A 3PABB 1OD7A 2Y4SA 3JSSA 4IMLB 4H25A 3KJ6L 1PQZA 3VXSB 1T1ZB 25C8L 5C0RL 3WD5L 4PJBB 3TGXA 3OZ9H 5C8JB 3MRKB 4RFNB 4OT1H 5DRXA 4LCYA 4JM2D 4NWUH 3U7YL 3U30C 3ROOA 3V5DA 4BK4A 1H5BA 3EYQC 4FQ1L 2P5WA 3HS0B 2VLMD 5EO9A 4X6FA 4PB9L 3ECBB 2JCCA 1Z3GL 3ESUF 4OFPA 5C0GB 1CXLA 2PW2B 4U6HA 5LQBL 5C0BD 4AEHL 1ND0A 3PIQB 4PV9B 5JHDB 5LJYH 4FXGA 1OB1B 4KJYA 4D0DB 5EIIB 3T4YA 2IAMC 4YR6B 2XN9B 1DBML 3O2DA 4PJ7A 3T65B 1ZLSL 1OAXL 5CP7A 5TFSH 5KJRL 3RIFK 2VITA 2VSCA 5MENA 1P9MC 3O8XA 3FB7A 1HQRB 3NCYS 1RUAH 2FATL 2VLKB 4Z7UB 1X5LA 1OAXH 4YWGH 5HHMB 1PG7W 4QYOB 1MCOH 4FQXD 3LDBC 4EDXB 4JRYA 3Q5YA 1B6DA 3VXRB 5I30H 1BBDL 3LKOA 1A6AB 3CC5B 3S5LA 3RY6A 5GRVK 4NUGH 5D2NE 2DTML 2FDBP 2FBJH 1D5BB 4H26B 4NT6A 4YPGB 2A6JB 1E27B 3IFLL 5CILL 4GMSH 3H7BB 4Q0XH 4D9LH 4P9ML 5CIPB 4LCUB 2A83A 2FJFB 3BKCH 3ZYIA 1CXHA 3C9NB 3BKML 1XGRB 4X6BB 3FHAA 1KEGL 1T4KA 5DVMA 3KXFD 1KG0A 1FE8H 5CWSA 1NBZB 2WK2A 2FL5A 5H2BB 4LSPH 5GS0H 1CICB 2V7HA 4ELMA 1KT2A 4NNXB 4O51B 1PZ5A 5DHYA 1G7IB 3DUSB 3R1GH 1MFEH 3FOMB 1FLRH 5IVXE 3QEQD 4YIQB 3OR6B 1AR2A 3SDYH 1HDMA 4ZFFA 5DJ8A 5KVMC 3OJMB 4Q0XL 4D9LL 3IKCB 1KLGA 2J2ZA 4TOYL 3RTQD 1FG9C 3RIAF 4PS4L 1ADQA 4L4VD 3D3VB 2XNAA 1NC2D 4N8CH 2O5XL 4PJIF 4OFVA 3ALPA 3RAJL 3KLHD 4OLXL 3AU1B 5DA4A 5HYEA 4KMQA 2E9JA 3DIFB 1TQCC 1HINL 3SJVE 5HI5C 4MNQB 3MFFB 1EEZB 4LPVA 2RFXB 2ICWA 5JOPE 5C9KA 3UBXI 2JIXD 5EOCJ 4IRZH 1J0KA 5J13C 5D1ZD 1YA5A 3X3FL 3WNKA 3OTTA 3F7VB 3BN9C 4TVPD 3X14A 3UROR 5BV7C 5HGDB 1A3LL 2G2RB 2JIXA 4APQC 4JY4A 4PRAB 1RUKL 3SDAA 1OTSD 4PJFB 1S7QA 1C16B 4U49A 4TSAH 4WHTA 5HD8D 2A0LD 4FZ8H 3IVKB 1MRFL 4M7LH 4GKNA 1JYNA 3V6FA 1U41A 3O2DL 3RU8H 2E7HA 1QQDA 2QADB 5GGQH 1NBYA 1TJHH 3F6LA 2E9WA 1RIVL 1X5HA 2WUCL 3JVGA 3QEGL 1EJ6A 2GK2A 4XP5L 3GSWB 1FO0B 2NTSP 3F5WA 3MLXH 4PJXA 5TGBA 4DKFH 4K94H 4M48L 4JFPA 5IBUB 1MI5A 2NY0C 5F6IB 1P69B 3P4OB 4DFHA 4DOHB 1M7IB 4KHXL 2ZUSA 4HSQA 1F6FB 1QR1B 2WNGA 4GQ9L 4W70A 4D0CA 4PJCA 3GMRB 1TNMA 5HJ3A 4LCIL 4R8WH 2OTPA 4TNWK 4F80A 4XNXH 4U1GC 1A7NH 2QHRL 1L7TH 1P5VA 4MWFA 3MTRA 4PV8A 4IDLA 3RY5A 4V1DE 3WFZA 3R8QA 4GSDH 5KVEL 5K9KA 2FEDC 4HBCH 1FFPB 3T0XA 5IVXB 2BY3A 4LQFH 3OJDB 1FAIL 4LEXH 4NNPH 1OGTA 4PJ7F 4U2YA 5FUCE 1UM4L 2A6DA 5EU5A 2P24A 4AIZA 5FHAL 4HK0A 1MWAA 3OX8A 4HFWA 5AG9A 4QRPE 1RUAL 1NMAH 2HVJA 3TT3H 1MCRA 1A6TB 5FGCB 3SKJH 3CAFA 5JW4R 2ZUUA 4PGBA 4Z0XB 3MLPA 4ODVL 4LSUH 1QKZH 4QF1B 1U8MB 3I6GB 2W0FA 4U1LA 3MV9B 1FN4A 5JHLH 2OI9C 3QJFA 4MXVE 4TSBH 3WS3B 1G6RB 4CUCA 3HNVH 4BZ1H 2XOTA 2FGWL 3BEVB 4D0BB 3DMMB 4X7EC 2HT3D 1GOGA 4OCRH 3DMMD 5C6TL 3FQXA 4FTVA 4CBPA 4FXLA 3Q3GA 1LD9A 5D6CA 2QQNL 1NC2A 2QLVB 3Q6GL 2YMXH 3B5GA 2M1KA 4M1DL 1VEPA 1A3RL 2R4RL 4DVBB 1Q9LA 2JJTC 4H20H 3FOMA 2D31B 1QFOA 2RQ8A 3G6DL 3AS1A 2I26N 2Z91B 5JW5A 4LP5A 2R2BA 4K23L 1OAQH 2Q20A 3U9UB 2BVQA 5E1AA 4IOIA 1MRDL 3ARGD 5HTSA 5I75B 1S7VA 1UJ3A 4ODUA 2VR4A 4I0PD 1YNLH 2LAAA 3GO1H 4MA1B 5CIPA 4XPTL 4XMPH 5IM7A 2FBJL 2IFFH 3VXMB 5CJOL 2A9NL 4XPTH 4YHKH 5I30L 3ZYJA 1IL1B 1GZPB 5E6ZA 4JY4B 3F5WB 5ICYA 2AJXH 3VXRA 2R29H 5HY9B 1BM3L 4KKAD 4PJAA 4X5XA 4TVPE 5DUBB 3NA4A 2KZ1B 4FOMA 1ZKAA 1IT9H 3TEUA 1PKQE 4WFHE 2GT9A 4QGTA 1G1YA 4XCNA 5IKCA 3SDDC 2VXSH 1DE4B 2Q76B 1F90L 3HI6L 3B9EA 1ZGLM 3QWRD 1CLYH 2YSSB 4XCEA 4LU5H 4GRWB 1Q9KA 1RZKL 4CU7A 1QSEA 2X1WL 1S7QB 4F9LA 3ES6A 3NABL 2DM7A 5I2IB 3CX2A 4JHWH 3RL1A 1BQSA 1BBDH 3LV3A 5GGVH 3SGJC 1NUNB 4P2OB 2O26U 4L9LC 3STLA 4L9LB 4LRIC 4PRIB 3WE6B 1MAKA 1A4JB 5IMMA 4OZFG 2PO6C 1PZ5B 4L4TB 1WGOA 1FL5A 4NC1E 1EJOH 3OKLB 1FL3B 1LWRA 1J0ZA 1NCDH 2F19L 3ULVL 1I1FA 1A22B 1X4YA 4X4MA 1A7RL 1CLZH 1DTUA 4HHAA 2KDGA 1KN2L 5BMFH 1WIOA 4Z76A 4OB5H 2GY5A 4J3UA 4YDLC 4W6XB 5HSFA 3MOBL 4TSCL 4M4RA 2F53B 1DN0A 4FQCL 2CKBL 4GRLA 3S97C 5CAYB 4PRHA 3L7EB 1S7WA 5KSAA 3NOIA 1ZAGA 3SDCD 5J6HB 1VFAB 2NY0D 1XF4A 1CFVL 2UYLB 3U36B 2X4TA 1JNNH 3HE7C 5CZKA 4JPKH 1RD6A 3WFBH 4L4VA 2EXYD 3WIHA 4X6CF 5JA9A 3RVTD 2ADFH 3C60B 1LEGA 5F9OL 2UZXB 4Y8AA 4WFGD 4HGWA 3EO1B 5F3BA 4Y5XB 4L1DA 4PPTA 4O02H 5T1MB 4LCUA 1QA9B 3UTQA 4JO2L 5EU6E 3MRHB 1FFQA 2R4SL 3GIZL 5EN2A 4HIEB 3A6CL 1IKFL 2ZG2A 1FP5A 2NY2C 2VDLH 5DEGA 1MJUL 4Y4HD 1QFWM 4F7PA 4LAQH 2WIIB 4DGVH 4PJBF 5FOBA 5E2UH 5TQ2H 3GGWB 3MRDB 3QFJE 1NFDB 5BW7A 5GSRB 3QDGB 3QXDB 4ZUSA 2ZSWB 3MV8A 4NQEA 2K7QA 1QSEE 2A38A 4PRNA 3TN0D 3TVMA 4L29B 4LVNB 4P23D 3LKNB 2VITB 1V5JA 2J8UE 4GKSA 5MENB 2KBGA 1O0VA 2NW3A 3RJDA 4ISVB 2R0LH 3D0VA 1WZKA 4AENA 3NFNB 3EW3B 3MRLA 3KPSD 4PV9A 4JPIB 4JQIL 3ZDXF 3K3QA 3C60C 1BLNB 3PV6B 3EOTL 4XBEH 3TYGL 2FSEB 5I15H 1MUJA 4YXLL 3ARFD 3QIBC 5HYSA 5FF6B 2APWA 4Y5YC 4PY8J 5C0BE 3TYFB 1AHWA 4HPYH 1AC6A 3ROOB 4JZJC 5FYJU 1I1AA 4OIIL 4I13B 3MRKA 2IAMD 5I1JH 5BV7H 1XCQB 3ARDD 3EOAB 4I2XA 1QBLL 4Z7NE 1SM3H 1HZHH 5HPMA 4Q9BA 4ISVA 2IH1A 4PJ9C 4RGOL 4YDIH 3MACL 2RR3A 5J6GB 4C83B 4HEME 3TZVB 4YDLB 4ODTL 2J5LB 1MVUA 1LE9B 2BX5A 2YPVL 1DL7L 1F4AA 2ZSWA 3MV8B 2KQMA 1CT8B 1HKLH 5JA8B 4KK9D 1DBJH 4PJAF 2VMFA 2CMRH 5KS9A 1ITCA 4RRPA 1FVCB 3MNWB 4NZRH 1G9NH 1TCRB 1XZ0B 3BZ4B 1Q0XL 1L0XA 4MLSA 2A73B 3U4EA 5IMLB 2XACC 3NGBB 1OQOA 2I9LB 2PO6B 1MHHA 4H5SB 5C0AD 2X05A 4RA3A 5LGKA 4CADB 4WO4D 3SKNA 1FO0L 5DQJB 1JZ8A 2DB8A 1G9NL 4XNYH 4HT1H 3BP5A 4WDIB 5DTFB 4L3EE 3FB8B 1FE8L 4MQSB 4Y4KD 3TPUA 5DYOB 4OZHF 5DC4B 5FGBC 2VDKH 4C59B 2PXYB 3CFBA 5C86A 3ULSA 5FAAA 5CKAA 4KQ4H 3BPLB 3ZDYE 4PYHA 2LFGA 1MHHB 3KPOB 5CHNB 3VG9B 4FA8A 4BFGA 1SM3L 5EC1B 2XRAL 3RZWA 3QCUH 3NIDF 4I8DA 1R3KA 3MRGA 4OUOA 2VQ1A 4U1MA 1XF2A 4XB7A 2ICWJ 4RFOL 3RI5K 5DK3A 1LK2A 2A77H 4Y4HB 4HLZH 4JFXB 1ORSA 2UUDH 4LPWA 4PJEB 2VDOL 5KVFL 1NDGB 1OAQL 1WWBX 3FB8A 1I8IB 3O9WC 2JJWA 1OSPH 1W0YT 4XCCH 3UYRL 2BVTA 3Q5TA 3QIWD 1WFUA 5DZNA 1AQKL 5TE7L 2NY5H 4JFZL 5GHWH 3NPZB 3EOAA 2YWYA 1RU9H 3DROB 2EE6A 2H8PA 4PB0L 1NCCH 5DD0H 3C8DA 1FNFA 4GH7B 5JDJA 3L7FB 3FTGB 3IXTA 2LU3A 2W9EH 4YUEH 4U1IB 5J13B 4HMEA 2GITA 2XKUA 2OR7A 3OGCA 3ES6B 4ODSH 1RIUL 5INCA 3SGEI 2NY5L 1G0XA 3QCVL 1RZ8B 2VC2H 2CIKB 4HS6B 4LKCA 4CVZB 3FB5B 5E1HB 2QQLL 5TF0A 4MMZC 5IW6A 3P2TA 3VG9C 3VJ6B 3FQUA 4JRXA 4RISL 3JWOL 4NKIL 2V2XA 5AZ2H 4YXHL 1EGJH 4HFUH 5D9SB 2EE2A 3AS3A 4JFEA 1JPGA 5ERWB 5SWZA 1NH6A 4OQTA 3SQBA 2EDLA 5D5ME 3KHOA 2EE3A 2QL1A 2FX9L 1NMBH 3A6OA 3ILPB 3WS6C 2HMIC 2VN4A 4G3YH 2YRZA 3I2CL 5DRWB 4XP6H 1N6UA 2CXKA 4YBLB 4G6AC 2QSCH 3JV4A 1KUMA 4S1SH 3D18A 3ME0A 3WIHH 2XKNA 4J4PD 1U8KB 3TWCH 3LEXB 5A2FA 2MKWA 1JPFB 3CFKB 3VXMA 1S7TA 1ZVHA 2P5WE 4LLAA 1I9EA 2DQHH 1Q8MA 1HXMA 1XR9B 2BC4B 3OXRA 1KPRA 3GHEL 1FFOB 4U7MA 3NAAH 2CK0H 3NCJH 1CXFA 4Y5XA 2PTVA 3PDOA 2AJ3A 4LSDA 4NDMB 1B2WL 4OFYA 4WY7H 5E00B 4I3RL 4P4RA 1F3RB 3RVWC 3KPQB 3L6FB 3B83A 4M7LT 2NZ9D 1P84J 3L3HA 2CIIB 5DS8A 5I66A 1GGBH 3S88H 2XFXB 2FCBA 4KI5E 4MAYB 2C1PA 4F15B 2GY7B 2HN7A 3LIZL 2X4TB 1A9BB 4XC3H 4Z0BL 5JMRA 5KW9L 4GRWF 1A1NA 1YPZB 3S37L 2YC1A 4HUKB 5DURB 3HC3H 4U6YA 1AY1L 5DDHA 1WIPA 1CDHA 2Q8BL 3CU1A 3MRRA 2F53A 4PG2A 1P53A 3ARVA 2P5EB 4UAOC 3NH7L 3O4LE 3SHSA 1W8OA 4TSBL 4DGYL 1NGZA 4LFHG 4JM2C 1NANI 5JHDE 2YD9A 1ZVSA 1ITBB 3BVNA 3QUYC 5F44A 4AT6A 3STLB 3WE6A 2FEEL 2W0FB 4OCMC 3SDXF 2GK0A 5F1SA 3IB4A 4Z0XA 1S7WB 5IB4A 1WC7A 4KKNA 4GRLB 5A2IH 3BPCB 1TZIB 5ETUA 5D1ZB 2P24B 4OLYL 2DD8L 4M03A 4MXQD 4HF5H 4G8FA 2DTSA 5E6ID 2YEZA 2CR6A 4OLUL 1B6UA 3JWDL 4WI6A 3UMTA 5IG7B 3FOLA 5TE4L 1FPTH 1I75A 4LAQL 3B9KC 3U0WL 3KVQA 3CDGA 5GPRA 4NJ9L 2DWDB 4LLMB 5I71C 2BNRB 1GIGL 3THMH 2MHAB 3OHXA 2X6MA 43CAA 4EUPB 4WEUD 4X9GA 1ZT4B 4KGJA 1RHHB 1EHXA 3TCLB 3UAJC 3C5SA 5D7LA 5IQ7H 4ZFOL 1XGUA 2DQGL 3ZKMD 2IAND 3DSNA 1JF6A 3GBNH 4FTVE 4F33B 1IGCL 4OLWH 3OGOE 1OWRM 4J7RA 4PY8I 1C5DB 1Z5LA 3V4VL 3IJYA 2PTTB 4HGMA 5CD5C 5FEBA 1JV5A 1T22B 4HH9A 4NZJA 3S35H 2D7PA 2Y5EA 4Y16B 4H1LH 3LD8C 5CP3H 5DJ6B 3TO2A 4POYA 4ODSL 3VW3L 4PJDF 5KSAD 3EJZD 4OBSA 1KEMH 3IF1B 2M2DA 2XKSA 3QEUB 2VZSA 2ADGB 1MWAL 4CVUA 4YUEL 2W9EL 3RWJA 3PV7A 1KFAH 1T04B 1V3JA 3O2VL 4GW4A 1XF5B 4FNLL 5IM7B 4NRXA 1CDGA 3VRLE 3VD5A 1IGFH 2WBWB 4I18A 3GBNL 2W9DH 3IDYC 3I02A 4JDVA 1R5WB 1YN7B 3PHSA 2BXZA 5GSVB 2JIXB 4ONFL 3Q0HA 5I8CB 2NY1D 4YZFF 5FIEA 4MNQD 4IOIB 4ONOA 1HNGA 4UTAL 4PIRF 4UILH 3ULVE 3LAFA 5CJ8A 2RFXA 3MLVH 5SWSB 3MV9A 4D94A 3GO1L 1F58L 4UV4L 3QZWG 3H0TA 1D9KC 1NUGA 4I2XE 5IUSA 5TJWK 3T2QA 5DJDA 2AXGA 1YEDA 4I18B 1ROWA 3RWCB 3V5KB 1KTLB 2OQJB 3GJFH 4DFIA 2MMXA 1BD2E 3GBML 4WTWA 1IGCH 1KC5L 8CGTA 3DX7A 5CFHA 2MQCA 4PUBH 4ZODA 1J9CT 5F7EL 4FZEH 1JHLH 5IMOA 3GJEA 1U42A 4PUBL 4XGZB 1BOGB 5FYJD 4NNYB 5T1LB 1EEYA 4E42A 2HT4D 3QJFB 4PGEA 3P40A 4MD5A 3RGVA 5T3XE 1HHHA 2XWBA 4QHLB 4XNZB 4X6EA 4IRJA 1XGPA 4HLJA 1T66D 3RWFA 3C87A 4APQB 1T2XA 3F7QA 5I1GL 1MWAB 4HFWB 4F9PA 3GM8A 4G42A 3T0AA 4LBEA 1D5IH 3X3GL 1VGEL 3MLSH 1T04A 4XXDB 3T0VA 3S35X 3OJDA 3CIQA 1MI5B 3SDXA 4NO0D 4TVPL 2NLJA 3ZHDA 5DRNA 1YEJL 4V2CB 1TQCB 5F97E 5C0CE 2D7TH 3OF6D 4AH2A 3QAZB 5BO1H 3FN0L 4HJJL 1JK8A 4MA8L 5D96B 4NHCL 1CICD 4BFIB 4IOSD 1DQQB 3AXLB 5T3ZL 2P8PB 4YC2B 1JGEB 4D3CL 5LBSH 3N1GC 2IBGA 5JPNA 1VEMA 5T33H 5F1OB 1C7SA 2COQA 4FQ1H 5C0DB 1YUHA 4FMFA 4Z7OE 4NQCA 1BQHG 1NDMB 3C09C 4ZQKB 4NWUL 3U7YH 5EO9B 2GCYB 2P5WB 5DJCB 4N0FA 1UVQB 4XNXL 1IC4L 1X6NA 4PY7B 3BUYB 3RVWD 3WEXA 1YN6B 3ILQC 1LK3L 3SGKA 5FHBL 1QSZA 2G5BA 2D0FA 3HE6A 1NMAL 1QVOA 3TT3L 5IG7A 1NGZB 1QZ1A 5M94B 5JXEC 1ZLVK 3BP6A 1MVFA 3QEQA 3MLTA 5D6DC 4YQXL 1QHOA 2AV7A 4H88L 4NC0B 4UINH 1KCVH 1UM4H 2BHUA 2PUQT 1QG3A 1FYTD 5FDYA 2GFBA 2C7UA 2DOCA 4XP5H 3V5HB 2Y36H 2H3NA 1A7PL 1IAOA 5C0AA 4JG0L 4P48A 3Q6FB 1UACL 3T08A 3H3PH 1S7XB 12E8H 4AT6B 1FYTA 2VXUL 4M62L 3T2NH 5D72L 4JG0H 1F4XL 1B4JL 1ONQB 3HB3C 5J57B 3FFDB 4F7TA 3GMQA 3PWPB 1IM9B 2NXZD 4HXBL 2GJ6D 4B50A 1BGXH 3F7YA 1G7JB 3PJSB 2RGSA 1JBJA 1RUPL 4PRHE 2O5ZH 4WV1A 1TPXB 4EKXA 3LN5A 4UT6L 4M61A 4X6BA 4JCMA 3D3VA 3CUPA 4ELKA 2UWEA 2IGFL 2X1XR 4LLUA 3WV0A 2IC2A 1IGFL 2OR9L 1QFWI 2PETA 2Q3ZA 4F2MA 5ACMA 3NPSC 2MQ0A 3RBGA 3QP3A 3WKML 1AO7D 1MFNA 2CXGA 5DJ6A 4UT9L 3L3HB 4EI5D 3C5JB 3T3PF 4GW5A 5KANI 5LXGL 5I1GH 4P5MB 3T0ED 5JR1L 4ZO9A 1FZJA 1RZJL 3BUTA 2IAMA 4RAUA 2BNQE 4I18C 3MV7E 2WM0A 1G7HB 1IEAA 4Y2DA 4ZOAA 4RWYL 1HXMB 1MSPA 1BD2B 4KU1A 4N0RA 3AREB 1P2CA 5BS0E 1CFBA 3BQUB 3ILQD 1TTFA 3SE3A 3UYRH 4XCCL 3W0WE 4DQOH 3D18B 1BOYA 3ULUE 3UTTB 4KJQD 2WW8A 2VDOH 1OAKH 2Z35B 3QQ4A 5BS0D 1DN2A 4R6UA 4MQ7A 2VLJB 3EOYG 1U8IB 2F53E 1J8HD 4N90E 3O4LB 2FYYB 3L7FA 5E8EA 1I9IH 3ZYOA 3U4AA 3OXSA 5ALCL 3L1OL 2IFFL 3R4DA 4R2GD 2DN7A 3RGVC 5DZLA 4G5ZL 3GIVB 3GRWA 2NQCA 5CP7B 4UV7L 2NY3B 5K9JL 1QBMH 4YHZL 2AV1B 3MRFA 4IRJC 4NBXB 3PP4H 3RX8A 1CICC 4TRPH 1EMTL 4Y1AB 5JPMA 5IHUL 3FT4B 3U46A 2Y5TA 3PP4L 1S7UA 2DWEA 3CD4A 3VCLA 3HZYA 5F7HA 2CIKA 4PJ5B 1S9XA 4JY6A 4JCLA 5FA3A 4WFEE 4F7MB 5DC9B 3P9MB 3QXTA 4HZAA 4QXUH 1TFHA 3QUZD 1JPST 3QNXB 3KYAA 5I1HH 4HJ0C 4U1GB 5DLML 1AQDB 5GISL 2R9HD 3JV6A 2FD6L 2XTJC 3GB7A 3QI9B 1LE5B 2CRMA 5GGRY 4QRRB 1VPOL 2AEPL 2VH5H 4LSQL 1F97A 3BGFC 3KLAB 2VYRE 3QQ9C 1JF1A 5JQ6L 3GSOB 5DEFB 1JFQL 1T3FA 1YECH 4RMVA 3LMJL 4BYHA 5BJTA 5LGHL 4JHAL 2BP3A 2HT4C 3TBTA 1YQVH 1RMFH 1W0WA 3S8WA 4NO2B 3E8UH 4ORGA 2IEPA 5GJTL 3PWVB 1S9YA 3U6RA 4UTBL 2OZ4L 2R23A 3C5ZD 4BQ8A 1K2DA 5L9DH 3U6RB 2A73A 2ZG1A 3X11A 2E6PA 4S1RH 2ERJC 4TPRH 5CSZB 3VXUA 4Y5VA 5TQ0L 4XC3L 3GSOA 5MERA 1IKFH 1A6UH 4HKZB 5F8QC 1DBKH 2G60H 4X6DA 3KLAA 4JN2B 5IB3B 4ZS6D 2XY1A 2K3TA 4G6FB 4KK9C 5L0QB 4C83A 5DK2B 4MA3B 5C08E 3W2DH 4YHYC 1DLFL 1T6VN 2H2SC 4YLQT 3FRUB 1J0HA 1EUUA 1UT9A 3X11B 4PJCF 2YKLL 2ZOKA 1T1YA 4AG4L 4M62H 5IGXH 4LSRH 3L3GB 4X5WA 5AZEL 4F7CA 3RGVD 4OZIB 4KTDH 3ZSTA 1PG7X 1OSZB 3EAKA 3FONA 5LAXB 4HBCL 1OAZL 1S9XB 4KTDL 5ICXA 5D72H 2CPCA 4YZFE 2ADJB 4JR9L 1JHKL 1KB5L 3GHBH 5EO1B 3QNZB 4P2RE 3ARFA 4G7YH 4MVBD 3OKEB 2D7QA 1GH7A 2MJWA 3LSOB 5JOEA 5I1AA 2BSTB 4KKCC 1CVSC 1G84A 3MODH 3O45B 3ROLA 2NXZC 3RNKB 2O93L 5CEZL 2PXYC 2H2SD 2LVCA 4WJ5B 3PNWA 1J05B 2ZP0T 1ZA3B 4WHYG 4UBDC 5TQ0H 3SCMC 4JPVL 3P9MA 3Q2CA 2GJZB 5TH2B 1M05A 1BMGA 5DEGB 2V2WA 3H9YA 4EQ3A 3PGFH 4ODXA 5D1QA 3KPPA 4ZUVA 5BRZA 1BX2A 2W9LA 1J7VR 3CLEH 3NTCH 4D3CH 5GGVL 4FFVC 3CFCH 3MRHA 3QCTH 4JO4H 4KAQL 4XBPA 2B2XH 2P48B 3FT2A 4F57H 1VENA 5LCVH 4E41B 4GLRI 2VXVH 4X4ME 2DYPB 3EFDL 5EWIL 3UTZB 3DETC 1M6OA 1BZ9A 3WNMA 4BK5A 4YHLL 3FB6A 5F7LB 5FK9B 1HYSD 2PO6D 5FO9B 1ZHBB 3HPJB 1ZLWH 3QDMB 2VR5A 4GKZB 1XF2B 1KLUA 3UPRB 3RTQA 5GISH 5IVZB 1B9ZA 1BREA 1VFAA 2HKHL 2Z8RA 4LSVL 4E41D 5EWIH 2Z9TA 3EFDH 4PP2B 1I7TB 2OK0L 4U3XA 1WEJH 4HW6A 2OL3L 5B38A 3BJ91 2L7JA 3CFCL 3P0GB 1NBVL 1WAAF 4L8SC 3HI1A 5F6HI 1RQ5A 2WIMA 5FDWA 3IU3B 3E6HB 2PYFB 4M6OH 3SBWA 4M61B 1NGYA 5EU3A 1U3YA 2VDPL 2LVEA 1SYVA 1V3KA 4OGAD 3VXME 3JTSA 3QDJB 2EZ0C 1FLRL 9CGTA 1QBML 2Y23A 2CUHA 3QIUA 3GB7B 4X0KA 3PHOA 2I27N 1CVRA 4IRSD 1NMBL 4F58H 3JV6B 4F7TB 2CJUH 1FL5B 3UTTD 2B4CC 4JZNA 1UZ8A 4FZEL 1FLTX 4RFNC 2R1XB 2R0WH 4XB8A 3BQUD 4MA1C 1CDBA 3HCVB 1BQHB 1Y6MR 2DQDL 2DBJA 4M3JA 2R0WL 1IC7H 2GFBB 4KVCH 3T3MF 3BP7A 2DQHL 4F58L 1TETL 2VUYA 5CEYB 3U83A 4M5ZL 5EZLA 2AV7B 3I6LD 1I7RB 2C3HA 3W9DB 1JNNL 3OR7A 3LEVL 4QOKA 3V6ZB 1GCFA 4UILL 3ZLQC 3TIDB 4NQUA 1AO7B 2OTUB 1IZJA 4U6VH 4YHZH 3MREA 1RU9L 4J4PA 4BKLB 4JM4H 2BVOA 4UT9H 3INUH 1ZTXL 3O3DB 4POZC 4W6WB 3CK0L 2CR3A 5C0NC 4BSWA 1G7MB 2LQRA 5ITBH 3PV6A 3HFMH 5E5UB 3O4LD 4XCYA 1IEBB 2AI0H 1JWUA 1DVFA 5FM5O 2D0HA 5E56A 3ULVH 3W5MA 3PWJB 2DM4A 4JFYA 2H2PC 3QUXC 1E28A 4J6RH 1F6LL 5JTWA 1ZTXH 1CQKA 4YNYA 4K7FB 1NGQL 1UCBL 2BDNL 4L5FL 5F96H 4YEEA 1QVOB 4LPCA 4ONGL 1GGUA 1H8OA 1MREL 4IMKC 4U6VL 4ODUB 1VHPA 2QQNH 1YN6A 4GW5B 4QHUA 3UJIH 3FT3A 3SDAC 3HI5H 2JJUA 4LQFL 5ICYB 3TV3L 4WNQB 3MPCA 1IARB 3UTPD 1F90H 1DEEB 2NLJB 2R2BB 1EH9A 5SWQA 1FIEA 4FXKB 4HIEA 1MIEH 3CZJA 4K2UH 2QHRH 4PJ9B 4JDZA 1G9EA 4XP4L 1ZOXA 1HSBB 3D39B 4NFBA 1ZT7B 4C54A 1LD9B 5D6CB 3KPRD 5KSAC 3MYJA 4XVTH 1FZMB 3QR2A 4JO2H 3UTSD 1YNTB 1H3GA 3V6OC 1FZOB 3C60A 3GMOB 5ANME 1YEIL 3BXNA 5KVDL 5T1LA 4Z7WF 2MTPA 4P2OD 3H42L 3K4AA 3SO3C 3UTSA 5GGRA 3T4AA 4M8VA 5ESQB 1RUPH 1IJ9A 2AKRA 2H1PH 5JW5B 4F9PC 2BNUA 3QIWA 1FAIH 5D93C 4GUPA 4C56B 4XVUD 3LHPL 3HRPA 1PKQA 1HEZB 2DBLH 3HZMB 1MCHA 1AGCB 3OB0K 3T3ME 3DO7A 1S8DA 4LCWB 4F3FA 5F6IC 2I24N 5IOPB 2VZ1A 5F1IA 3IAPA 4HWBH 4OD2A 4ZPVB 1YYML 1HHIB 5KS9F 3DX8A 5JW4M 4WWID 4U1NB 1VFOA 1UB6A 2EDKA 2VXTH 1HHHB 1NUFA 1RZIB 1T2QH 5HHQB 5KSUA 4JFFD 2OZ4A 2E7CA 3IFOA 4XAKD 2DJ4A 1SJEA 4N5EC 1P1ZB 2WUBL 3MV7B 3NVQA 2ED8A 3G6JE 4LLYB 3CVHA 4J3VA 1OAYH 5DGQA 5ISZA 4I0PA 1NCNA 4HUWB 4L1HA 2YMXL 3HUJB 4UU9B 3DUHA 3S7GA 4XVSH 3RL1B 4L4VE 4R97B 3MROB 3CLEL 5JZ7D 3CH8A 3H9SD 1OARH 4OZHA 2ENSA 1K4DA 4OD2B 1HILA 3DRTA 2VAAA 2L7UA 5KAQG 3KXFA 1F4WH 2OL3H 3QUYB 3SJVB 4U1SB 3D87B 5FGBA 2J4WH 4FXKA 5C0EB 4GXVL 5IHZB 4JPVH 4OZ4B 3IDMB 1G7PA 3O9WD 5J3HD 4IDJH 1ULVA 3VXNB 5D5MA 2EC8A 1T66C 1KTDB 1G7QB 2X4SB 1IRAY 1V7NL 3UTTE 2EDJA 2X4SA 1J0JA 3HAEA 4LARL 3GI8H 2P42B 1F4HA 2AJUH 4J1UB 1QQDB 5LCVL 5J8OA 5B3JF 3MZTA 1TZHA 5IK3A 5C0EA 4CGTA 5DJZB 5GS2D 5ILTL 3S3SA 4U1SA 2BRQA 1BGXL 4GQPH 3DVNA 4CNIB 4P4KA 1TENA 1RHHA 2PYEE 3EGSA 5INDA 3B3IA 4APQA 4WHTB 2UZIL 3RY4A 4OM1H 2UY6A 5E6YA 4NQEE 1LEKA 3WJLA 1EMTH 2ZJSH 4GO6B 2LV4A 4JKPL 5EUKA 4BSWB 4WW1B 5IR1A 4WNQA 3WJJA 2CLVA 4CMMB 5JW4N 4JKKA 3GBLA 2DWDA 3MV9D 2NW2A 2BVPB 1IGYA 2QKIB 2R2EB 5EBLB 1DBBL 5CEZD 3TIDA 3L5HA 2FHCA 1P1ZA 1CLZL 2MFNA 2PNDA 3BHBA 4XP4H 2QSQA 3QA3B 1WWCA 5IEHA 2ILLA 3SDDB 4FP8L 3S37X 1UB6B 2DL2A 3Q1SH 2X44D 3U0PB 5DQDL 1B4RA 3BP7B 2GSIB 1EGJL 1QFHA 1BQUA 4G9FA 4DTGL 1MAJA 1JRHI 4YBQC 3LDBB 1LNUB 3DX6B 1KEGH 5C09B 2Q8AL 1IGML 4YIQA 2VXQL 3TC9A 4V1DD 2AERT 1KFAL 1UWGH 2BNRA 3QSKB 4JHAH 1XGTA 4LPXA 2PR4L 3MREB 1UZ8B 4MJ5A 3TIEB 4NUJA 4M7LL 5ESQA 4P46A 5F96L 8FABB 5E9DE 4LHUD 5CCKL 5EU7E 3D9AH 4FQCH 2NMSA 2ID5A 5BVJA 3TN0C 2ZG3A 2J6EL 3AROA 3JTSB 1G0DA 3UCRA 4OJFH 5E03A 2X4UB 2Q8AH 5KSBB 4U1NA 3LKRA 3IJSB 3RZCD 2X4NA 4HXAH 3CFIC 1MQ8A 1B0RB 1CDJA 4FQQA 1OP3K 1NCDL 1MH5A 4PGDB 5ITBL 4DW2L 2YUVA 2BHYA 1OSPL 5EU5B 4NO5B 4LVNC 2DJSA 4JM4L 1CFTA 4JFFA 5E5RB 5EBMB 3LRSB 1MQKH 4LNRB 4J8RA 3IF1A 4P23C 4MZ3A 5A1AA 1A6AA 3CC5A 3S5LB 3CXHJ 2QEJA 4L4JA 1IFHL 4JRXE 4LU5L 4BQCA 2XY2A 5DEZA 3HHRB 1FQ9C 3KPQA 3FMGL 3L6FA 1V3MA 3QNYB 5MEPA 2IF7A 1E6JL 1KJMA 4Y4HC 1MCJA 1QNZL 1TNNA 5DJAA 5F72S 4YNYB 2FJFA 4ZTOH 3OF6A 1DLHA 5I1LB 2YD7A 5C6WH 1D5ZB 5FYKL 3CFKA 5GS3A 1Z2KA 4OGYH 5IBLC 5F7DA 1U95A 5CBAB 2F5AH 4D8PB 4JFPB 1SY6H 4PRHD 3LKOB 1V3LA 3MSPA 3G5ZA 3M1BA 3PP3K 4JRWA 4KK5C 1MCBA 5E00A 5FHBH 1BZ9B 1JWMA 2XPGB 1NGPL 2P5ED 4ZXBD 4NZRL 2PF6A 3FHQA 2B4CH 1NGWB 3X12A 4I4WB 1WBZB 1RJZB 1C7TA 1W8NA 1HKLL 5D7IF 5IW6B 4P5TA 4WU7B 3BAEL 1J0IA 3QH3A 5D5MF 3WNNA 3L5XH 5AAMA 5CEYA 5BXFA 1BFOB 1CTNA 1T21A 3VA6A 5GS2H 1ACYL 5ICXB 5T3ZE 2GUOA 5ESVB 1BJ1J 5T33L 2B0SL 4AQ1B 3BGMB 4AMKH 5C0IA 1G7MA 5MP6L 1SJVA 2CLZA 5BOPA 1OL0A 2BNQD 4OZIE 1WEJL 4YXKL 1OP3H 3HLAA 2B1HH 5JOFA 1N0XH 2V5YA 2CDEA 1GPOL 5C9JA 2BCKA 3WFCL 3RVVC 5DR5H 2NY3C 4X6DF 2YRLA 2AXFB 3MRMA 4B53A 2Y07L 3BZDA 2V2XB 1OTTC 1EEZA 4MSWB 5CGYD 3O3AA 1Q94B 4NN6B 5JW4Q 4EDWL 4F57L 1EHAA 3ARGC 1Q1JH 1NFKA 2DKMA 3WNLA 4PJDA 2BFVH 5K9QG 4V1DA 2PXYD 3DX9B 1CDYA 4Q97A 5CJQL 4RCAA 3VFNA 1QKZL 4U31A 2BVEA 5FM5M 1A14H 4JQXA 5FCSH 2MSPA 5ALBL 1R6VA 3HPJA 4B7LA 4G8GA 2GSGB 4OIAA 5HYJA 1C12A 2Q7NA 2VKXA 4KK6C 1A7OL 1KCSL 3PP3H 3TPUB 4KUCD 4NDMA 3BT2H 3IDUA 3BKYH 1BQLL 3G6JB 5GS0L 4FQHB 3UTZA 1H3XA 5CLTA 4PTTB 3QQNA 4Y5VB 3LQAH 4XPBH 1OY3B 2ED7A 1JWSA 5B38B 4PJXE 4O5LL 1U9KA 2QQLH 3VFNB 4YPGA 3JWDH 3RU8L 1D5BA 4NT6B 1AXSB 2OSLB 1S9YB 4LLVA 4N1CA 1NLBL 4OI9A 4JHBA 1S7UB 4WTXA 4HIHB 1PJ9A 5DD0L 2UY7A 4KZEL 4EOWH 4NIKB 3JUYA 3SKNB 5F71A 4FQIH 5HHMD 2OJEB 4NSKA 5EIIA 1S5HA 3ARFB 1DANT 5CINL 3VD4A 1SMOA 3WKNA 4MA7L 4JM2F 5CMAB 1IAMA 1A6VH 4BELD 4HX1A 4EVNA 3ZHKA 1AR1C 1MEXL 5BZDA 4P2RA 2VAJA 3OGCB 4LPTA 4YHPA 4P2RB 4XPGL 2OJZH 1WAAA 4HS3B 4QRPB 4DUVA 4M1GH 1MOEA 1NCTA 2O5XH 2Y5TB 1N6VA 1AD9B 4KMTH 2E6JA 2H8PB 4X7TB 2D7MA 4O4YL 4D2NA 2OMNA 3VXSA 5LGHH 2DLFL 7FABL 4GRMB 5SX4I 5DK2A 3PABA 4Z7VB 2EYTA 4LHQB 3VFSB 2AJVH 4PRNB 4OCYH 5BO1L 2FB4L 4EUPH 4FG6D 4ZUSB 4OKVB 4TTDD 4J6RL 2UV3A 3WXVL 1KB5A 3D2UA 3HZKB 3LQAC 3NIGE 3W9EB 1WTGT 5HBBA 1FORH 4PD4J 2H9GB 5DHVA 4DUXA 4R3SB 4QXUL 1DANU 1HH9B 3TZVD 3FRUA 4QGYA 2UWEB 4GT7A 3TBTB 1YEEL 5IFAH 4S11A 1ZA6A 4Z6AT 5DYOA 3JBG7 1JYWA 4FQHA 1NCAH 5J9PA 3EO0B 2ZPKH 1HQ4B 1A9EA 2V9RA 4BUGA 4HUVB 3CDCA 4W4OC 3BD5A 1OW0A 1U8NA 3QFDA 2NX5E 3BPNC 4F7PB 1N0LA 1OTUD 1D3CA 1YEGH 3GEWB 2R23B 4P49A 5BQ7B 2UUDK 2EKJA 5JIHA 3GSVB 3MJ9L 5C08B 1A3RH 2PCPB 4ORGB 4R90H 3MXWH 3BGMA 1LDPL 4W68A 4ZPTA 1F45A 2DWEB 3VCLB 1Z9LA 3EYUL 3SEPA 5L2KA 3LRHA 1I1YA 4Y1AA 4DEPC 5C6TH 1KCUL 4WWKB 4PB9H 1RJZA 2ZUQC 3ZT6A 1BIIB 1TQBB 1M7DA 3VE0B 4RGND 2W1NA