5D8AA

Crystal structure of recombinant foot-and-mouth-disease virus a22-h2093f empty capsid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
210
structure length
190
Chain Sequence
TTTTGESADPVTTTVENYGGETQVQRRQHTDVTFIMDRFVKIQNLNPTHVIDLMQTHQHGLVGALLRAATYYFSDLEIVVRHDGNLTWVPNGAPEAALSNTGNPTAYLKAPFTRLALPYTAPHRVLATVYNGTSKAQLPASFNFGAIQATTIHELLVRMKRAELYCPRPLLAVEVSSQDRHKQKIIAPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based energetics of protein interfaces guides foot-and-mouth disease virus vaccine design.
pubmed doi rcsb
source organism Foot-and-mouth disease virus - type a
molecule tags Virus
molecule keywords VP1
total genus 34
structure length 190
sequence length 210
ec nomenclature
pdb deposition date 2015-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5d8aA00
3ZFEB 4IV3B 4N53B 5CFCB 1NCQB 1COV3 4GB31 1HX6A 1AR83 1QJZA 4WM7C 1RUJ2 1BMV2 1RUG2 4IV1C 5BNPA 1EAH3 4SBVA 4JGZB 3ZFFB 1MEC2 5C8CA 4CEWA 2R061 3VBRC 4CDXA 1MQTA 1W39A 1RMU3 1NCQA 1NCRC 1PIV2 3ZFGB 3LOBA 1B35A 1VBC3 4N43C 2ZZQA 1MEC1 4QPGA 3VDDC 2MEV2 1VAKA 5D8AA 5K0UC 2FZ2A 3TN92 1X33A 1MQTB 1H8TA 1HRI2 1R081 2WZR3 1RUG1 1RUE2 1PO11 4CDWB 1R083 2WZR1 4AEDC 3ZFGA 1Z7S1 4QPGB 1GFF2 3JBG2 1NG0A 1ZBE2 4Q4Y3 3VBHA 1AR82 3VDDB 5K0UB 1VBB2 5L7OB 1PO21 1VB2A 1AR73 4Q4Y1 4CDQC 4QPIB 1AL21 5DDJ2 1EV13 4RS5A 4RQPB 1ASJ1 5BNOA 1FMD3 1VRH2 1EV12 4CDUC 1R1A1 2R042 3VBSA 2HWE3 1RUH2 4JGYC 2GH8A 1RMU1 1RUH1 1VBB1 3VBFC 5LK7B 1AR62 1ZBA2 1RVF3 5JZGC 1R1A2 4RQPA 4RS5B 4WM8A 5C4WC 1K5MC 4BCUA 2HWF3 1RUF3 2RS12 2RS51 3CJIA 1RUC3 2HWB1 1FPN3 3NAPA 4FTSA 1PIV3 1WCDJ 4GH4C 1RUC1 1PGL1 3TN91 1R093 2WS91 1VB4A 5C4WB 3TN93 4RHV3 1E57A 1RUD1 5AC92 2WZR2 3VBOA 1HXS3 3J8F3 1PO22 5AC93 3J8F1 5FMOS 2R062 2RS13 1SMVA 2R043 1V9U1 1OOPC 2RM21 4Z92B 1FMD1 5CFDA 1RHI2 1V9U2 2R073 4LLFA 1AL22 5DDJ1 1C8NA 1R1A3 1RUE1 4Y5Z0 5L7OC 2R071 4Q4W2 1RHI3 2HWE1 1COV2 2R072 4Q4W1 5DDJ3 1AR93 3ZFFA 5JZGB 4CEYC 5BNNC 5ABJA 1OPOA 2WFF3 3JBG1 1VRH3 4PDWA 1D4M1 3JBG3 5C9AC 1X36A 2RR11 1FPN1 1IHMA 1POV3 3JB4C 2RR13 5ABJB 2HWB2 1R092 2HWD1 1HRI3 3VBUC 4CDQB 1ND3A 4N53C 4FSJA 3DPRB 2HWD3 1PGL2 1RUC2 3HAGA 1K5MB 2DF7A 1RB8G 1TME1 5GKAC 4WM7A 4IV1A 2HWC2 1VBE3 5BNPC 2XBO1 4RFT0 1RUD2 2RS32 5A33B 5J98B 5A32B 4Y4YA 4CEWC 4CDUB 2BBVA 4NWWA 3JD71 1V9U3 3ZFEA 3NAPB 4YVSA 3VBRA 3DPRC 2HWF2 4CDXC 2X5IA 1MQTC 4WM7B 1ND2C 1VBA2 5C8CB 4Q4Y2 1NCQC 1NCRA 1OOPB 2RS33 4GMP1 1PVC1 1BBT3 5A33A 4CEWB 2WFF1 2PLV3 4GMP3 1PVC3 4JGZA 1VRH1 5ACA1 1RUF2 4QPGC 1BEV3 1C8M2 3VBFB 1VBA3 4YVWC 1ZBE3 5ACA3 1H8TC 4Q4V1 5A32A 2MEV3 1VBA1 1C8M3 1ZBE1 1AL0G 1NA1C 1AR81 4AEDA 2MEV1 3VBUB 2R063 2BUKA 1AYM1 3JD72 1Z7S2 2RM22 1ASJ2 2HWC3 4QPIC 4NWVA 1TMF1 5CFCC 1AYM3 3J8F2 4IV3C 2HWC1 1VBE2 1VBC1 4CDWA 2HWE2 4PDWB 1TME2 4CDQA 1VBE1 3ZXAC 2QQPA 2XBO3 1FOD2 1MEC3 4RR3A 4RS5C 4YVWB 3JB8A 1AYM2 2WLPA 5J96B 1RUG3 2HWB3 3VBSC 2BFUS 4EJRA 1PIV1 4JGYA 1RUJ1 1VBC2 4RQPC 4YVSB 1TMF2 4N43B 1K5MA 2WS93 2GSYA 4CDXB 2PLV1 5ACA2 1ZBA3 5C8CC 2WFF2 1FOD1 2VQ0A 1NY71 3CJIC 1ZBA1 1AL23 3NAPC 4FTEA 1COV1 5CFDB 3VBSB 4Q4V3 4GH4A 2ZAHA 5AC91 1C8M1 1VBD2 1B35C 1PO23 5BNNB 4Q4X1 4WM8B 2RM23 4N43A 1BEV2 1DDLA 3CJIB 3VBOC 1NOVA 5K0UA 5D8AC 1VBB3 2BFUL 3VDDA 1QQP3 1RVF1 5FOJB 1BMV1 1QJY1 4RHV2 4GB32 1QQP1 1QJU3 1QJY3 2HWF1 1RUF1 1RUH3 3ZFGC 1AYN1 1RUI3 5L7OA 1RMU2 1AYN3 4AEDB 1EAH2 1B35B 3VBHC 2BPA2 4CEYB 2XBO2 3IDEA 3ZFFC 1RVF2 5FMOL 2RS53 1RUJ3 1PO13 5BNNA 2RR12 1CD3G 3FBMA 4PDWC 2RMU1 2X5IB 5BNOC 1HQNA 1QJX2 1D4M2 1HXS1 4Q4X2 1CJDA 1Z7S3 2ZTNA 1R091 2HWD2 2RMU3 4CDUA 1AR63 1HRV1 2Y26A 1QJY2 4RHV1 1PO12 5D8AB 1NCRB 1R082 2R041 3VBFA 1AR71 1NY72 3M8LA 5JZGA 1EV11 1ND3C 4WM8C 4N53A 4Q4X3 2FZ1A 5C4WA 4FTBA 1ASJ3 4JGYB 1H8TB 1VBD1 5BNPB 1QJU2 1VBD3 4IV1B 1RUE3 1HRV2 1AUYA 1RUI2 1QJU1 1RHI1 4Q4W3 1FMD2 4GH4B 3ZFEC 2PLV2 1HXS2 4YVSC 3DPRA 1POV0 1RUI1 1POV1 2X5IC 1AR72 5BNOB 1ND2A 4GB33 1PVC2 1AR92 4RR3B 1HRI1 1NA1B 3VBRB 1QJX3 4Q4V2 5C9AB 1EAH1 2XPJA 1QJX1 4JGZC 1OOPA 1BBT2 1F2NA 2RMU2 5CFDC 1TMF3 4YVWA 1PGW1 2TBVA 1RUD3 1AR61 1HRV3 1QQP2 1A6CA 3S6PA 1NA1A 1TME3 4CEYA 1M06G 5ABJC 1ND2B 2RS11 3VBOB 2WS92 1AYN2 4QPIA 5CFCA 1OHFA 5C9AA 2RS31 3JD73 4IV3A 2IZWA 3VBHB 4CDWC 1FPN2 1ND3B 4GMP0 1AR91 2RS52 4RR3C 1PGW2 1F8VA 1BEV1 2WWSA 3VBUA 1BBT1 1D4M3 1FOD3
chains in the Genus database with same CATH superfamily
2GP3A 1V6IA 2A3YA 5DUUA 3T2PA 4IV3B 2XWJB 1ODMA 2WT2A 2OIIA 3ZN4A 5F9TA 1OURA 3A7QA 3VL9A 4OHZA 1H1IA 3OPWA 5CFCB 1JZ3A 5KHGA 1XYNA 2BGOA 5FY9A 1RUG2 2QQMA 4ZPIA 2ID4A 1IS3A 4YZ5A 3NO8A 2QFEA 1DU3D 4LHNA 1REFA 3ZFFB 4IE5A 5FO8B 3PVOA 3W58A 1GNYA 4CUBA 3I54A 5E16A 1FV2A 5FBZA 2P17A 2QQVA 1I9RA 2PHDA 2R061 4RSUA 3VBRC 5J3UA 1TQ5A 4CCMA 3ZYBA 1XSQA 4CDXA 1MQTA 4UW6A 5FJHA 2BNOA 4OI0A 3ZSKA 4LE4A 4PT6A 4EE2A 2BEOA 3OD4A 3ILFA 2DVGA 3H3UA 5DUWA 3ZXGA 3ZFGB 1CPNA 2W1WA 3LOBA 2WNUA 2VQTA 3GM8A 1OH4A 2YC4A 1YFYA 1PX3A 3J7HA 1UX6A 4XEZA 1TNFA 1WMXA 3KGLA 3LSDA 1VLNA 3PU8A 1U5YA 4TYSA 3K48A 4XFAA 2BTVC 3MF9A 3IMNA 4QPGA 5K0UC 4XJUA 3N7KA 4EN7B 3MIDA 5FZHA 4AHXA 2OA2A 2R0HA 1MZEA 1HRI2 5FZ4A 1RUG1 2AH2A 4OZXA 5A80A 2VCCA 5FZ3A 4LKDA 2OXBA 5DAXA 4OMCA 3POJA 5A3OA 3VV1A 3WP3A 3ZFGA 1PHMA 4ISRA 5LATA 3WG3A 1F9KA 3ACLA 3KT4A 2ET1A 4NHYA 4YM1A 1Z7S1 3JBG2 1G86A 2QE3A 3W5NA 1MVEA 2VMHA 3LPFA 1SBDA 1SLAA 1NLQA 4Q0QA 2J1VA 4UAPA 3RNSA 3VDDB 4DINB 3AP9A 5FY4A 2OYZA 1FNZA 3GXUA 2HH9A 5A7NA 3UT0A 3AFGA 4YZ4A 2ARAA 2XG3A 1PNGA 5IVJA 4DS0A 4CDQC 1PX4A 1ONAA 4I30A 4QPIB 5DDJ2 4TXWA 2Y0OA 1SLLA 4MGSA 1HIXA 3KWVA 1GNHA 2BERA 2EXJA 5FZ0A 2JDZA 4D8MA 2DWRA 5FUIA 5FYSA 1DCSA 2XKPA 3PUAA 1EV12 4DEQA 2Q30A 1OXCA 1ST8A 4KWKA 4ZU5A 1R1A1 4Y1XA 2R042 4ISQA 2GDFA 2QQJA 4OYUA 2KR2A 5LA1A 2VGDA 3T4HB 1JMUB 5LY1A 5J7MA 5DQ0A 1RMU1 3HBKA 1X8EA 1ZBA2 1RVF3 5FY1A 5A7PA 1R1A2 2D40A 4GJYA 4RQPA 2VD7A 4AEKA 1KDKA 2VVEA 4R4ZA 3GYDA 5FZAA 4PBPA 1CAXA 4XJWA 1KD7A 2PAEA 4FFIA 4XUQA 3J7NA 1RUF3 4C8DA 2RS51 3ILRA 3PLQA 5F5QA 4RYDA 4DQAA 3O1MA 3OG2A 4AFBA 1WCDJ 2VL4A 5FZKA 1LAJA 1ZRCA 1RUC1 3AP4A 3C8XA 1UXXX 1US3A 2O8OA 3AYEA 2ERFA 2BYVE 3K75B 1W03A 2VZ1A 3VDAA 1ENXA 2GAUA 2ZEWA 2WRAA 4XIKA 1RYYA 3ZIXA 5C4WB 2YFZA 4BQ4A 3TN93 3MUZ1 1AJKA 5FZGA 3UL2A 1E57A 2VTXJ 4K6BA 2CWSA 4UOJA 3ELNA 3OF1A 5GM0A 5JI7A 4P00B 5EJ1B 4OQ9A 2W1UA 3H50A 1HXS3 3SLIA 3IM0A 3U75A 2JG8B 4FQ4A 4GWIA 3SISA 1Q8PA 5FZFA 2Y64A 2XWBB 1VRBA 2DFBA 2P6CA 5AC93 1W2AX 2XXZA 5FMOS 3ZPYA 4LA2A 2R062 1CAVB 2RS13 5HBAA 1IPSA 2RM21 3GJBA 4UT5A 4Z92B 1FMD1 1RHI2 2R073 5FZBA 2V09A 4ARXA 3L2YA 4Y33A 1BK1A 3B02A 2VUAA 1JOJA 1AL22 1T6GC 2QKDA 3UETA 2H6BA 4IW3A 2EICA 3A23A 5L7OC 4Y5Z0 3ACGA 5A7SA 3ZX7A 1YIFA 4BK4A 1KS4A 1Z0HA 4QPYA 4YG0A 5LY2A 1J58A 3R6SA 4H2AA 1W9FA 2EF6A 2MNGA 4NRPA 5BNNC 4M3CE 1YIPA 3PU3A 3CKHA 4B4QA 1RXFA 5F39A 4N7IA 4E8DA 4QXBA 5FPLA 3R0RA 1D4M1 2ZA9A 1ZREA 3NV4A 3O0VA 4CP9A 4KGGA 4XHBA 4GKYA 1X36A 4JDNA 4Y1ZA 2RJKA 3ZYGA 1ULGA 1S2EA 4R4XA 2JG8A 1NLRA 1V70A 4NHMA 3VGIA 3B9IA 3ZKUA 1CESA 1XNTA 1WLWA 2V4VA 1HB4A 1FPN1 3CBNA 3Q8EA 4QQLA 3JB4C 4GXLA 3QCWA 1ZYBA 3HNYM 4ITCA 2D3PA 4J1XA 4LK6A 2VUCA 3BGAA 4EYUA 1WWYA 4QX3A 1KITA 1IG0A 4WVZA 3BOWA 3GNEA 2ZGPA 4QB1A 4K7JA 4Q1PA 5I8TA 4TN7A 5A7OA 3WDTA 2BDRA 1H9PA 1QMJA 3O5SA 2DF7A 2JD9A 4ZS2A 1TME1 3LPGA 1JZ6A 5J48A 1UN1A 5GZDA 2J1AA 4FPKA 2DCKA 4AI2A 5I8YA 1O59A 4M0NA 4MXWA 4OUSA 2VW1A 2RS32 2VUJA 4LEJA 3OY8A 3M4FA 2LRPA 5IFPA 3LGRA 3WQ0A 5I8SA 4CEWC 3WNOA 3JZVA 2BOJA 4YVSA 3TBDA 3D82A 1Q8QA 4G9SB 5F5CA 1EP0A 1J3RA 2HWF2 3JUUA 3ZXEA 3WP5A 2YPDA 4WM7B 1ND2C 4KL1A 3KV6A 4KMQA 1VBA2 3AZVA 3EQEA 3N9QA 4QX2A 1NCQC 3A0KA 4LE3A 5IK8A 4XF0A 3DYPA 4HANA 1OOPB 4GMP1 3FX3A 3ACHA 2YU1A 1BBT3 1S4CA 5A33A 1R1ZA 3WQ1A 1W8WA 1YJLA 2A73B 3ZMOA 1O4YA 5EZWA 2Z5WA 1ZNPA 3KT1A 3MV11 1MZ5A 2GMMA 4JGZA 3VHRA 3KM5A 1VAMA 3ETQA 1N3QA 1RUF2 2QBXA 1Y3TA 3VKOA 3AJZA 2QQWA 3IDAA 4Y1VA 3VBFB 3VHNA 4QDQA 1UO9A 5IWFA 3U4XA 2AC1A 5FCCA 1HW5A 1HQLA 3CDZB 1VBA1 2YB7A 4A6SA 4FPYA 1ACCA 1NQJA 2VNOA 3OJBA 4AFDA 1IQAA 1Q56A 3GBFA 5IVYA 2YV8A 3T0DA 1UY0A 5FPVA 2ETEA 1JYIA 3VBUB 3WDWA 2OPKA 2VBBA 4AHWA 4JKMA 1ASJ2 2VZUA 2J22A 1WCSA 3PVBB 3NNFA 4XVHA 1TMF1 1C4RA 1AYM3 2R32A 3MIHA 1YQ2A 2VZRA 4CCDA 1W0OA 5FQ0B 4YW3A 5FYHA 2HWC1 3VB9A 5I0DA 2P37A 3G7DA 1GQHA 4XXPA 1NZIA 4ZY9A 4CDQA 2QQPA 1VBE1 2PQQA 2DTYA 3ZXAC 4A7YA 2WBKA 4WVMB 2D6PA 4DXRA 1MEC3 3BYWA 4RR3A 3JQXA 3N7LA 2ENRA 3ENRA 3JB8A 3E6BA 4E2QA 1IS6A 3IMMA 4R9AA 5AFBA 2W95A 4ARYA 3B69A 4QX5A 2P4EA 3HNBM 5A3WA 5FZDA 3KV9A 3VBSC 1O3RA 4CZSA 4EJRA 4JV4A 1PIV1 3ASIA 2J1SA 3WCRA 4BLIA 3T2OA 5DAVA 1LOCA 3TB0A 4Q2FA 3AZYA 1UU5A 1VBC2 1WZXA 3M7AA 1NT0A 2LM3A 2YU2A 4RQPC 3RJ2X 1PZ9A 4YVSB 4EZ4A 4CU6A 1W6NA 2PTMA 3FZ3A 3VUOA 4E4DX 3MI8A 3MFAA 5DAWA 3RRDA 2P2KA 5C8CC 1FV3A 1DGWX 1UMHA 3J26N 5FOBB 3KD4A 3UKVA 5IW0A 3ZR5A 3CJIC 1U5IA 2ATFA 1AF9A 1NUKA 3TNPB 1BK0A 1I3HA 4XPVA 4JVAA 4FTEA 1GP6A 4CCEA 2FQPA 1FT9A 3MW4A 4Z82A 5KBFA 1S2BA 1C8M1 2XJPA 1VBD2 3KV5A 4UW3A 5FZ1A 3PUQA 1IKPA 5BNNB 3VBOC 4LO4B 5T5OA 4AW7A 4BWOA 2JWPA 1BEV2 1L7QA 4BPZA 3I2IA 1DDLA 4XMAA 3WVJA 3MO4A 2ZGSA 4FFHA 4TWTA 1SDDB 2BFUL 2VOVA 4I01A 3AVRA 5F1RA 5FOJB 2OX0A 5FZOB 1F5FA 4LK7A 1O3QA 1N1TA 3OPTA 3N4MA 1A34A 2VVFA 3OCPA 5GJ6A 3D3AA 1BVP1 4A42A 1QQP1 1WD4A 3O0XA 1W2UA 5ERLA 3MEPA 4IE4A 3NMBA 2W9XA 4OI2A 1RUF1 2IXIA 1UZ0A 3PVEA 3ZYIB 4NIGA 4IQPA 2H0VA 2BV4A 5DXDA 2FDKA 2ZGOA 3R4SA 3CF6E 4JTNA 1XU1A 3SMHA 1C28A 4EROA 3AK0A 2EAKA 3BI3A 1J84A 4I0BA 3KCYA 2D5FA 1EAH2 4QM9A 4QX1A 1UAIA 1DGRA 3O1VA 2BZDA 3VKMA 2RS53 4UFMA 3SEEA 5BNNA 1Q8OA 5LRRA 1QOOA 3WHTA 3VKFC 1RXGA 3F95A 5JMCA 4XF1A 2CU5A 1H8VA 2GH2A 2I45A 1WA4A 3FBMA 3LA2A 4WVVA 1YNAA 2RMU1 1DZRA 5FYYA 3OD0A 5BNOC 1GICA 5KWRA 2GN7A 1UYYA 4CDUA 2VZQA 1AR63 2JICA 2ILMA 1PVXA 4HT1T 1MS1A 4QXCA 4MGKE 5KXBA 3O12A 1QJY2 1W90A 4RHV1 3NNLA 1JYVA 4AFAA 3EYPA 4QX8A 3VBFA 1LHWA 1NY72 3S7EA 4Z2WA 3M8LA 4QQ2A 1EV11 1CZVA 1N1VA 3I2FA 3FC0A 4N53A 1W8FA 4Q4X3 4Y22B 4ASMB 4FTBA 2A6VA 1EUTA 2VCMA 3WG4A 4NVPA 2O1QA 4ZXEA 5FR3A 3FUOA 3TWIA 4C1WA 1XE0A 2YFUA 3IB3A 3K4AA 1YJKA 2WQ4A 4FOWA 5L9VA 2H6CA 3TEXA 1F4HA 1FATA 1QJU2 1V0AA 2V5YA 3FL7A 4TLGA 1UOGA 1IKQA 2FCVA 4FPOB 2IFWA 3DEMA 3DUIA 4FPEA 3UYJA 3B9CA 2Q0AA 3WW1A 3T30A 1DQ6A 4ZU7A 1UZYA 1AUYA 1RUI2 1QJU1 1X7NA 5DN2A 1H30A 3UGFA 1W6PA 3R05A 3AFKA 4YVSC 5L36A 3G6JB 1E5SA 2RDSA 2KM2A 2WWUA 3THTA 4DZGA 1POV0 2YXSA 1AR72 3MF6A 4XYXA 5FREA 4C91A 3PIGA 3SNMA 3ECQA 2GP5A 2ZGUA 4D3WA 1TNRA 2K46A 1KXGA 1QJX3 4FPHA 4LOTA 4Q4V2 1EAH1 1H6YA 2D6NA 2ZS6B 4X6QB 5JR2A 2Q8OA 4CU9A 5FWJA 1YQ5A 2VW2A 3BU7A 5EHDA 5EPAA 3WDYA 1NE4A 1BBT2 1TEIA 4OHXA 3ZDVA 3WEZA 4C90A 3PTYA 3KGZA 5DABA 4ES8A 2IC1A 1HJGA 1D2QA 3FHAA 3OUHA 4AQ2A 2P34A 1WMFA 1HRV3 1QQP2 2VW0A 2WSVA 3L9JT 1W99A 4DXZA 2D6LX 1GMMA 1SZBA 5AVPA 1MR5A 5APAA 1CAWA 3OUJA 5EQUA 4A44A 4AE2A 4ES9A 1YWKA 4CEYA 5ABJC 5H9RA 1DQ2A 1E5IA 1ND2B 4HPKA 3FJSA 1YHFA 3WP4A 4BLJA 4CXYA 5ANNA 1RJ7A 5FRAA 1JUHA 3FFQA 3LIHA 1W9WA 3O1UA 5C9AA 4XIOA 3FN9A 3VDBA 1UW8A 3VBHB 1PM4A 1A78A 1FPN2 1ENRA 1PMIA 3OGSA 4GMP0 3KMHA 3TAYA 1AR91 2XJVA 5GLUA 3V0BA 3TNQA 2XR4A 1O8SA 5A6YA 4QKBA 2XLAA 1F8VA 4HZFA 2WWSA 4UWDA 1UL9A 3VN4A 2LUWA 4FCAA 1BBT1 3POIA 4A3ZA 4HFSA 3BOPA 5LA2A 3ZFEB 3LWCA 3QOPA 3C7HA 4LMFA 5BV6A 1NCQB 3POEA 4DY5A 1HX6A 1AR83 5F32A 4WM7C 5LK5A 4G4FA 5B4NA 1BMV2 5BNPA 5AVAA 4MXVA 1EAH3 1OT5A 1WLTA 3EB7A 4W6YA 3NRUA 1C1LA 1DZTA 5C3OA 2BW8A 1RUNA 4YW5A 5FO7B 3HJRA 3ZVXA 1W6OA 5D1IA 1K42A 2Y0IA 5FPAA 2DYCA 4OHYA 1A3KA 1NAEA 5KHIA 1JZ4A 1S1AA 3MDPA 3M2MA 5FKCA 2D6MA 2FMDA 1IS4A 1RMU3 3BVCA 2VVDA 3K46A 1NCRC 3HN1A 3RYRA 1PIV2 2D6KA 3AYCA 1EUUA 4NN0A 1VBC3 3GZUC 3O1PA 2CSGA 3Q8FA 4Q0VA 3WG2A 5FYMA 3OBAA 4NIHA 4AVSA 4LHSA 2ZZQA 1SBEA 5JI9A 4AGGA 4AI8A 4JKKA 1VAKA 5D8AA 1X33A 1MQTB 4AQTA 1PK6B 3SH4A 4BMEA 4GQ7A 2WZR3 4IGOA 5IVBA 1V00A 1L3JA 2C4XA 1BJQA 1YI9A 3HT1A 2AENA 2WZR1 1C5HA 3PUIA 4XFFA 2ZKLA 3CQOA 3HT2A 4Y20A 1FNYA 2XJRA 5F3EA 1ODNA 4QPGB 1GFF2 1QGLA 4MSVA 3GZTB 2VOKA 3POGA 1NG0A 5FQ0A 4ATEA 1ZBE2 3M3CA 3WNXA 2IXCA 5BNQA 5G05L 1AR82 4LBOA 1UIKA 2PHUA 5L7OB 3B7MA 1SFNA 1PO21 1VB2A 2P6HA 5FPXA 1AR73 1W8HA 2OUHA 1WKYA 1W05A 1MZ6A 4OCTA 4QU2A 4UW4A 5LBBA 3WF3A 5M0TA 3RFRA 3ROUA 5BNOA 1KGYA 3OB8A 4YW2A 5J09A 3OBRA 3LA7A 2Y6GA 2W46A 5JDBA 1NXMA 5FK8A 5A7QA 1H2LA 4EN8B 5FP4A 1ZZCA 4CDUC 1W8NA 5DPNA 4PQ9A 4AYUA 5FYUA 5T5LA 3OGRA 4P02B 2ADDA 3H3LA 3NW4A 1D0HA 1Q8SA 2E7AA 4XURA 3SH5A 4AVBA 1VAVA 2B42B 4LT5A 1RUH1 1VBB1 1A8DA 2E31A 4E2GA 4H14A 5A3MA 4RS5B 1XXNA 2AUYA 5C4WC 2KXLA 3DKWA 1UKRA 4JCKA 2UY8A 3X29B 3DKQA 3N35A 3BIEA 4CP1A 2IXLA 3CIHA 4JTOA 2VCBA 3WR0A 2ZAAA 3PURA 1SDWA 4N9IA 3AKRA 3MLJA 3SC7X 3U1XA 2JE8A 2VECA 5I0TA 1H9WA 1FPN3 3GF6A 3NAPA 1GNZA 1VMHA 5DUXA 2WJSA 4GH4C 4L11A 3LD8A 3AMMA 4GAZA 1W8UA 2JENA 1YQ6A 4FOYA 2VTXA 3A4UA 1PZ7A 3WINE 2IUWA 3VL8A 5DG1A 1VB4A 3FLPA 3BCWA 4QPWA 4AAPA 2B5HA 2YBKA 5FLHA 3PUSA 4RHV3 3RYPA 3ILNA 1RUD1 4AGRA 2CTVA 1CX1A 4URAA 1F15A 1H1MA 3HEIA 3K3NA 4FXKB 1VMFA 2XHKA 4QX0A 3V56A 1W9TA 3OGGA 4XZUG 3RDIA 1ULDA 1LHVA 4P9XA 2DU1A 4PI0A 4XMIA 4D0QA 1OD3A 2R49A 2JKBA 3H0OA 4HKWA 5L9BA 2R1BA 2JG9C 1SMVA 5F5AA 2Z79A 3ST7A 2W1QA 2FDJA 2W87A 1HDKA 1YEWA 4YZ3A 5CFDA 1V9U2 2OQ6A 3LOIA 5T55A 4PF5A 4ZS3A 4MLOA 1STMA 4BYYA 5C3SA 3ETPA 4YGEA 1C8NA 2A70A 1CIYA 1LOGA 4Q4W2 5CZKA 5FWEA 5EXOA 4AF9A 1XNAA 1RHI3 2R072 3WNMA 3ZYRA 2FDFA 2QQNA 5DDJ3 3ZFFA 3OYWB 4JRLA 3S0MA 2FDIA 4CEYC 4DRVA 3MIFA 4CXWA 3WP6A 5B2GB 2Y6LA 3IWZA 3AZXA 1VRH3 4PDWA 4HK8A 3DN7A 3BTXA 4JRAA 1U5XA 2D3SA 2Y34A 3C7GA 3LDKA 4LKEA 4XQ4A 4YZ1A 2D5HA 3T3YA 1N1YA 1WW4A 3JBG3 1APNA 2UYAA 3T0AA 4E9KA 2VMCA 2ZGMA 3QLQA 4HMZA 4AWDA 5IK4A 3LB9A 1OMIA 1JN2P 1LTEA 1POV3 1QHDA 3KQRA 1O6UA 4XHXA 1IZ3A 4NHKA 2B7YA 2Y6JA 5FP9A 5H9PA 2HWB2 1CQ9A 1W6MB 4XTMA 3NJYA 1LNSA 3S5QA 2QQOA 2A7AA 1HRI3 3GZEA 4S2GA 5IFTA 4CE8A 1JHJA 2HLEA 1UY2A 3DPRB 5F2SA 3VHPA 4CCNA 2HWD3 4E4HA 1ULPA 4COVA 2JDHA 4GD4A 2F17A 5JR7B 1PGL2 2YYOA 4NJ4A 3HAGA 3IPVA 4DMIA 4K8FA 4H3WA 1J83A 2Z69A 4YM0A 5GKAC 2NMOA 3T08A 4FPGA 1RL3A 2YZ4A 4WM7A 5FZEA 2Q1ZB 4ZXKA 1OC1A 2VJXA 3HQUA 3VKLA 4Y26A 1VJ2A 1UPIA 2E6VA 2WO1A 4IETA 4PIZA 5J98B 2YBSA 1H0BA 2OZ6A 4CDUB 4AL9A 5DMYA 4QD2A 4XF4A 1IPJA 3NQHA 3ZFEA 3NAPB 4OUMA 2EXHA 5F6KA 4EN9B 5I0RA 3VBRA 1HQWA 2HBTA 4FO9A 2DV9A 4CDXC 3HPNA 4YFWA 1D0GA 1MQTC 5FTTC 3WNNA 2ZHNA 5IAXA 3C7OA 2QTWB 3OEBA 4K9SA 1TZOA 4IGPA 3POWA 5CKQA 3S7IA 1EPWA 2OVUA 4W4ZA 2WNUC 2VZ3A 3D5OA 3LDBA 2PLV3 2K2SA 4CSWA 1VRH1 2R1DA 5A3PA 5ACA1 2R30A 2WLQA 3K4DA 4QPGC 4TTGA 2DCJA 3J7LA 2DCYA 5FMDA 4NIDA 1VBA3 3OYWA 3CJXA 4XJ9A 4NHXA 4Q0SA 5DAQA 2ZGRA 2NPIA 4JC1A 4XXAA 1MS5A 4O9GA 3H7JA 1MVQA 3E97A 1NA1C 3DECA 1J1TA 5FZ9A 2X29A 1LOEA 2B46X 3WG1A 2XGXA 2W92A 1UOBA 1S0GA 2PAKA 1HV1A 2R063 2WNEA 1AYM1 1WGPA 3EBRA 1Z7S2 2RM22 2ZABA 2DUOA 1XNDA 1J59A 2WA3A 4AI1A 2BQPA 3M3EA 4YRDA 2WINB 4BA6A 4D69A 2HYXA 2JE7A 3AP6A 3WF2A 2Y60A 2F4PA 5HCHA 2YUEA 3U78A 3CZUA 1XU2A 4XCBA 5F6LB 4PDWB 5E1RA 2X8KA 1WCUA 1E5HA 2XBO3 3ZXJA 5CG8A 2WNVB 4LBNA 2C9AA 4FP3A 1D4VB 4QHBA 5IVVA 2JX9A 3U4SA 1S0DA 3KVAA 1K45A 1ZRRA 3LZZA 1LHNA 4XUOA 3SH3A 1UY4A 4K21A 1AYM2 3M3OA 1W0NA 2WLPA 5J96B 3NWKA 4P9JA 3AB0A 3LEMA 3SITA 4GZ9A 4IEYA 4OI4A 5FMCA 2ZMNA 4Y22A 2XHNA 4EWEA 3PMEA 3H7YA 2WNUB 5FLJA 4A2UA 2XLFA 4LUMA 1TMF2 2G9FA 2CAVA 5IAVA 3S30A 3C7EA 5BY5A 4YNIA 1OUXA 2E7QA 1ZBA3 2GNDA 5K9YA 3VD7A 1REEA 1WD3A 2LW8A 3PJQA 4O61A 2I07B 5FYBA 1QJFA 4Y1YA 3UNPA 3E5UA 3I59A 2JDUA 4XFHA 2ADEA 4ATFA 1ZBA1 4D7SA 4EV0A 4PF1A 1DLCA 3NAPC 1COV1 3O7OA 5IJRA 4LBMA 1J3PA 1I1EA 1LGNA 4META 2HKXA 3KSCA 2ZAHA 4RA0A 5BXXA 2VNRA 2B4KA 3RGBA 4LIUA 4XF9A 1B35C 1PO23 1GLHA 4HETA 5EJZB 5CU1A 5LEKA 3P6BA 4YARA 3H42B 4N43A 3QBQA 2D3RA 1DF0A 2GC2A 3K4ZA 3VDDA 2GMPA 1LRHA 1W6QA 2EXKA 4YW1A 2A6WA 1OKOA 1AX2A 4M00A 4I3GA 2WZPP 4QXKA 4GB32 3USUA 4CCCA 4Z8BA 5JSPA 1VR3A 2A6ZA 4DIQA 3MLKA 1QJU3 5IUQA 3ACIA 2JG9A 4LBJA 5FYVA 4BISA 2WNOA 3FFZA 4CUAA 5EIYB 4B7EA 2WR9A 4AVVA 4PQQA 1X9PA 3E6CC 5TSWA 5T50A 2WDBA 2XONA 1OQ1A 2PQSA 2DVBA 2FDGA 5C8WA 2VM9A 4KNCA 3GBGA 5KR7A 4I0WB 4IEOA 5C6CA 5FIXA 5L7OA 1RMU2 3LA3A 4AEDB 3VBHC 4HVQA 5C71A 4OHVA 5CG9A 5ANQA 2ZGQA 4LO7A 4M3CF 5ISLA 5FMOL 3BTYA 1RUJ3 4FPFA 4CVUA 1PO13 2B9VA 4AQ6A 3E6DA 1GZWB 2Y6KA 2XQXA 4BHPA 2OT7A 2GN3A 3B00A 1CVNA 2VMIA 4KWUA 3RVHA 1JYXA 1HXS1 2GNBA 2OQ7A 3VZMA 1Z7S3 4LULA 5BYNA 3AMHA 2PHXA 3HBZA 4CPBD 4XBLA 3KV4A 2VMDA 5L9RA 1HRV1 1U12A 2Y26A 2QQKA 1IS5A 1D2SA 1OFSA 3POBA 5JIUA 1UY1A 5D8AB 4NO4A 1X8MA 2ORZA 1IQDC 2JG9B 2A5ZA 2GNTA 2QQIA 2R16A 1OLMA 1Y43B 3M1HA 2HBUA 5FJKA 4IERA 3WNKA 4BXSV 5JZGA 5JXIA 4JHZA 4WM8C 5F3CA 3I59B 1ASJ3 5KXCA 3LEGA 1H8TB 1LEDA 3MLLA 4CUGA 3WHUA 3FWEA 3MPBA 1VBD1 5BNPB 4IUGA 4LBKA 3SKJE 3IT8A 1ZVFA 2VMEA 3ZPOA 5A3LA 2YG0A 2Y6FA 3T2QA 4IV1B 4W8JA 1PMJX 1XOYA 4Q4W3 4IEZA 1FMD2 5FUPA 4GH4B 1UPSA 5HI0A 5JMOA 1GR3A 3WV6A 2DURA 1SLTA 3U0ZA 2Y6HA 2RJ2A 4AOCA 3A0NA 4Y24A 2ET7A 3RZHA 1UYPA 3AZWA 2GC3A 1POV1 3EXUA 4MHUA 5D21A 1ND2A 1RC6A 1OF4A 2XMLA 5A70A 5BNOB 1AR92 3USSA 4RR3B 4XC9A 5A3TA 2ARBA 4MGQA 3O1OA 4PCRA 1QEXA 3KQ4B 1W8TA 1RTVA 2DCZA 5C9AB 4R52A 1N3OA 3ZM8A 1VE0A 3H8RA 3H1MA 2W3JA 1YI7A 3HN3A 2WFPA 1QJX1 4JGZC 1W3XA 3RYKA 2Z2SB 5LZ6A 4YM2A 2VXRA 4P9IA 5JUVA 1Y4WA 5C5UA 4A4AA 1F2NA 2WA4A 3N9LA 1J1LA 2O0OA 2XJSA 2TBVA 3VZOA 2BGCA 1MACA 2EVXA 1ZRIA 4GKXA 5EYXA 2SLIA 5FXVA 1AR61 5KXDA 1SFYA 4D94A 4X8NA 5FZLA 5FBJA 1XRUA 4XETA 4W65A 2CGNA 2W5FA 3AL6A 1F31A 4KWJA 5HXVA 3RQ0A 3I49A 2YROA 5K8SA 3TEWA 1NA1A 1TME3 3PTRB 2Y33A 3U11A 5C3QA 2GC0A 1X82A 1XNKA 1ZZ7A 2IXJA 3N9PA 3I2GA 2AYHA 4LBQD 1AYN2 3I2HA 5CNAA 3TRSB 5LEJA 2WT1A 4WZCA 5LBFA 3ZN6A 4LIVA 5EJ3A 2X09A 3PHMA 3WY6A 4DUVA 3PL0A 2RS52 3POYA 4LORA 4ZHNA 3DL3A 2QQUA 4RR3C 3RI9A 3V65A 4OULA 5FP3A 2DCTA 4BXFA 3H8XA 1QNWA 4KH9A 3KF3A 1PK6C 3AKPA 3RPQA 3N7JA 4N53B 2XJUA 3SCFA 4AVAA 1BZWA 1QH7A 1SPPA 2XH6A 4LR4A 4OMDA 3OY8B 4GB31 4HPKB 1QJZA 2JECA 1RUJ2 4ASKA 4IV1C 3AM2A 3H9AA 5JCTA 4Q8LA 4YGBA 2P3JA 5LWBA 2H0BA 4AI0A 2W39A 5IVCA 1W6PB 1XJAA 2ZX3A 4JGZB 4YGCA 4LPLA 5F3GA 1MEC2 3SCGA 3A22A 5C8CA 3EHKA 4M4RA 2JIGA 2TEPA 4PJYA 3OEAA 1IGOA 3KCCA 2BRTA 1RITA 3KF5A 2IVJA 2JDAA 4HN1A 4Y20B 1UOJA 1W39A 4FI9A 3U14A 4PHZA 1D7PM 1SPPB 5FDBA 3BTZA 5CVRA 1UKGA 1MS9A 4NIIA 1UD1A 1YFWA 1URXA 3MIEA 2XJTA 4C1XA 2ZPXA 4RGAA 4B4PA 1JYNA 4FQZA 3HVDA 5JXGA 3ES4A 2UY9A 4MADA 1X50A 5GLVA 5K7PA 1MEC1 3VDDC 2MEV2 2XUMA 4DNYA 2FZ2A 4Q1RA 2XKOA 2JEMA 4XW3A 3U10A 3DXUA 4Q27A 5LRSA 1HV0A 1S0BA 3WQBA 4D7YA 4COYA 2W91A 4QGNA 1H8TA 5LB6A 3MZHA 3UKNA 3NNJA 1REDA 3IPVB 3GJAA 4RGGA 2LTNA 4CDWB 1AVBA 2NMNA 5EFUA 5I91A 4AEDC 4QKFA 5FZMA 5C33A 5HV0A 2VXJA 3P1IA 4V1PA 3WUDA 3MV01 2BNNA 3FMGA 2B9UA 2VH9A 2E51A 3T1LA 3O1TA 3K2OA 4FP2A 3O14A 3VBHA 3BALA 5K0UB 3USUB 2W47A 3LE0A 3W5MA 3KLSA 4KBBA 1UY3A 5F3IA 3I3EA 4Q4Y1 1OI6A 2CWMA 5HPOA 3NVCA 1EV13 4D6SA 3ORJA 4RS5A 4XAEA 4GULA 4KG0A 5T5PA 3RWKX 5E6HA 1FMD3 3GHMA 3ZN6B 5FP8A 2OZJA 1O5LA 2AZ5A 3IBMA 3WF4A 2E63A 2BP6A 4YW4A 5CEHA 5A7WA 4GALA 4WBBA 1UYXA 3I3QA 4FVVA 3CU7A 4AXOA 1EYBA 4D6RA 5I0SA 2PXJA 2HWE3 1RUH2 4LJHA 4JGYC 3K77A 3OGJA 3VBFC 3ALQA 5LK7B 1GOFA 1AR62 4LBLA 5LA9A 5LA0A 5JZGC 4QM8A 2WNVC 4HKOA 4IEXA 2PYTA 4KU8A 2WZ8A 3N9NA 4QHZA 5FYIA 5FYTA 5IVFA 3ZXDA 1KS5A 3AMNA 4BMBA 4MX3A 2IFRA 2Z42A 2VQUA 4NRMA 2O14A 1LU1A 4BU2A 1C5IA 4X6RB 2VNGA 1OVSA 2RS12 2VCAA 1BCXA 3UJQA 3VD4A 5JPMB 1JZ8A 5BUVA 2PMWB 1RUC3 2AGSA 2PAMA 3D4KA 2Q1MA 3GHNA 3IAQA 1HKDA 2XQRA 2GZWA 2I74A 1PIV3 1DQ0A 1YLLA 2G19A 3ZDSA 3WCSA 3ZO0B 3OUIA 3KHBA 1I5PA 4YZ2A 2D43A 3TN91 2PHWA 5T3NA 4O65A 1U5ZA 4F7ZA 1R093 4ORFA 4DO0A 5FKBA 1MS8A 4COUA 1XYOA 3IDCB 4W6WA 3WOGA 2DDUA 4LXLA 2VO5A 2WZR2 3VBOA 4QGLA 2B8MA 4ET7A 4CCLA 3J8F3 1PO22 1UQXA 1CONA 1YFXA 2J1RA 2P5BA 3HQRA 4U2AA 2Y38A 3VZKA 1YXWA 2ZX1A 2YC0A 5E8AA 4Y1UA 3WF0A 3LF7A 1UWWA 4HSJA 4V2VA 4QQPA 4N7UA 2A71A 4FT8A 1DQ1A 1GBGA 1GANA 4BQ3A 2ZGLA 3U07A 4IDZA 2XVKA 3BUCA 4NPRA 1LESA 1LR5A 4XE9A 4LLFA 4GJZA 1ENQA 1R1A3 4WVWA 2R071 1W6NB 2PHRA 4Q4W1 2HWE1 4MZUA 1OKQA 4R9DA 3SEPA 1AR93 3GGLA 1CZTA 1LKNA 3WX5A 4ZU4A 4I3PA 4M0HA 1TVGA 5ABJA 2HEWF 3LFMA 1SLCA 1AZDA 1KRIA 3E5QA 3JBG1 5JLVA 1AX0A 1CWPA 5F2WA 3V0AB 1ZRDA 3Q8BA 1O4ZA 4NPLA 5C9AC 4L9BA 1WLDA 5EWSA 1XQNA 2P3KA 4BQWA 2YBPA 3JQWA 1YO8A 1XYPA 2N7GA 2VTFA 3F2ZA 4ZZ5A 1IHMA 3DV8A 3D0SA 2RR13 1NZCA 2B39A 1CAVA 5A6XA 2IXHA 2ZHKA 1CIWA 1DQ4A 1DGWA 1LJ7A 4XFCA 4CDQB 1ND3A 4FSJA 4QXHA 5FZIA 1PK6A 3AP7A 1V6MA 3J4UH 5CKMA 2ARXA 2XLGA 2RDQA 4MV2A 3O1SA 1RB8G 4HKLA 3I2OA 4OQ8A 2ZJCA 4IV1A 1MZFA 2XL9A 1VBE3 5BNPC 4QKDA 3L2HA 5J1XA 3PMSA 4BK5A 3N9MA 3C2UA 2P3YA 3C7FA 3WNLA 3D0JA 4CXXA 2BBVA 3MUY1 4P5YA 3JD71 1V9U3 4PBOA 4HXCA 3I2JA 2ZZJA 4BQYA 3BPSA 2XJQA 3LEKA 2NYYA 2ZKNA 4XQWA 1OUSA 5FPZA 3DPRC 3HMYA 4B1LA 5AFEA 4Y5TA 3ZMNA 1W28A 2PFWA 2D93A 4L92A 4UFJA 5C8CB 1NCRA 4YSFA 5D2AA 1QY4A 3O0WA 2RS33 1YUDA 4A41A 3AVSA 1LOBA 1PVC1 4NAMA 1WW5A 2G4IA 1JHNA 1EY2A 4GMP3 1PVC3 3DF0A 5CAZA 4PI2A 3URFA 4GWJA 2ZEZA 4QHOA 4M01A 2W68A 1QOTA 5GZEA 1DGRN 1BEV3 1W04A 1S55A 1C8M2 2DU0A 3DGTA 1DYPA 4P9WA 4R8HA 4YVWC 3T09A 5CADA 1ZBE3 3WT3A 4N9HA 1H8TC 2L9LA 5A32A 2MEV3 2LS6A 2ZEXA 3MYXA 1BYHA 4HK9A 1YQ8A 2YDEA 1AL0G 3OPZA 5FY5A 4XACA 4DB5A 4AFMA 2Y8KA 2QJVA 2BUKA 1MS3A 3JD72 4BOWA 1OA4A 1ZZ6A 2EIBA 2IXKA 1ULFA 2HWC3 3BODA 4QPIC 4CCKA 3SXWA 4TLFA 3BKZA 1F35A 4CYDA 2QVSB 5CFCC 5HXMA 1O8PA 1GV9A 1T2XA 2JKXA 2ZMKA 2WL1A 4IV3C 5A6ZA 1VBE2 3OBTA 1VBC1 3U37A 1JI6A 3OSDA 2RV9A 4GWNA 3Q8AA 4CDWA 1S0CA 1ALYA 1FI2A 3KT7A 1VMJA 4KWLA 5FV3A 2J1TA 2VUDA 1ZZ9A 1GOHA 1CR7A 1OLQA 2GMEA 1FOD2 4RS5C 4CP0A 2Q8DA 1QKQA 4YVWB 2AACA 3PDQA 2DVDA 3W21A 4BH9A 2C9KA 4AEMA 4D6QA 3FBYA 4P5HA 4KI5M 4KG8A 1RUG3 4QWNA 4K40A 5FFOC 5JXJA 1P8JA 4XFBA 3ZSEA 1W6OB 2EIGA 1IOAA 1CJPA 3H3ZA 1GU3A 3M70A 4MXWB 2BFUS 1BQPA 4I09A 4JGYA 2WSUA 3BIWE 2D98A 1RUJ1 4E2SA 4QQOA 3RZLA 4BQXA 4MGIE 4XUNA 2WNVA 2E9QA 1BLZA 3HWJA 3FUQA 3PIJA 4YYOA 2WS93 3AYAA 3AKTA 2EAAA 2VY0A 1GQPA 5ACA2 2CGPA 1A8MA 1V6LA 3H1WA 4DUWA 2VQ0A 1F5JA 3IDBB 1NY71 1W2NA 1B09A 4OUEA 5I0UA 3OOXA 1Y9GA 5A7WB 1ZZ8A 4V2WA 5CFDB 3WXPA 4MUVA 1R64A 4GH4A 4EWDA 1UU4A 2BBAA 1C3HA 2QUOA 4AEJA 5AC91 4LO5B 4XF3A 2QDRA 3GCXA 3GCWA 1V6JA 3RZZA 4XQDA 3WNPA 4BJ0A 2EA7A 2RM23 3BN6A 1QH6A 3B5LB 1AHSA 3AJYA 4DFSA 4Y3OA 2K9ZA 1OA3A 1NYWA 1VBB3 2E53A 1WMDA 2XVGA 4KBZA 4LO6B 3DXTA 1NE6A 4GIQA 1BMV1 1JS9A 4FPLA 1QJY1 4RHV2 2WZEA 5EP9A 2WAAA 4PLMA 4IEWA 1WBFA 1WMEA 4Q26A 1QJY3 3VD9A 2HWF1 5K4LA 2SBAA 1OLME 1RUH3 2CDPA 2IVIB 2JDMA 4KGQA 4IXLA 1W6MA 5CKNA 5A1LA 4LUKA 1RUI3 1UMIA 2JB4A 5FZ7A 1HJFA 2FCUA 1QXJA 2BNMA 2C5DA 4XJAA 2HJIA 4BQ2A 1IG3A 3IAPA 5FUNA 4JHTA 5CISA 2DBIA 4BDVB 1N47A 1KJLA 1W8OA 3IDEA 2ARCA 3ZFFC 2JB8A 2R6QA 3P5BA 4LBQB 5LASA 3MBWA 4LO8A 4YFZA 1UMZA 2WUHA 1S2KA 4H55A 4OLLA 3LEIA 1EPZA 4O7XA 4PDWC 4RN5A 2X5IB 2PHTA 1QJX2 4JDMA 4LQRA 4MGYE 4Q4X2 4QQHA 1CJDA 3MIBA 4QKNA 2R7EB 3HQXA 3LIGA 2ZHMA 2ZBJA 3ME2A 4OZOA 1HLCA 3T0BA 1H4HA 1PO12 5F37A 5JSOA 1NCRB 2VOTA 5FY7A 3ZIWA 3WDUA 1QU0A 1OA2A 3VD5A 1NKGA 2AR6A 4A3XA 1YFUA 1ND3C 2FZ1A 4K1ZA 5GLTA 2ZMLA 1Q5OA 4E27A 2VZTA 4JGYB 2TUNA 1KQRA 4JKLA 3NJVA 1GOGA 4Q29A 5F7UA 2PN5A 4UFIA 5KHJA 5JVVA 2NQYA 3I2KA 2P1BA 2PHLA 1QWRA 1VBD3 3I3BA 4JQTA 4RFRB 1G9AA 1O91A 1RUE3 2IWGB 3UESA 4EN6B 3P3NA 3QH6A 1HRV2 4YG3A 1I5ZA 4XFIA 3T4VA 1OD5A 4R9CA 1RHI1 3ZYFA 4I2OA 3KCXA 3ZFEC 2D44A 2PLV2 2J42A 4FPJA 1CAUB 4OVEA 4MO3M 4IE6A 3I97A 4X8PA 5J36A 5JOZA 1RUI1 2QZ2A 5DAPA 4XOGA 1PVC2 2RJLA 4CP2A 2BOIA 2VMGA 4UBGA 2DUQA 2VC9A 3KHCA 2J1EA 1CAXB 4L0PA 3WW3A 4MVTA 2WAOA 5KC6A 4F83A 4XDPA 3ZYJB 1LCLA 1JOPA 1OOPA 5T5JA 1OQEA 3Q9OA 3POSA 4AI9A 1US2A 5E88A 1OBNA 4CCJA 5KC5A 1TMF3 2EIEA 4UW5A 1RUD3 2WWJA 1XBFA 1LU2A 1UNBA 4AI3A 2VOWA 4LTAA 4AG4A 1N1SA 3LDRA 4JX0A 1JYWA 3CHXA 4KQ7A 4LLOA 1RJ8A 4K8RB 3HOBA 1AXZA 2DFCA 2A3WA 2BJSA 4IEPA 4UFLA 5DG2A 1I6XA 3V0AA 1HB3A 3QD6A 3P3PA 5LCWL 1SFPA 2WN2A 3VBOB 3KZ4C 4W50A 2WS92 2VNVA 3GZAA 4WV8A 1SBFA 2G9ZA 2YHJA 3LSEA 1CN1A 5CYYA 1OHFA 4UF0B 2C1FA 3NKGA 1G9CA 2RS31 3JD73 4IV3A 4J25A 3VZNA 4FAGA 3BU0A 4LHLA 2OPWA 2CDOA 4CDWC 2RE9A 4UFHA 1OH3A 3CZJA 4INDA 4SLIA 2CHHA 2K0GA 3IZOA 4DY3A 2RHPA 4LKFA 2FBEA 5FZOA 1CAWB 1PGW2 4OI1A 3IKWA 4CRQA 1W6QB 5CIRA 3VBUA 2CAUA 1UZZA 3MGUA 4K20A 4XJZA 2A75A 1FOD3 1DGLA 2OKXA 1ZM1A 4DPNA 4AZZA 2CL2A 4YW7A 1LOFA 1GWKA 1GP4A 4QT6A 1COV3 3ITQA 2JDNA 5GLWA 4UYBA 3ZLIA 4G3YC 2E26A 2W0XA 1GSLA 3VHOA 1PM7A 1CPMA 4SBVA 1SG3A 3RZJA 1CZSA 1N3PA 3GDBA 3WD5A 5JWPA 1C1FA 4XJ8A 1LB2A 4Q0UA 4CEWA 2RDRA 4B7KA 4L97A 2NLRA 1W8ZA 1WA6X 1QIQA 2BVVA 2QZ3A 3ZR6A 4LITA 2EXIA 2VR4A 1K5JA 1Q43A 1GKBA 2JDPA 1BHGA 1DG6A 3E5XA 4OHWA 4AK3A 3RWNA 3V0BB 1NCQA 3LKJA 1Y7BA 3UGHA 5LBCA 1GUIA 4IL7A 3S5AA 1B35A 2LROA 1UXZA 2YPJA 1W3VA 4Q5OA 2ZX4A 4ZKTB 4HBNA 2GNMA 2ZX2A 3ZN5A 4N43C 2A6XA 3RI8A 3H1YA 1LHUA 2TNFA 5FK7A 4IGQA 2CYFA 2W1SA 4IESA 4YGDA 2ORXA 4M3CB 2QNKA 3TN92 2ZOEB 2UWBA 5IATA 2FCTA 3NV3A 3D8CA 3UJOA 4BIFA 3RZKA 3ZXLA 1R081 2KA3A 4MGTA 5FY8A 4JDOA 1M4WA 2JXAA 1RUE2 1PO11 1WW6A 2VBPA 3MIGA 4EQVA 1V6NA 1TG7A 3WZ1A 1R083 2XUEA 2QDNA 2CGOA 1UIJA 3KB5A 1WCQA 2D7FA 2KD7A 3A21A 1FAYA 4BM8A 5LBEA 2UWCA 4AFCA 1W9SA 3AXDA 1G7YA 5FYCA 4Q4Y3 3LQCA 4I02A 2DVAA 3SKVA 3NV2A 2VU9A 2YGLA 1KEXA 1PMHX 4RGKA 3SCHA 5FXXA 1VBB2 3ZXKA 4Y5SA 1JBCA 2Q5TA 4QB6A 4CTEA 3O1RA 4H7LA 4DRRA 1IPKA 1AL21 2Q1FA 2VOXA 4AQSA 4RQPB 1ASJ1 1H6XA 5JIAA 1XB9A 2PELA 2MPFA 1VRH2 5DZGA 4QMAA 4UBHA 1F4AA 2Z4FA 1LULA 3VDCA 3CEWA 3ZYPA 3SHRA 3VBSA 3LCPA 4DEVA 1RGSA 1Q8VA 4J1WA 2GH8A 1XE8A 3R4UA 1LOAA 1H2KA 4WM8A 2VZOA 2C26A 3VKNA 1K5MC 4XZPA 5JPNB 1SCSA 4QU1A 2FMYA 5SV5A 4BCUA 4NUBA 4LNVA 4U36A 2HWF3 3Q8CA 5DZFA 4NMIA 4YM3A 1XNCA 2WYFA 3R4DB 3CJIA 5GALA 3T2TA 2HWB1 3LAGA 3THDA 2F6BA 4XABA 3ACFA 4FTSA 1J3QA 3I8TA 4B4RA 4IEVA 4A6OA 1PGL1 5A1AA 3RSJA 1NLSA 2XDVA 1HN1A 3M3IA 3PJYA 5FAXA 1NQDA 2WS91 3UK9A 2DVFA 2B45X 4BQ1A 2V73A 3AC0A 2UWAA 4UFKA 5GZCA 5IHRA 3W20A 5AC92 4B29A 4BZ4A 1HB1A 2WQ8A 4AR2A 3RMYA 4COZA 1QF3A 1BXHA 3N3HA 3PVNA 1ULEA 4AVTA 2D6OX 1PZ8A 1LODA 1UOFA 5G04L 4MYEA 2OUJA 2V72A 1QXPA 2ZACA 1FX5A 4HL0A 4QAWA 3J8F1 3OGVA 1TE1B 2JDYA 2VAUA 3JU9A 3VZJA 1FXZA 1L7RA 4RD7A 1OVPA 4CU7A 3TEZA 2R043 1V9U1 1OOPC 1YQCA 1H1AA 1RINA 3PNAA 5DZEA 1SHWB 1JTZX 2WIIB 4D7TA 3HD8B 5DDJ1 4AVCA 4QGMA 1RUE1 4HVOA 4NR1A 1U0AA 4HG6B 5B4XA 2AREA 5JSRA 3C3VA 5FZ8A 1COV2 2WO3A 4KU7A 1LGBA 2HEYF 3MW2A 4IE7A 3W9AA 5JZGB 1JOBA 3ZOIA 5FO9B 2WO7A 2AEZA 1OPOA 1GZCA 1JODA 2WFF3 3FLRA 4J6GA 4S2DA 5F8PA 5HCBA 4NAOA 1QNYA 3CMGA 3RZMA 1DP0A 2EIDA 2WQZC 2WYSA 3IIIA 5T52A 4FFFA 1BKZA 5EYYA 1O3TA 3TYJA 1G8WA 4L99A 2VZPA 2FHRA 3HNMA 4LOSA 4O9EA 2RR11 1K12A 4EZHA 2BWCA 3TOJA 1XSRA 2A6YA 3QACA 3IN9A 1PGSA 2YY1A 5ABJB 1R092 2HWD1 3CL1A 3J9SA 3WUCA 4HLTA 2VQAA 5SV8A 5HCAA 4AHYA 4FBFA 1SLBA 3VBUC 2PA7A 5LW9A 4N53C 1X9TA 2FDHA 2R0FA 5IK5A 3WSOA 2VBDA 4YWAA 5A3NA 4P9LA 3J7MA 3WDVA 2FD8A 1NXD1 2VE1A 3MPPG 1O3SA 2VZVA 1LOFC 1RUC2 3AX4A 3I4IA 4NPMA 1K5MB 4XDQA 3NV1A 3WDXA 3UV9A 4BQ5A 1JZ2A 4NROA 1ULCA 2E7TA 2NZ9A 3W59A 2HWC2 3VLBB 3ZKYA 3ZXFA 2ZEYA 2XBO1 4XCAA 1OLRA 2ZCWA 4RFT0 4K1YA 1RUD2 4M4PA 4NIAA 3M3QA 3AMQA 5A33B 2D97A 1GP5A 3B94A 1S0EA 5A32B 4Y4YA 4TSVA 5JOYA 5J37A 2BU9A 4NWWA 3ES1A 4YLZA 1JUIA 2DBNA 4N90A 1DYKA 2GU9A 5H9SA 3WW4A 4DOUA 3N36A 3NJZA 2I2SA 2X5IA 3NJXA 2CV6A 4I0AA 2JDKA 4Q4Y2 2X53S 2J1UA 1Q3EA 4FXGB 5JXHA 4QDRA 3I2DA 3NL1A 5IVEA 5L19A 3CO2A 5FPBA 4CEWB 2WFF1 1OSGA 5FXZA 2WT0A 1KFXL 1SACA 2NN8A 4S2FA 4WVMA 1JW6A 4XUTA 2RG4A 3RMXA 4B3NA 4CPBA 1VP6A 1S0FA 3CLPA 4F8AA 1O4TA 4LKSA 2ES3A 2Q8EA 1SCRA 1XC6A 2W52A 3AKSA 5ACA3 5GZGA 3TEYA 4Q4V1 3FLTA 4GA9A 1KDMA 1JYTA 1XE7A 1C8M3 1L7LA 1ZBE1 4XUPA 2F4LA 5T54A 3UGGA 1AR81 1JYCA 2W2IA 1OF3A 4JAAA 4AEDA 2MEV1 5DUVA 2BGPA 4MHRA 1GYKA 2DUPA 3WF1A 3ON7A 3OTFA 1GZWA 1Z78A 3RG0A 5C5TA 4FOVA 4NWVA 4DXTA 3EMRA 5IK7A 2RDNA 1DQ5A 3J8F2 2Q8CA 4P9YA 4MG2A 3VZLA 1VIWB 1UZVA 1V6KA 2HWE2 2W08A 3AL5A 1TME2 1GWLA 3ATGA 3MW3A 4QB2A 1V6OA 1G6NA 1UX7A 2WO2A 3E1F1 1QDOA 2NM1A 2OS2A 2GALA 5FZCA 5JAXA 5HV4A 5JOWA 3IIAA 4GWMA 3NSTA 5KHKA 4BB3A 4EWAA 3RS6A 3ABZA 4AAXA 2AEYA 1GZ9A 1RIRA 1XNBA 4UXAA 4A7KA 1UCXA 2HWB3 3AXEA 3AYDA 4LA3A 1G9BA 2E33A 4Z2AA 5A3UA 4QX7A 1QXRA 2WKKA 1S0JA 2A1XA 3K3OA 1CX4A 4NOTA 1OFNA 3INAA 1GWMA 2G9GA 2XOMA 1K5MA 4N43B 2UYBA 4K3UA 2GSYA 4L8QA 5FMBA 4CDXB 1HB2A 2PLV1 4AGVA 2VPVA 5CB7A 3FHIB 4F3JA 3APBA 2WFF2 1FOD1 3H8OA 2YMZA 1C57A 3JXSA 4E4ZA 4HSLA 4L2NA 4XILA 1AL23 1JU3A 4MGZE 3VBSB 4Q4V3 3VD3A 4XTPA 5IYYA 4HVRA 1BVVA 3QH7A 3UKTA 1AXYA 1O7FA 2XL7A 3MICA 5C3PA 3GBWA 3B01A 3NNMA 2WN3A 4Q4X1 3CNAA 4CUCA 3BPZA 3N7MA 4P9GA 1ZZBA 2ZXQA 4WM8B 2ZHLA 4TZDA 1SEFA 4W6XA 5FY0A 3ZSMA 1O5UA 1WUVA 3CJIB 4YG6A 1W9YA 1NOVA 1UU6A 2ZX0A 4XBQA 5D8AC 2X10A 5GZFA 1QQP3 5K0UA 4FOQA 5I93A 1RUOA 4NHLA 1RVF1 4IEUA 1LGCA 2VULA 2VMFA 1QJEA 5FP7A 2V4AA 4ZZ8A 1DFQA 2WC2A 2UURA 4LBQA 3I7DA 2E32A 3FHQA 1POQA 1DLLA 2PHFA 2BWAA 4P08A 4CA9A 2YGMA 2ZGKA 3ZFGC 5CBLA 1AJOA 1LHOA 1AYN1 1ENSA 3AMPA 3MHZA 3SQOA 3AKQA 5FLIA 4YPJA 1E5RA 3I3DA 3D6EA 1AYN3 4ZONA 1B35B 1YCIA 5A6QA 2BPA2 4CEYB 1S0IA 5EV7A 2XBO2 5CA6A 5HCFA 2QCSB 1RVF2 3FE5A 3V64A 1W06A 2Q4SA 3NNGA 3T1MA 1ULOA 1JZ5A 1NX9A 2RR12 3JCIA 2VZSA 4YW6A 1WBLA 1CD3G 4N8MA 3K51A 4CCOA 1JU4A 1MS0A 4E4SA 1HQNA 1D4M2 3GALA 2V5DA 1ZA4A 1H2NA 2ZTNA 1R091 2HWD2 2ZGTA 4S2HA 1GZTA 2RMU3 1LECA 3B93A 1T6BX 3ZYHA 1XPWA 1CAUA 2VG9A 4RL7A 1VPHA 1UYZA 4M3CA 2G1MA 2MHFA 4EN0A 1ZX5A 1R082 2R041 4NE9A 1AR71 4URTA 3POFA 1HN0A 2CNAA 2BVBA 1JXNA 4PIXA 3WQ7A 4HN0A 4FFGA 4C0HA 5C4WA 3DCQA 5GLZA 2YC2A 3BTAA 3OBZA 3S57A 1LENA 2RVAA 3ZSLA 2XB6C 4C0BA 4B1MA 1KFUL 4FAHA 3MFCA 2UU8A 1QOSA 1Y9QA 2WABA 4H7MA 5FPUA 5BPXA 3WW2A 4XDOA 5C70A 1OQDA 4LHKA 3BB6A 1G9FA 4QDSA 4HOOA 4XFGA 2CY6A 1GQGA 1ZA7A 3EO6A 3KVBA 4Z07A 1OPMA 1JZ7A 4DUXA 5JOXA 3RZGA 1FYUA 1K3IA 1HXS2 4PLNA 5IT6A 1MS4A 3DPRA 4MH0E 2HEVF 5FYZA 2A3XA 4Z1VA 4DXSA 2X5IC 3N9OA 4Q0PA 3HIFA 4BIOA 4GB33 4XAAA 4NRQA 5KXEA 1SLIA 1YYNA 3DYOA 4FPCA 1HRI1 1NA1B 4Y4RA 4XBNA 3VBRB 4B8EA 1LEMA 3LFIA 1YC61 4Q8KA 2XPJA 2HYKA 4PLOA 1WCKA 3THPA 5L73A 4BE3A 5H9QA 2LALA 3DYMA 1DYOA 2C24A 3AZZA 1H2MA 4OFGA 4WZFA 1KJRA 1QDCA 4CP9B 3NKTA 3I3MA 2EALA 5FXWA 2RMU2 5E89A 5CFDC 4ASLA 2P3IA 1DZQA 1PGW1 4YVWA 4A45A 2JIJA 1H4GA 3B3QE 4PIYA 5KHHA 1UF2C 1CGPA 1A6CA 1MPXA 3S6PA 1WLCA 2X05A 2JE9A 2JJ6A 1W2TA 1M06G 1Y9MA 2RS11 5FZ6A 5A1FA 1UZWA 1DBNA 4JZRA 3WLUA 4ONUA 4QPIA 2JD4A 4COWA 5C7GA 4IE0A 4A7ZA 4HONA 5CFCA 1VALA 2DTWA 2O8QA 4UI9L 4CU8A 2QQLA 4IEQA 1W0PA 1YRZA 2JG8C 2XVLA 1G9DA 1ZRFA 2IZWA 1SQ4A 1AXKA 1AX1A 2J7MA 1ND3B 2OW4A 4MOAA 1W2OA 5F5IA 3ZSJA 2W94A 2C0ZA 4AHZA 1WW7A 3RJRA 5C3RA 1JH5A 1PNFA 3HR9A 4JQRA 4R9BA 1BEV1 1DHKB 2C6SA 3AP5A 2ZGNA 4P14A 3THCA 4E8CA 2NP0A 3H8UA 1DIWA 3KS7A 2GC1A 3EJKA 3PUHA 1D4M3 4UF0A
chains in the Genus database with same CATH topology
1V6IA 2A3YA 5DUUA 4IV3B 2XWJB 3ZN4A 2WT2A 2OIIA 5F9TA 3VL9A 4OHZA 1H1IA 5CFCB 5KHGA 1XYNA 1RUG2 1IS3A 4YZ5A 3NO8A 2QFEA 1DU3D 4LHNA 1REFA 3ZFFB 5FO8B 3PVOA 3W58A 3I54A 5E16A 1FV2A 5FBZA 2P17A 1I9RA 2PHDA 2R061 4RSUA 3VBRC 5J3UA 1TQ5A 4CDXA 1MQTA 4UW6A 2BNOA 4OI0A 3ZSKA 4LE4A 2BEOA 3OD4A 3ILFA 2DVGA 3H3UA 5DUWA 3ZXGA 3ZFGB 1CPNA 3LOBA 2WNUA 1YFYA 1UX6A 4XEZA 1TNFA 3KGLA 3LSDA 1VLNA 1U5YA 4TYSA 3K48A 4XFAA 2BTVC 3MF9A 3IMNA 4QPGA 5K0UC 4XJUA 3N7KA 4EN7B 3MIDA 4AHXA 2OA2A 2R0HA 1MZEA 1HRI2 1RUG1 2AH2A 4OZXA 3VV1A 3WP3A 3ZFGA 1PHMA 4ISRA 3WG3A 1F9KA 3ACLA 3KT4A 2ET1A 4YM1A 1Z7S1 3JBG2 1G86A 2QE3A 1MVEA 2VMHA 1SBDA 1SLAA 4Q0QA 3RNSA 3VDDB 4DINB 3AP9A 2OYZA 1FNZA 3AFGA 4YZ4A 2XG3A 1PNGA 4DS0A 4CDQC 1ONAA 4I30A 4QPIB 5DDJ2 2Y0OA 1SLLA 1HIXA 1GNHA 2EXJA 2JDZA 2DWRA 2XKPA 1EV12 2Q30A 4KWKA 4ZU5A 1R1A1 4Y1XA 2R042 4ISQA 2GDFA 2VGDA 5J7MA 1RMU1 1X8EA 1ZBA2 1RVF3 1R1A2 2D40A 4RQPA 4AEKA 1KDKA 2VVEA 4R4ZA 3GYDA 4PBPA 1CAXA 4XJWA 1KD7A 2PAEA 1RUF3 2RS51 3ILRA 3PLQA 5F5QA 4DQAA 4AFBA 1WCDJ 1ZRCA 1RUC1 3AP4A 2O8OA 3AYEA 2ERFA 2BYVE 1ENXA 2GAUA 4XIKA 3ZIXA 5C4WB 3TN93 1AJKA 3UL2A 1E57A 5JI7A 4K6BA 2CWSA 5GM0A 3ELNA 3OF1A 3H50A 1HXS3 3SLIA 3IM0A 2JG8B 4FQ4A 3SISA 1Q8PA 2XWBB 2DFBA 5AC93 5FMOS 3ZPYA 4LA2A 2R062 1CAVB 2RS13 5HBAA 2RM21 4Z92B 1FMD1 1RHI2 2R073 2V09A 3L2YA 1BK1A 3B02A 2VUAA 1JOJA 1AL22 1T6GC 2QKDA 2H6BA 5L7OC 4Y5Z0 3ZX7A 1YIFA 1KS4A 1Z0HA 4QPYA 4YG0A 3R6SA 1J58A 2EF6A 2MNGA 5BNNC 4M3CE 1YIPA 4B4QA 4N7IA 3R0RA 1D4M1 2ZA9A 1ZREA 3NV4A 3O0VA 4KGGA 4XHBA 4GKYA 1X36A 4JDNA 4Y1ZA 2RJKA 3ZYGA 1ULGA 4R4XA 2JG8A 1NLRA 1V70A 4NHMA 3VGIA 3B9IA 1CESA 1WLWA 1FPN1 4QQLA 3JB4C 4GXLA 3QCWA 1ZYBA 4ITCA 2D3PA 4J1XA 1KITA 4WVZA 3BOWA 3GNEA 2ZGPA 4K7JA 4Q1PA 5I8TA 3WDTA 3O5SA 1H9PA 1QMJA 2DF7A 1TME1 5J48A 1UN1A 5GZDA 4FPKA 2DCKA 4AI2A 5I8YA 4M0NA 4MXWA 4OUSA 2VW1A 2RS32 2VUJA 4LEJA 3OY8A 3M4FA 3LGRA 3WQ0A 5I8SA 4CEWC 3JZVA 3TBDA 4YVSA 3D82A 1Q8QA 4G9SB 1EP0A 1J3RA 2HWF2 3JUUA 3ZXEA 3WP5A 4WM7B 1ND2C 4KL1A 1VBA2 3AZVA 3EQEA 1NCQC 3A0KA 4LE3A 5IK8A 4XF0A 4HANA 1OOPB 4GMP1 3FX3A 1BBT3 5A33A 3WQ1A 1R1ZA 1YJLA 2A73B 3ZMOA 1O4YA 5EZWA 2Z5WA 1ZNPA 3KT1A 1MZ5A 2GMMA 4JGZA 3VHRA 3KM5A 1VAMA 3ETQA 1N3QA 1RUF2 1Y3TA 3VKOA 3AJZA 4Y1VA 3VBFB 3VHNA 3U4XA 5FCCA 1HW5A 1HQLA 1VBA1 4FPYA 2VNOA 1NQJA 3OJBA 4AFDA 1IQAA 1Q56A 3GBFA 1JYIA 2YV8A 2ETEA 3VBUB 3WDWA 2OPKA 4AHWA 1ASJ2 1WCSA 3PVBB 1TMF1 1C4RA 1AYM3 2R32A 3MIHA 1W0OA 5FQ0B 4YW3A 2HWC1 2P37A 3G7DA 1GQHA 4XXPA 4CDQA 2QQPA 1VBE1 2PQQA 2DTYA 3ZXAC 4A7YA 4WVMB 2D6PA 1MEC3 4RR3A 3JQXA 3N7LA 2ENRA 3ENRA 3JB8A 3E6BA 4E2QA 1IS6A 4R9AA 5AFBA 3B69A 4QX5A 1O3RA 3VBSC 4CZSA 4EJRA 4JV4A 1PIV1 3ASIA 3WCRA 4BLIA 1LOCA 3TB0A 4Q2FA 3AZYA 1UU5A 1VBC2 3M7AA 2LM3A 3RJ2X 4RQPC 1PZ9A 4YVSB 1W6NA 2PTMA 3FZ3A 4E4DX 3MI8A 3MFAA 3RRDA 2P2KA 5C8CC 1FV3A 1DGWX 3J26N 5FOBB 3KD4A 3UKVA 3CJIC 1U5IA 2ATFA 1AF9A 3TNPB 1I3HA 4XPVA 4FTEA 4JVAA 2FQPA 1FT9A 3MW4A 4Z82A 5KBFA 1S2BA 1C8M1 2XJPA 1VBD2 4UW3A 1IKPA 5BNNB 4LO4B 5T5OA 4AW7A 4BWOA 1BEV2 4BPZA 1DDLA 4XMAA 3WVJA 2ZGSA 4TWTA 2BFUL 2VOVA 4I01A 5F1RA 5FOJB 1F5FA 1O3QA 1N1TA 3N4MA 2VVFA 3OCPA 5GJ6A 1BVP1 1QQP1 1WD4A 3O0XA 1W2UA 3MEPA 4OI2A 1RUF1 2IXIA 3PVEA 3ZYIB 4IQPA 2H0VA 5DXDA 2ZGOA 3R4SA 3CF6E 4JTNA 1XU1A 3SMHA 1C28A 4EROA 3AK0A 2EAKA 4I0BA 3KCYA 2D5FA 1EAH2 4QM9A 1UAIA 1DGRA 3VKMA 2RS53 5BNNA 1Q8OA 5LRRA 1QOOA 3WHTA 3VKFC 5JMCA 4XF1A 1H8VA 2GH2A 2I45A 1WA4A 3FBMA 3LA2A 4WVVA 1YNAA 2RMU1 1DZRA 5BNOC 3OD0A 1GICA 5KWRA 2GN7A 4CDUA 1AR63 2JICA 2ILMA 1PVXA 4HT1T 1MS1A 4MGKE 5KXBA 3O12A 1QJY2 4RHV1 4AFAA 3VBFA 1LHWA 1NY72 3S7EA 4Z2WA 3M8LA 4QQ2A 1EV11 1N1VA 3FC0A 4N53A 4Q4X3 4Y22B 4FTBA 4ASMB 2A6VA 3WG4A 4NVPA 2O1QA 3FUOA 3TWIA 4C1WA 1YJKA 2WQ4A 4FOWA 2H6CA 1FATA 1QJU2 2V5YA 1IKQA 4FPOB 2IFWA 3DUIA 4FPEA 3B9CA 2Q0AA 3WW1A 4ZU7A 1DQ6A 1UZYA 1AUYA 1RUI2 1QJU1 1X7NA 1H30A 1W6PA 3R05A 3AFKA 4YVSC 5L36A 3G6JB 2KM2A 3THTA 4DZGA 1POV0 2YXSA 1AR72 3MF6A 4XYXA 5FREA 4C91A 3SNMA 3ECQA 2ZGUA 4D3WA 1TNRA 1KXGA 1QJX3 4FPHA 4Q4V2 1EAH1 2D6NA 2ZS6B 4X6QB 2Q8OA 2VW2A 3BU7A 3WDYA 1NE4A 1BBT2 1TEIA 4OHXA 4C90A 3PTYA 3KGZA 4ES8A 2IC1A 1D2QA 4AQ2A 2P34A 1WMFA 1HRV3 1QQP2 2VW0A 2WSVA 3L9JT 4DXZA 2D6LX 5AVPA 1MR5A 1CAWA 4ES9A 4AE2A 1YWKA 4CEYA 5ABJC 5H9RA 1DQ2A 1ND2B 4HPKA 3FJSA 1YHFA 3WP4A 4BLJA 1RJ7A 5FRAA 1JUHA 3FFQA 5C9AA 4XIOA 1UW8A 3VBHB 1A78A 1FPN2 1ENRA 1PMIA 4GMP0 3TAYA 3KMHA 1AR91 2XJVA 5GLUA 3V0BA 3TNQA 2XLAA 1F8VA 4HZFA 2WWSA 1UL9A 3VN4A 2LUWA 4FCAA 1BBT1 4HFSA 3BOPA 3ZFEB 3LWCA 3QOPA 5BV6A 1NCQB 4DY5A 1HX6A 1AR83 4WM7C 5LK5A 4G4FA 1BMV2 5BNPA 5AVAA 4MXVA 1EAH3 1WLTA 4W6YA 1C1LA 1DZTA 2BW8A 1RUNA 4YW5A 5FO7B 3ZVXA 1W6OA 5D1IA 2Y0IA 2DYCA 4OHYA 1A3KA 5KHIA 1S1AA 3MDPA 3M2MA 2D6MA 2FMDA 1IS4A 1RMU3 2VVDA 1NCRC 3HN1A 3RYRA 1PIV2 2D6KA 3AYCA 4NN0A 1VBC3 3GZUC 4Q0VA 3WG2A 4AVSA 2ZZQA 1SBEA 5JI9A 4AGGA 4AI8A 1VAKA 5D8AA 1X33A 1MQTB 4AQTA 1PK6B 3SH4A 4BMEA 4GQ7A 2WZR3 1V00A 1L3JA 1BJQA 1YI9A 3HT1A 2AENA 2WZR1 1C5HA 4XFFA 2ZKLA 3HT2A 4Y20A 1FNYA 2XJRA 4QPGB 1GFF2 1QGLA 4MSVA 3GZTB 2VOKA 1NG0A 5FQ0A 4ATEA 1ZBE2 3M3CA 3WNXA 2IXCA 5BNQA 1AR82 4LBOA 1UIKA 2PHUA 5L7OB 3B7MA 1SFNA 1PO21 1VB2A 5FPXA 1AR73 2OUHA 4QU2A 1MZ6A 4UW4A 3ROUA 5BNOA 5J09A 4YW2A 3OBRA 3LA7A 5JDBA 1NXMA 1H2LA 4EN8B 4CDUC 1ZZCA 4AYUA 4PQ9A 5T5LA 3VUOA 3NW4A 3SH5A 1D0HA 1Q8SA 2E7AA 4AVBA 1VAVA 2B42B 4LT5A 1RUH1 1VBB1 1A8DA 4E2GA 4H14A 5A3MA 4RS5B 1XXNA 2AUYA 5C4WC 2KXLA 3DKWA 1UKRA 4JCKA 2UY8A 3X29B 3N35A 4CP1A 2IXLA 4JTOA 3WR0A 2ZAAA 1SDWA 4N9IA 3AKRA 3MLJA 2VECA 5I0TA 1H9WA 1FPN3 3GF6A 3NAPA 1GNZA 5DUXA 2WJSA 4GH4C 4L11A 3AMMA 2JENA 4FOYA 3A4UA 1PZ7A 3WINE 3VL8A 5DG1A 1VB4A 3FLPA 3BCWA 2B5HA 5FLHA 3RYPA 4RHV3 3ILNA 1RUD1 4AGRA 2CTVA 1H1MA 4FXKB 3V56A 2XHKA 3OGGA 3RDIA 1ULDA 1LHVA 4P9XA 2DU1A 4XMIA 2R49A 2JKBA 3H0OA 4HKWA 2R1BA 2JG9C 1SMVA 2Z79A 3ST7A 1HDKA 4YZ3A 5CFDA 1V9U2 3LOIA 5T55A 4PF5A 4MLOA 4BYYA 4YGEA 1C8NA 2A70A 1LOGA 4Q4W2 5EXOA 4AF9A 1RHI3 2R072 3ZYRA 5DDJ3 3ZFFA 3OYWB 4JRLA 3S0MA 4CEYC 4DRVA 3MIFA 3WP6A 5B2GB 3IWZA 3AZXA 1VRH3 4PDWA 4HK8A 3DN7A 4JRAA 1U5XA 2D3SA 4XQ4A 4YZ1A 2D5HA 1N1YA 1WW4A 3JBG3 1APNA 2UYAA 4E9KA 2ZGMA 3QLQA 4HMZA 4AWDA 5IK4A 3LB9A 1OMIA 1JN2P 1LTEA 1POV3 1QHDA 3KQRA 4XHXA 5IUQA 1IZ3A 4NHKA 2B7YA 5H9PA 2HWB2 1CQ9A 1W6MB 4XTMA 2A7AA 1HRI3 4S2GA 3DPRB 3VHPA 2HWD3 4COVA 1PGL2 5JR7B 2YYOA 3HAGA 3IPVA 4DMIA 4K8FA 4H3WA 2Z69A 4YM0A 5GKAC 2NMOA 4FPGA 1RL3A 2YZ4A 4WM7A 2Q1ZB 4ZXKA 3VKLA 4Y26A 1VJ2A 1UPIA 2E6VA 4IETA 4PIZA 5J98B 1H0BA 2OZ6A 4CDUB 4QD2A 4XF4A 1IPJA 3ZFEA 4EN9B 3NAPB 4OUMA 2EXHA 5F6KA 5I0RA 3VBRA 1HQWA 4FO9A 4CDXC 2DV9A 4YFWA 5FTTC 1D0GA 1MQTC 2ZHNA 4K9SA 3POWA 3S7IA 1EPWA 2OVUA 2WNUC 3D5OA 2PLV3 2K2SA 1VRH1 2R1DA 5ACA1 2R30A 2WLQA 4QPGC 2DCJA 2DCYA 1VBA3 3OYWA 3CJXA 4XJ9A 4Q0SA 2ZGRA 2NPIA 4JC1A 4XXAA 1MS5A 4O9GA 3H7JA 1MVQA 3E97A 1NA1C 1J1TA 2X29A 1LOEA 2B46X 3WG1A 2XGXA 1S0GA 2PAKA 1HV1A 2R063 2WNEA 1AYM1 1WGPA 3EBRA 1Z7S2 2RM22 2ZABA 2DUOA 1XNDA 1J59A 2WA3A 2BQPA 3M3EA 4YRDA 2WINB 4BA6A 4D69A 2JE7A 3AP6A 2F4PA 2YUEA 1XU2A 5F6LB 4PDWB 5E1RA 2X8KA 2XBO3 3ZXJA 5CG8A 2WNVB 4LBNA 2C9AA 4FP3A 1D4VB 4QHBA 2JX9A 1S0DA 3SH3A 1ZRRA 3LZZA 1LHNA 4K21A 1AYM2 3M3OA 2WLPA 5J96B 3NWKA 4P9JA 3AB0A 3SITA 4IEYA 4OI4A 2ZMNA 4Y22A 4EWEA 3PMEA 3H7YA 2WNUB 5FLJA 4A2UA 2XLFA 4LUMA 1TMF2 2G9FA 2CAVA 3S30A 5BY5A 4YNIA 2E7QA 1ZBA3 2GNDA 5K9YA 1REEA 1WD3A 3PJQA 2I07B 4Y1YA 3E5UA 3I59A 4XFHA 4ATFA 4D7SA 4EV0A 1ZBA1 3NAPC 1COV1 3O7OA 4LBMA 1J3PA 1I1EA 1LGNA 4META 2HKXA 3KSCA 2ZAHA 4RA0A 5BXXA 2VNRA 4XF9A 1B35C 1PO23 1GLHA 4HETA 5LEKA 5CU1A 4YARA 4N43A 3QBQA 2D3RA 1DF0A 2GC2A 3VDDA 2GMPA 1LRHA 1W6QA 2EXKA 4YW1A 2A6WA 4M00A 1AX2A 4I3GA 2WZPP 4QXKA 4GB32 3USUA 4Z8BA 5JSPA 1VR3A 2A6ZA 3MLKA 1QJU3 2JG9A 4LBJA 3FFZA 4B7EA 4AVVA 3E6CC 5TSWA 5T50A 1OQ1A 2DVBA 5C8WA 4KNCA 3GBGA 4I0WB 4IEOA 5C6CA 5L7OA 1RMU2 3LA3A 4AEDB 3VBHC 4HVQA 4OHVA 5CG9A 2ZGQA 4LO7A 4M3CF 5FMOL 1RUJ3 4FPFA 1PO13 4AQ6A 3E6DA 1GZWB 4BHPA 3B00A 2GN3A 2VMIA 1CVNA 1HXS1 2GNBA 3VZMA 1Z7S3 4LULA 5BYNA 3AMHA 2PHXA 3HBZA 4XBLA 1HRV1 1U12A 2Y26A 1IS5A 1D2SA 1OFSA 5JIUA 5D8AB 4NO4A 1X8MA 2A5ZA 2R16A 2JG9B 2GNTA 3M1HA 1Y43B 4IERA 5JZGA 4WM8C 3I59B 1ASJ3 5KXCA 1H8TB 1LEDA 3MLLA 3WHUA 3FWEA 3MPBA 1VBD1 5BNPB 4LBKA 3IT8A 1ZVFA 5A3LA 4IV1B 4Q4W3 4IEZA 1FMD2 4GH4B 1UPSA 5HI0A 1GR3A 3WV6A 2DURA 1SLTA 3U0ZA 3A0NA 4Y24A 2ET7A 3AZWA 2GC3A 1POV1 3EXUA 5BNOB 1ND2A 1RC6A 1AR92 3USSA 4RR3B 2ARBA 4PCRA 1RTVA 2DCZA 5C9AB 4R52A 1N3OA 3H1MA 1YI7A 2WFPA 1QJX1 4JGZC 3RYKA 2Z2SB 4YM2A 2VXRA 4P9IA 1F2NA 2WA4A 1J1LA 2O0OA 2XJSA 2TBVA 3VZOA 2BGCA 1MACA 2EVXA 4GKXA 5EYXA 5KXDA 2SLIA 1AR61 1SFYA 4D94A 4X8NA 1XRUA 4XETA 4W65A 2CGNA 4KWJA 5HXVA 1F31A 3RQ0A 2YROA 5K8SA 1NA1A 1TME3 3U11A 2GC0A 1X82A 1XNKA 1ZZ7A 2IXJA 2AYHA 4LBQD 1AYN2 5CNAA 3TRSB 5LEJA 2WT1A 4WZCA 3ZN6A 5EJ3A 3PHMA 3WY6A 2RS52 3POYA 3DL3A 4RR3C 3RI9A 3V65A 4OULA 2DCTA 1QNWA 4KH9A 1PK6C 3AKPA 3RPQA 3N7JA 4N53B 2XJUA 3SCFA 4AVAA 1BZWA 1QH7A 4LR4A 2XH6A 3OY8B 4GB31 4HPKB 1QJZA 2JECA 1RUJ2 4IV1C 3AM2A 3H9AA 5JCTA 4Q8LA 4YGBA 2P3JA 2H0BA 4AI0A 2W39A 1W6PB 2ZX3A 4JGZB 4YGCA 3SCGA 1MEC2 5C8CA 3EHKA 2TEPA 4PJYA 1IGOA 3KCCA 1RITA 4HN1A 4Y20B 1W39A 5FDBA 5CVRA 1UKGA 1MS9A 1UD1A 1YFWA 1URXA 3MIEA 2XJTA 4C1XA 2ZPXA 4RGAA 4B4PA 4FQZA 5K7PA 3ES4A 2UY9A 1X50A 5GLVA 1MEC1 3VDDC 2MEV2 2XUMA 4DNYA 2FZ2A 4Q1RA 2XKOA 2JEMA 4XW3A 3U10A 4Q27A 5LRSA 1HV0A 1S0BA 4D7YA 4COYA 4QGNA 1H8TA 3MZHA 3UKNA 1REDA 3IPVB 4RGGA 2LTNA 4CDWB 1AVBA 2NMNA 5EFUA 5I91A 4AEDC 5C33A 4V1PA 3WUDA 2BNNA 3FMGA 2B9UA 2VH9A 2E51A 3T1LA 4FP2A 3O14A 3VBHA 3BALA 5K0UB 3USUB 3KLSA 4KBBA 4Q4Y1 1OI6A 2CWMA 3NVCA 1EV13 4RS5A 4GULA 4KG0A 5T5PA 1FMD3 3GHMA 3ZN6B 2OZJA 1O5LA 2AZ5A 3IBMA 2E63A 4YW4A 4GALA 4WBBA 4FVVA 3CU7A 4AXOA 1EYBA 5I0SA 2HWE3 1RUH2 4JGYC 3OGJA 3VBFC 3ALQA 5LK7B 1AR62 4LBLA 5JZGC 4QM8A 2WNVC 4HKOA 4IEXA 2PYTA 4KU8A 3ZXDA 1KS5A 3AMNA 4BMBA 4MX3A 2IFRA 2Z42A 1LU1A 1C5IA 4X6RB 2VNGA 2RS12 3UJQA 1BCXA 5JPMB 5BUVA 1RUC3 2AGSA 3D4KA 2PAMA 2Q1MA 3GHNA 1HKDA 2GZWA 2I74A 1PIV3 1DQ0A 1YLLA 3ZDSA 3ZO0B 3WCSA 4YZ2A 2D43A 3TN91 2PHWA 5T3NA 4F7ZA 1U5ZA 1R093 4ORFA 1MS8A 4COUA 1XYOA 3IDCB 4W6WA 3WOGA 2WZR2 3VBOA 4QGLA 2B8MA 3J8F3 1PO22 1CONA 1YFXA 4U2AA 3VZKA 2Y38A 1YXWA 2ZX1A 2YC0A 5E8AA 4Y1UA 4HSJA 4QQPA 4N7UA 2A71A 4FT8A 1DQ1A 1GBGA 1GANA 2ZGLA 3U07A 2XVKA 4NPRA 1LESA 1LR5A 4XE9A 4LLFA 1ENQA 1R1A3 4WVWA 2R071 1W6NB 2PHRA 4Q4W1 2HWE1 4MZUA 1OKQA 4R9DA 1AR93 1LKNA 3WX5A 4ZU4A