5D7LD

Structure of human mr1-5-op-ru in complex with human mav36 tcr
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
199
structure length
187
Chain Sequence
EDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELSSILNITATQTGDSAIYLCAAYNTDKLIFGTGTRLQVFPNIQNPDPKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 32
structure length 187
sequence length 199
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7lD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7lD02
2V7HB 3PUCA 5DEFB 5JORB 5CGYC 2FJGB 3MLRL 1FDLL 4LHUA 4KQ4L 4OZ4A 1FYTE 3GMPB 3PHQB 3QUYD 4QOKD 5FB8A 2A9MH 4BKLA 1AGEA 3EYSH 1G9ML 2Q7NA 4WJ5A 5KJRL 2E7LC 3QWOA 1ZHLB 1OVZA 3QNZA 1OTUD 4JFYB 4NZRH 5T3ZL 4R4FL 3RRQA 4PREB 2X7LB 4EQ2A 3QO1B 1WJ3A 4J1UA 5D7LE 2YN5A 3D18A 2H8PB 4ZS6D 3O45A 1PG7W 3TM6A 3BZDA 3HZVB 2DQTH 1FJ1A 3RU8L 1CE6A 1YJDH 4H0GA 1JN6B 4WHTA 2LTQB 2GTZA 1CFVL 4JPIB 1JNNL 4NOBA 4MJ5A 4RISH 3NABH 2VB5A 3UBXB 2VLRA 1PFCA 4KMTL 4WFHE 2P8LA 4TVPH 1CR9H 2Q8AH 5KVGH 1TNMA 4GW4A 2JIXD 5E5MA 4LFHG 4WCYH 2R1WB 1MJ8H 3I3DA 1JHLL 4L8SA 2PXYD 3HNTH 5JXAL 5ESQB 3QDMD 3FCTB 3TJHC 2X4UA 5HI4C 4XMKL 5BO1H 5I8CB 4M48L 4TSBH 1EEZA 2DBJA 3TCXA 4F7CB 1MH5B 1NBYA 3PWVA 3LZFH 8FABA 1ZWIB 4LLDB 5IHLB 2X40A 5ICZA 2AJVH 3KPRA 3N1PC 1HDMA 4XAWH 3RVVD 5DVKA 1CXEA 1U6AH 3T3PE 3MQIA 4YJZL 1UFUA 1CI5A 5F1IA 1YC8A 3RIAF 4P4KB 3DVGB 5AUMB 1H15A 3QAZC 1H3TA 3TZVA 2YPKA 4WO4C 4P3WA 3O6KL 2V7NB 5K9JL 3K74B 1UENA 2P24A 2OI9C 5BRZB 3BD3A 4J4PC 2PKDA 5L2KB 4QXTA 2VDRL 1NEZG 4L5FL 1XGYL 2NXZD 3MBEB 2HFTA 5K59E 1I7ZB 3FB7B 5IB1A 3RVXD 2H2PC 3PV6A 3SDXA 1VFBB 1R5IB 2P4AB 1MFBH 4N0YL 5GZOD 1JTOA 1G7MB 2AEPH 4XNZB 3KLDA 4L4TD 5I30L 1Q8MA 1UJ3B 1J1OL 4U1IB 2UVEA 3LEYH 3HUJA 4RGND 5IHZB 3A67H 1MAMH 1GIGL 3OKKB 2X4PB 1ZEAL 5DK0A 4PG9A 5FIEA 4DKAA 3G5XB 1NGWB 2AJUH 5KOMC 5TPWL 3IVKA 4AEHH 5D7IF 1IKNC 1NC4B 4ZUTB 2HP4A 3TT3H 4B0MM 4M6ML 1FFRA 3GMOA 3NZ8A 4Y19D 2VDML 2C1OA 4IMLB 1S9WB 4ISVA 5SV3A 1FGVL 4KKAC 1G0DA 4YK4C 4X6EA 4XVSH 4OF3A 3OKNB 2HFFB 3PL6A 1MJUH 5FHBH 4N0FB 3PGFH 1FO0B 1AHWA 1MSPA 5ENWB 4P2CG 1BJ1H 3T1FB 2I07A 4FFZL 2HT3C 2VDQL 2YKLL 1AIFB 3H9SD 3QB7C 1LO2H 4E0RB 1YEDB 2VE6A 2DICA 3OZ9H 1BF2A 1YUHA 2R2HB 4XHJD 3NCFB 5EIVA 3IAQA 2ZZUT 3CDCA 3ULUE 2FWOA 5F88B 3FT4A 4I48A 1ZS8A 2XWBA 4DVRH 5EOTA 3OKLA 4KAQL 2DL9A 2PYEE 3LQAL 4PJGF 2YD3A 1R3KB 4O9HL 3BJ91 5E1HB 4WW2A 1R3JA 3TBYA 2A73B 1DQJA 3D3VE 3K81A 3MACL 4P9MH 2DAVA 1Z5LB 3T2NH 2F8OA 1FLRL 3GSRA 4PJHB 3T3MF 1V7NL 1TDQA 1FL5B 5HYJA 5C0GB 1KG0A 4NQEB 1WIUA 5KG9B 5JA9A 1CE1H 2EZ0D 2ICWI 4NN7B 4Y1AD 2NXYC 4Z7UE 2YBRB 4M1GL 3OB0H 2CIKA 1FPTL 4OZHE 2WP3T 3PWPA 3W11C 3S88H 4XNMA 5D9SA 5EZLB 2WQRA 1D5BA 5DUBA 4PJCB 4Z7NE 2X10A 5D2LB 2X4RA 2BNRE 3IKCA 2UZIL 3ZT6A 3GO1L 2DJSA 2Y36L 3FTGB 4HIIB 2EYRA 3C6SA 3QAZB 4J23A 4KDTC 3E6FB 3FB5A 4WO4B 4ONFH 1IM3A 3ARFC 1Y18B 2MKLC 5IEHA 3VFVB 3U48A 4HWBA 2OI9B 3TPKA 1KPUB 1K2DA 3LB6C 4LPYA 1OF2B 2B4CC 1UJTA 3FZUC 1YMMB 3BZ4B 4U1JB 3VE0A 3U4BL 2XQBL 1G7HB 3KS0J 3QQ4B 4S1DC 4Y5VC 4F7PB 2BSTB 4EBQL 4R4NC 4KK9C 1KTLB 2R0KH 1XCTB 3A0OA 4OCSL 3CFBA 4OD1L 5JMRA 1IGIL 4JLRA 1NCCL 3MV9E 2QSQA 3HNSL 4P23C 1A7PH 4MD4A 5DJDA 1L7TH 5F6HI 3W39B 4NNXB 1UM5H 1U8QA 4ZFOL 4JM2D 4OI8A 3O6LH 5DWUL 5MEPA 2WBKA 1PQZB 4JFFB 5J12C 2GK0A 4KZEL 5CJOL 5CKGA 1T04B 3DO7B 4OSUH 3CZFA 1Z2KA 3ILQC 3SDDD 4DKEL 2CKBL 4IHOA 2DIAA 1XT5A 1ZANH 3LKSA 2C3GA 2DI7A 3L5IA 4K3JL 4LNRA 4GG6E 5T1DH 3ZE0E 1P1ZA 3FMGH 2EIZB 4WFEE 3OAUH 3DUSB 4P46C 2OXHA 1UXWA 3MRJB 4Y4FD 4YK4B 5DLML 1KEMH 4PP2A 2OP4L 3BN9C 4LKCA 4J3TA 4B41A 5GRJL 3RWCA 4EUPB 3FONA 3JWDL 4EXKA 5EU3B 4QHNB 3RY5A 2VLME 2WBJC 4OZGE 5D1XC 4HKZB 1H3XA 2R1YB 4K8RD 5D2NA 2DQCL 1EEUA 1IILE 3O2DH 3LH2H 2UYLB 3BKYL 1H0DA 3AM8A 5I1LB 4I2XA 5CP7B 3JWOL 2DMCA 4OT1L 2W0PA 2JK5A 2YPLB 1VEMA 5DJAB 3W81A 1VCAA 5C7XH 3OB0K 1KJ3L 4KTDH 3IT8D 1O7VA 4XGZA 5BVJB 3OPZH 4HUKB 2ZKHH 1JPTH 5JOPD 3ULVC 1UADC 1EXUB 4XP1H 4ZOCA 3IFNL 5C3LD 1GXEA 5FYLE 2V2WB 3BPOC 1NAMA 1BQSA 1U91B 3PQYA 3RZCD 3O2DA 2DYPD 4U4BA 3B3IA 1AC0A 2IFFH 4PG2C 4XXCA 2HRPL 4YIQB 4BSVA 3UYRL 2EYSA 5GS1A 4Q9RH 5I19H 1XF3A 2NXYB 3V7AG 1WZMA 5E8DH 3CFJB 4E42A 1KSRA 5HYQB 2YMXH 3WNLA 4NYLB 1G9MC 4FQHB 1U3ZA 3BKJH 3EOBA 3FQWB 4UTBH 4GS7C 4NQVA 4N8VB 3FQTA 3ARFB 3AU1B 1CBVH 3L5JA 5B38B 3PWNB 1KC5H 4LLMA 1DLHA 2V9RA 3D85B 5TDOB 3IDNA 2QKIA 3KDMA 4ZXBC 3T2PA 4DVBB 3WHE1 2DWDA 3HE6A 4FQXC 2Q6WB 1OP3H 3HNVH 5J6HB 3PGDA 1EGJH 3GSXB 3QH3A 4Y5VB 3RWFB 2HTLD 1HXYB 3MLVL 4TUJA 1HHJB 4PY7A 4LVNB 4S2SB 4OD3H 4P23B 4I5BA 4Z7OF 3ISWA 3P0VH 5L2JB 2YC1B 2NY0C 5ADOL 5DHVB 2AXHA 2YHGA 1VKXB 3LAFA 4ZSOA 2E27H 3HZMA 2YK1H 5GQBA 2DKUA 3EFFB 3SE9H 5FGBA 1MFNA 1F11B 4G5ZH 4PJ9C 3S36X 5J12B 1XF5B 4GRLC 4ZO9A 1A7OH 3LN9A 1NGYB 2JLLA 4NQDA 5K9KA 3ARYA 5ITBH 1C08B 1JUFA 2DWEB 2N7AA 4LKXA 3DHJA 1ADQA 4J6RL 2APFA 4X6CE 1QSFE 3FT3A 2X9YA 3W5NA 4P46B 1OM3H 2ZG1A 2X1WL 3SJVA 3V4PL 3QNYB 3IF1B 3I9GL 2P5WA 3O3EB 1OTTD 3ARDA 5A3ID 4F57L 4XPAL 1BZ9B 3ARRA 3OJVC 2H1PL 3IAGC 3HG1A 2ZCLL 5INCA 5D70L 2G60H 5BJTA 3DURB 1JF1A 3O3BB 2DQDL 2R56H 4NO5A 2WBJB 2Q3ZA 5D1XB 3IXAB 2F8XC 4ODTL 3WUWG 2FEEL 5ESAB 1SQ2N 4ZUVB 4AIOA 5ERWB 2F15A 3PWUB 2EYTB 3OKMA 2HN7B 3FB6A 3MYJA 5KANG 2AV7B 4QRRA 5TQ2H 1TETH 3U36A 1LEIA 4MNHB 1L0YA 3QXAB 3FN3A 5JXEA 4CW1B 5HHNA 5SX4I 4BFGA 1KV3A 5HHMD 4EN3C 3VXRD 1L4IA 1BD2A 5K9QG 3RWHB 2XZCH 3OL2A 1NQBA 2NX5E 1P69B 4JANB 5F96L 1ZGLM 2H6PA 5ILTL 4PJ5D 4LASH 5C86A 3F62A 2JF1A 3BPOB 1JHTA 4FTVE 5EOCJ 3T0EC 3PGCB 5HY9A 1IC4H 3PHQA 4K9EH 3ZKSD 5EOCL 2C3VB 1D9KC 4HBCL 1BX2A 3NCEB 3TGXA 1Y0LA 2QSCH 4EDWH 4JFYA 4PY8I 2Q20A 5ALCH 4PJDA 2GEEA 4MZ3A 1OP3K 4AENA 1X6LA 2FLBT 1HSAB 2D7MA 3WFDL 3GJFH 3GI8H 1GAFH 4OD2A 4U6TA 1T1XA 2YD9A 1T20B 4IS6B 1HCVA 3HZVA 1OSPH 4GS7B 3ARGD 5L9DL 2WWMD 1D5MB 3DX9B 4K23H 3RDTA 3VRJB 1ZA3A 2YRPA 5LCVL 4JPIA 3CU1A 3KJ4C 3LKNA 1NGZA 5DEGB 4QTIL 4XCEB 5FYKE 3UBXA 1JCKA 1MFEH 4ENED 2APXA 5EU6B 1F00I 4ZXBB 3LQAC 4JZNB 1PSKH 4XH2A 4YHKH 3EAKA 5J13C 4HIEB 4FQXB 1QR1B 4LCUB 1J8KA 1J11A 4ONOA 5GGVL 5F9DC 1FYTD 1D5IL 1BP3B 2RCSH 1K8DA 3KPSD 1G7IB 3RWJA 1YECL 2IBZX 3FCTA 4R9HA 5DURD 5LVEA 2B0SH 4PB0H 1MCNA 4E41D 3K80A 5I8CA 5KSBB 2NY0B 4P9HH 2MCG1 3F65A 5D72H 4TVPD 1IKFL 5D7LD 4F7CA 1P4BH 3QUXB 2BOBB 3KLSA 4PJ9B 5IHBA 4LLDA 4BSWA 4NQTA 5DJXA 4Q6IA 1P7KB 4WUUB 1HQ4A 1FFOB 4GRLB 1NCWL 5C9KA 4PR5A 1NMCC 1X5KA 1KN4H 3O2VH 5GPRA 1YEFH 1U8OB 4UV7L 3TYGL 3L3OA 4FABH 4UILL 3VXQA 1DUYA 2FO4B 5BRZA 1P7HL 1FIGH 5AD0A 5L2KA 2D9QB 3S35L 4CU8A 3B5HA 4JN1L 2X4SB 3RFZC 2BVPB 4QRSA 1I7ZA 2ZPKH 4YXKL 4RGOL 4G9FD 5JHLL 4PJEE 4L1HA 3LQMA 3O9WC 1F4XL 1VFBA 1Z0NA 1R5IA 3HMXA 5C6TH 2OTUB 1YEEH 4KKCD 5EBMA 5DA0B 35C8H 1G7MA 2LU7A 2JCCA 2HMID 4OFYA 2A6JA 4LRNH 4ZOBA 2ARJQ 1UJ3A 3BGAA 3P40A 1XGRB 3GM8A 3I50H 4P4RA 1ITCA 2ZUQC 4DZBA 2FBJH 5IHZA 1F3JB 4RAVA 5KW9H 2X4PA 5EZIL 4X9BA 1HILB 1Q9LA 1RUPL 5GRYA 4ERSH 2AAVA 3QFJB 4KUZL 4EN3B 5FFLA 1LO3H 1NC4A 1WAAA 4G8FA 4AEFA 2EIEA 3GJFK 3HE7D 3V6FB 5C07A 4K3DL 1I9IL 1LD9A 2WLYA 1JTPA 5FGCB 3U46A 4C56E 3K7UA 5MP6L 3C5SB 3I75B 3EOTL 5GRZA 2OBGA 3OKNA 3T0EB 2EDXA 4HWNA 5ISZB 4YHYC 4JJ5A 2ZUXA 3GIVB 5DMIL 1FO0A 2R15A 2WUCH 2ILLA 1IGFH 5JR1L 2HT4D 4G7YL 1TJIH 1N6VA 1D9KB 4ZUSB 4NKIH 3MOBL 3HPLB 4YLQT 1S9XB 4MQTB 2IMNA 4O4YL 5ACLA 2DQFB 4GG8A 3CMOH 3KYKH 4WW1A 2H45A 3UO1L 2B1AH 1CDGA 2DLTA 2R2HA 4O5LL 4TSAL 2ESVA 3JWDC 5C0RH 3CFEB 4I8DA 1MHCA 3MV8D 1HHHB 3L3GB 5F88A 2XZZA 2W0FB 4UU9A 4M62H 5L0QC 1T5XB 5AG8A 1INQB 3SQOH 4ZOEA 4LLYA 4UOJA 1PYWA 3KJ4B 1I1FB 1SJHB 3AS2A 1TQCC 3I2CL 1G6RL 3F7VB 4HC1L 1Z5LA 3ZSTA 5J13B 4LMQE 3TVMD 4G8EB 4ODXB 1LDSA 5EIIB 3D9AL 1FL5A 4LIQE 3VXPB 5AAWA 2C3WA 2W60B 3REWB 3LPWA 1EPFA 4GKNB 4ETYA 3KJ6L 4YHOH 12E8L 3HAEB 3NCYS 5FV1L 3BGMB 3ULUL 5E8EB 4G8IB 2YD2A 1JWMB 2YBRA 2MQ0A 3K8KA 3RPIB 2F58L 2DLFL 3VFSB 1FL3B 1AP2B 1NSNL 5TQ0H 5JUEH 4HIJA 3S37L 1QNZL 4B7LA 4PJCA 5D2LA 3GI9L 1NMCB 2VRAA 2IAMC 2NY1D 1JRHI 1KLGB 2IWGA 2F53D 5CINL 4IOIB 2JTDA 1MCQA 4EIGB 25C8H 5C09B 1IAIL 1Y18A 3UJIH 4D9RE 1R3IL 5I16B 2DM2A 5I74C 3D3VD 3QEHB 3E8UL 2W92A 2HJFB 2MKWA 4J4PA 4UT9H 1NAKH 1FNGA 2YWYA 4XNQA 3DJ9A 3IYLW 4JQIH 3H3PH 3HKFA 1QFOA 3I6LE 4U1JA 1I85C 2Z4QB 5IB3B 1G7HA 4JM2F 3EYUL 2ZG3A 2J8UB 2VZSA 1IVLA 1IMHC 1BQHB 5HYFA 1S7XA 4CN6A 2YEZB 1N0LA 3NZHL 3WUWA 1M7XA 3O9WB 4D0BB 2R8SH 5FKPA 2KL6A 1KB5L 4RGMC 5BZWA 1YY8B 3RUGB 3BAEL 2GUOA 4HXAL 3W39A 3F7QA 3P9MA 1C5BH 4FQ2H 2YD8A 4NNXA 5HD8D 3UTTE 4NO2B 5A40E 3OGCB 2VDPH 5E2UH 4GAJH 1I1RA 3C60A 2BNRD 3BESR 3CH1B 5FUOH 1AGBB 1UZ8A 4JN2A 4LAQL 4LDEB 4WEBL 5KSUB 4GQPH 4LSPL 5AZEH 3DO7A 3MROB 3NOIA 3MRGB 2VZOA 3G5VA 4PV9B 4OCRH 1F90H 1OP9A 1QPPA 1RZFH 3N9GL 4YQXL 2P8MA 1JMXA 2X41A 3CCHB 7FABH 4D9LH 2CKBB 3BJLA 1U8PB 3L7FB 5E6IC 2Z93A 1RFDH 4JHWH 4L1DA 4FQLH 1TJHL 4YHYB 5BXFA 2IC2A 2VLKB 3A6BL 4G8GB 4KPHH 5D8JL 2OQJB 3MGOB 1T03L 2DDQH 1AFVH 1WTGT 3CFDA 3LN4B 4EUPA 1OGTB 4XC1H 3QHFH 2BFVL 4OQTA 5F3BA 2F54D 3RGHA 2R1YA 4PJ8C 4Y8DC 4V1DE 4PRHD 1HIMH 1LVEA 2ZCHH 2UYLA 2XQYG 4M6NH 1MCPH 2YZ8A 2YPLA 5DRWB 5INDB 1NCDL 3C2AL 3BYYA 4XVTH 2K7QA 4APQB 5L0QB 3RX5A 3UTZB 2R0LL 4YUEH 3OHXB 5IB5B 3IRZA 1KXQE 1F5WA 3NCJH 3WIFB 2XG5A 5BVJA 4PRBB 1EFQA 4WFED 2J8HA 4RAHA 1TQCB 3BI9X 2VH5L 4YHPB 1I7TB 5DD5L 1JPSL 3DMMD 5C08E 4NCDA 4XWGH 2G75B 2V2WA 3BYTA 5GJTH 2H26B 2EDEA 1U91A 5AZ2H 1KJ2L 1CDIA 4LEOB 2P5EE 1NMAH 1YZZA 2MMXA 2VLMD 4G6AC 1IAMA 4XBGA 4C4KO 3MNZA 3L3KA 1FZJA 3MJ8B 3CFJA 1D5XB 3IDXL 4FQHA 4RZCA 4P3CH 2ITDA 4UAOC 2IAMB 2FSEA 1MCSA 3GIZL 5KVFH 3SE3C 2L7UA 2BRRL 4K7PX 4KDTA 3P4MA 2FGWH 4P48A 4N8VA 5FYLL 5BOPA 3GSNB 2NZ9D 3ARFA 3AU1A 3RGVD 2DMBA 4OJFL 1U9KA 2B1HH 5B38A 3UTPD 2JJUA 2VL5A 5I74B 1JBJA 3D85A 3CFIC 3CNKA 2Q1EA 3P11L 1FL6B 2ITCA 4I13B 5SWSA 4MD5B 4DVBA 5JA8B 3V79C 1DQDH 2IH3A 4M7KL 3RBGA 3S5LG 2Q6WA 4CVXA 5IQ7L 5J6HA 4KQ3H 5LGKA 4Y5VA 2VC2L 4GAGH 1AKJB 2FATH 4QYOA 2X4TB 1Y6NR 2E9IA 1HXYA 1HHJA 4RGMB 4L8CB 4WDIB 1OD7A 3L3HA 4KH2A 4P23A 1H9VA 4UV4H 1RUAH 1RUMH 1IGYB 2XXMB 2YC1A 5LG1A 5I8KL 2AJZB 5DHVA 1VKXA 1J1PL 5E2WH 2DLEA 3PIQB 3IDIB 2OXGA 1F11A 4XP4H 3OXSB 2HKFL 1DTUA 1FP5A 3CLEL 4XB7A 4KK8C 1I8LA 3AREC 4PJBF 2VZ3A 3UMTA 5KS9B 5AWNL 4JPWH 2QADC 1UCTA 5DGQA 5J1AA 1A0QH 3VFWB 4Y4HD 5FA3A 5HXMA 2A1WL 2AK4D 1W0YT 4QRPA 4KVCL 1HINH 2VLRE 2P7TB 3O3EA 4TN9A 2Q87A 3MRDB 4O51B 5E6IB 1NBQA 3BP6A 3JXAA 5DRXB 1BZ9A 1SBBA 1YEJL 4YHIA 4XCFH 4PJFA 5IFHH 4KGLA 3O3BA 3KPLA 5FECA 4PJXB 2Q8BL 2DKSA 1K4CB 4YE4L 3P4NB 2WBJA 5D1XA 2D7QA 3IXAA 3DXAB 4PJ8B 1FGNL 3ZKNC 3R1GL 1A47A 5ESAA 1OAZH 3WD5H 1F2XK 2XRAH 4IRSD 1CFQB 2HN7A 4IMKC 3VXNB 2DTML 1URLA 1T2JA 3KXFD 4B5EA 5LQBH 4XAKE 4MXVE 4XVUC 5ALBL 5HYIA 3QXAA 1LP9A 4P2RB 3KPRE 2CDFA 3WKMH 5ELIA 5E9DB 4MNQA 1Q9KB 1CGSL 2HJLB 2FLRT 2Z91B 3PDDA 3C5ZD 1XH3B 3RWHA 1JZ2A 2M8XA 3OR7B 2AXGA 3SE8H 2YS4A 1TZHB 3MCKA 1KLUA 4KRPD 2X44D 4OZIA 2NR6C 1P6AB 3QDJD 1PZ5A 2QHRL 1J5OL 2GSGB 2V2XA 3MRHA 1ROWA 4WI4A 2OTWA 4L3EA 1IGCH 5A16B 5ESVA 1RAMA 5HI5D 1RZJL 2DD8L 4NFCA 3DV6A 4PG2A 1AR1D 1QA9B 1QBBA 2C3VA 1BWMA 2DLGA 4NUGH 3WE6A 4JRYE 3KR3L 5EZJB 4U6YA 1MLBB 1NUNB 5C0CD 3SDXE 3S98A 2ED9A 4LL9A 4BQCA 5HI3C 5BV7L 5T1KB 1RMFL 3ZDZE 4QGTA 3T8XB 4UAOB 5ID1B 1T20A 1NL0L 2VDOL 4R7DB 4PJ7E 2V2TB 2D7TH 3U6RA 4K7PH 4C4KT 1BBDH 2WIIB 3DVNA 5GHWH 3QEQB 2EDHA 3HUJE 1JP5A 4MQ7B 5CUSL 4UIKL 5JW5B 3BXNB 4YWGH 1UQSA 4NQUA 4BZ2H 1QSEA 3TO4A 5CKAA 5BW7A 4HIEA 4YXHL 1X5LA 2O61B 3D2UA 4LCCC 4FTVD 2HTKC 4HS3A 3IJYA 1ZKAA 2OSLB 3LPGA 2P1YA 4YAQA 2VISB 1C5CH 4FXLA 1WC7B 3FRUB 2VQUA 5I1EH 4FZ8L 1ZV5A 5F89A 3B9DA 1BZQK 1GSMA 2MQ3A 1OAQL 2COQA 4PJ9A 4LSVH 1G7JB 5D1QA 5DO2C 1FFOA 4GRLA 5FYKL 3HC3H 1QLFB 1V8HA 3BDYH 4JFDD 1U8OA 4WU7B 3C87A 2HKHL 3FOLA 2QADB 3O0RL 1UWXH 2R4RH 1B9ZA 2ZUVA 3GMLB 2AJYL 5I1IL 2IPKB 1I1AC 2AI0L 4X0KB 2ICCA 2ZSWB 3EYOA 3VG9C 4GMTL 4GFTB 4Z7WA 5K9OA 2X4SA 3LRHA 3PDGA 5EDXA 3SBWC 2IPUG 4YH6A 4HZAA 4YR6A 4OKVB 4YBQD 3NACL 5C0JB 4P59H 3RVUD 2IAND 4HV8B 5HYJE 1RZGB 3RI5K 1CYGA 4MJIB 2EDDA 2VITB 4HUVB 1AXIB 1A7QH 1AY1L 5DRNB 3CPLB 4WHYG 1Y6MR 4IIQC 4HJ0D 4I0KA 1HZHH 5D7IB 5I8EA 3U0TA 3N1FC 3WFEL 4BH8A 4JFXB 2LAAA 5J9PA 2BVUA 1T1YB 3ZT7A 4NP4L 1MY5A 3IJSB 3QFJA 1ZVSA 2QQQA 1K4DB 4JKLA 2PF6A 2A38A 4DUXA 4OLVL 5E08L 2WW8A 2VLJB 3REVB 3I75A 2W0KA 1I8IB 1UB6B 2XTLA 3HR5B 2BY3A 3T0EA 4RFNC 2V9TA 5ISZA 3EJZC 3DECA 1VSCA 3MRCB 3NFPB 1FZOB 1D9KA 4J7RA 3CXHJ 3HPLA 1S9XA 4M1DH 3ZDXF 1QD0A 2DQFA 4LLVB 1D5ZB 1DP0A 3PJSA 2CDGB 5HDBE 4JG0L 4N5EC 1KFAL 5C3TA 3DGCR 1M7DB 4PJGB 1BFOB 6FABH 4JFED 5FUZH 1TTGA 4GW5A 3L3GA 4M43H 5CGMA 3WDIA 1BOGA 3SDCD 2HVKB 4POZD 3QFDB 4JM4L 3AAZA 4ZMAT 1INQA 1KLFA 1QACA 1TVBB 1KCVH 3WXVH 1CLZL 3BKMH 4JY6A 1INDL 1I1FA 3UXFA 4DTGL 3S5LA 3I3EA 5E8NA 1RZKH 4OM0H 1KXVC 4NJAH 2XQYK 4KHXL 3F7VA 3IXTB 2NY7H 1KENH 1L6ZA 3IJHB 2A6DA 5MENA 4AMKL 4G8EA 5SWQB 4KHTH 1FVEB 4LCCB 2PUQT 5EIIA 3QEUB 2VXTH 5DUPH 1UWXK 1G6RB 4GKNA 3DOSA 3LVEA 3G08B 5I8OH 3TFKC 3LD8C 1AR2A 1KBGL 2VERN 3NCYP 5E8EA 4G8IA 3NFNA 3SDAA 2WNGA 1K8IB 3LRSB 1GC1L 1KCSL 4YZFF 3RPIA 3VFSA 1FL3A 1Y6KR 1AP2A 2IG2L 2Q76B 5EBLB 4XP5L 5C0AA 5D2NE 2FRGP 2P48B 3QHTC 2KDGA 3PHSA 4I0PC 4MS8C 5HDBF 3MV7B 4I2XE 1B3JA 1YA5A 1IBGL 2PYEB 5T5FL 4IOIA 2ICWA 2QQLH 1A6UL 4HLZH 5C09A 4CNIB 3VWJD 3MXVH 15C8L 4X7EC 1LEGA 1W0VB 1JFQL 4QHUB 5CSGA 3QEHA 4HJJL 1I1AB 4ZODA 2HJFA 2VAJA 1MI5B 1T3FA 3G6AB 1E6JH 3GMRB 1F4HA 2BXZA 3Q0HA 1JPFA 2Z4QA 1YPZF 1A9BB 1KIQB 3CD4A 3FQRB 1NDGB 5CEXA 2J8UA 1CICC 1BQHA 5DI8B 5FKAB 3TA3D 5E5UB 3GKWH 2BVOA 4D0BA 1IC1A 1MCRA 3PQYE 3PABA 3NMEA 2Y07H 4ZFZB 4OUOA 2BJMH 4PBXA 1GGCL 4MLIA 4LK4A 3M8OL 3RUGA 2NTFB 3U7YL 2W9DL 1RJLB 1UACH 4RFOH 5GZND 4IIQB 4HK3N 4NO2A 3OGCA 4DJMA 4J3VA 1ES0A 5T1LD 4WTXA 1PW3A 3CH1A 1AGBA 1FN4B 4MJ6A 5HYSG 4O00A 4ELME 3L3JA 3MROA 1WV7T 3DSNA 3MRGA 1ERNA 3STZB 2GYSA 3GZKA 4FZEH 3E6HB 1QKZL 3VFNB 2CK0L 4Y7MA 1C7TA 3CCHA 1B0WA 3O4LA 2BHYA 4HFWA 1DBML 2H2SC 3NGBC 1U8PA 4XXDA 4JGMA 5BOZG 4ZG1A 5IBTL 1SY6L 2VLKA 1CG9B 4WEUD 4M7LH 2X1XR 5HSFA 2BCKA 4XMLH 2OK0H 5IQ9A 4MAUL 3VFRB 4ODUB 3T08A 3MV9B 1N59B 2GIYA 2SEBB 2VXSH 4YPJA 5CS7A 4FNLL 2GY5A 4DKDC 4P2YA 3BKCH 3IU3B 4GXVH 1C12A 2R69H 4KK5D 3WMSA 2IH1A 3C8DA 3QCVL 3VI4F 2R2BA 1G7PA 1Z9LA 4ZSOE 1LE5A 4DZ8A 1CK0L 4LQFL 1T0MB 3VMOA 5L88H 43CAB 5IIEA 1CLYL 4NQDE 5D6DC 4JO4H 1HEZA 4PRBA 1Q1JH 2JJTA 3TV3L 1F6AB 5F1NA 3ARBC 2J6EH 5HDQH 2G75A 1VESA 3E3QE 2VXQH 5LWYH 3SJVE 3L3DA 2OJZH 1LK3L 4LEOA 4A6YH 2P5WE 4U3HA 4MA1C 4Q9QH 1A1OB 3LD8B 2DTSA 2ZJSH 4ODBD 1MVUB 3QG7L 4YDVB 4YBHA 4QHLA 3DTXB 2Q7YB 2XZQL 1U42A 4NO0B 5JQ6L 1Q9OB 3E1F1 5EOQH 4FMFA 4DCQB 3STBA 1RZJC 3LDBB 3MJ8A 3Q1SH 1DUZB 5IESL 1U2HA 5F97E 4WHYH 4XCNB 2VWEC 2B5IC 2I24N 4I0PB 1IC7L 5DK2A 5J11C 2IAMA 1U8LB 5DQ9B 1XGUB 1MVFA 4TRPL 1UCBH 3FQNA 4QRRE 1CZ8L 4OIIH 5GGQL 1NGQH 3GSNA 2VXUH 5BZDB 6CGTA 1WWAX 1FH5H 3GHBH 1A6TB 3SPVB 5I17B 2CRZA 1CGTA 1PBYA 3RVVC 4DAGL 1AXTL 5C08D 5JPMA 3U1SH 5EUOF 2GFBA 4PV8B 1G6VK 1BD2E 1I85A 2EDNA 4P3DB 3WS6C 4Y8AA 1CICB 1HKLL 4DW2H 1AKJA 2P5ED 3WEXA 1BECA 2X4TA 4LPVA 1WISA 1R3HB 3VWKD 4H88H 2L0DA 4ZNCD 4L8CA 4NHCH 2W65B 5CIPB 5C6PB 4CJ1A 4WDIA 4ZPVB 4X4MA 3O2WL 5FK9B 5GS0H 4I3SL 1MQKH 2NY3D 3EYFB 3UTSB 3W2DH 3EO9L 2NY2D 5AYUL 1NCBL 3JV5A 3PIQA 4D8PA 1IM9D 3RVXC 2DQUL 2HG5A 4PJDE 3RHWK 3MRMB 2I9TB 1MWAH 2NW2B 4KTEL 3OXSA 3NH7L 1FV1B 4ZTPL 3V9FA 1IGJB 3F58H 3QXWA 4U6HA 5E1AA 5KS9A 3W0WB 5GGTL 2DRUA 1PLGL 3GBMH 4H8WL 4ELKA 4RRPA 3BQUD 5EU7E 3BFOA 3BP4B 2H3NB 1XGQB 3MZTA 1N0XL 5GRVK 3NGBB 2P7TA 4DUWA 2J5LC 3MRDA 5E6IA 4LP4A 5HDLA 1NLDL 1CS6A 2DQGH 2HFEB 1DQLH 2DF3A 2IMMA 2JB5H 1JI2A 3NFSL 4WTZA 4AEIL 3RTQD 5BMFL 4PYGA 4P5TD 4DWHA 3WIHA 4P2OB 2BNUB 4HT1L 5DUML 1MHPH 1T21A 1RVFH 4JHAL 2ADFH 5F9OL 3FRPG 2H32B 3VH8G 2X4OB 4KFZC 1INEH 5SX4H 1IE5A 1CFBA 1FNSL 1QUNA 3KVQA 1CFQA 3T0VA 3FHAA 2IPUK 5SWZA 4NZUH 5KBNC 3U9PL 3O6FD 4K3EH 1F45A 1K9TA 1MPAL 2W9EH 1LE9B 4GKZB 3MLUH 2A9ML 1Q9KA 4X6CB 4PJDF 1N7MH 1V5JA 4OFPA 2HAZA 2HJLA 2Z91A 1KPRA 5DFVD 2RQ8A 2GJ6A 1YYLH 5DJ8B 4MNGB 4UINL 1CIUA 2ENYA 4HHAA 2IPTH 4LBEA 1XR8B 3ARBB 2VLRD 4PRIA 4X7FC 3AFLA 5BRZE 5L2KE 2CDEB 4QRUB 4MA1B 1LDPL 2LABA 3ZYOA 1D6VH 1QA9A 2AEQH 2DQTL 1W0WB 4HWEL 4QXUH 2JIXB 4H26A 4ORGA 1BAFH 3QXDB 1MLBA 1T1WA 1N26A 4JG1L 2CGRL 1VDGA 2N56A 2JCCE 3MCLL 3CSYB 2F5BH 4XAKD 2B5IB 5ID1A 1SYSB 2WUBH 4UQ3B 4R7DA 5J11B 5I1JH 5DT1H 3MOAL 2EDLA 2WIIA 3SE3A 1IT9H 4F33A 4GSDH 3HNTL 1BHGA 3QEQA 4YXLL 1JI1A 3LY6A 3MO1B 5IOPB 5C2BH 4I77L 3BSZL 3B83A 4XPFH 2NX5B 3UPRA 4OLXH 3QDGA 4R26L 1F97A 2X1PA 4HWZB 2I5YH 2IADB 1WAAE 1D6EA 1AGDB 3QPQC 2UUDH 5C07E 4NQCA 4NN5C 4XP6L 2O61A 5J6GA 1H5BC 1J12A 1S8DB 3K46A 3BEVA 1YEGH 1HH6A 4PS4H 1E4JA 3M17B 1GGTA 2A74A 4JRYD 1WC7A 4JHZA 3MFGB 4QXWA 4HS8H 3MA7A 5HYSA 3F6IA 1UWEL 2FECL 3G04B 2VQ1A 3P9LA 1VPOH 3D25B 3F12B 4JO1H 5C0BA 1GC1C 4Y4KA 3DX6B 1VFMA 5IFAH 1MY7A 4L4TB 3AREA 3EYVB 2JCCF 2EH7H 3VW3H 4JM2C 1ZHNB 5DHXB 5E2TH 5I1DB 1LK2B 1NGPL 2IPKA 3BUYB 1VENA 5I1AB 3TBTB 2AEPL 3CXDH 4NQXB 4HQQH 2E3VA 2J5LB 1RZ7L 5EU5A 2C4XA 3LS5L 3SDDC 3JWNC 4H20H 1A6VL 3LEYL 3G6JF 1T4KB 1DSFL 1WAAF 3A67L 3BP7B 4HV8A 2OZ4H 1N64L 5D7JA 2UWEF 4BZ1H 1RZGA 4MJIA 2A9NH 1BOYA 3UP1A 2CUHA 4AEHL 4HUVA 5E6YA 3WDJA 5DRNA 4IRZL 2LU4A 4ZPTB 1A6WL 4ODHH 4TUOB 2Y5TB 4O2FA 1GGIL 5D7IA 3ZYZA 4XRCB 1QRKA 1B2WH 3IAPA 3OF6D 4JFXA 4U1HB 1MJUL 3UPAA 1BJ1J 5E99H 3PGFL 4K8RC 4AEEA 3IJSA 4PJCE 5D2LE 1CF8L 4NWUH 2IQAA 3T2OA 5FHAH 4U6XA 1WFOA 4IDJH 5CJBA 4TUKH 3MXWL 2VLJA 4D3CH 2P45B 2BNQA 4HW6A 2MSPA 1UB6A 4LSDA 3DBXA 1E6OL 1U3HD 1CU4H 2V5RA 4F3FB 1LGVA 3ARSA 1EHXA 3K2UH 3DSFH 2Y6SD 3MRCA 4LARH 1CL7L 1VFUA 1MF2L 2XXCB 1ZGLB 1T7XA 1E4XL 4LLVA 4M4PA 3RKPA 3GFUA 3F7RA 1C5DB 2UUDK 3KLHD 4XPBH 4MA8H 1XF1A 2XWJA 5FM5O 4D0CA 1WBZA 4HCRA 4P9ML 1BF8A 1EEYB 5B22A 2IALA 4S10A 1KCUH 4R2GC 3FO2B 4ZS7H 5HGAB 1MREH 1YMHB 4PGBA 2FX7L 1T89C 1NUGA 2HVKA 3R8QA 3QFDA 1KPVB 3N50A 1J9CT 3JV0A 3CIQA 1RUKL 3EFDH 4HWBL 3GK8H 3RY4A 4R4BB 1JZ3A 3ORJA 3ARXA 2MPAH 4AIZB 1I8KA 2D0FA 3ECBB 1I9EA 4ZNEA 4WWKC 4C56B 3IJHA 4NN5B 1YY9D 1LO0H 5SWQA 4FP8L 5I1GL 1H5BB 2NYYD 1JGVL 1FRGH 3QEUA 4YNYA 4I3RH 1AC6A 2NMSA 2FR4A 5C0ND 5C70A 2W07A 3G08A 4JQXA 2YPVL 2D03H 1U8JA 1G7LA 4OGYL 1GGBH 4WFFE 1RZIB 1IFHH 1JRHH 4WI5A 4ONFL 3T4YB 1BM3L 1SBSH 2DL2A 1OGAA 2Q76A 4OB5H 5EBLA 1MFDL 5E56A 2GY7B 4OZFG 2IQ9L 4DGIH 2CIIA 3QI9C 4Z8FH 4YX2L 3VD9A 4U6VH 1EJOH 4HUXB 3EYQC 2J4WH 4OLZH 2YPLE 2ZOKB 2ATKB 3LPFA 4N0UA 1X5IA 4JM2B 3CLFH 1EFXA 3WJLA 1W0VA 1FORH 5EO9A 4TQEL 1I1AA 4R97C 1PY9A 3O41B 1Q0XH 1QFUH 4AQOA 5CBAB 5IGXL 2CO7B 2A83B 1BPVA 3BD4A 1JYWA 1KIQA 1UM5L 1J86A 3O6LL 3TJEL 3SBWA 5SX5H 1YN7B 1HXMB 3CGTA 3P2TA 3BISA 4KTYA 4HKJB 4DGVL 1O7SA 5TE7L 4JREC 4LSUL 4M7JH 5J1TC 3BEWB 1MLCB 1J0JA 1TFHA 4PFEA 3AMKA 4MDIB 2EE3A 5A3IC 1ZANL 1TZGL 1I4FA 5EO1B 3FMGL 4KZDH 2O5ZH 4G6FB 3H0TB 4ZDHB 5F7NC 3FFCD 3RVTC 3W9DB 4AG4L 1FN4A 4NCC1 2NNAA 4JZOB 4JDTH 4L4VD 3TPUB 3UYOD 5JZ7C 4EVNA 3X14B 4XWOC 1JNHA 1FSKC 1TVHB 3WO4B 1R5VB 5F7EH 2HFGL 5FEBA 4ZFGL 2AGJH 5MEQB 4JR9H 5FGRA 5IB4B 3QIWC 2PYFA 3QIUA 4G3YH 1NAML 3QRGL 3VFOB 4FXKA 1CVSC 1WCBB 1K3IA 3O2DL 2P42B 2YUXA 3LH2L 5CJQH 3VXTB 2DKMA 4TYUA 5SWSE 1P7QD 5E03A 4S1SH 1AI1H 3CUPB 2MCPL 4F7EA 5CGTA 5EBWA 1T2QH 4ODUA 5DJ6B 5TE4H 3C6LA 1SMAA 2WAHA 4KTDL 5KTEL 4KKLC 3UTTB 3B2VH 3IU3A 4HLJA 1IRAY 4Q97A 1Z9SA 3MGTA 4R2GB 3NVQA 5JO5B 3H3BC 5IT2H 1AH1A 4XP1L 1C1EL 1X5HA 1NPUA 2JELL 3RJQB 4FQIL 2W91A 5FDYA 3QULA 5EC2A 1OCWH 43CAA 2Q3AA 2Z31A 1QRND 3LHPH 1DBBL 3G9AB 3MNWB 3BIBX 3O3UN 3I84A 3VD4A 4M7LT 1TQBB 5GGSB 5I19L 3L1OL 4WWKB 1F6AA 3PDOA 1TZIB 3TIDB 3SCMD 3ULSB 1HYSC 1F58H 5E8DL 1MRCH 2YMXL 1WBYB 4RNRB 4QRPE 4NNPH 5IW3A 3QUMA 1S3KH 4XC3H 3HC0B 1MCJA 5CCKL 3DTXA 3GRWA 1X5GA 2Q7YA 2CRIA 4NO0A 1CBVL 3C08H 4PJFE 4V1DB 3FT2B 1KC5L 1VADB 5SX5K 4IEFB 4ZUWA 2Z8VC 3RKDD 5JLZB 1LMKA 4IOFD 1YJDC 1MJ7H 4XCNA 3QI9B 4X98B 4HKBB 1YNLH 4KROB 5DQ9A 1GCFA 1ADQL 5DFTA 3G6DH 4U31A 3EDJA 1HH9B 3OG6B 5HHPB 3WHXA 1FG9C 5CILL 2VIRA 5T3XE 1CWVA 3F7YA 3HAEG 5BZDA 3HZYB 1LP9E 3OKOB 5IK3A 4KKNA 1KNOB 3GDBA 5I17A 1SEBB 4KU1A 4MNQE 3TZVC 4F9LA 3ILPA 1TXKA 4PV8A 4X7TB 1DQQB 5DJZA 3QSKB 4P3DA 3TH3T 3ULVE 1W72H 1CICA 3SGJC 3TP4A 3ARDD 2VDKL 1R3HA 3LIZH 3N1QC 4JREB 2W65A 5CIPA 2R0WH 2MTPA 3ZDYF 4ZPVA 4Z0XB 1ZMYA 1EUUA 3AY4A 1KIPA 2EDOA 3RWGB 5IV2B 4HGKC 2NQCA 2M1KA 1FBIL 1CDJA 2VR4A 4PJBB 4TNVF 3UTSA 4OM1H 5I18H 3MRMA 2I9TA 2Z92B 5BVPL 1PAMA 3DX8B 1QVOB 1DL7H 3SGKA 4JFQB 1RK0B 4PJFF 1FV1A 1SM3H 3DVFA 4X7SL 2DN7A 3HI6H 1FSKB 5FYJH 2ATPA 1EAJA 3W0WA 2DM4A 3ARTA 3EJJX 1S78C 3QIWB 3WLBB 4OGXL 3MLRH 1FDLH 4OF7A 3HZKB 4KQ4H 1XGQA 4PTUB 3JV4B 1X3DA 3KPPB 2O5XH 3U9UA 2IFGA 5B39B 3L7EB 1LHZA 4LCWD 3T4AA 3L5WB 2D7PA 5F7WC 1QSEE 1G9MH 5D7SL 1G9NL 4LHUB 5T3ZH 2R39A 1J0IA 2OR7A 1AHWC 1AGEB 2D4DA 1F6FB 4WJ5B 4OZIF 3INUL 2X4OA 1ED3A 3CK0L 3QUYA 4I9WD 4QOKA 3N06B 1MHHA 2Y06L 4AYFA 1EBAA 3RU8H 2HT4C 4QKXB 4J1UB 4RMTA 1SVCP 4F58L 4LASL 3P4OB 3D18B 4HUMB 3U7WL 4OZFH 1Z9OA 3VFGL 2DLHA 1JNNH 4QHKI 4ZUUA 4WY7H 1N2RB 1FFPB 1F8TL 4NN6C 2EDKA 4KMTH 5FYJU 1JHKL 1FJ1B 4NOFA 5D6DA 2ICES 2NY5L 4NUJB 1YQVL 4WHTB 5DJ8A 4MNGA 3DARA 4NKDA 4MJ5B 3BRDA 1BFSA 5JXAH 2P8LB 3SKOA 4NWTL 2BX5A 3RI5F 4F8TA 3R4DA 1BQLL 4JY4A 4UQ2A 2CDEA 1U3JA 3UCRA 4XMKH 1BJMA 4Z7WE 1V3MA 4M48H 4PRPD 1OSPL 4QNPE 1A9EB 2QSTA 4R3SA 2AS5M 2JIXA 4N1HB 3QXDA 4JCMA 3VRIB 3TVMC 1T6VN 2PXYA 2GT9B 4Q7DA 2ZUWA 2CMRL 4WI7A 5CZVH 2F74B 5ICXB 1F6LL 3CSYA 1EEZB 3MC0A 3QDMA 4C54A 5DURB 1NBYB 4UQ3A 1T66D 1A6PA 3BT2L 1GYAA 3KPRB 3O6KH 1UWGL 2OS7A 1MAKA 5K9JH 1CGWA 3C8KA 2E7HA 5IOPA 4KGJA 2X89D 4P4KD 2D9CA 2VDRH 4PB0L 3TZVB 2YPKB 3QFJE 3O3AA 4L5FH 1XGYH 2IADA 1AGDA 4NDMA 3KYNB 4M00A 4U1LA 5D72L 2QLVB 4GRWE 3WS6A 2BY0A 3UROR 3S36L 5L2KD 4JKKA 4QXTB 5FGCE 3HMXL 4N0YH 3T0EE 2NZIA 3MBED 5SV4A 1KN4L 5ISZE 4LF3A 4CMHC 3VGHA 1DEEB 3PV6B 3DETC 1OAUL 5I30H 4XPHL 1J1OH 2ZG2A 4G6MH 2HLAA 3MJ7A 1V05A 3D87B 5GRUL 4Z7WF 2O26U 4G9FB 4H0HB 4F80A 1SEQL 2H9GA 3BUTA 2DJUA 2EDRA 3D25A 3TEUA 5HPOA 3QHZL 3EHBC 3GMNA 3HUJB 1G0XA 4L4TA 4M6MH 2VDMH 4GH7B 4AT6A 1EX0A 4WFGD 1FGVH 1P2CA 4PG9B 3QJFA 1LK2A 3C9NB 4JZJC 5DMGD 3IVKB 3BUYA 35C8L 5F8QC 1T7VA 3NZ8B 3SKJL 1WEJH 1IEAB 4S1QL 2C1OB 4ISVB 1FO0L 4P2QB 4QLRA 3BGFC 5LXGL 3C5JB 4X6EB 3S3JA 4U1MA 4K7FA 3I50L 3VA6A 5MENE 2VDQH 4Y19A 1T4KA 5CGYD 2FBJL 3BP7A 3OXRA 3MPCA 1JE6A 3GHEH 4GRWF 1AHWB 3VU2A 1MIML 3QT2A 2CRYA 1U8HB 4TUOA 4Q0XL 2Y5TA 1S7TB 2VE6B 2BXYA 4KAQH 1YUHB 4JDZA 4GLRI 1U58B 4U1HA 5C0AE 3WNMA 3MRKB 3H9SA 2FWOB 4NN6B 4UB0L 1ZS8B 5E8PA 3MACH 2WUCL 3SE4C 5EOTB 4LSSL 4Y5XA 4YGAB 5ADPH 1TJIL 3HAEH 1ORSA 1FLRH 3MV8B 3NA4A 5C09E 4KJYB 1V7NH 4CAGA 1R3JB 3TBYB 1IGMH 1DQJB 1I3RA 4UBDD 3S34L 4F3FA 3GSRB 5E2VH 1AXSA 5HHXH 1KULA 5HYJB 3ME0A 1EMTH 2J8UE 4M1GH 1ZHKA 5C0IB 2AKRA 1HHGA 3NAAL 3Q5YA 1EZVX 2DQHL 3OG4B 1C5DA 1RJYA 4QTHA 5DD3L 3TVMB 4HBQA 3H9YA 4NQED 3JZ7A 3QIBC 4XBEL 5GS1C 5HI4D 3RUGE 4POUB 1JGEA 2UZIH 3QWRA 3GO1H 3FO2A 3NPSC 3MRBA 2Y36H 2CIKB 2KBGA 1YMHA 3V52L 3X3FL 3ARQA 3PWPB 2JE8A 3LKRA 3H7LA 1CFTA 1N5AB 1KPVA 3VXSD 3DX7B 5DUBB 3MNVA 5DSCA 2AP2A 5JPNB 3IKCB 2EXYD 4Z18A 4YHOL 2GAZB 3C6SB 2WANA 1H3PL 4GOSA 3ECBA 4LMQI 3AB0C 4KVNH 4WO4D 2XQBH 5IEHB 1OY3B 2C3HA 3SY0A 1CVRA 2F53B 4OCMC 1K2DB 5EA0L 4EBQH 1H5BA 2FNBA 5JHDB 2NZ9C 3O4LE 1YMMD 3VE0B 4TVSa 4OD1H 3HE6C 1BLNB 1NCCH 2WBWB 2NPLX 3HNSH 4JE4B 1KELH 1NBVL 1HI6A 5EH1A 5L7XH 1G7QA 4YBLC 4CMHB 4W4NA 2VLKE 2HYMA 2RBLA 5DWUH 5F21B 4HH9A 3CFBB 3T4YA 3Q5TA 4M1CD 4U1KA 4KZEH 3MRFA 4MD4B 5J57B 1NAKL 4WHCA 2QQNH 3QQNA 1U8QB 4DKEH 2CKBH 3LKOA 5C8JB 5FGBC 4K3JH 3WXWL 4HUXA 4JFFD 2ZOKA 4YEEA 1YPZB 2R8SL 2B7DT 4JM2A 3CZFB 3SOBL 5DLMH 3EKCA 4H1LA 4JZJB 1KGCE 1ZLSL 3W9EB 2OP4H 5IMLA 2WINA 1UXWB 3GMMA 3SDDA 3BGFB 2XNAA 5GRJH 2OL3A 1NLBL 3JWDH 1M7IB 2AJ3A 5EZOL 4HKJA 5EN2B 5B3JE 4PP2B 4O58L 4OQTL 4Y4HC 5DJ2A 3BZEB 4WFFD 4LKCB 2DQCH 1MLCA 4MDIA 2ED8A 3JWOH 4OT1H 3RWCB 4OCRL 2HT3D 4B50A 4OCYL 3H0TA 4ZDHA 5LBSH 5JNYA 4UTAH 5IF0A 1H0DB 5KAQG 4JPKH 4OF6A 5DD1H 1RJZA 2JK5B 1FFNB 4JHWL 3TPUA 1IAKB 4QRQB 4XI5C 1DBAL 4IOSD 3BWUC 5JXEC 2DDQL 4KUCD 1HK6A 4XZUA 4KK6C 3LN5B 3DIFA 3IFNH 4LP5A 1JYNA 2PCPB 2QQKL 5MEQA 1L7IL 5H94A 5IB4A 4OLYL 1FG2B 2J7LA 2AABL 4N5UA 3VFOA 1HIML 2ZCHL 1IL1B 3VXTA 2HRPH 3UYRH 4F9PA 1KCLA 1NAMB 3I6KA 3PQYB 4BYHA 1WIPA 4XVTL 2GTWB 5DJ6A 4M9PA 2EEBA 3B3IB 3RHWF 3VG0L 1ZK9A 4BSVB 3P4LA 2GJZA 3QIBB 5GS1B 1G9NC 4UT6H 3RNKB 1RU9L 1XF3B 3RZCA 1MNUL 4X4ME 2CUIA 3ROOA 2DYPA 2NXYD 3H9HB 3NPSB 5JO5A 3KPOA 1AR1C 4KV5E 3W11D 5GJTL 1AQKL 3CX5K 3MUGB 3MNWA 4NQVB 1WITA 3RDTC 1UA6L 2EO1A 3DI3B 4HAGA 3AB0B 5GGSA 3FQTB 4X6BA 1NEZB 3ARFD 5KS9E 1TZIA 4LLMB 3LEXA 1IQDA 3IDNB 3KDMB 3LB6D 4MX7B 3HCVA 1WBYA 2DBLL 3MLVH 4RNRA 3FZUD 4M7ZC 4P3CL 5IJVB 2DWDB 1UM6H 1T6WA 1ZLWH 3EGSA 2VL4A 3HE6B 3V95A 4NPYA 3ZL4H 4YBLB 4S1DD 1DQTA 5DXWA 4KK9D 4Z7VA 4TUJB 5EC1B 1A5FL 5TE6L 3JSSA 1VADA 4I5BB 3B43A 1NFDF 4QXGH 2XG4A 1JWSB 4JPVL 5CJ8A 2YXFA 3H9ZA 3CSPA 4ZSOB 4X98A 2ORBL 1DQDL 3FN9A 5EUOB 5SWZE 4Q6IC 1HH9A 5HHPA 5J3HC 2CLZA 3V4PH 1JUFB 4LKXB 1KNOA 1S9VB 1SEBA 1DQMH 1Q0YL 4G43A 3FT3B 4QEGA 4XPAH 5EBGA 2H1PH 4X7TA 1DQQA 3V4VH 3K3QA 4P46D 2ZCLH 3SJVB 1R24B 3RA7H 3ALWA 2YD5A 4YHML 2DQDH 4PRIE 5K93A 2I25N 2MWCA 4BH7B 4Y4HB 5FUCC 4ODTH 1X4ZA 3HG1B 3V5HA 4Z0XA 2X4QA 3HA0A 1JF1B 5IV2A 1WGOA 4PJBA 1A4KB 2WBJD 5D1XD 4YBQC 5T3XL 3RVUC 2BSSB 4YFLI 3DX8A 1IQWL 1QVOA 4JHBA 3OKMB 3S6CA 5EU4B 3MYJB 4QRRB 3FHQA 4LOUC 3CZJA 1X6NA 3DPBA 1LEIB 5CJXC 4HJ0C 4OCXL 5FO8A 1T5WA 5HHNB 3ULVL 3EDEA 2YD6A 5F96H 5ILTH 1ZVHA 2CR6A 3WN5C 3QEQE 1I1CA 3THML 3N1GC 2CLRA 1BD2B 4YHLH 1MHEA 3JV4A 3RWDB 3QDGE 3KPPA 5B39A 3ULVD 1A6AA 2H6PB 1C16A 3VXRA 2FEDD 1GOGA 4M3JA 1JHTB 4NQCE 3L6FA 1RUQL 2CLVA 5HY9B 5GSVB 3P77A 5FYJD 4NO3A 4BQ9A 3SDYL 4PJ5A 3WKML 2FZ3A 5DZNA 1XZ0B 3QDJB 4U7KA 4ODVL 4X99A 2WV3A 1KEGH 1BX2B 3FFDB 1TNNA 1Y0LB 4U2YA 2ICEB 4JB9L 5TF0A 4PJDB 3B6SA 5L9DH 4KMLB 4AENB 3A6CL 4HMDA 3P4OA 4OD2B 3V4UH 1T1XB 1N2RA 4MCYA 3BO8A 4J3OC 5T3ZD 3OR6A 1FFPA 4R7NA 2R4SH 4QTIH 1KTKE 1HSBA 3S4SG 3PF2A 3DGGB 3RDTB 4OLEA 1NEUA 1ZA3B 5C0BE 2F5AL 4NUJA 4FG6C 4LHQB 3LKNB 1WZLA 5GGVH 5JIPA 1NGZB 4MCZB 3ARGA 4POZC 1D5IH 2V6HA 3UTQA 4BFIB 5EU6D 4XH2B 1YECH 4M7ZB 4ZXBD 4PLNC 2CQVA 1OAYH 1KN2L 4FQXD 4OIAA 1PKQA 2D7TL 2UVFA 4ZFFB 1XF2A 1A9EA 2IEPA 2VKXA 1K8DB 1IKFH 2HT2C 3GJFB 3GSWB 3RWJB 2WP3O 3LOWA 3HRZB 2E7BA 3VRIA 3P3YA 2GT9A 3KPSA 5BQ7A 1NCWH 5ICXA 3S37X 2F74A 4YWGL 4MJIE 4CMMB 2NY0D 4BZ2L 5GGSY 4JRXB 5KVDH 1ZXQA 4UV7H 3QUXD 3TBVA 4E41A 5DHYB 5D7IE 1YEIL 1CXLA 32C2A 4PJ9D 4UILH 3JUYA 4BSWB 5DJXB 4Q6IB 4WUUD 1HQ4B 3EZJB 4GRLD 4PR5B 5DD6A 5CWSA 3NIFE 1TTUA 4YDIH 4AY0A 1NCNA 1SHMA 2WIMA 5F7FA 2DQEL 3S35H 4XX1G 4UDTB 3L3OB 1UG9A 4L8DB 3VJ6B 4JN1H 3VXQB 1DUYB 2BVEA 2J88L 3KYNA 1UZ6F 2Y4SA 4YXKH 5GXBB 1IEBA 4U1SB 5JHLH 1JZ6A 5AD0B 5ACZA 1RULL 3MFFA 2VLJE 3SGJA 2BNQE 4LSVL 2BY2A 3BDXA 3BPNC 5F7UA 5C0FA 3TN0C 4QRSB 4LSTL 1DEEA 4IDLA 3VFUA 1KTDA 4HIHB 3VFMA 5IVXF 4NSKB 2R4RL 1YC7A 5EBMB 5E0QA 3H7BB 2JCCB 5C1MB 4G9FA 4LQ1A 3TA3C 1WCQA 2A6JB 5J06A 5F1SA 5EZIH 5C71A 1F42A 1RUPH 4PJGE 1AQDA 1CDBA 2AVGA 3ZYIA 1B0RB 4KUZH 1NDMB 4X8JA 4P4RB 5IBUB 4DZBB 3C60C 5GZNC 2XY1A 4NFBA 1I9IH 4RAVB 2HJKB 1FVCB 1X5ZA 4P59L 1Q9LB 5E00A 3WN5B 3C9NA 5MP6H 5A2FA 5JDSA 3T3ME 5A2IH 3G6JB 1UKTA 4EN3D 3EOTH 4G8FB 1BREA 3JTSA 3NIDF 2C5DC 5C07B 1IEAA 5DMIH 3NIFF 3QXTA 1LD9B 4P2QA 4ZNEE 5JR1H 1OP5H 3MOBH 3U46B 3C5JA 2AQ1A 2BDNL 2ZUSA 3V5DA 4O4YH 2VSDA 4PGJA 3IFLL 4JJ5B 5ISZD 5KZCB 3ZKQD 3W82A 4DKFL 4DQOL 3UO1H 3LQZA 1CTNA 2FB4L 4O5LH 1BQUA 1D9KD 4FQ1H 2XN9D 1JZ7A 1CL7I 3RQ3A 1U8HA 4JFHD 3O3DA 4JFOB 5D5MF 5IKCB 1S7TA 5CP3H 1N6QL 4GG8B 4WW1B 2XIDA 2L4OA 3EJYC 1OGAE 1U58A 2ESVB 3MLZL 4ALAH 3MRKA 1K3ZA 1MHCB 3NCMA 1P9MC 2APWA 4PJHF 3I2CH 3MV7E 1G6RH 5J1SC 4HC1H 3WNPA 4UU9B 4N0CC 1IARB 4RQQB 3MV8A 4KJWD 4LLYB 1PYWB 4KJYA 4N0UE 3BZFA 3D9AH 1DBJL 4M6OL 3VXUB 5CLWA 1WK0A 12E8H 4KJPD 1MI5E 5EPMA 5FUZL 3WFCL 1XFPA 3ULUH 3HR6A 3MJ9H 3BHBA 4M43L 4X9GA 2R1XB 1YEKL 3AS3A 1KF9B 5C0IA 4QHMA 2F58H 2DLFH 5KVEH 3TVMA 3WXVL 1EIBA 1KCVL 3QO0B 5BS0B 1RK1B 5D7KE 3I02A 3S37H 2FH8A 4U7MA 3MZGB 4NJAL 2DIJA 3GI9H 2ICWJ 1BFVH 2NY7L 5M95B 5IW6B 4JFPB 5CINH 5CEZE 2R29L 3AUVA 1CGYA 2I60L 1OQOA 1IAIH 2BOCA 1N5AA 4HIJB 1TMCB 3DX7A 2BVTA 1M05A 5JPNA 3E8UH 4DOHE 1L9MA 3BP5A 3NCBB 2GAZA 1S5HA 1TJGH 3V6ZB 3MJ9A 1X5YA 1ZT7B 5C09D 4PLOB 1DBKH 5FM4A 1FZMB 4B7IA 3EYUH 5F7LB 1CDUA 1O0VA 2F53A 3NZHH 1FNGB 2V17L 4XNQB 5JHDA 2Y23A 2Z8WC 1KB5H 4D94A 4UZGA 3BPNB 1BLNA 3D3VA 3TN0B 2GITA 2RGSA 4HXAH 1S7XB 5F93C 3WUWB 5I15H 3O9WD 5FKPB 4FQCL 5BZWB 1MCKA 3MXVL 1J8HB 1OP5K 1KJVA 2GUOB 4HH8A 5HJ3A 1I9RL 2ZUUA 4HF5L 4LAQH 4M4RA 4WEBH 4LSPH 2XTJD 3P9MB 1Z9MA 5F6HJ 2GHWB 4UIMB 3U2SB 5B8CA 5GSRA 5C8JA 3OKDA 2YRLA 3C60B 4P5KA 4JN2B 1UZ8B 1YPZA 3N9GH 4YQXH 1EO7A 3CFCL 1D3CA 2NY2C 5HGBA 3WKNA 3K0WA 4JZJA 1I8LC 3G5VB 3IGAB 2FX8L 1CQYA 2E6JA 2XWTA 3WLWC 1DFBL 4NT6B 3W9EA 3KYOB 4RFOL 1CXHA 1FFQA 4X5WB 3A6BH 3PE9A 2P8MB 5D8JH 5E8OB 1AO7D 1T03H 4BQ8A 4ZD3L 3BIKA 1I3VA 4NHUA 1ZA6B 1M7IA 3B9AA 5EN2A 2Z93B 2BFVH 3QA3A 5BXFB 3K8LA 1MCEA 3BZEA 4UNVA 2VLKD 3HLAA 4HEME 4G8GD 5DS8B 3V5KA 2VLLA 3CFDB 4W68A 5DTFA 3BD5A 3GBNL 1SMOA 3BMWA 4CU6A 1NCDH 2NY4D 5F3BB 3C2AH 1T80A 3LSOA 1CGUA 5F7YC 2E6PA 3S4SA 3ZE1F 2BZDA 1ETZA 1O5DT 4WEMB 4KWUA 4GBXD 1FFNA 2F54A 3RPKA 1IAKA 1KCKA 1H8NA 4QRQA 4DN4L 4PRHA 2VH5H 5DD5H 5GS3A 3SE4A 1JPSH 2AXFA 4APQD 3LN5A 1NMBH 2PCPA 5I9QC 1OOAA 4BFBD 4GAFB 1FG2A 3O6FC 3TO2B 1KJ2H 5HHOB 3QXUA 4FFVC 5MERA 1MFCL 2EH8H 2FL5B 3H42L 1T0PB 1IL1A 5A2LH 5CEYA 3Q2CA 1XCQA 3OAZH 4Z7OE 4L3AA 5JW4Q 2C7UA 3DMMA 2GTWA 5GRVL 3B9KC 5CZXC 1JV5A 3BN3B 4OGAC 5L88L 3IDXH 1QBML 4XNXL 1T22A 3QIBA 3AMLA 5JDJA 3RNKA 4XBGB 3MNZB 3L3KB 3H9HA 1FZJB 3GIZH 4EEEA 1DZBA 2BRRH 3UTSE 2J6EL 5CD5C 4PGCB 4RZCB 5FYLH 4GJTB 3ETBF 3EDFA 3GSNL 1MCLA 4OJFH 3V8OA 4WI8A 2R0ZL 3T77B 2ITDB 4LU5H 5LWYL 2OJZL 4A6YL 2FSEB 3MUGA 3P11H 3MUJA 3MA9H 3P4MB 3D39B 2ZUYA 4LPWA 1F4YL 5EOQL 1NEZA 2VL5B 3W0WE 5IQ7H 3WO3B 1A1NB 4MX7A 4EI5D 1BVLA 5E7FA 3TO4C 2ITCB 5SWSB 4RWYL 5BW7C 3MLPA 3LV3A 3RGVA 3QRFM 5IJVA 2IH3B 2VABB 5IP4A 5I1HL 4CVXB 4JKPL 4KDVA 3VFPA 3QUZD 4WENB 5I8KH 4QYOB 3RP1A 1J1PH 3QEGL 4KDWA 4OIIL 3T09A 5EC1A 2VXUL 2N1KA 3L3HB 4X83A 3OAYH 4OTXH 2A0LD 2HKFH 1HQRA 4K55A 4E5XB 4KI5F 5DZOA 1JWSA 1UEYA 3CLEH 3GUTB 4YO0B 5T1MB 4QOKE 5D6CB 2FBOJ 3W5MA 5AWNH 5EUOA 2KQNA 5D1QC 1WWBX 3RIFF 2NY2B 2DS4A 3X12A 2A1WH 5ETUA 1U93A 5CSZB 3F6LA 3BOVA 2V5SA 4KVCH 1S9VA 2QEJA 5GS0L 1EGJA 1RV6X 5J1AB 1CD1B 1CT8A 5DYOB 3VD5A 2H32H 2KZ1B 1SJVA 5FA3B 4MNGE 4LRIC 4QRPB 1R24A 3HB3C 3WIHL 4YE4H 3BP6B 4R0LC 5E6ID 5ECJE 4BH7A 3IDUA 4Y4HA 2EIDA 3QQ9D 2AK4A 4P49A 4YPGB 1OAKL 4CKVX 2Z0BA 3E2HC 4YHIB 1ZAGA 1MRFL 4PJFB 1J10A 1IC5H 1R0AL 3KPLB 5FECB 3QZWG 4M61A 1RIVH 4HS6B 1A4KA 3GBML 2VN4A 3DXAD 4PJ8D 3OAZK 1J1XH 1N5YL 2BSSA 2C4FU 2FD6L 1YYMH 1ACZA 5DMJB 2Y72A 5EU4A 2D31A 3QDME 2VWEE 4MVBC 1K5NB 2Q86A 4BA8A 2CK2A 1LP9B 4IRSA 3K4AA 5HVGB 5DMKA 4P2RD 2CDFB 3KXFA 4MNQB 5E9DD 1F2QA 5I9QB 3CU7A 1J5OH 1MHPL 1HOCB 3UBXI 3O6FB 4HUUB 4LLUA 1RZJH 2AXGB 2DD8H 3RWDA 2P8PB 3MCKB 1KLUB 1ONQA 2VQTA 4OZIB 1S5IH 2FHFA 4YEFA 1ZHBA 1PZ5B 4BELD 4NZUL 3KR3H 2V2XB 3A6OA 3C5ZA 3MRHB 4EXPX 4Z78A 4K3EL 2OTWB 4L3EB 2GKIA 4ZTOL 4AK1A 1RJCA 5ESVB 5GSVA 3B9KB 3DV6B 5F7MC 1XZ0A 3QDJA 5BV7H 5TFSL 3WE6B 1RMFH 2HH0L 1U3HC 4PGEA 1DDHB 3FFDA 1YNKL 5H35B 2ICEA 4U6YB 1NL0H 5CSBA 3ZTJG 1BBJA 4PY8J 4NKOA 3EDKA 4MAYD 2OMNA 2IPTL 3VGEA 4LAJH 3TH2T 5T1KD 5C0CA 1FNLA 3KLHC 4TULH 4UIKH 3U6RB 4P99A 3OAYK 5F6IC 3DVNB 4XNYL 1D6VL 1S7UB 3DGGA 2PO6C 2AEQL 3R0NA 3TESA 4L4TE 4QXUL 3P0YL 4YXHH 4PGDA 3TF7C 3WV0A 4MB4A 5DDHA 2XOTA 4MCZA 5E4EC 4HKXA 1OT1A 1DVFC 1UQSB 1QSEB 4BFIA 3TO4B 4RGNE 4G42A 3FO0L 2WUBL 3D2UB 4NZTL 1WFTA 1X5JA 4ZFFA 1QG3A 4HS3B 4FZ8H 3IJYB 1GPOL 1IT9L 2PW2B 3MYZA 3CX2A 4GSDL 1UM4H 3GJFA 3GSWA 4HPYH 4YAQB 3HRZA 3U0WL 1F3RB 1FCCA 2VNCA 2NYYC 3MR9B 4OLXL 5FYKH 2XFXB 3SDAC 1CCZA 3MBXL 2I5YL 5F89B 4CMMA 3PWLB 4LCYA 4JRXA 3JVGA 5DF0A 2XYCA 1P6FA 2AXJA 2HKHH 5DHYA 5IROA 3O0RH 1RZKC 1H3VA 3PNWB 1GZPA 5D1QB 1QZ1A 2AJYH 1QFWL 4D9QE 3PP3H 4OI7A 4HDIB 2AJSL 3MRIA 3H9SE 3OB8A 2W9LA 4KK8D 4JAMA 4UDTA 2OYPA 2GCYA 3FOLB 4L8DA 2PW1B 2CRMA 4GMTH 3VJ6A 2QADD 3T0XA 1JNJA 1DEDA 4WIQA 4WFHD 4JFDA 4U1SA 3NACH 4XNUL 1REIA 3HI1A 5FAAA 3D6GA 3EYOB 2NY6C 1WWCA 2DQJL 4R0LB 4Z7WB 5K9OB 4G80B 3FKUS 1AY1H 4YR6B 3E2HB 3VXOB 4WV1C 3IS0X 4HIHA 3VW3L 4NSKA 4HXBL 3WFEH 3H7BA 5FYKU 3N85L 3FQXB 2IANA 3NBNA 4NP4H 5L8JB 1DR9A 4XCCL 1B0RA 2D4FA 5I8EB 4OLUL 1NDMA 1H3WM 3U0TB 1JF6A 3MGAA 5EO0B 4ODWA 4L8BB 4UUJA 4BH8B 5CJXA 2PTUA 1BVKA 2BK8A 1CFSB 5J9PB 5E08H 2HJKA 1FVCA 1X7QA 1OWWA 3WN5A 3FO9A 4BZ1L 3G6JA 1ZVSB 3BH9A 3G9VA 2A9NL 2UWEA 4GRWB 5TGBB 2VLJD 2NR6D 2H41A 4J3WA 5IW1B 1B2WL 2X9XA 4JG0H 3L3IB 1KFAH 5I1CL 1VGKA 5E99L 4GLRH 1FIEA 3UJJL 3RJDA 5DZLA 4HCRL 2WM0A 1U3HB 3GBLA 1UH3A 4JFOA 3PJSB 1RHHA 5IKCA 3QQ3B 4OFKA 1QBLL 4PJEA 3O6MH 4TTDC 4Z0BL 4PB9L 1QLEL 2UY6A 3UJTL 1M71A 4LHJB 4D3CL 3CVHH 1B88A 2Z8RA 4HULB 1CLZH 2BY1A 5LAXB 1OAXL 4QWWC 1INDH 4DTGH 4CRPA 4GW5B 3DSFL 4LHUG 1BOGB 4N1CA 5F6IB 4KHXH 1A1MB 2PO6B 3AAZB 2NTSP 4AJ0A 4JFEA 2R2CA 3QCTL 4RQQA 4AMKH 4JY6B 4XP9H 3S5LB 5E8NB 4XPBL 5E4EB 5B4MC 3CDYA 3IETB 1DVFB 3VXUA 2JJTC 4PJAF 4MHHI 3K1KC 1OTSD 1KBGH 3PP3K 2A6DB 1KCUL 5MENB 4ZS7L 1MREL 4YDLC 4JQVC 1OWRM 1AE6H 3GB7A 5IFJB 1B90A 3H6JA 5FOBB 2R1XA 2O5YH 3CVHA 1GC1H 1KCSH 1PG7X 4MB3A 2IG2H 5BS0A 5HGHA 3QO0A 4XP5H 1RK1A 3ZLQC 4XBPB 5H2BA 1A7RL 4QCIA 3NFNB 3SDAB 5F1OB 4FQQB 4PUBL 4POYA 2XACC 1WUNT 4U3CA 5IW6A 5T5FH 3SGDI 4JFPA 4DN3L 1XGTB 5C0AB 5ACMA 5FOJA 1I7UA 3ULUD 3VI3E 1I3GL 4HPOL 4N1EA 1FRGL 15C8H 5TDPA 4LIQH 1JFQH 4HJJH 4OCLC 4YDJB 3MV7D 2D03L 3RKDC 2PYED 5E5RB 2ICWB 3IS1X 3V6ZA 1X5XA 1ZT7A 3LRGA 4NM4L 1ACYH 1IFHL 1FZMA 1LEGB 4NBZB 1ZOXA 2VAAB 1CLOH 3IFOB 1I1AD 1SBSL 5IMMB 1T3FB 1MI5D 2VZVA 1XGPB 3VWJA 4RMWA 2NY6B 4PJIA 1JPFB 1X44A 2J2ZA 1GGCH 3EZ8A 2E8YA 3TN0A 2W9DH 5CAYB 3VXMB 1M4KA 5CEXB 1EJOL 1W8OA 3RNQB 2J4WL 4OLZL 3RX7A 2BVOB 5CEZL 4WV1B 1QPXA 5CJ5A 5JOPE 1X4XA 3PABB 1FE8L 2BERA 5D7KD 1J8HA 1A6ZB 5FO9A 3TA3A 4Z7QF 1QFUL 2FIKA 3ZTJH 4GKOA 1BIHA 1Q72L 5GS2D 4OFIA 2IGFL 1XR9B 1GJIA 5FCUH 4UIMA 3U2SA 2P46B 4GXUM 1AJ7L 1P4LA 1ES0B 3VGFA 2ZUQB 2G2RA 4N68A 4MJ6B 1XAUA 2CK0H 4OLWL 3L3JB 4TSCL 3IGAA 2E9JA 4X9HA 3VI3F 1S7WB 1ZLUH 2QR0B 4NT6A 5IBTH 3NTCL 3KYOA 4NRZB 1SY6H 4UNTA 4X5WA 3DRQB 1WTLA 5E8OA 3O4LB 1S9KC 4MAUH 4HFWB 5T33H 1ZA6A 4XXDB 5GS0C 1BMGA 3ES6A 3GNMH 4K94H 2F8VA 3BX7C 3EJZD 4WU5A 3RBSA 5DS8A 1RD6A 2BCKB 1QLRB 1SYVB 7CGTA 1P5VA 5IQ9B 3QCVH 5D1ZC 2C9AA 1FNHA 2DI9A 3MV9D 1EERB 4Z7VE 4N5ED 5EFIA 3TNNB 1OSZA 4LQFH 4G3YL 5CBEA 4C83A 4OQ1A 1C12B 2IH1B 2ADIA 4M02A 1CLYH 3QJHA 2R2BB 5CJQL 1G7PB 1P9MA 3TT1H 1LE5B 2A6IA 1OB1B 4DZ8B 5I71C 1T2QL 4DGYL 1I7RA 1LO5A 5DK3A 5IIEB 3TO2A 2FX9L 3WDHA 1HEZB 4N9GB 1VEOA 2VUYA 5HHOA 2FL5A 5MEOA 3QUML 1NFKA 5F1NB 3QG7H 4YDLB 1IZJA 3GRWL 2XZQH 3BH8A 4NC1C 1PG7H 3L3DB 2LTQC 2RJMA 3MLXH 2DOCA 4UDUB 5C0EB 4YGVA 1OCWL 5IESH 3RAJL 3TFKD 3BWAB 4QHLB 2OR8A 3WFBL 2J12B 4ZQKB 1NCTA 1LILA 2E9WA 2FYYA 4NO0D 4HK0A 1IC7H 3BVNA 4M8QB 4K2UL 4TRPH 2YA1A 1CZ8H 3DROA 5JOEA 3ALXA 1ITBB 1AD9B 3MRQA 4PJBE 4PGCA 5GGQH 2X1QA 4FOMA 3T77A 4I0PD 5DK2B 4Z7VF 3H2WA 4XC3L 1S3KL 4DAGH 4GQ9L 1AXTH 3FO1A 3FQNB 1EHAA 3X13A 4MXWH 3D39A 4KMQA 1DLFH 2W38A 4WWID 1T66C 4BUGA 3C08L 4A6YB 1HKLH 4JDVB 1A1NA 1A3RH 5JPMB 3UYPA 2GFBB 1OHQA 5FYLD 3MV01 2VABA 4P4KC 3O2WH 4Y2DC 1NFDB 2X4NB 1YNLL 5C08A 1CICD 3VXRE 3WEXB 1ZLUK 5AYUH 3HC4L 2DQUH 5DD0L 4HJGA 1NC2B 4I0CC 2E7CA 4KTEH 4PJ5E 4E5XA 1A3LH 3MUHL 2OLDA 1N3NB 3VWKA 2VZTA 4OIBA 4ZO8A 4ZTPH 2LU3A 3F7PC 3MBEC 4NNYA 3WYRA 2IBZY 4YO0A 4D8PB 5T1MA 3GUTA 2HG5B 5D6CA 4GKSB 2VDNH 1W72L 5GGTH 4H8WH 1WLHA 3K4DA 1I9JL 1MEXL 3DUUB 4XNZC 4Y4KC 5JW3H 5CSZA 3Q48A 4ONGL 3MMEA 2QL1A 4U6HB 5E1AB 4ETQA 1U41A 4XB8A 1PZUB 5E4IA 4ODSL 1CD1A 1NLDH 4N90E 5DYOA 4ELKB 5BMFH 3FJTA 4OM1L 4AEIH 5HGDA 3WCYA 2H2SD 5DUMH 1WT5C 1J0KA 3BQUA 5F9OH 4YPGA 2C4FT 1GVIA 3BRGC 4PD4K 2EEDA 1PKQE 3TYFA 3D1MC 4EQ3A 4G7VL 5D1ZB 5D7JC 4LCWB 5KVMC 3KPNB 4NGHL 4P2OD 1PX3A 1T21B 4HS6A 3U9PH 3ARZA 4MQSB 4Z77A 4FA8A 1MPAH 3RTQA 4P5TA 1IAOA 3C8HA 2CJUL 3KPSE 3BPCA 2O5XL 4LVHC 5SWZB 3FL7A 1EHLL 3DRTA 1K5NA 5DQDL 4ZAKC 1BGXL 3CMGA 4UINH 2Y25A 4WRLA 4HLZG 5I71B 4E41E 1HWGB 2XT1B 4N8PA 1T7WA 4LSRL 3PXHA 4TVPE 1HOCA 3O6FA 1QSFD 4HUUA 4X6DA 1KPRB 4HG4K 2GJ6B 5HPMA 2P8PA 1LDPH 4HHAB 4LBEB 4N8CL 3ARBD 1CTOA 4PRIB 4HWEH 1WIOA 3IU4L 4L9LA 4JG1H 2CGRH 3B9KA 5F3HA 4WY7L 3OKYA 5DJYA 3SO3C 3SEPA 4F7MB 5JOFA 3MCLH 4UBDC 3BE1L 1DDHA 3KYMA 5H35A 4H26B 4ORGB 5E6ZA 2XZAH 1T1WB 5DVLA 3O8XC 2AV1A 3MOAH 3PHOB 2YZ1A 4OCWL 1VGEL 4U49A 4BZYA 1YDPA 4PRPB 3WIIL 3B9VA 1KOAA 4XTRD 2DIBA 4YXLH 1OLLA 2R23A 3X3GH 4G9FE 1MAJA 4I77H 1HE7A 1OPGL 3DI2B 3BSZH 1AGFB 4AL8H 5KSAC 1SVZA 3CDFA 4R26H 1BIIA 4KJQC 4JO3L 4F33B 1S7UA 4PP1C 1F02I 4NN7C 1F4WL 2ADGB 3IFPA 2OR9H 4XP6H 3UPRB 3S3PA 3QDGB 2NX5D 3WSQL 3ZKMC 3UDWC 2EE9A 5CZVL 1D6EB 2EXYC 1EDQA 4NQCB 5I0ZA 2CR3A 1IAIM 4Y2DB 4Y2OA 5J6GB 4P2QE 4G6KL 3BEVB 2PW2A 4TPRL 5LGHL 1U36A 1T83A 1HH6B 1SJEB 1UWEH 4JQXC 4GRMB 2A74B 3MR9A 2EECA 4YFDB 1P4IL 3LEVH 4QY8B 2XFXA 1MRDH 1FAIL 5H8DA 3MA7B 3PWLA 5F1KC 3RVWD 5DGRA 5HYSB 4JRYA 5DR5H 5I2IB 4J3XA 2VQ1B 3P9LB 1YEHL 4JCLA 3PNWA 5JIKA 1TVDA 1NGPH 4HDIA 5C0BB 4M1CC 4Y4KB 5KAQF 4KXZI 3AREB 3WFHA 3U0PB 1KCRL 4PJ7A 2PW1A 1RZ7H 2KPNA 3LS5H 3WJLC 4G6ML 5FYKD 4W6XB 2F9BT 1GL4B 1A6VH 4HUWB 5EORH 1P5UA 1QHOA 3MV8E 1R5WB 4LRIA 1BVZA 1DSFH 5IVXB 1N64H 2BMKA 3V6OA 3D0LB 3ZDXE 4X5XA 4I18A 4R0LA 2VDLL 5EU5B 1GH7A 3VDBA 4G80A 2YWZA 3KNBA 2EDBA 1E27A 2ED7A 4NJ9H 4IRZH 1MCCA 2X70B 1A6WH 5FO7B 4RDQG 1MFAL 3SGEI 3VXOA 3T3PF 3O11B 5TF1L 1GGIH 5D7JB 1JNLH 5IUSA 4JJHA 1UB5B 3CDGA 4LSQL 3AROA 1K6QL 2MHAA 5C0DA 1UXSA 2EDJA 3FQXA 1E28A 1WEJL 4OAWB 2BHUA 4O2FB 1X5AA 4LVHB 1CF8H 1OW0A 3G5ZA 1BEYH 1TPXC 5EO0A 1A14L 3GSQA 1MIEH 4L8BA 1WZ1L 4D9QD 4ZOAA 4ZAKB 1B4JL 4NKMB 3PWPE 1CFSA 2HVJA 4FFYH 3MXWH 5K59F 3K4ZA 1QTYT 1J05B 3GSVB 3GHEL 2IQAB 1E6OH 3DUHA 4U6XB 3OF6A 1GHFH 4R96B 5TGBA 4JO2L 3QIUC 2APTA 1CL7H 2BNQB 3OJMB 1MF2H 3QUKB 1YNTA 4PYHA 5J56B 5D4QA 5IW1A 2F53E 3DBXB 1E4XH 5D5MB 4LPXA 3KYAA 3L3IA 5JHDE 1OLZA 2HA1A 4YZFE 3SO3B 3P30L 3NIGE 1U3HA 5ADPL 1UYWL 3ZTNL 3C6LC 4Z5RB 2FX7H 1GRWA 3O8XB 4TOYH 3QQ3A 2XWJB 2XA3A 5IVZB 2DLIA 2DQIH 2P47B 4FRWA 4D0CB 1IGML 1FNEB 2RFXA 1RUKH 1WBZB 1NANI 4HWBH 2IALB 1N4XL 5LAXA 3QWRD 4LGPB 5KSAB 3ESUF 4PGBB 4KKBC 5E2VL 4MYWB 1IGTA 5HHXL 1A1MA 2JB6A 2PO6A 3V0VA 4F15C 1QOKA 1EMTL 2D7OA 3QG6B 2B2XL 2Z31C 1YPZE 2VXVL 4FP8H 5I1GH 4Y5YA 2EKSB 1JGVH 5A2KH 3OKEA 3S96A 1DN0A 3IETA 1DVFA 1I8KB 2ZCKL 5HHVH 3VXSB 2A77H 4RX4D 2YPVH 5KN5B 1YN6B 3MSPA 4C56D 3QPQD 4JVUA 3MLSL 4ZYKB 4OGYH 43C9B 4LNVA 5IFJA 3UC0L 1XMWA 5FOBA 5DJ0A 4YNYB 5HHQA 3ULUF 1A4JA 2FR4B 1BM3H 4HUNB 1B6UA 3QCUL 5CMAB 1MFDH 1NGXB 1G7LB 1U8JB 1MCDA 4XBPA 3AXLA 1E4KC 2IQ9H 4LPCA 4YX2H 2KZWA 4FQQA 4KVNL 1M6OA 3UBXG 1OGAB 1XF4B 1XGTA 3NIGF 2HWZH 3U82B 4BFEA 5F7KC 2CIIB 3FOMB 4FFWC 4Z95H 1RI8A 4TQEH 4YDJA 2EICA 4LVNC 5IGXH 1KELL 2F54E 2W1NA 3CX5J 5L7XL 1S7VA 4N0UB 2JJWA 3MODH 4XT1C 4PRHE 1EFXB 1HN1A 3TJEH 2VAAA 4XPGH 5EO9B 2OL3L 3IFOA 5IMMA 3PP4H 4F9LC 4K3GA 1RIUL 1XGPA 4K7PY 4UT7L 4Z7UF 4DGVH 5TE7H 4LSUH 2QQNL 3VG9B 4OZHF 3OQ3B 4KI5C 1JIBA 3TBWA 3VXMA 1LNUA 2APBA 2I27N 1TZGH 2A6KA 3RNQA 4Z7NF 3VH8B 4WV1A 4DUVA 1RURL 1VA9A 3TBSB 1WSST 4U05A 1KACB 1ZT1A 4M93C 1A7NL 4JY5L 3VI4E 5JTWA 3VFTA 1A6ZA 3FN0L 1JGLL 4HWUA 3AY4C 5GGRB 4AG4H 2AK1H 2XA8H 1I4FB 2HLFD 4K8RL 1XR9A 3KWWA 2ZUTA 4G6FD 1TPXB 2CUMA 3RWEA 2HFGH 4DOHB 2G5BB 4J12A 4CADB 3SGKC 4ZFGH 4XX1E 2NNAB 5ICYA 1NAMH 1XIWD 4EVNB 3QRGH 3BW9A 3Q6FB 1JNHB 3RY6C 3FFCA 1S7WA 2AERT 4D9RD 3MUY1 4MA7L 2QR0A 1S7SB 5I76B 4NRZA 4L4VA 2MCPH 3DRQA 2PYFB 3QIUB 1KT2A 2RIKA 5DMYA 5JMOC 4MA3B 3I6LD 4FXKB 1KIUA 3U30C 3GM0A 4R8WH 5LBSL 4RFNB 4UTAL 4JPKL 4HIXL 5DD1L 5KTEH 5IBUG 3UTPE 4F7EB 3J7HA 5I6XC 1QLRA 2FIRT 5IBLD 1SYVA 5EBWB 3P73B 3C6LB 1C1EH 1P7QA 2FEDC 2JELH 3TIEA 4FXGA 1T0NA 3TNNA 4YDKL 4O02L 5E24E 5IG7A 4GG6F 4FQIH 3ZE0F 3UTTD 5E94A 3QUYC 3MGTB 3PG2A 4OF8A 4LCIL 4R2GD 1DBBH 3WUZA 3JV6B 4PTTA 2ZP0T 1OB1A 3CJJA 1OTUC 3L1OH 3VCLA 5EUOE 4F15B 4YHNB 3QULB 5EC2B 1JWUA 3CVIL 2Z31B 3C2SA 1I8MB 1J88A 1OARL 1HHKA 4ZS6C 4NZJA 4N9GA 2EE6A 4ELMA 5IR1B 4UT6L 1VEPA 3F8UB 3PDOB 4OZGF 4WWKD 5CCKH 1QRNA 4QF1B 5J8OA 4JQVA 4MXQD 1L0XA 4W6YB 3ZYJA 4UDUA 3SCMA 5EULV 3QUMB 4G9DA 3WNNA 3V8CA 4XVJL 4EI6A 5C0EA 4P57A 3BWAA 4ZQKA 3HG1E 1BJ8A 1EO8L 2AK4E 5F8RC 3TLRA 2CKNA 3OSKA 4Y16D 4M8QA 4KY1H 1JGDB 2PXYC 4V1DD 1ADQH 3HFML 1QO3B 4ZUWB 1JGUL 1AD9A 1V7ML 4WTWA 5CILH 4PRAA 2FDBP 3QPXL 4MQXD 3QI9D 1UM6L 3SKMB 4C57C 3N0PB 4KROD 5MHSE 4NRYA 3EYQD 2J6EA 3ZL4L 3WHXB 4YHZL 5DRZB 1ZT4A 4D2NA 2VIRB 3F7YB 4LDOB 3LS4H 4UNUA 5IK3B 3QUXC 3BMVA 4A6YA 2A2QT 3Q5OA 3KXFE 4EOWL 4JDVA 2FCBA 3ILPB 3MCG1