5D8HB

Crystal structure of the base of the ribosomal p stalk from methanococcus jannaschii with antibiotic thiostrepton
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
207
structure length
207
Chain Sequence
b'MAPWKIEEVKTLKGLIKSKPVVAIVDMMDVPAPQLQEIRDKIRDKVKLRMSRNTLIIRALKEAAEELNNPKLAELANYVERGAAILVTDMNPFKLYKLLEENKSPAPVRGGQIAPCDIKVEKGSTGMPPGPFLGELKSVGIPAAIEKGKIAIKEDKVVVKKGEVVSPKLAAVLDRLGIKPIKVGLNILAVYEDGIIYTPDVLKVDEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title CRYSTAL STRUCTURE OF THE BASE OF THE RIBOSOMAL P STALK FROM METHANOCOCCUS JANNASCHII WITH ANTIBIOTIC THIOSTREPTON
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ribosomal protein
total genus 46
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d8hB01
3.90.105.20 Alpha Beta Alpha-Beta Complex Molybdopterin biosynthesis moea protein, domain 2 Molybdopterin biosynthesis moea protein, domain 2 5d8hB02
4V19J 3J7Z5 3JSYA 4NWBA 3J7YI 5GAHI 1ZAWA 2QA4G 1ZAXA 5GAGI 4UY85 5D8HB 1ZAVA 5D6GA 5GAEI 5GADI 3A1YG
chains in the Genus database with same CATH superfamily
2FZCB 3BREA 3KLGA 4UQTA 2AZ1A 2GJFA 2YBVA 1HBUB 2Z2ZA 3T19A 3IN5A 3C14B 5JMNA 1VQYA 3VQTA 5I3UA 2DGXA 2AJ1A 2MQMA 5DDPC 3KYLA 1RA6A 1U25A 4CT8A 4NOHA 1KQKA 2HNDA 3W63A 4Y3CA 5IFMA 3VVUA 4X2BA 1P9YA 5KFAA 4C3MA 2OFHX 3OVBA 5A8WA 3LF0A 4OHVA 2F7VA 2ZH7A 3F56A 5K8NA 2HBYB 2FDNA 4LSNB 5IT0A 4RWWA 1CJVB 3SV4A 2V4JA 1OQ3A 1NPKA 1CG2A 2HYIB 2RQCA 3ZZOA 3CJRA 4WCEQ 3F41A 4DUTA 3O2IA 3CCMS 1RTHA 4LSLA 1TMMA 4USIA 4QU7A 4C48A 4GVLA 4EZ9A 1RT5B 2JNJA 1U7LA 2WSFC 4FNHA 1U02A 2CPFA 2KRBA 1FERA 4CT9A 1Z2LA 3THTA 2V94A 3M2RA 3AD8C 3NOGA 4DQPA 1DTQA 2RS2A 2HGNA 3R6GB 4H4KA 2B7BB 2WSEC 2I8EA 3M8QA 3LP1A 1Q86T 3R1HA 3WIVA 4CWBA 1CPZA 4OYWA 3RRKA 2ZBIA 1VOMA 1ZPVA 4ZLJA 3CIZA 4FVCA 1Q0NA 2HMIB 5CAAA 1EP4B 1J5OA 4KC5A 1S0NA 2XLJA 3CMES 1MU2B 1WEXA 2QA1A 2BA9A 2WW8A 4JI2J 3HHLD 4M5DB 2EXUA 4K4YA 4FZVA 1N36J 3SFGA 2G2YA 5J2NA 2WRMA 4LFCJ 3QSYB 1R89A 1F2HA 4ZN3A 1RTDB 2H5EA 1D8YA 5K14B 2Y1LB 3PVXA 3MEEA 2B8QA 1DHMA 4U8VA 1JJCB 1NBEB 4K4SA 3HDSA 4WU3A 4J91A 4NEZA 1JQGA 1SXLA 2ZE2B 3EDQB 4O23A 3TQ1A 5KAKA 1C1CA 4CH7A 4ZVRB 3BQ1A 4O0NA 1XMQF 2HBQB 4P6QA 1MMDA 2MKHA 4JI1F 4PG5A 4KO0A 5BJRA 1V3RA 4K4XA 4HDGA 2XHWA 2RUSA 3ULHA 3HHKA 2BE9B 1C0TA 1KFDA 3KG1A 6FDRA 3M8RA 1ZS6A 1D8ZA 4EI2A 1U26A 4A8MP 4P71A 1R0AA 4MJKA 3KUHA 4C8NA 4JI3F 3GG0A 3TAMA 2FPHX 1IBMF 2GMJA 2GX8A 4OX6A 4U7UK 2EFGA 1RABB 1Q7YT 1VCTA 3PJWA 3BGOP 4X65J 2E1RA 1GTEA 1M5KC 2AEJA 1IWGA 2DGUA 1RKIA 3TP2A 2B8PA 4ZP8A 2MGZB 3RYLA 4GVBB 4ZVSB 1MWZA 2JHEA 3KG0A 1YJVA 4AL5A 2RVJA 1WC4A 3LP2B 5I4MA 2K7JA 3NS7B 3W3SA 3NLCA 4Q7AA 2DNZA 2MYFA 1KFSA 2PA3A 4H54A 4WXWA 1T7PA 3CDWA 2RRBA 3OTOF 1FNOA 3GLJA 1XERA 2MY7A 2CQBA 3L7PA 3CF5Q 1R0CB 2IMWP 1LK5A 1HQUA 2JFKA 3THVA 4PWDB 2KHCA 2JC0A 3W2VB 2WAQD 2YNHA 1GMUA 1IKXB 2ZZNA 5KFJA 5KFPA 4LVOP 2QLJB 2FYXA 4NZ0A 1GEHA 3W60A 1RLCL 4B9MA 2PDAA 3NS6A 3GIKA 2OFGX 1GXUA 2CVIA 1UW9A 3RG6A 5KFNA 1CJKB 1VGYA 3DLGA 4FXVA 3DOKB 1KNZA 4M8LA 3M9MB 4F0MA 1UZ5A 5IQ6A 3T1HJ 2PFFB 3CJTA 4YHHJ 4ZA1A 4DSKA 2FJWA 3SQOP 3E01B 2DNRA 3QPIA 3MURP 1HNIA 1C1BA 4PG6A 3MUTP 3MR2A 4JV2A 3DOMB 3M8SA 4PQUB 3FNNA 2YKNA 2ALZA 3E8OA 3MECB 4LF9F 2W2OP 2EFPA 1KDNA 4K4WA 4DG1A 2DITA 4QWEA 2D3ZA 1O5JA 3LWMA 3VR1A 1AYEA 2HNZB 5CYMA 5AE1A 4WK1A 2E5LF 3DM2A 2JX2A 4W92B 3GFXA 1UJ4A 2ZH3A 2PMZD 1ZPWX 3TZXA 3EJMA 2BRLA 4NA1A 4O4GA 1MSWD 1FESA 4DX6A 4KV8B 2KXFA 2I2YA 1K0VA 3KKFA 4CNZA 2ZNZA 3KK3A 5C2CA 5M2PA 1N34J 3R2DJ 2KT2A 1N32F 4NCGA 2IVYA 1U1RA 1H74A 2YPYA 1SUQA 3PY8A 5RUBA 1X4FA 1X0FA 2YWHA 4X64J 3PACA 3DLBA 2W25A 4WK3A 3M8WA 2E5IA 1I5OB 4USUA 2UUCF 1NCLA 2HFSA 3N6MA 2EW9A 3BGUA 2A10A 3QIPA 3G96A 1V5VA 1HR0F 5DG9A 4XPCA 4PWWA 1IJFB 2ZM6J 1UFLA 2GIFA 3US5A 1IJEB 1IBCB 5KFMA 4WFBQ 3CDEA 4QWAA 1FT8A 2HHSA 5A8KA 1I6VD 1CULA 4L73A 4FXWA 4BS2A 1REGX 1WKKA 3MTKA 4B17A 4JI7J 3CW2C 3T5KA 1SJ4P 1ZTWA 2CZ9A 1L3KA 1RHQB 4NMLA 2F4FA 2P6TA 3POTB 3UE2A 1FKOA 3PRDA 2H5JB 2A3JA 3V4IA 1N6QB 4MMOA 2V9KA 3MM7B 4QPXA 4O44B 2AHOB 4ED3A 1TL7B 2DRAA 1VQPS 4WPAA 4CLZA 1FJEB 1ZM3A 4X4RA 4KHPF 3RB3A 1S9GA 3MM5B 4DV0F 3GV7B 3AB4B 1ICEB 1U47A 3EZ5A 2ZOGA 4NA2A 3OQ2A 3EMTA 5E41A 4F0KA 1HBUA 2CQ0A 4DPWA 3DLKB 4IFYA 1SKSA 3C14A 1CS4B 2DIVA 4YUDA 2WZ1A 1SL1A 1RTIB 3OJUA 4PXCA 5HMXA 2CJXB 4FBUA 3O44A 2DXFA 2XY5A 3M1VA 5B0DA 3NL0A 2WVCA 4WFXA 5CABA 3LAKA 2H51B 1K8AT 2H1YA 4BC7A 3TARA 3KHLA 3PHEA 2RDIA 1HWJA 5FD1A 3G6YA 2M70A 1OS5A 1TKTB 3DDNA 4LSNA 4KE5A 3A13A 1CJVA 1P1TA 2E1CA 1YLXA 2Y3YA 1KD1T 4YR0A 4LF5F 4DJBA 2VG6B 4KRWA 1YITS 2WBRA 1D9AA 3NMAA 4F02A 2R8HA 2YQ1A 2X3DA 1IBLF 3HVWA 2GHWA 4ANDA 2NZ4A 4RW7B 3GILA 4M94A 2BQRA 1T9WA 2RH3A 3D1OA 1QSSA 1H38A 5J2QB 3AY0A 2VJUA 2LQJA 2MKYA 1LQ9A 3IA0A 5KG6A 3GFZA 4F4WA 1JLQB 1WNEA 2W7OA 5HANA 4XIUA 1S6OA 1YJRA 4M5GA 4DQSA 2NQQA 4R25A 1S99A 1F60B 4ZCIA 4FF2A 2HMIA 3HFKA 1KC8T 2ACMA 2MQ8A 1X4GA 1CC8A 3VZHA 4DL3A 1MU2A 1RAHB 2R3VA 3HULA 3IGVA 4M5DA 2DNOA 4RJVA 2DNGA 1SI9A 2DYAA 1P27B 4URQU 3LPEA 1Y5LB 3KHHA 3EPGA 2ZKTA 1LFWA 5HQ8A 1XN9A 4A4JA 4I6YA 3V81B 1RTDA 4FF4A 1V5IB 3H4DA 3BR8A 5K14A 3R7NB 3CO9A 1CC7A 1TK5A 5HLFB 1NH8A 2FZKB 1CJUA 1H98A 1I3OB 5IC4B 2AEMA 2CXEA 4LFBF 1UWBB 4B3RJ 4UT4A 2FJAB 1D9FA 3LQVA 3G6XA 1DQ9A 4DX5A 1T05A 5K8OA 1NHVA 1VIXA 2B7CB 4USTA 3KXDA 1SV5A 1N52B 5D6GA 2WW4A 3W2WB 2CQHA 3OR1A 4G65A 3VALA 3W62A 3W5XA 4DL2A 3BPSP 4USKA 1PG5B 2OUGA 4OJHA 5DQIA 4RW9B 4XDCA 1J5EJ 2BBEA 5A0YB 3CD5A 3H2UB 4HLBA 2LXUA 3A8IA 1BMQB 3C46A 5DDQC 4CNYA 1OYDA 2J6SA 4C8ZA 3FBFA 3ZZZA 2ZUGA 1BWVA 2DRBA 3OXGA 2UU9J 4JI0F 4LF6J 2MPUA 4EGLA 4UOGA 4GVBA 3AAWB 1J2VA 1Y3KA 5KFGA 3UNGC 1KN6A 2EBEA 4AL6A 1FD2A 6AT1B 1X4EA 3IG1B 3R97A 3LO3A 4QIVA 4UY85 3FSXA 1WDDA 2HRUA 4JI8F 4NRTA 1FRMA 3HFVA 3K8WA 1LWXA 1TL1A 4JYAF 1WKLA 4Q44A 3ADAC 3M9OB 2VF3A 3WQPA 3MEGB 4WWSA 4F3QA 3JYTA 3RB6A 1IKXA 4N47A 1EB0A 3AJDA 4DR3F 1FRXA 3FCWA 3HVTB 3HM9A 1FNMA 3FRZA 1TVRA 4B9SA 4DR7F 4NPOA 4NXNF 5LOQA 1XNQF 1Q1KA 4C8MA 9ATCB 1VQ9S 2QZ8A 5FDLB 2YWGA 4KYZA 5A2QY 2OHDA 2HHVA 3ILOA 3MUMP 3VVTA 1ROFA 4YB6A 2VOOA 1LW2A 2VPWB 4QWBA 1XNRF 1YI2S 2R7OA 3E01A 4RW4B 4DXLA 2EC0A 2OKQA 5HK4A 3KLFB 4MYTA 2HLTA 2E5HA 3UDVA 1TK8A 4DV2F 4M5IA 2BW2A 2ZWOA 4KH0B 3J7YI 2ZH2A 2RU9A 3ITHA 2B0GA 2Q6CA 3GR0A 3JTNA 5C24A 2JSXA 2QMUB 2Q1LA 1TKDA 2ATCB 3DRYA 3M7VA 2IA6A 3HK2A 2XS7A 2CDQA 2LFVA 2G0JA 3I0SB 1RT3B 1KQFB 2YH1A 1G1XA 1N5TA 4OHZA 2QMXA 1NSQA 4UY8T 1F6TA 2ZHBA 1WOSA 1JLAA 5F8MA 3OTCA 1DQAA 4C8KA 1VQ6S 4C0HA 3KK1B 1Y9OA 1QE1A 3HT0A 4WJBA 3JSBA 4CO2A 3GQCA 1K47A 3W61A 3QLHB 3KOAA 2QT7A 1RT4B 1LV5A 4R0JA 1SL0A 1S9FA 1V6HA 4LF1A 3OFHA 1CJTA 3QQCD 1RBLA 4DS5A 4F2RA 2WBMA 2C2KB 3BS9A 3ISZA 4FYWB 2AMCB 5HVHA 3X1LB 4KFBB 2YNIB 4F67A 3GR1A 3GJTB 3F0NA 3M4XA 4B02A 2QIFA 4BHQA 1RT7B 2XYGB 2OPQB 2LQ5A 1HI0P 4QBUA 3GYGA 3ZO7A 1HD0A 2RRNA 2XZDB 2R7VA 4P74A 5D4LA 1TV6B 3VAFA 2M3DA 2KO1A 3J7A1 4X62J 4DR1F 3R27A 3QZ8A 4E0DA 4OHXA 1VDHA 1S6QB 4U6PA 3DC2A 1BLUA 4CLTA 3GB0A 1WC0A 3NEKA 3QGGA 1UWAA 4W98A 1WU2A 1FRKA 3OLAA 3Q8VA 3C6TB 2PC6A 3PYGA 3I31A 1QTMA 1N6QA 3JSRA 2XI3A 2B6AA 3WX4A 4GKJF 1U8SA 2VBYA 2WOMA 2CPJA 1VQSA 2QLWA 1HWIA 2D3OR 2NUHA 2IAJB 3MAAB 2VQEJ 2J9CA 4F50A 5JVGQ 5DQGA 2BEFA 3BN7A 2XLKA 2GHPA 3NMRA 3D7SB 3DLKA 1RBAA 4J9MA 2FU3A 2NYIA 2D9OA 3VGVA 5B0BA 3FEYB 5CD4A 1WUUA 3IR5B 2WB1D 1KKHA 4K4UA 3CVKA 4A8SA 1C0UB 3P96A 2YKMB 2EC2A 4ANEA 3KUEA 3VAGA 5KG5A 5CZVA 2R7QA 4P7VA 3DMJB 1VK3A 2WONA 1SH0A 1PAEX 1HQEB 1F9EB 3A12A 2C2EA 2Y0SD 1UZDA 4EO8A 1FDDA 1L3UA 1HNXJ 2ZEJA 2BOPA 2K7KA 2AGOA 1QVGR 1XI8A 2VA2A 1Y11A 2CDRB 2K8GA 5LJ5Y 5B0CA 1KQSR 2LA6A 4PD0A 1JK9B 1FVQA 3G8TA 4RW7A 5G0RA 3HD2A 1J27A 2WHOA 3OFGA 3PW7A 2QEXS 4NLTA 1ITPA 1UP1A 2BJ9A 2AWZA 4ZPCA 4IG3B 1M5VC 1X4DA 4ECRA 4JBCA 3RR7A 1EIYB 1S1WB 2FVSA 3PX0A 2AJ2A 3J7AN 1S1XB 2ROEA 3IAM9 5I3PA 4R8UB 2CG4A 2LECA 4J9OA 2A18A 4E2FB 4DQQA 4K50A 4K2JA 1TKXA 2MKCA 2KFNA 2DNLA 2RSQA 2HQIA 1RT2A 4ELUA 3OT9A 1FX4A 1QAIA 1N8RT 3NRBA 4ZOSA 2XNQA 4RWXA 4WFNQ 4ECVA 1YBAA 4DUZF 3QT6A 2AW0A 2Z8QA 2BJ3A 4NCAA 1SKRA 2W4DA 5HQLA 2HBZB 2HQCA 3BF4A 2ADBA 5GADI 1QJHA 2V8GA 3T5HA 2YWEA 1UEVA 1V3SA 1FJCA 4QIGA 3LPYA 2R9LA 4L72B 3M9NB 3N9UC 1NJIT 3IM9A 5HVGA 2WVBA 5AXKA 1S1UA 2F4VF 2GV1A 1UWBA 2GGPB 4RU9A 3DDIA 3PTWA 4MK7A 2F65A 3MF5A 4YP3A 3M32B 4I67A 1FDNA 3OVAA 2ZZMA 4HHJA 1V3ZA 1AZSA 3HHLB 3W2WA 4WZMA 1HQ2A 4FPRA 4IOCQ 2UXBF 3A8KA 1S6PB 4QPTA 1D0EA 3L7UA 1YZ6A 3P45B 2XWXA 3D68A 3EE3A 1M5HA 2OMOA 4WFZA 2FD2A 4DL5A 1Y10A 4NZ6A 4OL8A 4JI6J 4DL0C 3S1TA 1N48A 1RCOB 1MLAA 2K3KA 4NLRA 2KT5A 1S9EB 5HBMB 2W8KA 2DHGA 2CZVC 2ZD1B 4NLOA 3MMBA 4U95A 5HO4A 5A8RB 1RK8A 3OPKA 3PX6A 3NGUA 2LCWA 3GMGA 1X5OA 3AOBA 1RAOA 3I87A 1U8WA 3J81U 4HTIA 2NRPA 1RCXB 1H0HB 2IM3A 2XMTA 3BQ0A 1MNEA 2C2DA 4OV1A 1HNWJ 2DKOB 4Q5VA 1MN7A 4OI6A 4IRKA 2HPUA 5IZHA 1IN0A 3SCJE 5J1NA 4ZITA 3QATA 3Q0AA 3OSPA 4ILRA 1FKPB 1JLBB 5LXRA 2OLWA 4ERDA 2XGQA 2MMYA 3AQOA 5FLXU 1PIEA 3FRYA 3CNQP 4P10A 2V4RA 3T9NA 1Y5NB 1B0TA 1S48A 2CG8A 3H4BA 1NPRA 4FYVB 3OLBA 4B3TF 5FDLA 2ZJPQ 3CUNA 4X4UA 3UN2A 4DV6F 4GKKJ 2RNEA 3SYZA 5E3AA 2RF2B 1FC5A 4LF4J 2FHJD 3CCTA 1Z1ZA 3CJKB 1GT8A 4MKAA 2M5YA 1NZ8A 3H5UA 3DOLA 3P5TL 5MAOA 1U4BA 2B9EA 4S0MA 1VC6A 2CADA 2RT3A 1HBMA 1RT6A 2UZAA 1UJ5A 1S1TA 2L3MA 4CTAB 3T6BA 5HSPA 5ETVA 3RR8A 4PRFA 1HNVB 2FQQB 3LUYA 3QRRA 3HHLC 1HNZF 3R5JB 1S59A 1XQIA 2CPZA 3Q8QB 1BE4A 4BLGA 4C97A 2B9YA 3EXYA 1T94A 5IV3A 1RT3A 2XG8A 1IQZA 1R6YA 3KMQA 2NROA 4TN2A 2WVFA 3FDSA 3NNAA 2L41A 1TUVA 4F0HA 5HROB 2J76E 1LEOA 2DCLA 1FJGJ 2RQKA 4RUAA 4RNHA 2BACA 3W5YA 3R7SB 1S1VB 2MKIA 3ICLA 1UKUA 4W90B 2VC1A 3HSDA 2QX0A 1R7IA 3WC2A 2J9DA 3OBIA 1VQNS 3GSIA 4NYZA 3J81j 5KFTA 4Q2MA 3PKMA 3BH6B 1OMSA 1HPZB 4WBFA 3CJQA 3K5PA 2F8EX 4IOBA 2UUTA 2MJNA 3K2YA 2YNIA 3TO8A 3DXSX 1BGXT 4LRBA 4EBCA 3M2VA 5KG7A 3VQSA 1RT7A 2OPQA 3IR7B 1QAXA 1R8BA 4B3OB 3DRPB 5IT9U 3IXQA 1E6YB 2BE2B 3WZ0A 1KS2A 4PUOB 3DYAB 3C16B 4B3SF 5CH7B 3S7RA 2KRRA 3BEGB 5IM0B 5F8HA 4PG4A 5IWAF 3QO9A 1RWUA 2L48A 3HJVA 3VWSA 1NHUA 1IKYA 1S12A 1WI6A 2XI2A 1IWAA 4ZVQB 3UW1A 3C6TA 4DV5J 2KKHA 2XMKA 4C6AA 1WOPA 1XIQA 1TAQA 1FFWB 2XBPA 3Q8RB 3I6PA 4OQJA 2C3YA 4YEAA 1VQMS 2MQOA 4F4KA 4HYKA 3PCOB 1JJHA 4JV1A 3OV7A 4QR1A 1N36F 4EYHB 4IUFA 3MAAA 3DLLQ 4LFCF 3KJVA 3CC4S 3V6DB 1UA1A 2NXCA 1W2BR 2HVDA 4J9NA 3PFEA 4EMDA 5L38A 1WKJA 1WDTA 2HLUA 2CPIA 2LU1A 2RQMA 2IMOA 3H0PA 3MFIA 2GAGC 1S79A 5AJ3J 4BCAA 4J9PA 1VC0A 1RWKB 3CULA 3I96A 2DR6A 1IQTA 3UN5A 4IDKA 1L3TA 3W7BA 1M5SA 2IA0A 4CH0S 1C0UA 2EKYA 1BXNA 4ID5B 3IR6B 4RBUA 3T5LA 2V8HA 2HHTA 2GVZB 3ZZPA 5D3GB 4RW8B 2CPEA 4WZQA 4JV0A 4UOHA 2R8JA 3EWGA 1JXEA 2ZDPA 1HL6A 2XSFA 4O3RA 5C42B 2BJ1A 3KTQA 4KHMA 3DLEB 4B9VA 1F5AA 2I5JB 1NK9A 3IC1A 2OD6A 3RBXA 2J8SA 2DB1A 5BYRA 2FC9A 3Q86A 1KVIA 3SI8A 1WHYA 4NCBA 1RYSA 1UFKA 1TU0B 1AFJA 3UVJA 1S1WA 2EBGA 1S1XA 3LOUA 2V2KA 1WWHA 3LA0A 3N4WA 1Z4UA 4R8UA 2DGVA 1ULRA 1JLGB 4CLFA 2DRDA 1LWCB 2AGPA 1SQFA 4ECTA 1OY8A 4BWMA 4PXEA 2YKOA 3KLVA 3ENVA 5IT4A 1YJWS 2BM1A 1SVDA 2XO6A 3DLHA 3UDLA 2G13A 1LWFA 1G3OA 1HHTP 4RBTA 3D54A 2AYMA 4DR2J 1NSKL 1WHXA 2YNFA 4U67Q 3AJ2A 5LM7E 3N6LA 5L46A 1RTZA 2UV8A 4HACA 2FLNA 3M6VA 2X51A 2XMJA 4K4ZA 3DHWC 1T95A 5K9FA 1NK6A 2C42A 1RTJB 2IHR1 2GW8A 4GO5X 2IVMA 4IG0A 2CJ9A 1DY3A 4QYZK 3T1HF 1OO0B 5EN1A 2APOA 1S4EA 3HVAA 4RKUC 2R42A 3QRPA 2XSJB 2G0IA 1REVA 2HHHJ 1PKUA 4CH1A 1HBNA 2DNMA 2Q79A 3CD6S 4G3IA 4MIBA 2ZHAA 4HKQA 4K4VA 4WP3A 4Z2XA 3D1HA 2QGFB 3OHAA 2NQRA 5ETOA 1SCJB 1PCAA 3K7RA 1UVNA 4DDFA 4DU7A 5LSRA 1NPPA 3ENWA 2J6UA 3FZ2A 5GAGI 1XMBA 2P9GA 4YB5A 5HN0A 5A76A 2QRRA 4OYOA 5GAHU 3M05A 2MZ1A 2W4PA 5IQQA 4PPDA 4LJMA 1TELA 1HBOA 1LK7A 2IJRA 5FLXY 1NJZA 4WYWA 1WSVA 1NK7A 4TLQA 3MPWA 1N34F 2JDJA 1X5TA 2DNYA 3VGTA 2XLIA 2X1FA 4P2XA 2CWKA 2P5VA 4OIXA 2OD4A 2HWIA 4J37A 3W66A 3OW2R 1OIAA 4X64F 1F5BA 1RWXB 4FYYB 4NEYA 2E9ZA 4I2PB 2W9CA 4ECUA 2MEWA 3CIMA 3OD2A 1N0UA 5L9XA 3MM8B 2ZH5A 1XMQJ 3IWNC 3DKDA 2J7UA 2B4UA 3P4UB 1B99A 1HFEL 2ZM6F 2QLXA 1VK8A 1VRUA 1ZBTA 2Q6BA 3AA9A 3JS9A 1FHTA 2CPYA 1HMVA 2ZFHA 2O5DA 1MMNA 1RYRA 4IFVB 3BB5A 4LQ9A 3D0GE 2C3UA 5GAEU 1IBMJ 2JZ5A 1U45A 2VG5A 3MM9B 4JI7F 2C2RA 4P72A 1RWPB 3RB4A 4A48A 2M88A 2ZZTA 5F9NA 2EK1A 1NK4A 3FBEA 2Z56B 2KDOA 1Y7PA 2VOPA 4Y00A 2MJUA 2H4YB 3B8HA 4OHWA 1NU4A 4RUCA 4NI2A 4FS2A 5C5JA 1YG0A 1HNVA 2LQ9A 1LWEB 4OX8A 2VB6A 5B7WA 4ZLNA 2CQ4A 3PZPA 3H25A 2HRTA 2DNNA 3M30A 2MHNA 2BXJA 1NMEB 4ES1A 2EI5A 4J9QA 1WACA 5J1EB 3BYPA 5M2RA 4X66J 3K0JA 2YVSA 1RP5A 3VZIA 5KFBA 2CNLB 5IT9Y 4I64A 1S5ZA 2R7RA 3D0HE 4ES2A 4HT5A 3HVRA 2WB4A 4PZVA 5DRKA 1GAOA 4O3PA 4L76A 4ZVGA 2J0XA 4U7CA 3IBCB 3R2CJ 1HW9A 3PDNA 1X31C 4ENOA 2W2PP 1LFPA 2UVWA 2XMUA 2I9SA 2Q43A 1KTQA 3PRVA 3FQKA 4LVNP 2A2CA 2XZTB 3BGRB 2Z4PA 3MPUB 2XTJP 4LF2A 4AFFA 1KLMB 4UF4A 3UR3C 3OTDA 2W1BA 3RAXA 1BD6A 1DLOB 5GMDA 1WEYA 1I94J 2BQ3A 2NXEA 1RWVB 5E7OB 3C16A 3EGZA 5KFEA 2QYGA 3PJ9A 1RBOB 4WP9A 2AJ4A 1XEZA 2BZ2A 4FKYA 3QNWB 5IM0A 4QR0A 2M8DB 3MAHA 4PQAA 3BZQA 2NREA 5HP1B 5DZ6A 5T14A 2E5LJ 2E7XA 1VC5A 2DPJA 4RL1A 2R8GA 1D09B 2BANA 3SCKE 4F3OA 3IMQJ 2QE5A 4M63A 1Q78A 1PC4A 4N41A 2DR5A 1RJJA 4AQYJ 3KK2B 1WC1A 3AB2B 3GPAA 3DN9A 5A6WA 4DZDA 3C8YA 2D41A 4HT7A 4I56A 2ZDOA 4DEZA 1DTTA 3C15A 2AJ0A 4LFAJ 1CQNA 2ZJRQ 4UTGA 3N01A 3G82A 2R8IA 3N0VA 1XBWA 1NLKL 3TQEA 2Y1IA 2UUCJ 5ETKA 4KKOA 1MROB 4DLEA 2VPXB 3KLIB 3VTIA 2XM3A 1R8HA 4GRSA 3B6BA 4B3RF 3M8PB 2E5JA 2FJBB 4Q0BB 1SQEA 8AT1B 2JOQA 3LWLA 1VBXA 3K89A 4CO3A 1TP7A 1RXOB 4J9LA 4RNOA 3HHDA 2OEKA 1A7GE 3R5AA 2QO3A 1PC5A 2VD3A 3RBEA 2GVZA 4DPXA 3C6UA 2PEBA 3SV3A 1JXLA 2DNPA 3V6KA 1TAUA 5SZTA 1S7IA 2NQSA 2PFDA 1VS3A 1NNDA 4OI0A 4XDDA 4G1QB 7AT1B 2CQGA 2V6AA 3TEHB 3DLEA 4NLGA 1JLFA 2YPZA 3FUYA 2ERRA 2C2MB 1J5EF 3BKTA 3M6WA 4NMXA 5D4OA 2IRXA 4ZVEA 2RKIB 3KWMA 4RW6B 4XO0A 4MIAA 4EZ6A 3IFEA 4X4NA 1BQNA 4DV0J 1ZYQA 1VBKA 1NDLA 1ZA2B 3O3LA 2E7VA 3LGMA 2JLGA 5H9FK 4ZJQA 2BE7D 4BWJA 2LP4A 2JVRA 4FS1A 1S7HA 2BM0A 2FHKA 2O1PA 1PYSB 3PR4A 5KOWA 4EBEA 3HI9A 2FJDB 3FKBA 3VF0B 2BW7A 1C4CA 1X0PA 3EGNA 3PW0A 3HJFA 4OYZA 1ZM4A 4USJC 1FFSB 1XMOJ 1S72S 2GA7A 1RT1B 3QZ7A 1OSCA 3K5MA 4PG7A 3W64A 3MEDA 1WD6A 1Y3JA 4HH0A 3RBDA 1B4SA 1HI1A 1KTVA 3IS9B 3OFEA 3I32A 1ELOA 4DR6J 3FBCA 4ATNA 2JVOA 3TEGA 1U2RA 7FDRA 2HVZA 2XEXA 4QW8A 4TK3A 2VPZB 3BGFA 3O5TB 1JLEB 4TY8B 2YY3A 3FC9A 4USWA 2CYYA 2VG7B 2CPXA 4FYDA 1QTNB 1ZAVA 1JNZB 2QYCA 2BJDA 3T1AA 5T7LB 1QM9A 2XSJA 3AXKA 1JKHA 2F8MA 3GIMA 3G6ES 1K9MT 3QBCA 1NB2A 4IH7A 3O8WA 5DJBA 2GQCA 1BQMB 2FVRA 3KDOA 1RHJB 4NYOA 1YVFA 4ZVPB 4DV1F 3NBPB 4JI5J 2SXLA 3GYXB 4LT6A 1LW0A 1IKVA 2FVQA 3IM8A 4C8YA 2AYBA 2NRSA 4ES3A 4KGMA 2HKEA 2KVIA 3W9JA 5KFXA 2PEHA 2E29A 3A3NB 2LYVA 3ZZUA 1JLCB 4P2MA 3MXHP 4OLOA 3I5BA 3MUVP 4MAKA 4V19J 3MMCA 4NLQA 3LW5C 2HHQA 4C3KA 2B5JB 4ITSA 4RUHA 5D0GA 3MHYA 2W8LA 5LSOA 1RACB 3SIPB 3F44A 1U6BA 1EKRA 2ZWPA 1DAXA 3PYEA 3IRXA 1YJNS 2UXCJ 1SB6A 2VONA 1N5QA 1FDAA 2OPSB 2ATLA 3ISNC 2NQNA 3NGSA 3IGNA 2QL7B 4LFBJ 2AJFE 3P49B 5DG8A 3RUBL 2AX1A 1MW7A 4ZJOA 4DLGA 2A6OA 1VRQC 1Y0HA 3K5OA 1WTBA 3L09A 1CBKA 4QCLA 3BO3A 1HWLA 3H2VE 2E9RX 5SUHA 2L9WA 2LLZA 1KOHA 4IR9A 2J9DE 4I2PA 5KFCA 4YN3B 5D0RA 2LU2A 2L08A 2BDPA 5EHHA 3NY0A 1DARA 3DI6B 4K59A 4B9LA 4PAAA 2DGQA 1VQLS 1O8BA 3FGVA 1EHWA 3NAIA 3D6FB 4WKYA 5F0UA 3KHGA 4O3SA 5H1SV 3QAEA 4ZHRB 4X62F 1T3OA 1V9OA 2PN6A 3ILLA 4PEOA 1S0VA 4OZ3A 2X3GA 3CE8A 4Z7CA 3I0RB 2DO4A 5D78A 2OSQA 5E3RA 5KG3A 3AFGA 4DN9A 3CCVS 1VRTB 5ETPA 3B82A 4RU2A 5ERQA 1A6LA 3KLEA 2BKPA 3EVOA 3SDEA 4H4MB 3L9ZA 4ZMMA 4P2FA 1RAFB 3I4PA 1RU1A 3MD1A 1TZ0A 1WF1A 3MFHA 1B7FA 5GVQA 2F8HA 4TU8A 2W9BB 3OVSA 1B7YB 3TJAA 3BH7B 2AYEA 1VQKS 1JMTA 4TYBA 2VQEF 3JTOA 2MQLA 3MMJA 3VAKA 1X9MA 2KU7A 5B0EA 2KH9A 5AXMA 4QYRA 2PO4A 4USHA 3M2UA 2UVVA 3DRRB 3FZBA 1Q8KA 4Y2IA 5MLCV 4ZPDA 1F0XA 2MLZA 2KJVA 3GV5B 2FJXA 3ENAA 3DXBA 5KFQA 1X9SA 1UEKA 2VDIA 5J2MB 5LXYA 2OIHA 2EK6A 3D0IE 4AYBD 3GONA 4DPYA 1D9DA 1RB0A 3H5SA 5DLGA 1RKJA 4DR7J 2OI2A 4NLPA 2RJZA 2OPPA 3IO1A 5EX0A 1IBKJ 3QMQA 1B3TA 2OP5A 2WVEA 4KJIA 1PJ6A 1H3DA 4P75A 3UD3P 4YB1P 5ETRA 1XR6A 3DU5A 1HNXF 1P9QC 2DHSA 2V8VA 3MOJB 3NAHA 4DMZA 1FEEA 5H9EK 4PYAA 2Z30B 4KTQA 3JB9k 3MCSA 1UPPA 2ZJQQ 3RU0A 1CVJA 1YHQS 2AU0A 2YNGA 1DLOA 5F8IA 3JSMB 1HW8A 1S0MA 4N5SA 1PSDA 2UUAJ 3OJSA 4NX9A 1SC6A 4KSEB 3PX4A 3B54A 4OYIA 4ZK7M 3MCOA 3ENQA 1Y4ZB 4LRCA 1G2EA 2IBKA 3LGNA 4Y28C 2CUYA 3KLGB 5CQGA 3WDOA 2ZBQA 4AXIA 1IXKA 2UXDJ 4K7QA 4TYAA 4E98A 5I3UB 1WC3A 5CCMA 3W8PA 1S6UA 1YKWA 3KLHA 4NLDA 1NSAA 4F4AA 4QZVB 1WHWA 2EFNA 4LR7A 3WX8A 2HNDB 1E6VA 3C66A 4U90A 2DEJA 3OUYA 3G8QA 3JXOA 3RW6A 5A6PA 2BJ7A 2NQMA 2EWHA 2FHOB 3TUPA 3W65A 3P3DA 1IR2A 3BSCA 3HSZA 2FGOA 4CIOA 1SIWB 1HYSB 1EAYC 2LKZA 1PAUB 1AB8A 1XWLA 4ECXA 1OJ4A 4N8NA 3ILJA 2E5GA 1NAQA 2VFSA 4DF8A 2C22A 1RTHB 4LSLB 4C2MA 3HF5A 1VLYA 2NS1B 4MTPA 4DR1J 3M2RB 4HVZA 1S49A 2Z58B 1VLOA 1DTQB 1TUWA 2OO4A 4HHUA 4NWBA 4CYUA 3K5NA 4MFBA 5KOXA 3FFIA 3CC2S 3NWGA 3BBCA 2XO7A 4ECQA 1NK5A 3M8QB 4NE9C 1VISA 4F04B 1Q4RA 5ETQA 3L3CA 5CZXA 4LF8F 1IR1A 2R2SA 4CQ1A 3SFUA 4PXBA 4JI6F 3DRSA 1NK0A 4LUBA 1RQ0A 4KBIA 3GIJA 1OSDA 2G2OA 3BSOA 1J5OB 1RAAB 3CMAS 3HX9A 3TVKA 3G2XA 4KGVB 3BPDA 2N4DA 4P52A 4PYDA 3NS5A 1P6TA 3NGRA 3FBBA 3LALA 2D9PA 2HNYB 5J2NB 4F4XA 1K73T 2B4OA 4WTYA 1XJWB 5ETLA 1FA0A 5C25A 4WE1B 2H65B 3MM6A 3MEEB 4U9RA 3Q2SC 3V5RA 1FJ7A 1T9TA 4AUKA 4NLUA 5K5MA 3AQPA 2HFOA 4L3KA 1TR0A 4DUYF 2A6MA 4N77A 4YDDB 3EZOA 3K59A 2KM8B 5AT1B 2IFXA 1HNWF 1RWWB 1KRPA 3TOQA 4QR2A 4M5MA 1G8LA 1FF2A 1VFJA 1SBRA 1C1CB 4I1TA 4KR0B 3N6NA 2G2ZA 3C19A 4B3MF 1YJTA 1SH2A 3CJ0A 1YZ7A 1Q95G 3IS9A 1PO6A 2OELA 4KO0B 3F73A 3FVYA 1C0TB 5KG1A 1X4CA 2KJWA 4ZP6A 3X3UA 4J90A 1O6XA 1Q8BA 1R0AB 2BABA 2B9XA 4TY8A 4J5OA 3I82A 3G87A 4OZJA 2W4CA 4NLSA 3TAMB 3B78A 3HZGA 2VFVA 4GKKF 5JXSA 5L1LA 3TZZA 4MKYA 1ZETA 1WSRA 5KFIA 3DU6A 1NKEA 4J7CA 4DV4J 3M8ZA 3EVMA 2VJVA 4ED7A 5F0WA 4QW9A 2J8AA 1TL5A 3H90A 3UNYA 3ZC4A 1TQLA 1RT5A 4I0WA 1GMWA 3DCAA 3EUNA 5EWFA 1WG1A 1KVKA 1M5PC 2IRYA 3NNHA 1UZHA 4NASA 2YKQA 1UCNA 2PI4A 4AXJA 2CPDA 5G2RA 4DHVA 4V19X 2OMLA 1M1KT 3GJRB 3S8SA 1HQUB 2G1DA 3GYNA 4FF3A 4H4OB 2YNHB 2B5JA 3LANA 1EP4A 3KMSA 2YQ0A 2NLWA 2ZVIA 2W9AA 2NSCA 2YTCA 5D4NA 4PXDA 4KAIA 3D3CJ 2CIMA 3TVYA 3EGVA 3CTRA 3PEJA 5DS7A 4EYIB 1NKBA 2G1HA 2I1RA 2XY7A 1PJ5A 5LMUF 5EWEA 4NLWA 4RNFA 3HMJG 3DLGB 3K17A 4F36A 2GJ2A 4O0IA 3J7YU 1YQHA 3RB0A 3MPVA 2GJIA 1TKZB 1GK8A 3JQKA 3W8GA 3Q8SB 2DO0A 2HIYA 5KFHA 1NO8A 4LF7F 1AUDA 1R6VA 2KM8C 2ZE2A 1FRHA 3A8EA 4WKRA 3JQMA 1SKUB 1HNIB 3AD7C 1C1BB 3B4DA 3L95X 1W2IA 3QFHA 3HT3A 1GH8A 2YKNB 2JEJA 2ZHOA 1BC6A 4QWDA 4W4MA 1I6JA 1F9FA 4DCJB 3WIUA 5BR8F 2RU3A 4ILMA 3NKYA 3FEXB 2V8PA 1I51B 5CYMB 2YX4A 4O3OA 1URNA 3GV8B 2GAHC 1NRKA 2FLLA 1BUXA 1VQ4S 4F3MA 2F1FA 3AXMA 2DNHA 4DV5F 4FDFA 4O4GB 1GX5A 5CHCB 2HHPA 4P73A 2QA4S 2MB0B 2VH7A 1RUSA 3CCSS 4QIFA 3OR2B 2VBWA 3KK3B 2K1RB 3OL6A 1HWKA 2ZBCA 1N4LA 2E44A 4NCGB 3K5LA 2WCXA 3CCLS 1RLDA 1PJ7A 1TMJA 1SUQB 4A8QA 5FIIA 1UVIA 2DBBA 5L39A 3MI7X 2ZVSA 2MGZA 2HVIA 1U1OA 2MZSA 1GXLA 5B0FA 3I5AA 2FJEB 5HL7Q 4ZKAA 4KQZA 3LP2A 5DGBA 2AF6A 2X1BA 3FJ2A 4BBYA 3QIPB 4CLSA 1WC6A 4RPFA 3CT9A 4ELVA 1FE0A 5J2PB 1RGVA 3Q24A 5KG2A 2IRUA 1MMLA 3KNAA 4PWDA 1HA1A 2IC3B 3QAUA 3W2VA 5A8KB 3P6YC 2Y8YA 1CULB 3KFWX 4X4TA 1KVJA 4DFKA 3TJ9A 2UUWA 2BRKA 1K1QA 4C4WA 3TRGA 4HI1A 2JWNA 1VQ5S 3SSRA 2ZH9A 2QG9B 2EPIA 2OJ3A 2J7KA 4LBPA 1CJKA 1FKOB 4Z7YA 3DOKA 1SH3A 2MY8A 1NSPA 2KHDA 2N3LA 1FXDA 3HLUA 4ED2A 2EKNA 4IO9Q 3KJFB 1VBZA 5CCLA 3TJ8A 2ILZA 1YRUA 1RSCA 1TL3B 3HO1A 2LXFA 4DV7F 5EUHA 2E66A 4NA3A 4Q43A 2PMHA 3PRBA 2VPYB 3PW2A 1QSLA 4K0KJ 5KT2A 1KWMA 2ZUAA 1P1LA 3D67A 2OEMA 2KVQE 5G4DA 3OHBA 2X7IA 2HQFA 2AIRB 3DOMA 4PQUA 4IFYB 1NXIA 3MECA 5L1KA 4KPYA 3R3TA 3M1VB 3J7Z5 2QL5B 2HNZA 3CMQA 2VQFJ 3U1NA 5LMNJ 2C28A 2ZC4A 5KT5A 5JVHQ 3QGIA 2M9KA 5E2QA 4DR2F 2CWXA 2E1MC 4OZ0A 1RWMB 4EU0A 4R5PB 1U1KA 4WF9Q 1VI7A 2B4PA 1WF2A 2LEBA 2KG1A 1P8GA 4KV8A 2QTWA 3RW7A 1HYSA 3A3OB 1N5SA 1XR7A 3GCWP 4HL9A 3UI3A 1WC5A 2JRSA 2V67A 2GMHA 4I7FB 4JB8B 2CQPA 4ICLB 4PPZA 1H2UX 2XMWA 4D3GA 2HW3A 3GU0A 1F1BB 2GIRA 3UCGA 2DR9A 4LIRA 1RI7A 2KN4A 4B3SJ 1NHKL 3BQ2A 2HHHF 4ZS6A 1IR0A 3ZFVA 4KGKA 2EFVA 5I3QA 1VBYA 5IWAJ 3JTPA 1OPIA 1RAEB 5GADU 5HI7A 2MSSA 4Q45A 4YFUA 5F3TA 1MWQA 2AQ4A 2FB0A 4IQMA 5THWA 4ZVHA 4OYXA 3QRQA 3L7OA 1VQOS 3CDUA 4GC6A 2QSWA 1FE4A 3DNCA 4ZIVA 3FK4A 3H42A 2EVZA 1OWXA 2KG0A 2W2NP 2GO9A 3POTA 2GIQA 2HNYA 3SSQA 3PR5B 2LXIA 4OX9F 4F7VA 3J7ZT 3A4TA 5E5NA 3MM7A 4O44A 2LA4A 1TL7A 4UZBA 4RUBA 4WE1A 2Y1RI 1YK9A 3VHQA 4FP9A 2O67A 1U2CA 2X1AA 2CJQA 1HARA 4YY3J 2MZQA 3UPFA 1CJUB 2I6WA 3MM5A 4CLLA 4P7TA 4NXMJ 3G6VA 3D6TB 2DR7A 3R6LB 4OYAA 2C2OB 3DRXA 4ANCA 5CA5A 1YJ7A 1T05B 2MKSA 2N3OA 1KONA 2BVZA 2DNKA 1CS4A 1X8DA 1RZMA 2F9JA 1SV5B 5B09A 1RTIA 1RHKB 4HI2A 2RB7A 4ZPTR 2HK3A 3H20A 4CLWA 3OR1B 5ERUA 4PCQA 2HS0A 4NRUA 1R3NA 3EZUA 4M5KA 2NYHA 3TZWA 2C2ZB 2LEPA 3QT8A 3CGIA 1YJUA 1DZ5A 3SEOA 3AHPA 2Y0BB 1WEZA 1PILA 4NYPA 4C3LA 5HVFA 4DSLA 4KIAA 2B56A 2NQVA 4HEA9 2Z2LA 1TKTA 2VBXA 2HFZA 3ZZYA 1C2PA 2XULA 2VG6A 2G0CA 3I9ZA 5IS2A 2HWTA 2IJFA 4ZPAA 2B4VA 4Y2AA 2KXHA 2E7WA 3I56S 2OH2A 4DR5J 1NJYA 1T9XA 2FC8A 2LEAA 2JLFA 1RWOB 2NPIA 4BDPA 4OZLA 1UVLA 2G4BA 5J2QA 3KHRA 4DWIA 2VFUA 2VA3A 4CZCA 2BKNA 4TQSA 4ELTA 1LNQA 1TL1B 3AA8A 1JLQA 2MXYA 4CM2A 4X66F 4H4OA 1JB0C 3JYTB 1Q8IA 2ZNYA 1CSJA 2HIQA 3Q2TC 3MD3A 1RHRB 3H5XA 1SJ1A 1R0BG 1TVRB 2AP6A 3UD5A 3V2UC 3ZTQA 1N5VA 4OLPA 1H72C 3TA2A 2K06A 1N54B 4DL6A 4TY9A 3PKYA 2M7SA 4ETXA 4ZCMA 3V81A 1Y5IB 1AFIA 2M0GB 2GFFA 5HLFA 1TKZA 4PKDB 3I9V9 2MSTA 2RAQA 4C0BA 1LW2B 4DV3J 3PJXA 4DOZA 3HHNB 2KB2A 3BR9A 4ER8A 1I94F 3BKFA 2BQUA 3SZ2A 2FJVA 2IM1A 3ZTPA 1VHFA 3NGDA 4UQGA 3ITHB 1GMVA 1Q79A 4DSIA 5C24B 4LQ3A 3U1LA 4U8YA 2IM2A 3VGUA 3MPYA 5A2QU 5HJXA 4UUXA 1ZM2A 3NOCA 3PO5A 2JLEA 1RISA 1JX4A 4CLPA 1GQEA 4RW9A 1JLAB 4XAKA 4IH6A 5A0YA 4AQYF 3N5BA 4CLUA 3PEHA 3OSNA 1QSYA 1FI4A 3M6XA 3OR2A 4G1IA 3LP0B 2K1RA 1QE1B 2IDEA 4C11B 4LFAF 1HHQA 1VR6A 2E1PA 1UJ6A 4LSZB 2UP1A 1CJTB 3K8VA 2NUUG 3LH2S 2PA8D 4F4ZA 4I2QB 4HDHA 2DHHA 4NL5A 3D66A 1VQ8S 4ECYA 1ZTTA 4CLKA 2AKWB 3IG1A 4OI1A 4AD6A 4ZP7A 3O1LA 4QIEA 5J2PA 4QWCA 2VFTA 3N28A 2CJKA 4YDXA 3DHXA 5JUMA 2V9WA 2CQ3A 4KGZB 1IM6A 2D3O1 1NH7A 2IC3A 2UUBJ 3MEGA 2YX1A 3ETOA 3D6MB 2U2FA 5CYJA 4ED6A 4ZDNA 5ERTA 4AE5A 2FZGB 2R7SA 3G86A 3NG8A 1VHIA 2YWWA 2Q3PA 2DCUB 3NXZA 3HVTA 5KFVA 2GO8A 3T5JA 3ET6B 2IIHA 3KDNA 3CPWR 5F8JA 5F41A 4GMKA 1X7VA 1FK9B 1U24A 1AUSL 4JI4J 4DU8A 2B6AB 2YXLA 4RZRA 2F5GA 2WOMB 2XHCA 5DGAA 1L5UA 4TVAB 4A8KA 2C3MA 5KFSA 4N7TA 3UDEA 3EGWB 4FF1A 5KT7A 4OYMA 1SQGA 3H8YA 1TL3A 2PT0A 1ZM9A 3CCWA 1WTFA 3R5GA 5LJ3Y 2ASJA 2M8HA 3CCUS 4RW4A 4ZVOB 1U1LA 3EVWA 2AT1B 1PYTA 2NSBA 2CQIA 2ZBRA 2R7TA 3A1YG 1HHSA 5KT4A 2J6TA 3KLFA 1B0VA 3FCHA 3MWBA 4N8OA 3IP0A 2RS8A 2KTQA 4L75A 4DZ6A 1UPMB 2KYZA 2WSCC 4FN5A 2H9ZA 2R4FA 2V50A 5BYQA 2NQUA 4QQBA 4DFJA 2FY8A 3DGVA 1XMOF 2V69A 1YDLA 4P9SA 3I0SA 1N33J 1U2FA 2BKOA 2BJ8A 3T9ZA 4ZCKA 4TKTA 1BY9A 5DQHA 4R5PA 4USVA 1EJ7L 2WONB 4LRAA 1O0PA 4GO7X 6FD1A 2R7XA 1IUJA 1A0OB 1WF0A 5IXUA 1EZZB 4DR6F 5CXTA 3KK1A 2LVWA 4C0OC 2BR0A 3SCIE 1T0TV 4I7FA 2XCPA 4RNMA 3QLHA 4ICLA 1RT4A 5B0AA 1HKAA 1QDUB 1VYAA 3HPOA 2CNNB 2ZH8A 4ED5A 4ZCLA 5KT3A 5G0RB 1D1UA 3MMAB 1AT1B 2VICA 2OEJA 4KFBA 2JEGA 1K44A 4PR6A 2HZVA 5F8GA 4JV5J 3GWCA 4OI2A 2HS3A 2EEYA 4OJ3A 3ILIA 3PYFA 1TV6A 4FBTA 4TU9A 4J9UE 3W9HA 4JI5F 2AJQA 2J7WA 2AYGA 2DD8S 5HMZA 1WG5A 4X4PA 3G4SS 4YR3A 1TKXB 1S6QA 3V6JA 2B51A 3TVZA 1RT2B 5K20B 3CCJS 2LQBA 3LGHA 3ZTOA 5L9NA 2B9WA 3RAMA 2XMAA 3CJ3A 1X5SA 4IQXA 1SIZA 5LSLA 4K8RA 3HKWA 2R8KA 1ZZFA 2IYIA 1U49A 1T3EA 2UXCF 4JI2F 3DDKA 4M5LA 2IAJA 2OAUA 3NCQA 4C8OA 1G7CB 2ADCA 1S1UB 3SBMA 4EWTA 5LT5A 4DR4J 3EM1A 2NR0A 2XYHB 4ZP9A 4A47A 2IDLA 2V63A 4A46A 3V4MA 4L3NA 3PYDA 1R8AA 3T41A 4K2XA 1AZSB 5GAGU 3T1YJ 4DN0A 3TZYA 1NJWA 3UO0A 2BYCA 4OZ1A 4X4SA 3GIIA 4BC9A 2YKMA 1QLNA 5HQMA 2W01A 2U1AA 4Y65A 1GXTA 1F3FA 1S0OA 1S57A 5ADZA 1DJ0A 5G2SA 3DMJA 4M95A 1NUEA 2JEIA 4G6VB 2RHQB 1HQEA 1NDCA 2JEFA 1TUGB 5I42B 4MT1A 2VKZG 3UR0A 1TL4A 2IBOA 4JOUA 1FRLA 2DTJA 3BJYA 3GJQB 3AOCA 4Y0FA 3MMBB 5FJ4A 2HQ3A 3MR6A 4DFMA 4M5NA 2PE8A 2D7SA 2W7AA 3CJ2A 1U1MA 4X65F 3ZZTA 1Q16B 3TI0A 4IG3A 1X4AA 5C2GA 2DY1A 2AGQA 1S76D 2VHGA 2UVRA 1UA0A 1Q81T 2XS5A 3N79A 1D3WA 2H4WB 2VODA 3VAHA 4MH8A 1T9VA 2COLA 2DISA 5IC6B 3PV8A 1BQXA 3HSGA 5AXLA 4OV6A 3WHIA 2DGTA 1B64A 4RNNA 3UCZP 3QJJA 1UETA 2H48B 1GNKA 1N5YB 3W5ZA 2N82B 4OZ5A 2V34A 2DT9A 3S01A 2R7UA 1IBKF 1LOUA 4U7UD 3RRHA 2DEIA 4EBDA 1O51A 3D1QA 2P2CB 1F2GA 3TW0A 1YRTA 5KFOA 1JNRB 4LR8A 1YIJS 3FSYA 3MGJA 4I4BA 3DOLB 1GFWB 2GGPA 1HBMB 2NXUA 1RT6B 3THPA 1S1TB 3M32A 3E3XA 2UUAF 4YHHF 1YRXA 2ZH1A 3SQGB 4J9SA 4DV1J 4J9VA 2W2QP 3HHLA 4QOTA 2VUGA 3SCLE 1EX8A 3HZEA 5HMWA 3IWXA 3Q23A 3UQSA 1S6PA 1Q7LB 2ILYA 1UVKA 2IM0A 5CD4H 1T03B 4Y2MA 1WJ9A 3EXCX 2ASYA 3J81Y 1OYEA 2UXDF 4CO1A 2IY5B 3OL9A 4ED1A 5D0EA 1UMJA 2IVFB 3UDCA 3MR5A 4DCOB 2AV5A 1WHVA 2MQPA 2HVHA 1SJRA 1Q53A 3LP0A 4OHYA 1B70B 1M5OC 4CO4A 2ASDA 1S9EA 4Q8EA 5HBMA 4OJ1A 4C11A 2ZD1A 1RDRA 4CM0A 4UZCA 1HI8A 5A8RA 4K5RA 1IW7D 4DSFA 2RE1A 2HBRB 2DGOA 5ERSA 3T3FA 1YBTA 1QUPA 2HWHA 2F9DA 2HRYA 4C7QA 4DI6A 2HQDA 4I2QA 4O3QA 1K0TA 2QL9B 2CVEA 5BXIA 1QD1A 3M2VB 4QU6A 4FYXB 4ZIWA 1WI8A 4DSEA 3BM7A 2CA9A 3MR7A 4F2SA 2GNKA 2C3OA 2D1CA 3QT5A 4IRDA 4URSA 4XK8C 2DY9A 3TNVA 4I6AA 2MQQA 3KJNB 3G9CA 2D69A 5KG0A 2C1EB 3VAJA 3Q89A 1FKPA 2CNKB 2CRLA 4JI1J 1JLBA 2CJYB 1H7XA 3QO9B 3VV2B 4B9TA 4OYPA 4YR2A 3KJQB 2H5IB 4DPUA 3R5CA 1IKYB 1FX2A 3HCXA 3ET6A 1VMBA 3D6HB 2XYPB 1FNXH 4P2SA 2BMBA 3M6UA 3BSAA 2NPFA 1FK9A 3NGTA 4JI3J 2HFVA 2AD9A 1C4AA 3E2EA 1Y00A 2N4CA 2FTSA 2RF2A 1QAJA 3FQLA 5KFWA 3CJKA 3D3BJ 3CJSA 1AXQA 3RBZA 1R8PA 1I1GA 3KJVB 2Z0GA 2LQ8A 2FY1A 1KEKA 5HATA 2FGCA 4QYZJ 5D77A 2DK2A 2WTFA 1MG7A 4HTJA 3PXGa 4CTAA 1SL2A 2CJBA 3TX0A 1B0PA 2W7PA 1KSPA 1YX2A 2A0FB 3OTOJ 1SC3B 1T8EA 4IDKB 1OY6A 3HKZD 4EEYA 5CYQB 1DFDA 1FTCA 1RA7A 5F3ZA 2DXEA 3FCVA 3ISND 4KPCA 3CDAA 3GFHA 2XGPA 4DQIA 3MR3A 3GP9A 1H2VZ 1U48A 1H73A 3AT1B 2QA4G 2FHMA 3TUZC 3Q8UA 5HROA 2OPRB 4LBHA 2FUG9 2OTLS 5ITHA 5B0GA 2GC8A 3QFWA 5DM6Q 1HIYA 1S1VA 3AODA 1T9UA 2H3EB 2I0XA 1CQMA 2KFYA 1RAIB 1RADB 2GCFA 2QN6B 4E8UA 1ACMB 1FWKA 2H54B 4CRJA 4HHHA 1XC9A 2ZC3A 5EWGA 2YWFA 4Y6IA 5KTQA 3ELHA 3ZTRA 1HPZA 3MMAA 4R0EA 4RX6A 5L1JA 3JSYA 4DV4F 2D74B 3DFEA 1KLNA 3M8YA 4TQRA 2O3DA 3UVJB 2HG4A 5BYSA 4N56A 3BN4A 4B3OA 2R2UA 4ZVFA 3DRPA 3QSIA 2HSEB 2BE2A 1E6YA 1KQGB 3N5FA 3DYAA 1FKAF 4PUOA 2EFQA 5KFFA 4LF9J 4CI0B 5KFDA 5AE2A 2BX6A 1HLWA 2VKRA 3U7JA 4CO0A 4K4TA 3ZXWA 4PG8A 4F4YA 1AROP 1FD8A 3H5YA 2P9EA 3H7HB 1NB7A 2CQ2A 3DGPB 1LWFB 1X60A 1UVJA 4CO5A 2YNFB 3IWLA 1GMWD 4HACB 3R5BA 4WP8A 2EG1A 1IKWB 2UVUA 1RAGB 2YWKA 1S77D 4V1Ak 1N32J 3EX7B 5C7PA 4OYBA 8ATCB 2MDAA 1CLFA 3V6DA 3OFFA 3BDPA 2AX0A 2XY6A 4IG0B 2HAIA 3PW4A 2J9EA 2KT3A 3H98A 2YX7A 2EFOA 2J0WA 2WVDA 3CJ8A 5E3PA 1REVB 3QIDA 2EG2A 1HBNB 1HR0J 4WTOB 2L9DA 1JXVA 3H59A 4FVMA 3MCNA 4LIWA 1RE1B 4DX8H 4U96A 1EQ0A 4YMEA 4J9KA 2KI2A 2BUNA 5KFKA 4LF8J 4ID5A 2GVDB 2R2TA 3C3LA 4LR9A 2CQ1A 5D4PA 3MTJA 3HP6A 5D3GA 4RW8A 5I42A 3ETMA 1R31A 3OL8A 1S97A 3BSNA 4DL7A 4UW2A 5C42A 1A9NB 1S4FA 2BOAA 2P6SA 1FO1A 5E3CA 1W7WA 3AD9C 3CXCR 1JJ4A 1HBOB 2I5JA 4YOEA 1UTAA 1YWXA 1Q82T 2DVIA 4L6V3 1Q5VA 2GQ2A 2NXJA 4F25A 1LXNA 4ED0A 3MAQA 4KHPJ 1N0VC 4DUYJ 2E1AA 5D15A 1ZOTA 4A8FA 4LREA 2K3IA 1WORA 2UU9F 3JQJA 3PO4A 3TR5A 4LF6F 2X1GA 1SJ3P 3IRWP 3CCQS 1ZAXA 2DH8A 3A3PB 4IO1A 4G1PA 2XCAA 2ZKUA 5L8RC 2JL9A 1JLGA 2W9CB 3CC7S 1LWCA 3PG9A 3IBWA 2QLBB 3V6HA 4B3MJ 5DZ7A 3PHTA 5D0HA 1ZH5A 3FEZA 1XR5A 3Q83A 1VRUB 2LDIA 1N5YA 4DFPA 1QAYA 1G8RA 1HMVB 2V68A 2NQKA 1FRJA 1SKWA 4DPTA 4TU7A 4B08A 1H6KX 2P8IA 5U47A 3L4BC 3LAMA 3O6QA 4MK9A 2VG5B 3NP5A 5ETNA 2PIIA 4FXDA 3AJ1A 4LF5J 3HXMA 4M5JA 1RTJA 3VCDA 2CNOB 3G71S 3P8BB 2HFNA 1IBLJ 2QFIA 2FVCA 2AZ3A 3GJSB 3BKUA 2VBZA 3QGPA 4YB7A 4NI2B 5K8PA 3TX8A 3SQGA 4AL7A 3QWPA 2MTLA 3ZZRA 2Q66A 4UUWA 5LL6d 2OGUA 2F40A 4URGA 3ONQA 5KT6A 5EDWA 4K0KF 2MZJA 3D9BA 1RWNB 4LBIA 3M30B 5F8NA 1T03A 1ZZNA 1FWPA 3P5BP 1U0HB 3HHEA 3B4MA 1X5PA 2RRAA 3TA1A 4DSJA 2ZOFA 2R7WA 4TK1A 4MKVA 2BJEA 5J1PA 3RZAA 2VQFF 5LMNF 4RO0A 1NKCA 3GE9A 3RRGA 2CJAA 2C3PA 1T11A 2GQQA 5LMUJ 2ZITA 1OPZA 3BBFA 3FSIA 2V2ZA 3W9IA 1VQ7S 1EETB 3FMWA 8RUCA 3R7BB 1TFWA 4LF7J 1FDBA 4MIWA 1HWUA 5H9FJ 4AT1B 2PI5A 2WK4A 4I68A 4ECZA 4EUVA 3BBBA 2LDYA 1NDKA 3AH6A 1LKZA 4OZ2A 3QWUA 3MM8A 4EK2A 2RUGA 1FXLA 4HH1A 3BV8A 2PGCA 1Q8LA 2HEKA 3CDBA 5KFRA 4NLXA 4Q2LA 5BR8J 2F63A 4I6WA 3SXLA 4A8YA 4KB7A 2POKA 3GZ7A 1VJQA 3CD7A 1XK8A 2FVPA 2KZZA 3J80U 3CB4A 2BANB 2FLPA 4IFVA 4ETZA 1W25A 4FNIA 4UOCA 5K8MA 3KUGA 4ZVUB 4KGXB 2KYXA 1Q5YA 2NCKL 1NZAA 5B08A 2YH0A 1URRA 4F26A 3RTVA 3MM9A 3MOZA 1NEEA 5KG4A 3MCMA 3GTYX 1SC1B 5AXNA 4MKBA 2XC9A 1DTTB 3C15B 3OXLA 3GCXP 1GTHA 1PGZA 2NXNA 2RMLA 3G82B 1SPBP 1RHMB 3FMBA 4JI0J 4YQWA 2CFXA 2XWYA 3D28A 3I5CA 4YY3F 5ETSA 2HZCA 5EGYA 1FTRA 5IV4A 4KKOB 1LWEA 2MQNA 1OY9A 4NXMF 4X84A 1F3VA 4JI8J 5F8LA 3I4HX 5CYQA 4DCPB 2BV3A 4JYAJ 2PSZA 2P9CA 4OMFG 5J1EA 3QGHA 1AA1B 3D4JA 4A8XA 3UCUP 2HGLA 4ZJLA 2DH9A 2OPRA 1X9WA 1UFWA 2ASLA 3C6UB 4DR3J 2JJ4D 1M90T 2DHXA 4EFAC 3SSSA 3EPIA 3TAQA 2XZWA 4NXNJ 4LMZA 1XNQJ 1DBDA 1TTHB 5DDOC 2HURA 1JLFB 3LTOA 1YTYA 1NK8A 1RHUB 5F9LA 2VL1A 1L3SA 3EYZA 1U1PA 2XNRA 2K2PA 3BGRA 3PW5A 2ROPA 2RIJA 2VASA 4DV7J 1XNRJ 1BQNB 1WELA 4B9UA 4WXOA 3QJLA 1U6FA 7FD1A 1KLMA 4TNOA 2DPIA 2QFJA 1JIHA 3K58A 4DR5F 2QA2A 2R2RA 5GMKa 4C9DA 4DV2J 1BHNA 1FRIA 2A1BA 2V5HG 2M52A 1IVZA 1UEUA 1UVMA 1PBUA 2DGSA 3K57A 1FFGB 4ZLPA 1YSJA 3PIPQ 1EQMA 4WIQA 2DNQA 3JAMU 1R27B 5HP1A 3CO0P 2Y8WA 3DGPA 2HS4A 2ABYA 1L3VA 1RU2A 3MDFA 3PFOA 2VFRA 3MEDB 4WFYA 4ZPBA 2FLOA 2F3JA 2DIUA 1X4HA 3GFYA 3CJ4A 4DQRA 3KK2A 5DDRC 1SJFA 1IKWA 2N7YA 1TK0A 2XS2A 4DBQA 2HHWA 3MEKA 4UOFA 4IOAQ 5D8HB 2B43A 3S6EA 3H40A 3UD4P 2ZH4A 5ERRA 5A8WB 3NGKA 5GMEA 1UL3A 1NJXA 5KFYA 5AE3A 5HAOA 2J0SD 5ETTA 2V4JB 1H7WA 2DR8A 1F5CA 4RBVA 1MROA 3KLIA 3HFZB 4DV3F 1JKHB 1KHVA 3M8PA 3CSKA 5DETA 4Q0BA 3CCES 4RLEA 4ILLA 3PIOQ 5L1IA 3GSDA 4PD1A 1U09A 2PMWA 2HAFA 2VU5A 2GVDA 4XPEA 1LW0B 2LMIA 1IKVB 4TXSA 1ZAWA 2CAJA 2MHEA 2JC1A 5HMYA 2E9TA 5DLFA 3IBFB 2Y1JA 2XMVA 2N7CA 1F9HA 3LP1B 4IH5A 3ZZ0A 3CD0A 3U02A 1MWYA 5IOLA 3MMCB 3KG4A 1KP6A 3Q8PB 4G1QA 2ACYA 4OX9J 2M4MA 2MZTA 3TA0A 2Y9HA 2HVEA 4LRDA 1SC4B 4GKJJ 1FCAA 2YKAA 2HQGA 2RKIA 3E51A 2C2NA 1W26A 2KXNB 1NDPA 3IRXB 4RW6A 5H9EJ 3H2LA 4EO6A 5DG7A 4GC7A 3HSJA 2D3UA 3W1YC 2QC3A 2L9NA 5KFLA 1APSA 5DM7Q 2QSFA 3TANA 4ZN1A 3GG1A 2MKKA 4IYQA 4IKAA 3G8SA 4TLRA 1U6ZA 5ERVA 2XQCA 2HK2A 2O01C 1X4BA 4ECSA 1U1NA 3VGSA 3BYRA 3I55S 2IJNA 4NZ7A 2FTRA 1RT1A 3QT7A 3RGIA 1EKSA 4A8OA 4ZVTB 1VIOA 2UUBF 3TUJC 1BWEA 3TYTA 2X3LA 2YQ3A 1XTZA 4DPOA 4OJGA 4OZNA 1TFYA 2W2MP 4MK8A 1FVSA 3KNGA 3KLEB 2QLFB 2RDJA 2Z2YB 3SDEB 3SMZA 2W24A 2KFZA 1FWLA 2NZCA 2XMMA 1JLEA 2CZ4A 4D3HA 2VC0A 4JUZA 4JI4F 2DXDA 4ZPVR 2GHVC 5M2UA 4WYLA 2VG7A 4CP5A 5KFZA 4F8RA 4WU2A 1QY7A 3NNCA 4PWUA 4O3NA 4LF4F 2RILA 2QV6A 5T7LA 2VV5A 3BDEA 4XTTA 2PD1A 4QIWD 3QYYA 1BQMA 1DQ8A 3R1LA 4NLYA 4HR2A 3M2UB 3R5DA 2YKPA 1U0HA 2RD5C 2ZBPA 2J0QD 3NBPA 3MPDA 2A2DA 4Y2KA 3CCRS 2JFDA 3NCRA 2RHSB 1T02A 4MYUA 4C98A 4TK4A 2HFUA 3HD1A 2CQDA 4H4KC 4X4OA 2IPOB 4OI3A 2HGMA 1LXJA 3R9LA 1JLCA 2V2QA 1IM4A 1N33F 2CQCA 4DUZJ 2O66A 3PM9A 2OPPB 2ROGA 1KBRA 5ETMA 1PBAA 2V2VA 4ECWA 1QUVA 4FKXA 1FJGF 5DO2A 1EETA 2QJ3A 4ZPWR 3RAQA 3J80Y 3TWZA 3OTEA 3PNIA 2FIUA 3T6JA 1G4CA 2OPSA 3ZNJ1 2F4VJ 2DH7A 3D5MA 3GIRA 3ZTSA 1K1SA 4B9NA 2MLXA 1AW0A 4WIIA 3U1MA 1KOOA 4Q8FA 5GAHI 2ALYB 4CDIA 2RQ4A 2YNGB 1HD1A 3BO4A 4DS4A 1CEZA 3D2WA 5E0OA 3OTBA 3RJMB 3EDRB 1YBUA 4Y34A 3DI6A 2OTJS 2M2BA 3BGLA 1OQ6A 2UXBJ 4JV5F 4ID8A 4X4QA 2KL8A 2CPHA 4ZLLA 1YJ9S 1DRZA 4DX7A 1FEHA 2XB2D 9RUBA 4X4VA 3OXFA 4ZHRA 4C8LA 4A8WA 3C2PA 1UW4A 1MN9A 1R43A 2B3TB 4IR1A 1S10A 2CKWA 4WFAQ 3UWTA 4DG1B 1EARA 2NQPA 1YGYA 3I0RA 4KY3A 3KLHB 4J9RA 2VIHA 4O4RA 1VJWA 1JJ2R 4FPIA 4CCHA 3ZNUA 3IAS9 1VRTA 1E6VB 2OSRA 4PABA 3DLJA 3DM2B 2VDHA 3WBZA 2V0NA 3TUIC 3VAMA 3OUYB 4H4MA 1WG4A 2IYGA 2ZH6A 1UAWA 3CJ5A 2AEFA 3NCPA 2HHXA 4N76A 5EX3A 1H2TZ 5HJYA 2J5AA 2I38A 4M1KA 5JJBA 1DURA 2W9BA 1M0SA 2DHAA 5GAEI 1U0SA 4OI4A 5E33A 3BO2A 4DR4F 1N88A 1N56A 3TAPA 4KT0C 2HHUA 2Z57B 2RDDA 2QMWA 3U27A 1HQMD 3DRRA 5AJ3F 4IRCA 1U1QA 3T1YF 3MZIA 2FHJA 1M1GA 2MZRA 2HZAA 4CYUB 4MFBB 3AOAA 5T41A 3FFIB 4OFZA 2GS8A 5J2MA 3UN3A 3R8YA 3QJPA 4Y2CA 2V8DA 4M5HA 1QVFR 1SJQA 3NWRA 3CWJA 4QJVA 3A8JA 3OL7A 4JP8A 4CLYA 2KZMA 2DJWA 1JWWA 1ZA1B 1R8CA 2V4QA 4K5SA 4B3TJ 4I69A 3JAMY 3UFCX 3DRSB 4DF4A 1GX6A 2MKJA 2DGWA 4NLVA 4DV6J 1KHWA 4KHRA 1Z2ZA 4OX7A 4ED8A 3WC0A 4ED4A 4Z37A 4U91A 1WOOA 1T9YA 1FXRA 4USMA 2Z2MA 2G9OA 4LRFA 2JH3A 4DL4A 1PYOB 2GMLA 5KFUA 2GZOA 4KH1B 2MLYA 4RR5A 3VAIA 1G6BA 3CEDA 4YS2A 3V4IB 1NM2A 4ALZA 1KR4A 5C25B 3Q8YA 3JSMA 1T3NA 3MM6B 2UV8G 3CCZA 4L74A 2VZ9A 1M1HA 3Q22A 1S9GB 1RAJA 3EICA 2ZOMA 5E3QA 1HNZJ
chains in the Genus database with same CATH topology
3IWXA 3Q23A 1IN0A 3BREA 3SCJE 3KLGA 3UQSA 1S6PA 1DTQB 4UQTA 5J1NA 1Q7LB 2OO4A 1HBUB 4NWBA 2ILYA 3T19A 3K5NA 1UVKA 2IM0A 4MFBA 5CD4H 1T03B 3Q0AA 3IN5A 5KOXA 4Y2MA 3OSPA 4ILRA 3EXCX 2ASYA 1VQYA 3FFIA 3VQTA 3CC2S 3NWGA 5I3UA 3J81Y 1FKPB 2XO7A 1JLBB 2UXDF 2DGXA 4CO1A 2AJ1A 4ECQA 1NK5A 2MQMA 5DDPC 3M8QB 3KYLA 1RA6A 1U25A 5LXRA 3OL9A 4CT8A 2OLWA 4ED1A 4ERDA 2XGQA 1Q4RA 4NOHA 1UMJA 2MMYA 2IVFB 1KQKA 3L3CA 5CZXA 4LF8F 3AQOA 2HNDA 3UDCA 3FRYA 4Y3CA 3MR5A 5IFMA 2V4RA 2R2SA 3T9NA 4CQ1A 3SFUA 2AV5A 4PXBA 4JI6F 1WHVA 1Y5NB 1B0TA 1S48A 3DRSA 4X2BA 1NK0A 2MQPA 2HVHA 4LUBA 1SJRA 3H4BA 1RQ0A 1Q53A 4KBIA 3LP0A 5KFAA 3GIJA 1OSDA 3BSOA 1J5OB 3OLBA 4B3TF 4OHYA 3CMAS 3HX9A 5FDLA 4C3MA 1M5OC 4CO4A 3TVKA 2ZJPQ 3CUNA 2ASDA 1S9EA 2OFHX 4Q8EA 5HBMA 4OJ1A 4C11A 4X4UA 2N4DA 2ZD1A 3OVBA 3NS5A 4DV6F 1RDRA 5A8WA 3LF0A 4OHVA 1P6TA 2F7VA 2ZH7A 1HI8A 5A8RA 2RNEA 4K5RA 1IW7D 3F56A 3SYZA 5K8NA 4DSFA 2RE1A 2FDNA 3LALA 5E3AA 2D9PA 2RF2B 1FC5A 2HNYB 5J2NB 4LSNB 5IT0A 4F4XA 1K73T 2DGOA 2FHJD 3CCTA 5ERSA 3T3FA 4RWWA 1QUPA 1Z1ZA 2B4OA 2F9DA 2HWHA 4WTYA 1GT8A 3CJKB 2HRYA 3SV4A 2V4JA 4MKAA 1OQ3A 4C7QA 1FA0A 2M5YA 3H5UA 5C25A 3DOLA 3P5TL 4I2QA 4O3QA 4WE1B 1CG2A 5MAOA 1U4BA 3MM6A 2HYIB 2RQCA 1VC6A 3ZZOA 3MEEB 4U9RA 3Q2SC 4WCEQ 3F41A 3V5RA 1FJ7A 1K0TA 4AUKA 2RT3A 3O2IA 3CCMS 1RTHA 1HBMA 2CVEA 4LSLA 4NLUA 4USIA 4QU7A 3M2VB 1RT6A 2UZAA 5K5MA 4QU6A 1UJ5A 3AQPA 1S1TA 2HFOA 2L3MA 1RT5B 1TR0A 4DUYF 4EZ9A 4CTAB 1WI8A 3T6BA 4DSEA 4N77A 3RR8A 3BM7A 4PRFA 4YDDB 4F2SA 1U7LA 2WSFC 3K59A 4FNHA 2GNKA 2KM8B 2C3OA 2D1CA 1HNVB 2CPFA 2KRBA 3LUYA 2IFXA 1FERA 1HNWF 4CT9A 1Z2LA 3THTA 3HHLC 1HNZF 2V94A 1KRPA 3M2RA 4IRDA 3TOQA 4QR2A 4URSA 4DQPA 1DTQA 4XK8C 1G8LA 2CPZA 3TNVA 3Q8QB 4I6AA 1FF2A 2MQQA 2RS2A 3G9CA 4C97A 2B9YA 3EXYA 1VFJA 1SBRA 2HGNA 1T94A 4H4KA 1C1CB 2B7BB 2WSEC 5KG0A 3VAJA 1FKPA 2CRLA 1RT3A 2I8EA 4I1TA 2XG8A 4KR0B 3N6NA 1JLBA 1IQZA 4B3MF 1YJTA 1R6YA 1SH2A 3KMQA 3M8QA 3LP1A 1H7XA 3CJ0A 1Q86T 4TN2A 2NROA 3R1HA 3FDSA 3QO9B 3NNAA 1CPZA 4B9TA 2L41A 4YR2A 3IS9A 1TUVA 1PO6A 4KO0B 3RRKA 3R5CA 1IKYB 5HROB 3F73A 2J76E 1VMBA 2ZBIA 2DCLA 1VOMA 1ZPVA 3FVYA 1C0TB 4P2SA 1FNXH 5KG1A 2RQKA 3CIZA 1X4CA 3M6UA 4RUAA 4FVCA 4RNHA 2BACA 2HMIB 3BSAA 2KJWA 4ZP6A 1EP4B 3X3UA 1J5OA 2NPFA 1Q8BA 1FK9A 4KC5A 1S1VB 2MKIA 1S0NA 3ICLA 1UKUA 2XLJA 3CMES 1MU2B 4W90B 1WEXA 2QA1A 2BABA 2BA9A 2VC1A 2AD9A 1R7IA 2B9XA 2WW8A 1R0AB 3WC2A 2J9DA 4TY8A 3OBIA 1C4AA 3I82A 4J5OA 1VQNS 4OZJA 3HHLD 4M5DB 2W4CA 4K4YA 3E2EA 4FZVA 4NLSA 3TAMB 3SFGA 3B78A 3HZGA 4NYZA 1Y00A 2N4CA 2FTSA 2VFVA 4GKKF 2RF2A 5JXSA 5KFTA 5L1LA 5J2NA 1QAJA 3FQLA 4Q2MA 3PKMA 5KFWA 4MKYA 2WRMA 3CJKA 1ZETA 5KFIA 3DU6A 1NKEA 1AXQA 1HPZB 1R89A 3K5PA 1R8PA 1I1GA 3KJVB 2H5EA 2Z0GA 1RTDB 4ED7A 2F8EX 4IOBA 1D8YA 2UUTA 5K14B 2FY1A 2MJNA 3K2YA 5F0WA 1KEKA 2FGCA 3MEEA 4QW9A 3PVXA 2J8AA 2YNIA 1TL5A 3TO8A 3DXSX 4QYZJ 5D77A 1BGXT 2DK2A 2WTFA 4EBCA 3ZC4A 1TQLA 1DHMA 3M2VA 5KG7A 3VQSA 1RT7A 1RT5A 4HTJA 3PXGa 4CTAA 2OPQA 4K4SA 3IR7B 4I0WA 3HDSA 4WU3A 1SL2A 3DCAA 1QAXA 1R8BA 2CJBA 4B3OB 1B0PA 3EUNA 1SXLA 3DRPB 5EWFA 2W7PA 1KSPA 2ZE2B 1WG1A 1M5PC 2IRYA 3IXQA 1E6YB 2BE2B 3WZ0A 1KS2A 3NNHA 4PUOB 3DYAB 4O23A 2YKQA 1T8EA 2PI4A 4IDKB 4AXJA 2CPDA 3HKZD 5G2RA 4DHVA 3TQ1A 4EEYA 4V19X 2OMLA 5KAKA 5CYQB 4B3SF 5CH7B 1DFDA 1FTCA 1RA7A 1C1CA 4CH7A 3BQ1A 1M1KT 5F3ZA 3S7RA 2KRRA 3BEGB 5IM0B 3ISND 2XGPA 3CDAA 3GFHA 3S8SA 1XMQF 5F8HA 4P6QA 4PG4A 4DQIA 3MR3A 1HQUB 5IWAF 1H2VZ 1MMDA 1RWUA 3QO9A 2L48A 2MKHA 2G1DA 1U48A 4JI1F 3GYNA 2QA4G 2FHMA 4PG5A 3VWSA 4KO0A 3TUZC 1NHUA 1IKYA 5BJRA 1WI6A 5HROA 1V3RA 4K4XA 4FF3A 2XI2A 4H4OB 2OPRB 4HDGA 2XHWA 2YNHB 3ULHA 2B5JA 3HHKA 2FUG9 2OTLS 1C0TA 1KFDA 3KG1A 6FDRA 3UW1A 5ITHA 3M8RA 5B0GA 2GC8A 3LANA 3C6TA 5DM6Q 2KKHA 2XMKA 1D8ZA 1EP4A 3KMSA 1U26A 4A8MP 2NLWA 1S1VA 2W9AA 1TAQA 2I0XA 2NSCA 1R0AA 2YTCA 1CQMA 2XBPA 4MJKA 5D4NA 4C8NA 2KFYA 2GCFA 3Q8RB 4PXDA 4E8UA 4KAIA 4JI3F 2CIMA 3GG0A 3TVYA 3CTRA 3I6PA 3PEJA 5DS7A 4EYIB 1NKBA 3TAMA 4OQJA 2C3YA 2FPHX 4YEAA 1IBMF 2GMJA 2I1RA 2MQOA 2GX8A 4OX6A 4U7UK 2XY7A 1VQMS 5LMUF 5EWEA 4HYKA 4F4KA 4NLWA 1JJHA 2EFGA 2ZC3A 3OV7A 4QR1A 1XC9A 1Q7YT 5EWGA 4JV1A 2YWFA 4Y6IA 4RNFA 1N36F 5KTQA 3HMJG 3DLGB 3PJWA 4EYHB 1HPZA 4IUFA 3MMAA 3DLLQ 4O0IA 2GJ2A 4R0EA 3J7YU 1YQHA 3KJVA 4LFCF 3CC4S 3V6DB 4RX6A 3RB0A 1UA1A 2E1RA 3MPVA 5L1JA 2GJIA 3JSYA 1GTEA 4DV4F 2D74B 1W2BR 3DFEA 1M5KC 1KLNA 2DGUA 1TKZB 4J9NA 3PFEA 4TQRA 5L38A 2O3DA 3Q8SB 2DO0A 2HLUA 5KFHA 1NO8A 1RKIA 2CPIA 2LU1A 2RQMA 2IMOA 2HG4A 4LF7F 5BYSA 3MFIA 3TP2A 4N56A 4ZP8A 1S79A 3BN4A 2MGZB 3RYLA 4B3OA 2R2UA 1MWZA 4ZVFA 2JHEA 1AUDA 3DRPA 3KG0A 4BCAA 2KM8C 1YJVA 2ZE2A 4AL5A 2RVJA 1FRHA 4J9PA 1VC0A 3A8EA 4WKRA 1E6YA 1KQGB 2BE2A 1HNIB 3CULA 3I96A 1C1BB 3B4DA 3LP2B 3N5FA 3DYAA 2K7JA 5I4MA 1FKAF 4PUOA 3W3SA 1IQTA 3NLCA 4Q7AA 2DNZA 2EFQA 2MYFA 3L95X 4IDKA 2PA3A 4H54A 4WXWA 1KFSA 3CDWA 1T7PA 1L3TA 2RRBA 3W7BA 1W2IA 3OTOF 5KFFA 1M5SA 4CI0B 5KFDA 3HT3A 1GH8A 1FNOA 5AE2A 1XERA 2VKRA 2MY7A 2CQBA 2IA0A 3L7PA 2YKNB 3CF5Q 2ZHOA 4CH0S 2JEJA 3U7JA 1BC6A 4QWDA 1C0UA 4CO0A 2IMWP 4K4TA 4PG8A 4F4YA 1LK5A 1HQUA 1AROP 1FD8A 2EKYA 1I6JA 2JFKA 3H5YA 1F9FA 2P9EA 4ID5B 3THVA 1NB7A 5BR8F 4PWDB 3IR6B 2KHCA 2CQ2A 4RBUA 3T5LA 1LWFB 2RU3A 4ILMA 2JC0A 2V8HA 3NKYA 3FEXB 3W2VB 2HHTA 1URNA 2WAQD 5CYMB 2YNHA 2YX4A 4O3OA 3ZZPA 5D3GB 1UVJA 4RW8B 2CPEA 1IKXB 4JV0A 4CO5A 4WZQA 3GV8B 2YNFB 5KFJA 2ZZNA 2R8JA 5KFPA 1NRKA 1JXEA 2ZDPA 4LVOP 1HL6A 2FLLA 2XSFA 4O3RA 1VQ4S 4F3MA 4NZ0A 3IWLA 2F1FA 5C42B 2DNHA 4DV5F 4O4GB 3KTQA 1GX5A 3R5BA 5CHCB 2HHPA 4B9MA 2QA4S 2PDAA 2MB0B 3NS6A 2VH7A 3GIKA 2EG1A 4KHMA 2OFGX 1IKWB 1GXUA 2CVIA 3DLEB 2UVUA 2YWKA 4B9VA 1S77D 1F5AA 3CCSS 4QIFA 2I5JB 5KFNA 3OR2B 2VBWA 1NK9A 3KK3B 2K1RB 3OL6A 1VGYA 3DLGA 4FXVA 3IC1A 1HWKA 2OD6A 3DOKB 2ZBCA 3EX7B 1KNZA 4M8LA 3M9MB 1N4LA 2DB1A 2E44A 2MDAA 4NCGB 5BYRA 3K5LA 2WCXA 1CLFA 3CCLS 3V6DA 1UZ5A 5IQ6A 2FC9A 1KVIA 3SI8A 3OFFA 1SUQB 3BDPA 4A8QA 2AX0A 2PFFB 2XY6A 1WHYA 5FIIA 4IG0B 4NCBA 1UVIA 2DBBA 2HAIA 3PW4A 1RYSA 2J9EA 5L39A 2KT3A 3H98A 1AFJA 2YX7A 4ZA1A 3MI7X 2ZVSA 4DSKA 2FJWA 2EFOA 1S1WA 2MGZA 2EBGA 2HVIA 2J0WA 1U1OA 1S1XA 3LOUA 2MZSA 1GXLA 2V2KA 1WWHA 3E01B 3I5AA 5B0FA 2DNRA 2FJEB 1REVB 1Z4UA 3N4WA 3QPIA 5E3PA 4R8UA 1HNIA 2DGVA 5HL7Q 3QIDA 1ULRA 1C1BA 1HBNB 2EG2A 3LP2A 4KQZA 4PG6A 4ZKAA 5DGBA 1JLGB 2AF6A 2X1BA 3FJ2A 4BBYA 2L9DA 3QIPB 3H59A 1LWCB 3MUTP 2AGPA 4FVMA 4ECTA 4BWMA 4PXEA 3MR2A 2YKOA 3CT9A 3KLVA 4LIWA 4JV2A 3M8SA 4ELVA 1FE0A 3FNNA 4PQUB 2YKNA 2ALZA 3ENVA 5J2PB 5IT4A 3E8OA 3MECB 1RGVA 4DX8H 3Q24A 4LF9F 4YMEA 2EFPA 1YJWS 4K4WA 4DG1A 4J9KA 2DITA 5KG2A 2BM1A 2IRUA 1MMLA 3DLHA 4QWEA 2KI2A 2BUNA 2D3ZA 3UDLA 5KFKA 3KNAA 4ID5A 2G13A 4PWDA 1HA1A 1O5JA 2R2TA 3C3LA 1LWFA 1G3OA 1HHTP 4RBTA 3D54A 2IC3B 3VR1A 3QAUA 3W2VA 2CQ1A 5D4PA 2AYMA 5A8KB 3MTJA 3LWMA 3P6YC 2HNZB 5CYMA 3HP6A 5AE1A 5D3GA 3KFWX 4RW8A 4WK1A 2E5LF 1WHXA 4X4TA 1KVJA 4DFKA 3DM2A 2UUWA 2JX2A 2YNFA 2BRKA 4W92B 5I42A 4U67Q 3GFXA 1K1QA 1R31A 1UJ4A 3AJ2A 3OL8A 2ZH3A 2PMZD 3BSNA 1S97A 4DL7A 1ZPWX 4C4WA 4UW2A 3N6LA 5C42A 1A9NB 2BRLA 2UV8A 4NA1A 4O4GA 1MSWD 2FLNA 3M6VA 1S4FA 3TRGA 2X51A 4HI1A 2P6SA 1FO1A 1FESA 5E3CA 2JWNA 2XMJA 1VQ5S 4K4ZA 3DHWC 3CXCR 4KV8B 2KXFA 1JJ4A 3SSRA 2I2YA 2ZH9A 1T95A 2EPIA 5K9FA 1HBOB 2I5JA 2OJ3A 4YOEA 1K0VA 3KKFA 4CNZA 2J7KA 1NK6A 2ZNZA 1FKOB 3KK3A 1YWXA 2C42A 3DOKA 1SH3A 1Q82T 2DVIA 2MY8A 5M2PA 4L6V3 2KHDA 2N3LA 1RTJB 1FXDA 2KT2A 3HLUA 4ED2A 1N32F 4NCGA 2IVYA 2IHR1 2GQ2A 2GW8A 4GO5X 1U1RA 4IO9Q 5G2SA 1SUQA 4F25A 1VBZA 3PY8A 1LXNA 2IVMA 3MURP 4ED0A 4IG0A 5CCLA 2CJ9A 3MAQA 1N0VC 2E1AA 3T1HF 1X4FA 1ZOTA 2ILZA 4A8FA 1X0FA 1OO0B 2K3IA 1YRUA 2YWHA 5EN1A 1TL3B 3HO1A 3PACA 3DLBA 2LXFA 4DV7F 2UU9F 2APOA 5EUHA 3PO4A 2E66A 4NA3A 2W25A 4Q43A 4WK3A 2PMHA 3HVAA 2E5IA 3PRBA 3TR5A 4LF6F 4RKUC 2VPYB 2X1GA 3PW2A 1SJ3P 1QSLA 2XSJB 5KT2A 3IRWP 1REVA 3CCQS 2UUCF 1ZAXA 2DH8A 4IO1A 2XCAA 3N6MA 4G1PA 1HBNA 2ZKUA 4CH1A 1P1LA 2DNMA 5L8RC 2JL9A 1JLGA 2EW9A 3BGUA 2W9CB 3CC7S 2A10A 2Q79A 3CD6S 3QIPA 5G4DA 1LWCA 3IBWA 3OHBA 4G3IA 3G96A 3V6HA 1HR0F 3DOMA 4PQUA 4MIBA 5DG9A 2ZHAA 4XPCA 4IFYB 4HKQA 4K4VA 4Z2XA 3MECA 1IJFB 3D1HA 1ZH5A 3OHAA 1UFLA 2NQRA 3FEZA 3US5A 5L1KA 1IJEB 5KFMA 4KPYA 3R3TA 4WFBQ 1XR5A 3K7RA 3CDEA 1VRUB 3M1VB 2LDIA 3J7Z5 4QWAA 1FT8A 2HHSA 1UVNA 4DDFA 5A8KA 1I6VD 2HNZA 1N5YA 4DFPA 1QAYA 3U1NA 1G8RA 1HMVB 2NQKA 2C28A 1FRJA 5LSRA 2ZC4A