5D8HB

Crystal structure of the base of the ribosomal p stalk from methanococcus jannaschii with antibiotic thiostrepton
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
207
structure length
207
Chain Sequence
MAPWKIEEVKTLKGLIKSKPVVAIVDMMDVPAPQLQEIRDKIRDKVKLRMSRNTLIIRALKEAAEELNNPKLAELANYVERGAAILVTDMNPFKLYKLLEENKSPAPVRGGQIAPCDIKVEKGSTGMPPGPFLGELKSVGIPAAIEKGKIAIKEDKVVVKKGEVVSPKLAAVLDRLGIKPIKVGLNILAVYEDGIIYTPDVLKVDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF THE BASE OF THE RIBOSOMAL P STALK FROM METHANOCOCCUS JANNASCHII WITH ANTIBIOTIC THIOSTREPTON
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ribosomal protein
molecule keywords 23S ribosomal RNA
total genus 46
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d8hB01
3.90.105.20 Alpha Beta Alpha-Beta Complex Molybdopterin biosynthesis moea protein, domain 2 Molybdopterin biosynthesis moea protein, domain 2 5d8hB02
1ZAWA 5GAEI 5GADI 5GAHI 5GAGI 4UY85 3J7YI 3JSYA 3A1YG 1ZAXA 1ZAVA 4NWBA 5D6GA 3J7Z5 4V19J 5D8HB 2QA4G
chains in the Genus database with same CATH superfamily
1RSCA 5K9FA 3UDCA 4JI5F 1W26A 2DNYA 1VI7A 1QSYA 3SFUA 3M2UA 4DPXA 1UMJA 3THPA 2VQFJ 2ZHAA 1XIQA 3W8PA 4BC7A 1WEYA 5DG8A 2I9SA 4M5HA 2DYAA 3H4BA 1T3NA 1H38A 4LF8J 3ADAC 3DLKA 2DGOA 2XCAA 1OIAA 3NWGA 1VRUA 4P75A 5ADZA 3SV3A 2XSFA 2X3LA 4Q43A 2ZBCA 3OTCA 4HTJA 3FBCA 4AT1B 1RAFB 4DXLA 1XR5A 4C9DA 3BM7A 2ZNYA 2JRSA 2K1RB 2E29A 4NL5A 4I2QB 1XMOJ 1YJNS 2BQRA 2GAHC 2J8SA 3FK4A 2CQ3A 4P2FA 5U47A 3TAMB 3OVBA 2UZAA 3CT9A 4PXDA 1SH0A 5C24B 2QN6B 4X62J 1AUSL 3MEKA 4PYAA 4OJ3A 5L38A 3BPDA 3T5LA 3T41A 3H90A 4ILRA 1RTJA 4KIAA 4DSFA 2YX4A 3EXCX 4WK1A 1JB0C 1DAXA 5GMEA 1IKVB 4FF3A 4DV6J 1JLAB 5F0WA 5KFXA 4DI6A 2EW9A 1PCAA 5CH7B 4ZJOA 5GADU 3GIMA 3BQ0A 2OP5A 1QTNB 3PW7A 4X65F 2L3MA 2AQ4A 1RYRA 4DV4F 3W3SA 1FJGF 1VYAA 1WTBA 1RWOB 2LA6A 4ZP6A 1S1XB 3BKFA 1LWFB 4NYPA 3ILLA 3M6UA 3HKWA 2GVZB 2WVBA 3N9UC 1S6UA 2GW8A 3GFYA 3KG1A 4ZHRB 2QLJB 4M5GA 5ETMA 4DL2A 1RBOB 2ALYB 2ZUGA 3US5A 1M90T 2DR5A 4CLTA 3B4DA 3PFOA 2GIFA 2U2FA 1E6VB 3OT9A 3R5DA 4MYUA 1RTHB 2XZDB 4ZVEA 1BQNB 2PE8A 2FC9A 3SCLE 1D0EA 1SIWB 1VFJA 2FLLA 2YTCA 5I4MA 2WOMA 1N32F 2N4CA 3LGHA 1LXJA 2IAJA 4P72A 1C1CB 3CDAA 3UR0A 4NLGA 1DBDA 1RAIB 2XYGB 5C42A 3O8WA 2XGQA 3NRBA 3SCIE 1NBEB 1LWXA 1M5OC 1M5VC 2J5AA 4Q5VA 1AFIA 4I0WA 4MT1A 1L3UA 2IYGA 3M30A 2N3LA 4LSLB 3U1LA 2B9YA 2JDJA 2CDRB 3MEDB 1WKJA 1S6QB 4OHXA 5AJ3F 1S7IA 3HPOA 5MAOA 2D3O1 2DR8A 3TNVA 3CIZA 1KFSA 4ELVA 3BSOA 3CWJA 4DEZA 4WXOA 1XQIA 1RBLA 4C98A 3THVA 4B3RF 2E1PA 1IUJA 2CPYA 3E01B 4YB5A 3CCVS 2GA7A 4NA1A 4J7CA 5D3GB 4DR5J 1TZ0A 2FJEB 2CWXA 3RB6A 3IWLA 3PNIA 2V63A 1PJ6A 2H5IB 4WP3A 1S9EB 4ED7A 3K89A 3GFHA 3FRYA 3LP1B 2W2PP 4BWJA 4RBTA 4E8UA 1B0PA 3I31A 2UV8G 3RG6A 3RW7A 3PKMA 1NSKL 3O44A 4L72B 3U7JA 2RSQA 3AXMA 2NROA 4DCOB 1FE0A 4IH5A 4DCJB 4ZIVA 2U1AA 1KEKA 1Z2ZA 2AHOB 4LF4J 4ZP8A 4EO6A 5LSLA 2V2KA 1Q4RA 4OYOA 3TZXA 4QR2A 1X0FA 4LFAJ 2UVUA 5IT9U 4Q0BB 3TYTA 3RBXA 3CVKA 1VRTB 4FVCA 1JLBA 5KT4A 1HQUB 4G3IA 2J9DA 2FJVA 3OFEA 2PA3A 4KE5A 1V5VA 1I6JA 3TZYA 3FMWA 3VGTA 4FZVA 2F8HA 4URQU 3UDVA 4K4WA 1VC0A 5HVFA 3G86A 5KFRA 1UZ5A 5KTQA 4RUAA 3MM8A 2GQQA 5IOLA 2HMIA 2YNFB 4YEAA 1BY9A 3D4JA 4LF4F 4NCAA 1JLGA 1WOPA 3CJ0A 3DMJB 2YQ1A 2UUTA 4DR2F 1EZZB 1FDAA 1B64A 2ZBIA 2MPUA 3C6TA 2J6SA 3D9BA 2WVFA 1OPZA 1UWAA 2C3OA 3HZGA 4ZCLA 2DNPA 4J9LA 2J0WA 1U0HB 1N33F 2VD3A 3UN5A 3VAMA 1GTHA 2D9PA 3RBEA 2OEJA 4LF7F 1EB0A 2VFVA 3KK1A 3EDQB 1S0NA 2IHR1 1Q53A 2OLWA 2W8KA 2LXIA 3I5CA 2WONA 1UFWA 2IC3B 2Y8WA 1T3EA 2H4WB 3H42A 2V2ZA 3F44A 2C3UA 2W01A 4A48A 5EUHA 3GJRB 5DZ6A 1Y10A 4B3TJ 4F26A 2W4DA 3BO3A 4U8VA 3MM9A 1RADB 3T9NA 1YTYA 2UUCJ 1VMBA 3HVWA 4NASA 1K0TA 1QJHA 1XNRJ 1EKSA 5JUMA 2JLFA 4K5SA 4ECWA 3CD0A 1FRLA 1TR0A 1B3TA 1Q8LA 1YX2A 5HI7A 2ZBQA 4KFBA 4ED5A 1H2TZ 2OPPB 2YPZA 3ZC4A 5A6PA 4JB8B 4EEYA 3DLLQ 3RB4A 2OKQA 4P7TA 2HQFA 1D9AA 5IM0A 4K4XA 3X3UA 4YOEA 4PWDA 4OYXA 3FDSA 2CPDA 4JUZA 1AYEA 1LWEB 3UNYA 3HSZA 1R0CB 4LFBJ 1C4AA 2GO8A 4KO0B 1T9WA 1N6QB 1MU2A 4B3RJ 1BWVA 4NLDA 3HI9A 5DO2A 4X4TA 1SQEA 3BGFA 3ET6A 3KDOA 5E3AA 3ZZUA 5J2NA 1F3FA 1HBNB 1NH7A 1A0OB 1R27B 2I5JA 1TKTA 2LP4A 4U95A 2E44A 2QA4S 1RT3B 2ROPA 2L9NA 2YKNA 2BOAA 3QO9A 4LBPA 4F3OA 4RNNA 3PKYA 1TFYA 2ZC3A 2ADBA 2R7RA 3UDEA 5LXRA 4A4JA 4X4OA 2O66A 1YZ7A 3V2UC 2FJDB 1FC5A 3GMGA 4TN2A 1DFDA 1RU2A 1G3OA 3DFEA 4L76A 2DPJA 4LF5J 4WPAA 2KYXA 1G2EA 1KQGB 2QSFA 1TL7B 1JNZB 2FYXA 3MHYA 2XNQA 1DURA 2J7KA 3LQVA 2CJYB 3MMJA 4F4XA 3CDUA 1ZH5A 4DUZJ 3CCJS 3G8QA 1FI4A 3FCVA 1PAEX 2VDHA 1QSSA 3EMTA 1APSA 1N5QA 4ECQA 3MXHP 1OSDA 2HIQA 3H20A 5CQGA 2YKAA 4DL0C 5KG2A 1MSWD 3I0RA 3K0JA 2B51A 1V3RA 1MMLA 4O4GA 2W9BB 3BQ1A 4OYWA 4KH1B 3TJ8A 2R9LA 3BKTA 3DLGA 3K17A 1JLQA 2OELA 3P49B 3UNGC 3MECA 2VOPA 3QGIA 2VG5B 4F4WA 4EZ9A 2ZJRQ 4X66J 4FN5A 4USWA 5FIIA 2B3TB 1Y5IB 3D6MB 3OL8A 4PD0A 1K44A 4PD1A 3X1LB 3AQPA 4JYAF 1AT1B 5G0RA 4FBUA 2PT0A 1JXLA 1RK8A 4GMKA 4ZPWR 4DV1F 4Q8EA 3CNQP 2OH2A 2MSTA 3D0GE 2R7SA 1YITS 4XAKA 2R8HA 5F9LA 4TVAB 2CJAA 4ED8A 1FD8A 3AA9A 2RRNA 4I64A 1T8EA 2RQKA 3DRPB 4OJHA 5E3RA 1P1LA 4ZJQA 3K7RA 2WCXA 3NS6A 4NLOA 3RGIA 4RNFA 2CQPA 3R1HA 4XK8C 1S77D 4OYMA 4OX8A 2P9CA 3A1YG 4DL7A 1HBOA 3QZ8A 4GVBA 2KVIA 3M7VA 4WFYA 5KFDA 5SZTA 4J9PA 4USTA 5G2RA 1OS5A 4L6V3 1RTIA 2CJ9A 3DCAA 3IRXB 3CMAS 1LW2B 3NCPA 2V0NA 3PIPQ 1NB2A 4DUYF 1UCNA 2G1DA 3FMBA 5KFMA 3QAUA 1Y3KA 1U2FA 4NRUA 1HWUA 5FDLA 1HI0P 3I32A 4MKYA 1J5EF 2MQPA 4B02A 5CD4H 1EX8A 1HFEL 2DCLA 1GK8A 1FRXA 2DNGA 4KGKA 3LWMA 4K0KJ 1H73A 1WEXA 5H9EK 4FF4A 4MK9A 1EHWA 1FFGB 1NZ8A 1RT2B 2V8PA 1BQMA 2AX0A 3CJ5A 3W2WB 3OR2B 3T3FA 2GFFA 4FF2A 1JKHA 4C3KA 1CQMA 4LT6A 2QFJA 2BEFA 1BMQB 1Q95G 3N01A 2CRLA 1QAYA 4URSA 5RUBA 2OEMA 4MIAA 1R8PA 2HVZA 3NMAA 4WIIA 4G1QA 2B7BB 2A1BA 4KQZA 1EQ0A 1Q79A 1C4CA 1DTTA 4OZJA 2HVEA 1IKXB 2Z2MA 2IPOB 5ERVA 5IC6B 3BKUA 1R0AB 1VQMS 5J2QB 2E7VA 3L95X 3E51A 1TKXA 3CTRA 2R2SA 1RKIA 1TL3B 1X8DA 2FJWA 2VHGA 5AE2A 2YNHB 3W60A 5EWFA 3IN5A 1MN9A 2X1BA 3LAMA 2G0JA 2CQGA 4OI6A 2FHJA 3CO0P 1U1NA 2CDQA 5F8GA 5DQHA 3W8GA 5T14A 2YNIA 1OQ3A 1RHRB 3Q8YA 2ZH7A 4B9VA 2DH7A 2NXCA 3SSRA 4YS2A 2ALZA 3UDLA 3ZZPA 4DLGA 2IM0A 1RWVB 3NGRA 1W2IA 2DNMA 5AXNA 1JLCB 1U1MA 1RT5B 2QFIA 3M4XA 2BVZA 2G2ZA 3D2WA 2CPXA 4MJKA 3CPWR 3MM6B 2FJXA 2AGQA 1QVFR 1S4FA 3J80U 2RDJA 3MAQA 1VQ8S 1KSPA 4KPCA 4ECRA 4P52A 2DEIA 4HI2A 5KFFA 3KMSA 1VBKA 2HK2A 3KJQB 2BBEA 1TMJA 3CJQA 1RHQB 1RWUA 3W1YC 1LWCA 1WC4A 1KTVA 2HWIA 1HR0F 2R8IA 1HA1A 4ZPDA 1TQLA 2D69A 2AJ2A 3TVYA 4F02A 5KT7A 3H0PA 3TUJC 2MKYA 3R5GA 3VQTA 1VQOS 1YRUA 4FPIA 1SJFA 3ZTRA 2PI5A 4J9KA 4DV5J 4JI8F 1FVQA 2LQ5A 4ZPAA 1NK7A 3PHTA 2LQ9A 3UCZP 5B0DA 2IA0A 2KRBA 2P6SA 1VRUB 1XC9A 5A6WA 3EVMA 5JVGQ 5KAKA 4JI4F 2MZSA 4QJVA 4LR8A 4U6PA 2CQHA 4K4VA 3TVZA 5KFPA 3TO8A 3H40A 2A3JA 2M70A 3HX9A 4RWWA 4DF8A 3FQLA 2HKEA 1HNWF 2NR0A 5L46A 1HMVA 3GIRA 1NK6A 3QNWB 2CUYA 3EZ5A 2V67A 3FKBA 1DRZA 3TP2A 5B0AA 2PMZD 1T02A 3D67A 1BXNA 3EGNA 5C24A 3SQGA 2LQJA 3D1OA 3M32A 3ZFVA 1X9SA 4U90A 4UOGA 4WZQA 1J2VA 4IKAA 1JJ2R 3C15B 1P9YA 3J81Y 1MWYA 3CO9A 1X4EA 2XHCA 4ZPBA 2W9CB 4ICLB 3PY8A 2RF2B 3OV7A 1JMTA 2HVDA 3CDWA 3DGPB 3GJQB 1N56A 3QRQA 1XBWA 3SFGA 2DGWA 1S4EA 1IQZA 3SIPB 2EFQA 1WF0A 3H59A 3L7UA 3PR5B 4I67A 1HPZA 2FY8A 1X5SA 3M8SA 4CLKA 5AE3A 1WC3A 3CJ2A 4NEYA 3PW2A 2LA4A 2NS1B 2DR9A 4M95A 3N6NA 4F4AA 2IJFA 1BQNA 3HVRA 5BJRA 3NAIA 2JC0A 3ULHA 5HVHA 2JFKA 2WOMB 4RW7A 2OPRA 4RLEA 3KKFA 4HACB 2XLKA 2NPIA 4HH0A 2Y3YA 5IS2A 3OL9A 3DXBA 3J81j 3QIPA 4LRFA 4YB7A 4WCEQ 5HP1B 2K2PA 3KXDA 3LPYA 2FUG9 2HGLA 2UUBJ 4DL5A 3IP0A 4DFJA 5B09A 1M1GA 2XI3A 1T03A 3THTA 4NLVA 1OJ4A 3M8QB 2MKJA 2M7SA 4C8KA 2PN6A 2E1MC 3OXFA 2V4RA 3J7AN 4LIRA 1NJXA 4TNOA 2CVEA 4ED3A 4QOTA 3DKDA 3CEDA 3V6JA 1CJUB 1ZZFA 4H4OB 3MOJB 2F1FA 4DDFA 3H25A 1NUEA 1UP1A 3W61A 2FLNA 5D3GA 3L7OA 2QGFB 4I6AA 2KXHA 3TA1A 3K5NA 3QAEA 4KY3A 4J37A 1KP6A 4NX9A 5KG0A 5HO4A 2ZHBA 3R27A 3V81B 4ERDA 3P3DA 2RHSB 2V2QA 1X60A 3VWSA 4KGZB 3GV8B 2HNYA 1FDBA 4DX6A 2FHOB 4HT5A 5KFBA 5LMUF 3MEGB 1JK9B 2ASLA 4OFZA 1TELA 3C8YA 4O3OA 4D3HA 2O1PA 2WSEC 2OD4A 3Q89A 4ZVQB 1HBMB 1QTMA 1NPKA 2B5JA 1BGXT 2MQ8A 4WE1A 5DRKA 2E1CA 1N34J 1LOUA 2F63A 3WIUA 3KNGA 1UEUA 4J91A 3IM8A 4IR1A 3LWLA 1D1UA 5F0UA 4DV0J 1Q7YT 3DHWC 2KH9A 2VU5A 1CG2A 1KQSR 2V9WA 4P7VA 3L4BC 1R6VA 4HL9A 2W9AA 1RAHB 4CDIA 4I7FB 2HHVA 2BOPA 3MR6A 2UXBJ 3HKZD 2H5EA 5HANA 4CLPA 1YQHA 2VBZA 2ZZNA 4K4YA 3GWCA 2AEFA 2IM3A 2NYHA 1EIYB 3A4TA 1I94J 4ZCKA 5HJXA 4X4NA 2KKHA 1QDUB 4HI1A 1FRMA 4Q2MA 4H4MA 2J0SD 3M2VA 4TY8A 2KRRA 4KV8A 5J2MB 2CG4A 1NPPA 3TEHB 1FKOB 5C25A 5DM7Q 2XB2D 1JWWA 4KPYA 5GADI 2FGOA 1WC1A 4F3MA 2KN4A 5HMXA 3UI3A 2V4QA 4MMOA 5A8RB 2HBYB 2VB6A 2PEHA 1ELOA 4RW9A 4ZIWA 2VJUA 4N47A 1N8RT 1NRKA 2KU7A 4ED6A 1FT8A 1REVA 4J9NA 2EKYA 2I1RA 1ZTTA 4JI0J 1U25A 4UW2A 4K0KF 1UEVA 2DNNA 2GJ2A 4OJ1A 4CLUA 3NS5A 2ZVSA 4W98A 3TW0A 5HMWA 1S1WA 2BQUA 1Q82T 1QLNA 4LVOP 1YJTA 1H2VZ 2G0IA 4NLTA 4NLUA 4ID5B 5DZ7A 3NLCA 2OPPA 2ZOMA 3LTOA 4XPEA 1VIXA 1I6VD 2HZVA 4OI1A 5EWGA 1FDNA 2HS3A 3D28A 4X62F 2RMLA 1CS4B 3BR8A 3W5XA 3BPSP 3LPEA 4YDDB 4YR2A 1JJ4A 2UUAJ 4P74A 3AB2B 2E7XA 4EK2A 3MR3A 1OWXA 2HNDB 3KLHA 4ZVOB 2L41A 4KO0A 3QSYB 1N6QA 3PM9A 3VVUA 4JI6F 3SXLA 2VPXB 2ADCA 3ITHB 4DWIA 4HVZA 1JQGA 3BR9A 1AZSB 5EHHA 4X4PA 2CQIA 3DOMA 4CH1A 2F65A 1VC6A 4LF6F 1EAYC 3T1YF 2QLBB 2WB4A 2P8IA 2RILA 3MM7A 2CJBA 1WWHA 1RHMB 4C8YA 1MN7A 2ZC4A 3EPGA 2MLYA 2CPEA 4CLLA 3PHEA 5ETNA 1CJKB 2JVOA 1UJ4A 4TY9A 1ZETA 1UZHA 4KKOB 3MI7X 4TLRA 4USIA 4ZVHA 1TK0A 4NPOA 3CCQS 3R2DJ 1M5HA 4NCBA 2BW7A 2IIHA 4NOHA 2YX1A 3PCOB 2VC0A 4IQMA 2YKOA 2HLUA 4QIGA 4KTQA 3IBCB 3PACA 1HI1A 2H54B 1RT4B 3M8PB 5HATA 5K5MA 5ITHA 3CCRS 2HYIB 3QJJA 3EX7B 1HWJA 2FZCB 1NH8A 1BHNA 1EETA 3GSDA 5HQMA 2NQQA 4LREA 3MMCB 4RBUA 3TUPA 2HQDA 2PFFB 1X5PA 2HNZB 4JI2F 3CJKB 1J5OA 3BDEA 3HD1A 4R8UB 1XR7A 4C8OA 2ZZMA 2A2CA 2QYCA 3BGRA 2JC1A 3GYGA 3Q8VA 4ZOSA 2VG5A 3GIJA 1HHQA 4JI3F 1YLXA 2VONA 3R7BB 2R7TA 1PIEA 3GR0A 5BYRA 4LVNP 5A0YA 4OI4A 1QE1B 4CTAA 2QL9B 2KM8C 4ZDNA 3RU0A 1AXQA 2ROGA 1I51B 3MAHA 4M5JA 4R25A 4K59A 4ZA1A 4C8NA 3SBMA 2LKZA 1Y0HA 3T19A 4CT8A 2V8DA 1G8RA 1FX4A 1U6ZA 2KT5A 5FJ4A 3R3TA 3T5JA 1VR6A 2CQBA 2W1BA 3HJVA 3KUEA 3W2VB 3NGKA 1HYSA 2NQNA 3VGUA 1IR2A 2MZQA 2PMWA 3FVYA 4N77A 5CYMB 1S1UA 2FDNA 5IV3A 3RAQA 4LFCF 1FTCA 3NGDA 3HJFA 3DU6A 1NSPA 2E1AA 4DMZA 5KFUA 4O44B 4Y3CA 2QA1A 1IJFB 2NXNA 4GRSA 3R97A 4HYKA 4DR3F 4IG3B 1R31A 2GQ2A 3T9ZA 4B9MA 2VIHA 5FDLB 4TYBA 2R8JA 4P9SA 3WQPA 4GVLA 4MFBA 6AT1B 2W2QP 4DX5A 4KSEB 1YRTA 3DU5A 2UUAF 4TU7A 1WD6A 3KJNB 5LOQA 4J9SA 4OX9J 2MHEA 5CABA 1YJWS 4QYZJ 3JYTB 1UW4A 4IO9Q 5A8WA 2ZD1B 1RT6A 5ERSA 1IXKA 4AL7A 2XSJB 4F36A 3NOCA 3OR2A 2XQCA 3LP0A 4PPZA 2EPIA 4MKVA 1NPRA 1R8CA 2HHWA 4NLWA 3POTA 2F4FA 2UP1A 3DOLB 4IO1A 2KTQA 4RUHA 1OMSA 2Q66A 1GXUA 3IR6B 1NNDA 5THWA 5D4OA 3AJ1A 5CAAA 4G1QB 1E6YB 3LGMA 4USUA 1RXOB 3JSMA 2EXUA 1HNXJ 4FYDA 4KAIA 3HHLC 1IKXA 5J1EA 2RQCA 2EKNA 1NHUA 1IBKF 1G1XA 3CD7A 4ZP7A 2F8EX 1SV5B 3DM2A 5KFHA 1TL3A 2AW0A 5HMZA 1EJ7L 3CDEA 3CXCR 1U4BA 1SKWA 1VQLS 4LF8F 1FNOA 2XO7A 3GV5B 2DY1A 3W5YA 3ZZOA 1TVRB 2A2DA 4KT0C 4B3SF 2HVIA 2FC8A 5CCLA 3KK3B 3C14A 4IOAQ 1IKWA 2RKIA 2Q6CA 1F5AA 1FFSB 1C1BB 1FKPB 2VFSA 1I5OB 3NBPA 1V3ZA 3HVAA 4FNHA 4G1PA 2OJ3A 5ETLA 4CO1A 2NQRA 1HHTP 4DF4A 1C0TA 1YK9A 4M5KA 5CYQB 5G2SA 2P9EA 3D3BJ 4GC6A 3O6QA 3PEHA 4ZCIA 3MZIA 1Q86T 5LL6d 1NK0A 3ZTQA 1IBMJ 5JVHQ 1WC5A 2Q6BA 2DHGA 2R7XA 1IM6A 3U02A 4NXMF 3VAKA 1XMQJ 1MMDA 1RAEB 2YWEA 3CF5Q 3TANA 1S0MA 2COLA 3PX0A 2XS7A 3PRVA 1HLWA 2HG4A 3I0SB 4I1TA 4ZS6A 2GIRA 2DGTA 1T9VA 2P6TA 4B3OA 4ANCA 3VAGA 4BDPA 4NZ7A 1SKUB 1U8SA 2PO4A 3MMAA 4IDKB 4J9VA 3GSIA 3UCGA 1S12A 2E7WA 3B8HA 3D3CJ 5IZHA 4NCGA 4DU8A 2KVQE 2BE7D 2YWWA 1Q5VA 4I2PB 1S1VB 4AD6A 2J8AA 4OZ1A 3OPKA 3SV4A 4PXCA 4U7CA 1OPIA 4ES1A 2K06A 2R8KA 4CLZA 2SXLA 3GFXA 3NXZA 5JXSA 4BBYA 4JV1A 3CSKA 3MAAA 3J7ZT 1X4DA 1EKRA 2EFNA 3BGUA 1RAJA 3I5BA 3MCNA 3PFEA 4MYTA 4CZCA 4ZVPB 3MFIA 2LYVA 3EGVA 3AODA 1KKHA 4Z7YA 3VGVA 1VQ5S 5GAHU 3DRSB 2GC8A 3TA2A 1GMWD 4A8MP 3IBFB 5D0GA 3JS9A 2ZUAA 4O3PA 5LJ5Y 3BEGB 2RUSA 2E5HA 2K8GA 3RAXA 2AGPA 1AFJA 2BANB 2LDYA 1U48A 2ROEA 2KO1A 1TUVA 3U1MA 3MD1A 2GHPA 4O23A 3UW1A 4WFNQ 1VC5A 4NXNF 3BYRA 4MAKA 5CA5A 3G6YA 2FLPA 2DNOA 4F8RA 1ULRA 2LMIA 4DN0A 4M94A 2Z2YB 1F0XA 1PKUA 1RQ0A 3LALA 4YQWA 1M5SA 4OLPA 3K5LA 2XEXA 4B08A 2DJWA 2CZVC 2OGUA 2V8GA 2Z2ZA 3T5KA 2CQ2A 4OYPA 3OSPA 1WI6A 3T6BA 3S8SA 4ZLPA 4ICLA 1F5CA 5KFIA 2VFUA 2R7OA 3J7A1 2FPHX 3DOKB 1U26A 3P45B 2OEKA 4H54A 3OTOF 4DPUA 2CJKA 1UA0A 1FXRA 1HPZB 1QAJA 3ETMA 3IWNC 3FZ2A 5DJBA 1LW0A 1TL5A 1GAOA 1RT1B 2MYFA 2G13A 2Z2LA 2H9ZA 1IBLJ 2QX0A 3GQCA 4I4BA 2ZOGA 2RVJA 4LSNA 3K59A 1G7CB 4LFAF 4WIQA 3A8IA 4K2XA 4RW7B 2PSZA 3FFIA 4RW4B 4DZDA 2WVEA 4WFAQ 4C3LA 2ZKTA 4I2QA 3OTOJ 3IS9B 4YUDA 4DV2F 1FVSA 2YVSA 4R0JA 2DISA 2EC2A 3HFKA 5D4LA 1VK3A 2HQ3A 2N4DA 4OHYA 2E5IA 2DHAA 1K9MT 2O01C 3PW0A 4J90A 4TU8A 3ZTPA 3OUYA 2WSFC 2IDLA 3OTBA 3CD5A 2AJ0A 4EO8A 2GS8A 1RTJB 2PDAA 2W7PA 3RZAA 4K4TA 4K50A 4F67A 2RE1A 2HVHA 1RP5A 2HURA 2L9DA 4FDFA 3HVTB 2MGZB 1T95A 2R2UA 2JEJA 2QMWA 3VAIA 2E5LF 1HD1A 1O5JA 5F41A 4JI5J 4KB7A 2MZJA 3C46A 4DR7F 1S72S 1F6TA 3KG4A 4I68A 1ZS6A 4F0MA 1TKZB 4B3MJ 3AB4B 3NNAA 3CJTA 1R7IA 4CCHA 2GGPB 2JZ5A 1M1KT 4C0HA 4FF1A 3GZ7A 3A8EA 2WW8A 1K0VA 4FKXA 1DARA 4Z7CA 2C2OB 3FGVA 5KFCA 4F0HA 2X7IA 3UCUP 3RW6A 4DR1J 2HNYB 5JMNA 2BABA 1KLMA 1Q5YA 2NXJA 3JQJA 2IAJB 3ZZTA 3H7HB 5B0FA 1F9HA 3KG0A 2XCPA 3PW5A 2ACMA 4JI3J 4Y0FA 2QIFA 4C6AA 3N6LA 5HMYA 3K5PA 5CD4A 1RCXB 2K3KA 2CG8A 2WSCC 1IKYB 3G6VA 5GAHI 1FFWB 2AEJA 1TKDA 1UA1A 5KFWA 4ED2A 1WNEA 1PC4A 1RWMB 1S6QA 3FNNA 4GO5X 1K73T 3CCLS 3PO5A 2GMLA 4FXVA 4F50A 4PUOA 2BZ2A 3WIVA 5EX0A 2VBYA 3CJ4A 1VGYA 1OQ6A 2EFOA 4H4KA 4WU2A 3SMZA 1PYTA 1FA0A 4CO4A 2JVRA 2DHSA 1V3SA 3DDKA 4DJBA 5HQLA 2ATLA 1HNXF 5A8KA 2HLTA 4DQSA 3BO2A 4AUKA 4HKQA 2VF3A 2OPSB 3J7YI 3EWGA 5HAOA 3CJ8A 4CLYA 1JLFB 4PG5A 4CM2A 2X3DA 4F7VA 4WWSA 3T1AA 3M1VB 1HL6A 1MMNA 3HHDA 1ZYQA 1IBLF 1HR0J 4DQIA 2E9RX 5KT3A 2AGOA 4PAAA 3M2VB 5K8MA 4DX7A 4LRDA 4MIBA 2AIRB 3PYDA 4NI2B 3VVTA 1HKAA 3WX4A 1VQ6S 3QBCA 2IVYA 1RDRA 3IG1A 2M3DA 3SYZA 3FSXA 1FJEB 1YJVA 2DR7A 3HHLA 2R8GA 1FJCA 2FVCA 3CCUS 1VHIA 2H3EB 2HRTA 2CPFA 3M8WA 1SBRA 1RT7A 1JLBB 2XMWA 4M1KA 2OTJS 4UZBA 4YR0A 1Y7PA 2FD2A 4CO5A 2ZH3A 5ETPA 3B6BA 5D0RA 3NCRA 4DU7A 2HFNA 3W5ZA 4BC9A 3KLIB 3MTKA 3UPFA 1W2BR 2MKHA 1WTFA 4IFYA 2VQFF 4ED1A 2HMIB 4Q45A 2CPJA 1UVMA 3IXQA 1PJ7A 2ZE2B 2HHPA 2Q43A 1RHKB 2VKRA 4OI2A 5E33A 2R2TA 4O3SA 3K8WA 1XERA 4UQTA 3KLHB 4QZVB 4RZRA 4UT4A 4HDGA 1Q0NA 2RDDA 2MZ1A 1TP7A 3HCXA 3EGZA 3AQOA 2WBRA 3DLKB 1KS2A 5AXLA 2IBKA 2W4CA 3DLJA 2C28A 4M5IA 2CXEA 3FCWA 1HNVB 1DTQB 3QT8A 1QUPA 4TK3A 4CYUA 4LRAA 5E2QA 3DRYA 1XJWB 3UN3A 5L39A 2DBBA 5A2QY 4LR9A 5IXUA 1DLOA 1U1OA 1WUUA 4A46A 2JNJA 3KTQA 5F3ZA 3DLEB 2POKA 4KKOA 3S01A 1FKAF 2LQ8A 3OR1B 5HN0A 4DFMA 1H74A 4DHVA 1H7WA 3TQEA 1JX4A 1SL1A 2NUHA 3N79A 4S0MA 3C6UB 3E01A 4KFBB 3QMQA 3H2VE 1XK8A 3OFGA 2FHJD 1RABB 1FRJA 2BUNA 2XLIA 1LFWA 3SI8A 2D3OR 1RAGB 5E0OA 4O3NA 4FYWB 3R7SB 1NJWA 5LMNF 5J2PA 2Y1IA 2DK2A 1L3TA 4JYAJ 1MROA 1S79A 1RWWB 4DPWA 1C0UB 4FPRA 3LP1A 3LF0A 4FP9A 4JV0A 3CUNA 2ZVIA 4DL4A 3A13A 5L1IA 1RB0A 1MU2B 2GVDA 2RB7A 3MM5A 2HHHJ 1KNZA 1KBRA 3CB4A 5F3TA 2DY9A 1R3NA 3MR5A 1RWKB 3JSBA 1E6VA 1KOOA 1HBNA 3KHLA 3UQSA 4JI1F 1T05B 2KHDA 2D3ZA 3HF5A 3JSRA 4G6VB 1NK4A 2HWHA 2XTJP 3QO9B 3Q24A 4ELUA 3R1LA 2PD1A 1S48A 2B4VA 2JSXA 3PJ9A 4LMZA 3UVJA 4ILLA 3H8YA 3QZ7A 2DCUB 1UPMB 5A8RA 3M30B 1S59A 3LA0A 2XBPA 4KBIA 4QU6A 3W64A 2NZ4A 5LXYA 5EWEA 3AFGA 3G6ES 2WAQD 4FS1A 2YKPA 2NSBA 3HHKA 2VKZG 4QWEA 2DGXA 4LF2A 5HLFA 4PQAA 4FKYA 2EBGA 4EWTA 4I6WA 2OSQA 2NQMA 3C6TB 5KFJA 2EG2A 3EVWA 2PFDA 3PV8A 3VHQA 5GAGU 3LH2S 4BS2A 1F9EB 5IT9Y 1T9TA 2GAGC 3BSCA 3WBZA 2HGNA 1RHJB 2V6AA 1SC6A 2RDIA 3NG8A 4Y28C 5LJ3Y 2VG7B 4QW9A 2ZM6F 2KXFA 2RJZA 1PG5B 2E1RA 1RTDA 2AYGA 3BDPA 4MFBB 4O0IA 2BKPA 2C2NA 2B4UA 4V19J 3OXLA 2XMUA 1U24A 5D0EA 3BJYA 4USHA 4URGA 2DR6A 3EM1A 4J9MA 5T7LB 3QFWA 1U7LA 2HFVA 1P27B 5E3CA 4X64J 2F3JA 3T1HF 2HIYA 3Q2SC 2V4JB 3I9ZA 4AQYF 3J81U 1VBZA 2QLFB 2YKQA 4WU3A 4ES3A 2LVWA 5ETQA 4DG1B 3POTB 3VGSA 5EDWA 3DOLA 4OZNA 3FBFA 1RE1B 3OVAA 3D1QA 4C11A 2UXCF 1HD0A 5LMNJ 1B70B 4Q7AA 2OPQB 4A8OA 4OX6A 4IH6A 2AJ4A 4PWDB 3JSMB 4OI3A 1WC6A 5F8IA 1RGVA 1TMMA 3DYAB 2NRSA 1LNQA 1L3VA 3G9CA 3KJVB 2V69A 2A0FB 2Q79A 1LW2A 1BQXA 5B0GA 3TI0A 4F2RA 2UXDJ 4LF7J 2UVVA 4LFBF 1SV5A 2WK4A 2FVRA 3V4IB 3N6MA 4NLXA 4ECSA 1PO6A 3QQCD 3HFZB 4IOCQ 4IRKA 3TZZA 1NDLA 2FB0A 5B0BA 1H98A 3B78A 2ZNZA 1QD1A 2M52A 4CO0A 4F4ZA 5GAEU 3NGTA 1BE4A 3GPAA 2O67A 3N5BA 4C2MA 5LMUJ 3JXOA 4ZLLA 1NKEA 3W2WA 1BQMB 3I4PA 4ZK7M 1TL7A 4K5RA 3WX8A 2DPIA 3LUYA 4K4UA 4WFXA 2J6TA 2XYPB 2MQQA 5I3UB 4N8NA 3NMRA 1RKJA 3PRBA 3PX4A 1RJJA 3UE2A 5C5JA 2LDIA 3G96A 1CC8A 2G2OA 2ZWPA 5T41A 4DL6A 4DSIA 2HHSA 3I0SA 4QWCA 2MQMA 1X4AA 1WKLA 2IRXA 3MPWA 4OZ3A 2F4VJ 3KLFA 3JSYA 2VA2A 4PXEA 1Q7LB 2BE2B 2KZZA 2ABYA 2IDEA 2MZRA 4IYQA 2HRUA 4WFZA 4QCLA 4I2PA 2DNKA 3RBZA 3MOZA 1X4CA 4CRJA 3MFHA 3TAPA 5F8MA 4CWBA 3EUNA 2AV5A 1B0TA 5GMKa 1WG5A 3MPUB 2QRRA 2C2EA 2CQ0A 1JIHA 1HQ2A 4K4SA 4R5PB 3E3XA 2HW3A 4CO2A 5HL7Q 4KYZA 4UUWA 3BF4A 2YKMA 4DV3J 2JLEA 2BJ8A 2ZM6J 4ANDA 1H6KX 2B8QA 4LF5F 2XNRA 1WHYA 5DG9A 2HHXA 2V34A 2VG6B 1FCAA 2GCFA 4EMDA 2EFGA 3A8KA 2W4PA 4KGMA 2VQEF 1KTQA 3SDEB 2JX2A 2H65B 2RH3A 5DLGA 3MF5A 4I69A 1WF2A 6FDRA 5ETSA 4RL1A 1T0TV 3Q23A 1V9OA 5ERQA 4IG0A 3P5BP 1VJWA 2F9DA 2MKCA 2CQ4A 3M8ZA 3MDFA 3U27A 1RISA 1RTIB 3IRXA 4C7QA 5IT0A 1LWCB 2OD6A 1XI8A 3EDRB 1IM4A 5E41A 2MHNA 1WC0A 3Q8PB 3TR5A 1YWXA 3I0RB 1FTRA 2QA2A 5F8NA 1VK8A 2DIVA 3TX8A 2VPYB 5KFYA 3TARA 3S7RA 5EX3A 1ICEB 3MTJA 4GC7A 1X9WA 1WG4A 3ICLA 4TK4A 3MMBA 3ZNUA 4ECTA 2O5DA 1Y5LB 2PGCA 3FSYA 2XY7A 1SJ1A 2NLWA 4OX7A 3DLBA 2CZ4A 2B8PA 2KJWA 3AOCA 1FXDA 1RWNB 1HARA 1TK8A 3CD6S 4QU7A 4QIWD 3KWMA 3F73A 4L74A 2H1YA 4RW4A 2XY5A 2MDAA 5IC4B 5AJ3J 3UD3P 1NAQA 2B7CB 3R5JB 4DPTA 1IW7D 1VOMA 4P2XA 1BC6A 1M1HA 2C2ZB 2DRBA 4U91A 5L8RC 2JOQA 3RR7A 1VHFA 3BBFA 2IA6A 1KVJA 3ELHA 2FZGB 3H98A 2AYMA 5M2RA 1K8AT 3FC9A 1LK7A 4PRFA 1WHXA 3ILOA 3HVTA 4NYZA 3A3PB 2MGZA 3KLVA 3K58A 2YNGB 1FRHA 3IAS9 3OL7A 2APOA 2GHVC 2M8HA 1Y5NB 2VBWA 2XMKA 4HR2A 2F9JA 3DGPA 3CCES 3BO4A 1TKZA 4C8ZA 1N88A 2ILZA 2WBMA 2Y1LB 3DRRB 1SKRA 1RYSA 1N54B 1GTEA 4X84A 3C19A 5L9NA 1ROFA 2JEFA 4FNIA 2W2MP 3G8SA 2WHOA 1SUQA 2G4BA 1JLCA 4DOZA 1O8BA 4DV1J 4OZ5A 1CEZA 2UUCF 1TFWA 3C66A 1LFPA 3GJTB 3GU0A 3SSSA 2HFSA 4CH0S 1R8BA 1TAQA 2M4MA 2OPRB 4ETXA 3HHEA 1F60B 2PIIA 2WZ1A 3KLEB 4ZJLA 4RU2A 4GO7X 4UOHA 3QIPB 2QL7B 3KHHA 1SL0A 1TK5A 3AY0A 4CO3A 4UTGA 1SI9A 5HBMB 1HNIB 5F8LA 3G2XA 2EG1A 1YHQS 3T1HJ 1U02A 3O1LA 4HHHA 2AX1A 5KFOA 2OIHA 1PAUB 4IH7A 1OYDA 3NGSA 4ANEA 2V9KA 2XS2A 3VALA 3H5UA 3QT6A 2LECA 4KJIA 1PJ5A 1DTTB 3A8JA 3R7NB 2W7OA 1CJUA 3KLGB 1KC8T 1XNQJ 2RIJA 3LANA 4LJMA 4P71A 5KG7A 5L1KA 4YY3J 1S9GA 2KG0A 3DC2A 5A8KB 2IJNA 2XWYA 4QBUA 2H51B 2XULA 4J9OA 1FK9A 1SH2A 2E5JA 2YNHA 5M2UA 5E5NA 1VBXA 2P5VA 2YH1A 4OIXA 4WXWA 2UXDF 2XMMA 1P1TA 3OJUA 4DZ6A 2YNIB 2ZH6A 3BH7B 3FZBA 3IR5B 4DV7J 1VQSA 3HLUA 2CNLB 2MJNA 1U1RA 3PYFA 1IR1A 5J1NA 5K14A 3I5AA 4W90B 2AU0A 1U6FA 1WOOA 2UUWA 3HHLB 2QE5A 2DNZA 1V5IB 2YXLA 1NCLA 5BR8J 3MM6A 3DRXA 4WJBA 3WZ0A 1J27A 4L3KA 4WE1B 2XC9A 3RB3A 1KD1T 1J5EJ 1N36J 2NREA 1OY9A 1RU1A 1FWLA 5GAEI 1UFLA 5DDQC 4JI0F 1F5BA 3D5MA 4WBFA 3ZZRA 4XO0A 5CXTA 1B99A 1R6YA 4J9UE 1N5YB 4PQUA 4ZVUB 1T3OA 4RW6B 1D8ZA 1WI8A 4DR6J 2R7VA 3OFHA 1X7VA 4TKTA 5K20B 3UD5A 4DSEA 1NK8A 3R6GB 1KQKA 1NDKA 2OMOA 5ERUA 5J1PA 3ONQA 4PKDB 2QLWA 3IAM9 2IFXA 2ZE2A 2FIUA 4Z37A 2LEAA 3I6PA 3EJMA 4OZ2A 3F41A 4L3NA 3D0HE 1F1BB 4NYOA 3TRGA 2PC6A 3G87A 3DLHA 3V6DA 1GNKA 3ENVA 1FJ7A 5HJYA 4DBQA 3GIKA 1Q8IA 1NEEA 3LW5C 5DDOC 3VF0B 5C25B 3MEEA 5A76A 5E3PA 2VQEJ 3IMQJ 5H9EJ 2B4PA 2CADA 2NCKL 4OLOA 4AL5A 2MTLA 2B6AB 1HQEB 1UETA 1YVFA 4EYIB 4MH8A 3QIDA 2NQKA 1HMVB 2CVIA 3LP2A 4RW8B 2VV5A 1CJTA 1REVB 1SPBP 4JV5J 1VJQA 2CA9A 4Q44A 4AQYJ 3M8QA 2X1FA 2KFYA 4K4ZA 2QSWA 4F25A 2CAJA 2UUBF 5D4NA 2RHQB 3NGUA 4M8LA 3HMJG 1NJZA 4B9LA 1SC4B 3W65A 1XMBA 2NXUA 3JTPA 5K8PA 2D1CA 5I3QA 2RUGA 2GMHA 2OO4A 2MXYA 1LWFA 2QEXS 2CIMA 4HLBA 2QA4G 2GV1A 2GVZA 1KN6A 4ZHRA 5J2PB 3MPVA 1BLUA 4I6YA 4DUTA 3KK2A 3K5OA 4WYLA 2XM3A 3V81A 2NZCA 3RJMB 3NNHA 3PIOQ 2OHDA 1WG1A 2GVDB 1GQEA 1JNRB 2BJDA 2BRLA 1KR4A 4L75A 1W7WA 2GMJA 2WB1D 1KVKA 4RKUC 1GH8A 4JV2A 1Z4UA 3DOMB 1U6BA 1CSJA 1FDDA 3F0NA 1U0SA 3QLHB 4JBCA 5KFQA 1T05A 2GO9A 2QZ8A 3KUGA 3MCOA 4HDHA 5L1JA 1FE4A 5KG3A 2NQPA 2OMLA 2DNHA 2G1HA 2K1RA 1A7GE 2M88A 2Y0SD 4Y34A 4NLQA 1UWBB 1FEHA 1NU4A 2QTWA 3GCWP 1IBCB 4O3RA 5MLCV 3G82B 4LBIA 4P2MA 4LIWA 4XDDA 5ETTA 2C3MA 2QLXA 1S97A 4U67Q 3KJFB 1NXIA 1LV5A 4WZMA 2A6MA 1EP4B 3M05A 1N48A 1RLDA 2GHWA 1FD2A 2F5GA 2LXFA 5HLFB 3PYGA 1NK9A 4GKKF 4F0KA 4ZP9A 3V6HA 2KB2A 1U1PA 3C16A 3IGVA 1X4HA 4QIVA 3BN4A 3RTVA 5DLFA 4EBDA 1RZMA 2LFVA 2F4VF 1S1XA 4PG4A 1WJ9A 2ASYA 3D6FB 3JQKA 3OL6A 1I94F 3FRZA 2HNZA 3CJKA 3FEZA 4R8UA 2QJ3A 3W9HA 2Y8YA 1FKOA 3NOGA 1D9DA 4YB6A 2NPFA 2FGCA 3GG0A 4FXWA 2DNRA 3R9LA 1WSVA 4F4KA 2FHKA 4OHZA 4LBHA 4OMFG 2HQCA 1S99A 1R0BG 3Q2TC 1QM9A 2IVMA 1NK5A 1O0PA 3TUIC 5T7LA 4ZCMA 5B7WA 1HBUB 1TTHB 1IN0A 1TV6A 1HBMA 2M2BA 5C42B 3OSNA 4JI7J 3ENQA 2B5JB 1HNZF 2HHQA 2OAUA 2HZAA 1OY8A 2W2OP 4N7TA 4K7QA 2E5LJ 2BACA 4LSLA 3DHXA 1N4LA 2YPYA 1IBKJ 1HW8A 5DS7A 2BKNA 1FWKA 2VBXA 1QUVA 5IV4A 5HROA 4WP8A 4KR0B 3OLBA 3PX6A 1VISA 2EFVA 5CCMA 4YY3F 1JLGB 2BJ9A 1PILA 4C4WA 1XEZA 2QMXA 1KQFB 2HS4A 4ZPCA 3M2UB 4MK7A 4WKYA 4RBVA 1WACA 5K8OA 5B0EA 2XYHB 4DV5F 1QAIA 4TQRA 3IRWP 3P6YC 3M9OB 4OHWA 5F8HA 1I1GA 2C42A 2FLOA 2ZWOA 4YN3B 4USMA 4IG3A 2RD5C 3PYEA 4DQQA 4B9UA 3VAJA 4ZKAA 3MUTP 4DQPA 2UVWA 2Z58B 4H4MB 2WONB 1W25A 3CMQA 5I42A 1VQ9S 2IY5B 1X4BA 1YZ6A 1NKBA 1XR6A 2HPUA 2BJ1A 1YSJA 2R7QA 3WHIA 3OHAA 1DQ9A 4QIFA 3U1NA 1CBKA 2LCWA 3D6TB 3BGOP 4ID8A 1RWXB 4DX8H 2Z8QA 2XMJA 2W24A 2DGQA 2XSJA 2ZDPA 3HZEA 4HT7A 3R6LB 4KHPJ 1HQUA 4QWAA 2J7UA 5CYJA 4FXDA 1VBYA 1IKVA 1G6BA 1S6PB 3UO0A 1WF1A 4CLFA 4CI0B 5IM0B 5DQGA 5DG7A 5CZVA 3M8PA 2VC1A 4IR9A 2YNFA 4BCAA 5G4DA 1DJ0A 4Q2LA 5IFMA 3GYXB 5DGAA 1DY3A 1FRKA 1R8AA 2XMAA 1AW0A 2PI4A 1NHKL 5J1EB 3I82A 3BS9A 4M5LA 2N3OA 4Y2IA 1H72C 4KH0B 1S0VA 4RUCA 1J5OB 4CQ1A 2NSCA 1MLAA 3W9JA 4EI2A 1X9MA 2HEKA 3GG1A 1FNMA 3I4HX 2JEIA 1NO8A 2I5JB 2XZTB 3AD9C 4NLYA 1TKTB 4A8XA 1U0HA 3CCWA 1YIJS 3KK1B 1C1CA 3I87A 4CTAB 4C97A 4R5PA 3OLAA 4IRDA 2E9ZA 5D4PA 1SQFA 3MM7B 4ECVA 1FHTA 2LEBA 2YKMB 1UVJA 2KL8A 3S1TA 3K57A 4MKAA 2ZH4A 5CYQA 1U1QA 2VODA 1UTAA 2Z57B 2AF6A 3VTIA 3MEDA 3HHLD 5KT6A 1QSLA 2VG6A 2L9WA 1ZTWA 1WOSA 3QGHA 1T94A 3M6XA 4DR6F 1YJRA 2C1EB 4DLEA 1ZA1B 3ILJA 3M8RA 1FJGJ 2KFNA 2CZ9A 2DGSA 4NLSA 1Z2LA 2J76E 3KHRA 4YDXA 5BR8F 3J7Z5 4L73A 3CCSS 4V19X 4IG0B 1B7FA 2GJIA 1SIZA 1Y4ZB 1M0SA 2HSEB 3K2YA 4U96A 3M9NB 4MK8A 2R7WA 1D8YA 1UW9A 3CC2S 4TXSA 3MMAB 4IDKA 3FBEA 1S9EA 1RAOA 1GFWB 1LWEA 5SUHA 5DDPC 1LK5A 1EETB 1X0PA 4NEZA 4K2JA 4ZVSB 2BMBA 4KHMA 1RACB 3VAFA 2AJ1A 2YY3A 3CE8A 4RWXA 2LXUA 1ACMB 4WFBQ 3ET6B 3BZQA 5J2NB 3B82A 3HULA 1VRQC 2CPIA 2ZHOA 3MMBB 4M5NA 3V4MA 5IQQA 1SC1B 3JAMU 4EBCA 2FZKB 3KHGA 1RT6B 1MWZA 3BH6B 3ISZA 2YWGA 3SQOP 4DV3F 4Q0BA 2MJUA 2BKOA 4E98A 1VRTA 4U7UK 3DN9A 4KHPF 2V2VA 3EPIA 2UVRA 1VQKS 4PZVA 1HNWJ 3M8YA 2PMHA 4OYIA 3QRPA 2WW4A 4P10A 1Q1KA 1HWKA 1DQAA 7FD1A 4NXMJ 1N36F 3KOAA 2V94A 2AYBA 2YWFA 3MM8B 2JLGA 4LQ3A 1I3OB 2RU9A 1ZAVA 3QGPA 4GVBB 2BYCA 5KFAA 3W2VA 3DI6B 4U7UD 5LSOA 5AXMA 2HHTA 2XHWA 1SXLA 4P2SA 5AXKA 3MCMA 5F9NA 2J0XA 1SJQA 3GB0A 4DPOA 3L7PA 3ENWA 4AXIA 2I8EA 5CYMA 4DS5A 3KMQA 2BRKA 4PWUA 4QWBA 4LF1A 4QWDA 4LSZB 2RT3A 1UVKA 2W9BA 3DOKA 1K47A 1RI7A 3IR7B 4PWWA 4W4MA 2ACYA 3DLGB 2I38A 3C14B 5CHCB 1A6LA 3OJSA 2DXEA 3ISNC 3KK3A 3DRRA 5LT5A 4B9TA 3ZZYA 2H4YB 4PR6A 3CJSA 3P8BB 3I96A 3L09A 2WTFA 4JI6J 3AD7C 4NMLA 1IQTA 1CQNA 1R8HA 1JKHB 2EEYA 5IQ6A 2JHEA 3JYTA 8RUCA 4M5DA 5A8WB 2ZD1A 4YFUA 2XZWA 4EBEA 2G9OA 3FUYA 1G8LA 2IMOA 3AOAA 4K8RA 3CCMS 1S6OA 1TUGB 2YH0A 3IS9A 4OZLA 2V8VA 3MUVP 4BWMA 4JV5F 3TVKA 1TL4A 2GQCA 1PBUA 1X4GA 3CJRA 3G4SS 4DQRA 2BXJA 2HK3A 2UXBF 3CW2C 4N8OA 3ZO7A 4G1IA 3QSIA 1EQMA 3DXSX 1HBOB 3IC1A 2AKWB 4P73A 4PXBA 1NMEB 3TEGA 1TKXB 1S1TA 3W66A 4WTOB 4EYHB 1SJ3P 5H9FK 5F8JA 2MQOA 3TQ1A 4NLRA 3RUBL 2C3YA 4QYZK 3PG9A 1SJ4P 3AD8C 1PYOB 4RNHA 4ZN1A 1S9GB 3KYLA 4B3SJ 4UOCA 1X5OA 2WVCA 3DM2B 3FJ2A 3GONA 1JXEA 2HQGA 2MKSA 2ASJA 1CULA 2KHCA 3KDNA 2BJEA 2M0GB 2YKNB 4U8YA 4X64F 2EWHA 2FJBB 4JI2J 3ILIA 1FX2A 1T9XA 2AJFE 3NY0A 2ZH1A 1FKPA 3NBPB 1RT5A 3TZWA 4QQBA 3HSDA 1SH3A 4ED0A 5C2CA 4N76A 1MG7A 1Z1ZA 5GVQA 5A2QU 1VQNS 2K7JA 3TA0A 3QATA 3TWZA 4LRCA 1RT2A 1U1LA 1C2PA 1GEHA 4AYBD 3FQKA 2C2RA 1N5VA 2CJQA 2VPWB 1A9NB 2MEWA 3UR3C 3OVSA 7AT1B 4UQGA 1UEKA 5HQ8A 3HDSA 4ELTA 1FEEA 4IRCA 2QC3A 3I56S 2UV8A 4B3TF 1CLFA 1ZBTA 2YX7A 1R89A 2EVZA 2CNKB 3A3NB 2DD8S 2ZH8A 3SSQA 4DV7F 2DTJA 2Y1RI 2ZZTA 4C0OC 3CULA 4GKKJ 3C2PA 2GX8A 2N7CA 1T9YA 4DUYJ 1R0AA 1URNA 5J2QA 3Q8UA 4DR7J 2R2RA 2AP6A 1HWIA 3O3LA 1JLQB 2QG9B 4ZITA 3N28A 3J7YU 1S1VA 1UAWA 3AA8A 5KFTA 1VQYA 2HZCA 4CP5A 4ILMA 1AA1B 1YBTA 4PG8A 1JLFA 2X51A 2HAIA 4Y65A 3MUMP 2DVIA 5G0RB 4F4YA 1V6HA 4LF6J 2RRBA 3MAAB 5I3PA 3MPDA 1R43A 5LSRA 2ZH5A 5AT1B 3V6DB 4TQSA 1RTDB 4NI2A 4JI1J 3CCZA 4ZVRB 2N7YA 2V68A 4OZ0A 4Y00A 1FRIA 1OSCA 3IWXA 4EFAC 4ER8A 4E0DA 2HGMA 3ZZZA 1YI2S 3ZTSA 1HQEA 2D7SA 2RQMA 3SQGB 3H4DA 4CH7A 2BANA 3LP2B 1PBAA 4DR4J 3AHPA 4UZCA 1RT7B 1JJHA 2OFGX 4RU9A 2FVSA 3R8YA 3ENAA 1AROP 3I55S 2GJFA 1CJVA 2IVFB 2AT1B 4RR5A 4U9RA 2VH7A 3QGGA 3OTDA 2IJRA 5M2PA 2DIUA 3AJ2A 3H2UB 2HQIA 6FD1A 5FLXU 2MLZA 5FLXY 1YJUA 2JJ4D 1L3SA 4TYAA 1ZAWA 1JLEA 1RA7A 1RHUB 2B0GA 2HBRB 3GCXP 3GLJA 4ALZA 2MY8A 3BN7A 5KFKA 2XY6A 2BR0A 1PGZA 1LQ9A 3QT5A 4B17A 2XGPA 3CDBA 3HP6A 1UKUA 2GIQA 4PG6A 4Q8FA 3HT0A 3QJPA 2KFZA 1NM2A 1BD6A 2QYGA 2LEPA 3J80Y 2R3VA 1K1QA 2DB1A 2G0CA 2DRDA 1KLMB 3P4UB 5KOWA 2HHHF 3OFFA 1FERA 2DO4A 5BXIA 3PRDA 3SEOA 3QLHA 1SJRA 4DR1F 4ZLJA 1B0VA 4LSNB 5HVGA 5JJBA 5HP1A 2LLZA 2BJ3A 4M5MA 3GILA 4DV6F 3HO1A 2KJVA 1X5TA 2BE9B 3FFIB 3NCQA 5KFEA 5IWAF 2MKIA 1IKYA 2ZDOA 4Y2CA 4I56A 4Y2KA 1RLCL 4HH1A 4DSKA 3O5TB 2HWTA 2A6OA 3N0VA 4X4QA 4WK3A 1D09B 2VZ9A 4JOUA 3HD2A 3OUYB 4QYRA 2MY7A 4F2SA 4Z2XA 4GKJF 9RUBA 4PUOB 4C48A 2BM0A 2IYIA 1Y11A 3Q83A 2DNQA 3C6UA 3QT7A 3EE3A 1SC3B 1YG0A 2XLJA 3LO3A 3JTOA 1IWAA 3VZIA 1YGYA 4UF4A 4CNZA 5DQIA 2W9CA 4WF9Q 1P8GA 1QY7A 5B0CA 1MROB 3OBIA 4USVA 1Q78A 1QAXA 1KWMA 3D68A 1YJ7A 2EFPA 3DNCA 3IGNA 3M1VA 3QWPA 5DDRC 2EC0A 2GGPA 1U09A 1MW7A 1O6XA 2FVQA 1T11A 4ZVFA 1D9FA 3MEGA 3WC0A 2CQ1A 3GV7B 2VICA 4J9QA 4JI4J 1H2UX 2BQ3A 3IG1B 4HEA9 2MQNA 3I9V9 4A8SA 2DGVA 2W7AA 3BREA 2VFTA 2L08A 2ZFHA 2ZITA 2OFHX 2P9GA 2K7KA 2N82B 2ZBPA 1HBUA 1TV6B 1U2CA 2IRUA 2XO6A 1M5PC 5ERRA 1CPZA 2NQUA 1S10A 5D6GA 3PVXA 2HS0A 2BA9A 4QR1A 4I7FA 5KG1A 1YJ9S 5D15A 3AOBA 1WORA 3KLIA 3BV8A 4FVMA 3BB5A 4KRWA 3MWBA 4XTTA 2VUGA 2YBVA 3IFEA 4IFYB 1FO1A 3MR2A 1KHWA 1VQPS 2L48A 5HK4A 3VZHA 2FY1A 1FWPA 4HHJA 2RU3A 3C3LA 3HK2A 1HIYA 1LEOA 2Z4PA 4DSLA 1GX5A 2Z0GA 3W62A 3M2RA 4IFVA 1X4FA 3EZOA 1ZM9A 4F3QA 1H7XA 3Q86A 5LM7E 2MB0B 2FU3A 5K8NA 1PSDA 1HNZJ 4A8WA 2CQDA 2OPSA 2P2CB 3GYNA 4TY8B 5FD1A 3VQSA 3MURP 3RBDA 2W8LA 1S9FA 2C2DA 2Y9HA 2X3GA 1AUDA 1TAUA 2MLXA 3UFCX 4ECZA 1NZAA 1B4SA 2F8MA 5D78A 1UJ5A 5I42B 2XWXA 2KDOA 4CT9A 3Q0AA 4RW9B 1UJ6A 1TUWA 1ZM3A 1WSRA 1IR0A 2RS2A 4USJC 2FVPA 1VLOA 1TL1B 2BJ7A 2VDIA 3NS7B 1DLOB 4OX9F 1EARA 2ILYA 1WEZA 1JXVA 2KT3A 1FNXH 1PC5A 4B9SA 4TK1A 4N56A 2AEMA 1S1WB 3D1HA 3FBBA 3M32B 5B08A 1ZZNA 3E2EA 1UVNA 2V4JA 1DHMA 2M8DB 4LUBA 4ID5A 2CKWA 3C15A 4LRBA 1HI8A 4DG1A 7FDRA 5D8HB 1S6PA 1UFKA 2HFUA 3OHBA 4X2BA 3CC7S 3K5MA 3L9ZA 4TLQA 1CVJA 4E2FB 2OPQA 5EN1A 4DR3J 2RF2A 3BSAA 2G2YA 2R42A 3BYPA 3E8OA 3NNCA 5D0HA 3TOQA 5GMDA 4C0BA 4LF9F 4X4UA 2HNDA 2CPZA 2NUUG 1REGX 3R5AA 4MKBA 1S76D 2F7VA 3ITHA 1SB6A 2JL9A 4GKJJ 1RA6A 2ATCB 1FXLA 2EK6A 3PXGa 5HSPA 2EBEA 2DRAA 3HSJA 2AZ3A 2J9EA 2C22A 2V8HA 2VFRA 2NYIA 4KV8B 1YKWA 1CC7A 1VCTA 3GR1A 5J2MA 1VQ7S 2DGUA 3PJWA 1DZ5A 2UXCJ 2NQVA 2MMYA 4HACA 3Q8QB 3BSNA 1GMVA 2OI2A 1HNVA 1DTQA 1URRA 1CJKA 3RAMA 4CYUB 4OHVA 3P5TL 3HSGA 3TAMA 4X66F 2ZEJA 2KYZA 1GT8A 1F9FA 1T03B 1HHSA 4F04B 3N4WA 4PG7A 4X4SA 4CLSA 3Q22A 1WU2A 1D3WA 3ZXWA 3DLEA 4ED4A 3W9IA 4C8MA 3OR1A 3MD3A 4W92B 2BV3A 1OYEA 3R2CJ 1F2HA 1JLAA 4NLPA 1XTZA 4OYZA 5I3UA 2HFZA 3MR7A 1U49A 4B9NA 1GXLA 4DS4A 2X1GA 4H4OA 2DXFA 3AXKA 4OL8A 2IMWP 1RWPB 3MPYA 2DO0A 3B4MA 4WTYA 2J0QD 3AH6A 4A8FA 3MMCA 8AT1B 1CS4A 3HFVA 4ES2A 3LOUA 4NE9C 1DQ8A 2BE2A 2ASDA 2NRPA 1C0UA 3NWRA 3BGRB 1S57A 2VG7A 4PEOA 3ZZ0A 2VPZB 1RTHA 2O3DA 5C7PA 2BW2A 4MTPA 4LR7A 3MM5B 4R0EA 4J9RA 1Y00A 3R5CA 4ZMMA 5KOXA 2GZOA 1KVIA 3CGIA 3IA0A 3V6KA 4YB1P 3WC2A 2HBZB 1XN9A 2XI2A 3AJDA 1RBAA 4WP9A 2CNOB 2AMCB 2ZBRA 1L3KA 1KOHA 2QMUB 3GFZA 3H5SA 3IM9A 3ISND 3QFHA 4ZPTR 2MKKA 1K1SA 1B7YB 4H4KC 4QW8A 4DN9A 4FYYB 5KFVA 1WDDA 2Y0BB 3UVJB 4DFKA 1ZA2B 4UOFA 1Y9OA 4YMEA 2E66A 2B4OA 2KT2A 2ZKUA 4NRTA 2WVDA 1HYSB 3PJXA 2DT9A 4NMXA 4C11B 4N5SA 3LGNA 1YBUA 1RUSA 3OTEA 2ERRA 2DKOB 4ETZA 5C2GA 3DDIA 4A47A 4LF9J 1IJEB 2R7UA 3DI6A 5KFNA 1MWQA 3LAKA 4CLWA 4LFCJ 1RAAB 2AJQA 1VS3A 5H9FJ 3ZNJ1 4XIUA 3FSIA 3A3OB 4ECUA 2DXDA 5E7OB 1IBMF 2VASA 2OUGA 4RNOA 2Q3PA 2Q1LA 2DEJA 1NJIT 4Y2MA 4TU9A 1KFDA 3CIMA 2M5YA 3JQMA 5KFLA 3ETOA 2UU9F 2ZJQQ 2VL1A 2M9KA 4RPFA 3HT3A 4DV0F 5KG4A 4M5DB 1N33J 1ZM4A 4FYXB 1NDPA 3JAMY 3K8VA 3WDOA 1H3DA 3CCTA 4NZ6A 4EGLA 2BX6A 4P6QA 5AE1A 4XPCA 1NJYA 5BYQA 1N34F 1XNQF 2VOOA 3T5HA 1P6TA 3KUHA 4UUXA 3RRKA 4RNMA 3H2LA 4X4RA 3O2IA 2EK1A 1BUXA 3DMJA 4FYVB 2VJVA 4ITSA 3EGWB 2KM8B 4X65J 1H0HB 3OW2R 2RS8A 3KLFB 4NA3A 8ATCB 1RCOB 1S1UB 2HHUA 2PA8D 4JI8J 1S1TB 3DYAA 2KG1A 1ZPWX 3D7SB 1S49A 3KJVA 1YDLA 4O44A 1JJCB 2YQ3A 4O0NA 3VCDA 4YHHJ 2CQCA 4AL6A 1S7HA 2DNLA 1AZSA 5ETKA 3D54A 2IM2A 2AZ1A 4Y2AA 1YRXA 2IC3A 3V4IA 5ERTA 2DHHA 3T6JA 4DSJA 1CULB 2B9EA 3N5FA 1ZAXA 4NWBA 2ZH9A 2H5JB 2ZH2A 1WKKA 4PABA 4RUBA 4OYBA 4RO0A 3MM9B 3MGJA 3RR8A 2XMVA 1GMUA 4C3MA 1VIOA 2RQ4A 5BYSA 4KHRA 4PCQA 3SDEA 3KLEA 5KG5A 3LP0B 1UVIA 3PW4A 2IM1A 3FEXB 4A8YA 4CM0A 4D3GA 2I0XA 2YWKA 4ZLNA 2XMTA 3H5XA 4DUZF 5HBMA 1UL3A 3AT1B 1U8WA 4KC5A 5H1SV 3FEYB 4J5OA 5ETVA 3M9MB 4B3OB 1RT4A 4CNYA 9ATCB 3G71S 4DR5F 2DH9A 2HBQB 4KGXB 4ZVTB 2NQSA 4NCGB 3BBBA 3QYYA 4YP3A 1VDHA 3F56A 3PEJA 1P9QC 1ZM2A 4ZN3A 3P96A 5D77A 3HXMA 2WRMA 1NSAA 2EI5A 3G8TA 3RB0A 4HHUA 3PDNA 4ZPVR 3RRHA 4V1Ak 3PO4A 1MNEA 2W2NP 4FS2A 2J7WA 4OV1A 3DGVA 2QL5B 4QPXA 1M5KC 1RT3A 2Z30B 5IWAJ 3NL0A 1KHVA 3A12A 5A0YB 3VAHA 2AD9A 4OV6A 1IKWB 2H48B 1QE1A 2RKIB 1C1BA 3DRSA 4IOBA 2NXEA 5KT2A 1LKZA 2D74B 1ZOTA 3M6VA 3B54A 4LQ9A 2W25A 1C0TB 1N5SA 3QWUA 3W7BA 4ECYA 5KFSA 1HWLA 1KRPA 1TU0B 3HM9A 1QVGR 1U47A 2A18A 2R4FA 1SCJB 3VV2B 2LU1A 1WELA 4QR0A 5EGYA 3Q8SB 3NP5A 4DV4J 4JI7F 1N52B 3EYZA 2RRAA 3Q8RB 1CJVB 1Y3JA 1OY6A 1N5YA 1L5UA 4PQUB 2D3UA 1YBAA 2RAQA 1XNRF 2CJXB 2HFOA 2YNGA 4O4GB 1GX6A 3GE9A 1XMOF 4IQXA 1U2RA 2CNNB 2B9XA 4RX6A 2Y1JA 1RTZA 4B3MF 1Q8BA 3MECB 4N41A 2CYYA 1JLEB 1N5TA 1VLYA 4QIEA 4HTIA 3SCJE 4ATNA 2I2YA 1LW0B 3DDNA 1N32J 3TJAA 1RT1A 4DR4F 2JH3A 3OD2A 5DGBA 2FHMA 1SUQB 3D0IE 2JWNA 2LQBA 5KFZA 1FF2A 4BLGA 3D66A 3H5YA 3CMES 4WYWA 1BWEA 3JB9k 3GP9A 2HRYA 3SZ2A 2BDPA 3T1YJ 1NKCA 2X1AA 3EVOA 3S6EA 1FESA 2DITA 2RNEA 3PTWA 3NEKA 3QRRA 2F40A 2K3IA 2C3PA 1F2GA 1U45A 1T9UA 1F3VA 5ETRA 2B6AA 2J6UA 2IBOA 3CC4S 1NB7A 4UY8T 3OXGA 5KFGA 3DRPA 1IVZA 5ETOA 2MSSA 1KONA 3UN2A 4BHQA 1G4CA 4DV2J 4DR2J 1XMQF 3W63A 4RJVA 4OYAA 2KI2A 5GAGI 2FQQB 2PEBA 1E6YA 4OQJA 3JTNA 4PYDA 1PYSB 1NDCA 1XWLA 3NAHA 4NA2A 3UWTA 3AAWB 3MCSA 3D6HB 2Z56B 3KLGA 1N0VC 4Y6IA 2JFDA 4XDCA 2FTRA 4EU0A 4YR3A 4WKRA 2VA3A 4OI0A 1KDNA 2OTLS 3VR1A 3V5RA 4JP8A 1TVRA 4DL3A 2C2MB 2BM1A 3KK2B 3ZTOA 5L9XA 3BBCA 4USKA 3CJ3A 1ZPVA 3M6WA 2DH8A 5IT4A 3KNAA 4A8QA 2LU2A 4PPDA 2V5HG 5K14B 4DCPB 4M63A 1S0OA 3PZPA 4EZ6A 1Q8KA 2YQ0A 1LXNA 3G6XA 2XS5A 2D9OA 2J9CA 3OQ2A 2XG8A 3FCHA 1WHVA 3SCKE 1KLNA 3PR4A 2YWHA 2V50A 4OJGA 2ZJPQ 5E3QA 3RRGA 1UWBA 2J9DE 4O3QA 4AE5A 5KT5A 4NXNJ 3TJ9A 2B9WA 3G82A 2A10A 3IO1A 1GXTA 3QPIA 4G65A 4AXJA 2QV6A 1AB8A 1X31C 1HNIA 2MZTA 1UPPA 3KFWX 2KXNB 1WHWA 2E9TA 1EP4A 4YHHF 2CFXA 3GTYX 1IWGA 4CIOA 3TAQA 4AFFA 2B43A 4ECXA 3BQ2A 3TX0A 5DETA 1Q16B 3QJLA 1SVDA 4EUVA 4UY85 5KG6A 3C16B 1VQ4S 1T7PA 4KGVB 1SKSA 2AWZA 4NZ0A 1SQGA 3RYLA 3M2RB 4IFVB 1UZDA 1N0UA 4ENOA 4ZVGA 1FK9B 3UD4P 4MIWA 1Q81T 3HHNB 3EICA 5L1LA 3R5BA 1SL2A 4FBTA 2I6WA 4DPYA 2DHXA 3EZUA 4DFPA 4X4VA 3MEEB 3NKYA 1HQMD 4C8LA 4IUFA 2AYEA 3IBWA 2QO3A 5CZXA 2CPHA 2IRYA 4O4RA 4QPTA 1ITPA 3TUZC 2D41A 1TL1A 3GJSB 4RW8A 1CJTB 1O51A 3EXYA 2MQLA 2HAFA 1GMWA 1NLKL 2OSRA 2UU9J 2FJAB 2KZMA 2JEGA 2E5GA 3L3CA 3GIIA 4A8KA 1HW9A 5DM6Q 2GNKA 1NHVA 3BGLA 1OO0B 1WDTA 1UVLA 2CWKA 5HROB 1S5ZA 1U1KA 2FTSA 2ZOFA 2C2KB 1NSQA 2B56A 2QT7A 4RW6A
chains in the Genus database with same CATH topology
5K9FA 4JI5F 3UDCA 2DNYA 1VI7A 1QSYA 3SFUA 3M2UA 1UMJA 3THPA 2ZHAA 4BC7A 1WEYA 5DG8A 2I9SA 1T3NA 3H4BA 1H38A 1CEZA 3DLKA 2DGOA 2XCAA 1OIAA 3NWGA 1VRUA 5ADZA 3SV3A 2XSFA 2X3LA 4Q43A 2ZBCA 3OTCA 4HTJA 1XR5A 4C9DA 3BM7A 2ZNYA 2JRSA 2K1RB 2E29A 4NL5A 4I2QB 1YJNS 2BQRA 2CQ3A 5U47A 3TAMB 3OVBA 2UZAA 3CT9A 4PXDA 1SH0A 5C24B 3MEKA 5L38A 4OJ3A 3T5LA 4ILRA 1RTJA 4KIAA 4DSFA 2YX4A 3EXCX 4WK1A 1JB0C 1DAXA 1IKVB 4FF3A 1JLAB 5F0WA 5KFXA 3GIMA 2EW9A 5CH7B 5GADU 3BQ0A 2AGPA 2AQ4A 3PW7A 2OP5A 1RYRA 3W3SA 4X65F 2L3MA 1FJGF 4DV4F 1WTBA 2LA6A 4ZP6A 1S1XB 4ZS6A 1LWFB 4NYPA 3M6UA 2BQ3A 3HKWA 2NQMA 3N9UC 1S6UA 2GW8A 3GFYA 3KG1A 4ZHRB 4DL2A 2ZUGA 3US5A 1M90T 2DR5A 3B4DA 3PFOA 2U2FA 1E6VB 3R5DA 4MYUA 1RTHB 4ZVEA 3SCLE 1BQNB 2PE8A 2FC9A 1D0EA 1SIWB 1VFJA 2FLLA 2YTCA 5I4MA 2WOMA 1N32F 2N4CA 3UR0A 1LXJA 2IAJA 4NLGA 1C1CB 3CDAA 1DBDA 5C42A 2XGQA 3O8WA 3NRBA 3SCIE 1M5OC 1M5VC 2J5AA 4Q5VA 1AFIA 4I0WA 1L3UA 2IYGA 3M30A 2N3LA 4LSLB 3U1LA 2B9YA 2JDJA 3MEDB 4OHXA 5AJ3F 1S6QB 3HPOA 2DR8A 1KFSA 5MAOA 3TNVA 3CIZA 4ELVA 3BSOA 3CWJA 4DEZA 4WXOA 4B3RF 4C98A 3THVA 1IUJA 2CPYA 3E01B 4YB5A 3CCVS 2GA7A 4NA1A 5D3GB 1TZ0A 2FJEB 3RB6A 3IWLA 3PNIA 1S9EB 4ED7A 3GFHA 3FRYA 3LP1B 4BWJA 4RBTA 4E8UA 1B0PA 3I31A 2UV8G 3PKMA 3RW7A 4L72B 3O44A 3U7JA 2RSQA 2NROA 1FE0A 4IH5A 2U1AA 1KEKA 1Z2ZA 4ZP8A 4EO6A 5LSLA 2V2KA 1Q4RA 4QR2A 1X0FA 2UVUA 4Q0BB 3TYTA 3CVKA 1VRTB 4FVCA 1JLBA 5KT4A 1HQUB 4G3IA 2J9DA 2FJVA 3OFEA 2PA3A 4KE5A 1I6JA 3FMWA 4FZVA 2F8HA 4URQU 4K4WA 3G86A 5KFRA 1UZ5A 5KTQA 4RUAA 3MM8A 2GQQA 4LF4F 2HMIA 2YNFB 4YEAA 1BY9A 4NCAA 1JLGA 3CJ0A 3DMJB 2UUTA 4DR2F 1FDAA 1B64A 2ZBIA 2MPUA 3C6TA 2J6SA 1OPZA 2C3OA 3HZGA 4ZCLA 2DNPA 4J9LA 2J0WA 1N33F 2VD3A 3VAMA 3RBEA 1GTHA 2D9PA 4LF7F 2VFVA 3KK1A 1S0NA 1Q53A 2IHR1 2OLWA 2W8KA 2LXIA 3I5CA 2WONA 1UFWA 2IC3B 1T3EA 3F44A 2C3UA 4A48A 5EUHA 4F26A 2W4DA 3BO3A 3MM9A 3T9NA 1YTYA 1VMBA 3HVWA 1K0TA 1QJHA 5JUMA 2JLFA 4K5SA 4ECWA 3CD0A 1FRLA 1TR0A 1Q8LA 5HI7A 4KFBA 4ED5A 1H2TZ 2OPPB 3ZC4A 5A6PA 4EEYA 3DLLQ 3RB4A 2OKQA 4P7TA 1D9AA 5IM0A 4K4XA 3X3UA 4YOEA 4PWDA 3FDSA 2CPDA 4JUZA 1LWEB 1C4AA 2GO8A 4KO0B 1N6QB 1MU2A 4NLDA 3HI9A 5DO2A 4X4TA 1SQEA 3BGFA 5J2NA 5E3AA 5DGAA 3ZZUA 1NH7A 1HBNB 1R27B 2I5JA 1TKTA 2E44A 2QA4S 1RT3B 2ROPA 2L9NA 2YKNA 3QO9A 4F3OA 1TFYA 4RNNA 3PKYA 2ZC3A 2ADBA 2R7RA 5LXRA 4A4JA 4X4OA 2O66A 3V2UC 1FC5A 2FJDB 3GMGA 4TN2A 1DFDA 1G3OA 3DFEA 2DPJA 1G2EA 2KYXA 1KQGB 2QSFA 1JNZB 3MHYA 2XNQA 1DURA 2J7KA 3LQVA 3MMJA 4F4XA 3CDUA 1ZH5A 3CCJS 3G8QA 1QSSA 1APSA 1N5QA 4ECQA 3MXHP 1OSDA 2HIQA 3H20A 5CQGA 2YKAA 4DL0C 5KG2A 1MSWD 3I0RA 3K0JA 2B51A 1V3RA 1MMLA 4O4GA 2W9BB 3BQ1A 2R9LA 3DLGA 1JLQA 3P49B 3UNGC 3MECA 2VOPA 3QGIA 2VG5B 4F4WA 4EZ9A 2ZJRQ 4FN5A 5FIIA 2B3TB 1Y5IB 3OL8A 4PD0A 4PD1A 3X1LB 3AQPA 4JYAF 5G0RA 4FBUA 2PT0A 1RK8A 4GMKA 4ZPWR 4DV1F 4Q8EA 2OH2A 2MSTA 3D0GE 2R7SA 1YITS 4XAKA 2R8HA 5F9LA 2CJAA 4ED8A 1FD8A 3AA9A 2RRNA 4I64A 1T8EA 2RQKA 3DRPB 4OJHA 5E3RA 1P1LA 3K7RA 2WCXA 3NS6A 4NLOA 3R1HA 4RNFA 2CQPA 4XK8C 1S77D 4OX8A 2P9CA 3A1YG 4DL7A 1HBOA 3QZ8A 4J9PA 2KVIA 4WFYA 5KFDA 5SZTA 5G2RA 1OS5A 4L6V3 1RTIA 2CJ9A 3DCAA 3IRXB 3CMAS 1LW2B 3NCPA 2V0NA 3PIPQ 4DUYF 2G1DA 3FMBA 5KFMA 3QAUA 1Y3KA 1U2FA 4NRUA 1HWUA 5FDLA 1HI0P 3I32A 4MKYA 1J5EF 2MQPA 4B02A 5CD4H 2DCLA 1HFEL 2DNGA 4KGKA 1FRXA 3LWMA 1WEXA 4FF4A 4MK9A 1RT2B 3W2WB 1BQMA 2AX0A 3CJ5A 3OR2B 3T3FA 2GFFA 1JKHA 4C3KA 1CQMA 4LT6A 2QFJA 3N01A 2CRLA 1QAYA 4URSA 4MIAA 1R8PA 2HVZA 3NMAA 4WIIA 4G1QA 2B7BB 2A1BA 4KQZA 1Q79A 1C4CA 1DTTA 4OZJA 1IKXB 2Z2MA 5ERVA 1R0AB 1VQMS 5J2QB 3L95X 3E51A 1TKXA 3CTRA 2R2SA 1RKIA 1TL3B 1X8DA 2FJWA 5AE2A 2YNHB 5EWFA 3IN5A 2X1BA 3LAMA 4OI6A 2CQGA 2FHJA 1U1NA 2CDQA 5F8GA 5DQHA 4B9VA 5T14A 2YNIA 1OQ3A 2ZH7A 2DH7A 3SSRA 2ALZA 3UDLA 3ZZPA 4DLGA 2IM0A 1W2IA 2DNMA 5AXNA 1JLCB 1U1MA 1RT5B 3M4XA 2BVZA 3D2WA 2CPXA 4MJKA 3CPWR 3MM6B 2FJXA 2AGQA 1QVFR 1S4FA 2RDJA 3MAQA 1VQ8S 1KSPA 4ECRA 4HI2A 5KFFA 3KMSA 2BBEA 1RWUA 1LWCA 1KTVA 2HWIA 1HR0F 2R8IA 1HA1A 4ZPDA 1TQLA 3TVYA 4F02A 5KT7A 3TUJC 3VQTA 1VQOS 1YRUA 1SJFA 2PI5A 4J9KA 4JI8F 1FVQA 2LQ5A 4ZPAA 1NK7A 2LQ9A 3UCZP 5B0DA 2IA0A 2KRBA 2P6SA 1VRUB 1XC9A 5A6WA 5JVGQ 5KAKA 4JI4F 2MZSA 4QJVA 4K4VA 4U6PA 2CQHA 3TVZA 5KFPA 3TO8A 3H40A 2A3JA 2M70A 3HX9A 4RWWA 4DF8A 3FQLA 1HNWF 2NR0A 1HMVA 1NK6A 3EZ5A 1DRZA 3TP2A 5B0AA 2PMZD 1T02A 3EGNA 5C24A 3SQGA 1X9SA 2LQJA 3D1OA 3M32A 3ZFVA 4U90A 4WZQA 1J2VA 4IKAA 1JJ2R 3J81Y 1MWYA 3CO9A 1X4EA 4ZPBA 2W9CB 4ICLB 3PY8A 2RF2B 3OV7A 1JMTA 1N56A 3CDWA 1XBWA 3SFGA 2DGWA 2LEBA 1IQZA 4I67A 1WF0A 2EFQA 3H59A 3PR5B 1HPZA 1X5SA 3M8SA 5AE3A 3CJ2A 3PW2A 2LA4A 2NS1B 2DR9A 4M95A 3N6NA 2IJFA 1BQNA 3HVRA 5BJRA 3NAIA 2JC0A 3ULHA 2JFKA 2WOMB 4RW7A 2OPRA 4RLEA 3KKFA 2XLKA 2NPIA 4HH0A 5IS2A 3OL9A 3DXBA 3QIPA 4YB7A 4WCEQ 5HP1B 1NKCA 2K2PA 3LPYA 2FUG9 2HGLA 4DL5A 4DFJA 5B09A 2XI3A 1T03A 3THTA 4NLVA 3M8QB 2MKJA 2M7SA 4C8KA 2PN6A 2E1MC 3OXFA 2V4RA 4LIRA 1NJXA 4TNOA 2CVEA 4ED3A 4QOTA 3CEDA 3V6JA 1ZZFA 4H4OB 3MOJB 2F1FA 4DDFA 3H25A 1UP1A 2FLNA 5D3GA 3L7OA 4I6AA 2KXHA 3TA1A 3K5NA 3QAEA 5KG0A 4J37A 4NX9A 5HO4A 2ZHBA 3V81B 3R27A 4ERDA 3P3DA 3VWSA 3GV8B 2HNYA 1FDBA 2FHOB 4HT5A 5KFBA 5LMUF 3MEGB 1JK9B 2ASLA 4OFZA 4D3HA 3C8YA 4O3OA 2O1PA 2WSEC 2OD4A 1HBMB 1QTMA 2B5JA 1BGXT 4WE1A 5DRKA 2E1CA 1LOUA 3KNGA 1UEUA 4IR1A 3LWLA 1D1UA 5F0UA 1KQSR 1Q7YT 3DHWC 2KH9A 2V9WA 1CG2A 1URNA 4P7VA 4HL9A 2W9AA 4I7FB 2HHVA 2BOPA 3MR6A 3HKZD 2H5EA 1YQHA 2VBZA 2ZZNA 4K4YA 3GWCA 2IM3A 4ZCKA 4X4NA 2KKHA 4HI1A 1FRMA 4Q2MA 4H4MA 2J0SD 3M2VA 4TY8A 2KRRA 4KV8A 5J2MB 2CG4A 2XB2D 1JWWA 1FKOB 5C25A 5DM7Q 4KPYA 5GADI 2FGOA 4F3MA 2KN4A 5HMXA 3UI3A 2V4QA 4MMOA 4RW9A 2VB6A 2PEHA 1ELOA 4N47A 1N8RT 1NRKA 2KU7A 1REVA 1FT8A 4J9NA 2EKYA 2I1RA 1ZTTA 4K0KF 1U25A 4UW2A 1UEVA 2DNNA 2GJ2A 4OJ1A 5HMWA 3NS5A 2ZVSA 3TW0A 2BQUA 1Q82T 1S1WA 1QLNA 4LVOP 1YJTA 1H2VZ 4NLTA 4NLUA 4ID5B 3NLCA 2OPPA 2ZOMA 4XPEA 1VIXA 1I6VD 4OI1A 5EWGA 1FDNA 2HS3A 3D28A 4X62F 2RMLA 3BR8A 4YR2A 4YDDB 1JJ4A 3AB2B 2E7XA 3MR3A 1OWXA 2HNDB 3KLHA 2L41A 4KO0A 1N6QA 3PM9A 4JI6F 3SXLA 2VPXB 2ADCA 3ITHB 4DWIA 4HVZA 3BR9A 5EHHA 4X4PA 4CH1A 2CQIA 3DOMA 1VC6A 4LF6F 3T1YF 2WB4A 2RILA 3MM7A 2CJBA 1WWHA 4C8YA 2ZC4A 3EPGA 2CPEA 3PHEA 2JVOA 1UJ4A 4TY9A 1ZETA 4KKOB 3MI7X 4TLRA 4USIA 4ZVHA 1TK0A 4NPOA 3CCQS 1M5HA 4NCBA 4NOHA 2YX1A 2VC0A 4IQMA 2YKOA 2HLUA 4QIGA 4KTQA 3PACA 1HI1A 3M8PB 1RT4B 5K5MA 2HYIB 3QJJA 5ITHA 3CCRS 3EX7B 1HWJA 1NH8A 1EETA 3GSDA 2NQQA 3MMCB 4RBUA 2PFFB 1X5PA 2HNZB 4JI2F 3CJKB 1J5OA 3BDEA 4R8UB 4C8OA 1XR7A 2ZZMA 2A2CA 2QYCA 3BGRA 2JC1A 4ZOSA 2VONA 2VG5A 3GIJA 4JI3F 2R7TA 3GR0A 5BYRA 4LVNP 5A0YA 4OI4A 1QE1B 4CTAA 2KM8C 4ZDNA 3RU0A 1AXQA 2ROGA 3MAHA 4R25A 4ZA1A 4C8NA 4K59A 3T19A 4CT8A 5A8RB 2LKZA 1Y0HA 4ED6A 1U1QA 2V8DA 1G8RA 1U6ZA 2KT5A 5FJ4A 3R3TA 3T5JA 2CQBA 3W2VB 1HYSA 3NGKA 2NQNA 2MZQA 3FVYA 4N77A 5CYMB 1S1UA 2FDNA 3RAQA 4LFCF 1FTCA 3NGDA 3HJFA 3DU6A 2E1AA 4DMZA 5KFUA 4O44B 4Y3CA 2QA1A 1IJFB 4HYKA 4DR3F 4B9MA 4IG3B 1R31A 2GQ2A 3T9ZA 5FDLB 4TYBA 2R8JA 4MFBA 4KSEB 1YRTA 3DU5A 2UUAF 4TU7A 1WD6A 4J9SA 2MHEA 1YJWS 4QYZJ 3JYTB 1UW4A 4IO9Q 5A8WA 2ZD1B 1RT6A 5ERSA 1IXKA 4AL7A 2XSJB 3OR2A 3LP0A 4PPZA 2EPIA 1R8CA 2HHWA 4NLWA 3POTA 2UP1A 3DOLB 4IO1A 2KTQA 4RUHA 2Q66A 1GXUA 3IR6B 1NNDA 5THWA 5D4OA 3AJ1A 4G1QB 1E6YB 3LGMA 3JSMA 4FYDA 4KAIA 3HHLC 1IKXA 5J1EA 2RQCA 1NHUA 1IBKF 1G1XA 3CD7A 4ZP7A 2F8EX 1SV5B 3DM2A 5KFHA 1TL3A 2AW0A 5HMZA 3CXCR 3CDEA 1U4BA 1SKWA 1VQLS 4LF8F 1FNOA 2XO7A 3GV5B 3ZZOA 1TVRB 2A2DA 4KT0C 4B3SF 2HVIA 2FC8A 5CCLA 3KK3B 4IOAQ 2RKIA 1IKWA 2Q6CA 1F5AA 1FKPB 1C1BB 2VFSA 3NBPA 2JEFA 4FNHA 1V3ZA 3HVAA 4G1PA 2OJ3A 4CO1A 2NQRA 1HHTP 4DF4A 1C0TA 5CYQB 5G2SA 2P9EA 4GC6A 1NK0A 3O6QA 3PEHA 4ZCIA 3MZIA 1Q86T 5LL6d 5JVHQ 2Q6BA 2DHGA 2R7XA 3U02A 4NXMF 3VAKA 1MMDA 2YWEA 3CF5Q 3TANA 1S0MA 2COLA 3PX0A 2XS7A 2HG4A 3I0SB 4I1TA 2GIRA 2DGTA 2P6TA 4B3OA 4BDPA 4NZ7A 1U8SA 2PO4A 3MMAA 4IDKB 3UCGA 5IZHA 2XCPA 2E7WA 3B8HA 4NCGA 4I2PB 1S1VB 2J8AA 4OZ1A 3OPKA 3SV4A 4PXCA 4U7CA 1OPIA 4ES1A 2R8KA 2SXLA 3GFXA 5JXSA 4BBYA 4JV1A 3CSKA 3J7ZT 1X4DA 4MYTA 2EFNA 3BGUA 1RAJA 3I5BA 3PFEA 4CZCA 3MFIA 3V6DA 1RTDA 2LYVA 1VQ5S 5GAHU 3DRSB 2GC8A 3TA2A 4A8MP 5LJ5Y 4O3PA 3RAXA 3BEGB 1AFJA 2E5HA 2K8GA 2BANB 2LDYA 1U48A 2ROEA 2KO1A 1TUVA 3U1MA 3MD1A 2GHPA 4O23A 3UW1A 4WFNQ 1VC5A 4NXNF 4MAKA 5CA5A 3G6YA 2FLPA 2DNOA 4F8RA 1ULRA 2LMIA 4DN0A 4M94A 1F0XA 1RQ0A 3LALA 4YQWA 1M5SA 4OLPA 3K5LA