5D8HB

Crystal structure of the base of the ribosomal p stalk from methanococcus jannaschii with antibiotic thiostrepton
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
207
structure length
207
Chain Sequence
MAPWKIEEVKTLKGLIKSKPVVAIVDMMDVPAPQLQEIRDKIRDKVKLRMSRNTLIIRALKEAAEELNNPKLAELANYVERGAAILVTDMNPFKLYKLLEENKSPAPVRGGQIAPCDIKVEKGSTGMPPGPFLGELKSVGIPAAIEKGKIAIKEDKVVVKKGEVVSPKLAAVLDRLGIKPIKVGLNILAVYEDGIIYTPDVLKVDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF THE BASE OF THE RIBOSOMAL P STALK FROM METHANOCOCCUS JANNASCHII WITH ANTIBIOTIC THIOSTREPTON
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ribosomal protein
molecule keywords 23S ribosomal RNA
total genus 46
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d8hB01
3.90.105.20 Alpha Beta Alpha-Beta Complex Molybdopterin biosynthesis moea protein, domain 2 Molybdopterin biosynthesis moea protein, domain 2 5d8hB02
3J7YI 5GAEI 3JSYA 5GADI 1ZAVA 4V19J 4UY85 3A1YG 2QA4G 4NWBA 5D8HB 5GAHI 3J7Z5 1ZAWA 5D6GA 1ZAXA 5GAGI
chains in the Genus database with same CATH superfamily
1SC3B 2XSFA 2Q6BA 3TAPA 3BPSP 3OJUA 1UTAA 1HI8A 4LF6J 1FWLA 1H2TZ 4NCBA 3FC9A 4X65F 4NYOA 3HJFA 2XWYA 1KNZA 2HNDA 3MTJA 4O44A 2CZVC 5ERQA 4ZJOA 1P9YA 1KHWA 4F4KA 5K8MA 1E6YB 4DR6F 3CJQA 3DLGB 3KTQA 5F0UA 3N4WA 3VQSA 1BQNB 1HBMA 3DGVA 1QE1B 4KBIA 2ZVIA 1R89A 2W2PP 3IWXA 4C3KA 2YKAA 3CGIA 5B0BA 2ASDA 1KS2A 2CWKA 5L39A 4LR8A 3C16A 4OX9J 2LP4A 2CZ9A 4ECYA 3VF0B 3MEGA 2N4CA 3PM9A 2DRAA 2M4MA 3UR3C 1IBKJ 2DH8A 2UUAJ 1G1XA 2BRKA 3M32A 3H5XA 4KKOB 3CWJA 1YRTA 5GADU 3CCTA 1FKPA 2H48B 1ELOA 1XIQA 3C15B 3POTB 5KFFA 4ED3A 4ZPWR 4NXNJ 3MR3A 1F6TA 2B8PA 1HMVA 1BHNA 1Y10A 3GG0A 3KNGA 4NA3A 4A8XA 2W8LA 3IC1A 2HHPA 2C2ZB 3QT6A 3ZZZA 4NE9C 1UL3A 3CSKA 5HVGA 2HS0A 2I0XA 3UD5A 1U2FA 1CG2A 4EBEA 2ZEJA 1HI0P 4FNIA 3LTOA 2VD3A 3DN9A 3BO4A 2XLIA 4O3SA 4C6AA 3R2DJ 2BKNA 1PYOB 2QO3A 2A2DA 3NRBA 3KJVA 1EQ0A 1GQEA 3CW2C 3GJQB 2XI2A 5HMWA 2Z56B 1CJTA 5HBMB 3NGKA 2OJ3A 4DN0A 1BWEA 4FYVB 1R0BG 1RTHB 2P9EA 3BH7B 3KDOA 1T3OA 2YTCA 3OR1B 1W2IA 4MAKA 3UN5A 1NU4A 3Q0AA 3EGNA 5FLXU 3KHRA 4USWA 3EUNA 3RBXA 5HQLA 1R0CB 1NEEA 1S1WB 2JX2A 3BJYA 1HNWF 5HQ8A 3W8GA 1W7WA 2BJ3A 5ETQA 5KG5A 3OTBA 1PKUA 4YFUA 3LP2B 3P3DA 1M5VC 3OUYB 1S1UA 3TR5A 3AB4B 1B0TA 2A18A 2WCXA 1JMTA 1Z2ZA 3OR2B 4LRDA 5IV3A 1QTMA 4GKJJ 1LWEB 1RA6A 2AT1B 3TJ9A 2GHPA 3VR1A 2V34A 3V6DB 2BDPA 2DNYA 3I0SA 2EG2A 4DL2A 2B9WA 2XS7A 5ADZA 4WFZA 1LWFA 1HQUA 5KG4A 1QE1A 4IR9A 2FHMA 2VU5A 1FRHA 2DGOA 1IKVA 3G6VA 3HSZA 2BE2B 4O4GA 4PYDA 1RADB 1WF0A 4DLEA 2CQBA 4O0NA 2CYYA 3QRPA 4FP9A 2GHWA 3G87A 2VDHA 3MEDB 5IM0B 5LOQA 2Z2YB 1N33J 2PEHA 4RNHA 1YQHA 4ZN1A 2QRRA 1PBUA 3PRVA 3HP6A 2PGCA 3QIDA 2W9BA 4ZLNA 1S6QA 2VPXB 4PR6A 4TY8B 2NPIA 3FSXA 4J9SA 1N32J 1JXVA 2FD2A 5KFZA 2H5JB 3ZTRA 2ZH5A 2KT3A 1HMVB 2VQFF 2ZDOA 3O2IA 4ANDA 3ENQA 5A6WA 1IR0A 4ECTA 1D8ZA 4FF3A 3OXGA 5AE2A 2V68A 3EMTA 4B3OB 4J9VA 4IG0A 3W2VB 4FS1A 2ZZNA 1MWZA 2UU9F 3C19A 2V67A 4MFBB 4MIWA 4EZ9A 3KK2B 3J81U 1W26A 3D3CJ 4WZMA 1TKZA 4PRFA 4G1QA 3KK3A 4ZLJA 3G8QA 4LBPA 4C0BA 3DLBA 2FIUA 2KM8C 4Q0BA 4FYDA 1A9NB 5HL7Q 4NYPA 4OL8A 1TZ0A 1U0HB 5KFEA 3IRWP 4M5DB 3DRRB 4ZP7A 1F60B 4NEYA 1DY3A 2BUNA 5C24A 4BCAA 3KLFA 1TL5A 2BJ1A 4F2SA 2B9EA 1YJUA 3T19A 1XMQJ 2MQNA 2HWHA 2XMVA 3BREA 1EETB 3GYXB 4B3SJ 4DX5A 1X5TA 5DETA 5DLGA 4LF6F 1RAJA 2VFRA 2R7OA 3U27A 3J7A1 2ZH7A 5LT5A 2FY1A 3SZ2A 2F4FA 3OR2A 2ZDPA 5CAAA 1W2BR 4OMFG 2HMIA 1RCOB 3M8QB 1TR0A 4U7UD 4DV4J 1YBAA 2HS3A 3MMAA 3QT8A 2CQGA 1JLFB 3P4UB 4ZVUB 3TI0A 5I3QA 9RUBA 5H9EK 2V94A 4KPCA 4UUXA 1LWCA 4H4MA 4Q8EA 2RT3A 2HVIA 1XMOF 3TX8A 3U1MA 4RW4B 2MQQA 1LW2A 2C3MA 5KFLA 2FHKA 3MAQA 4MMOA 4PD1A 4FBUA 1IBKF 3WX8A 4USVA 3HVAA 2IDLA 1N54B 3SSSA 2E1AA 1XJWB 1AROP 1CSJA 2D7SA 2HBYB 2OP5A 5H1SV 2C2EA 4DUYF 2CIMA 5J2NA 1CPZA 5KG2A 3RW7A 3KLHB 4JI8F 1JLFA 2JFDA 2W9CA 4HKQA 4HDHA 1DURA 2Y1LB 2DHXA 1P1LA 2MZSA 4H4OB 4XK8C 2KHDA 3HZEA 5E3PA 4JV1A 1EP4B 4M5IA 4EI2A 4HL9A 4NRUA 5KFGA 1WHVA 2HHTA 1EHWA 2AWZA 3Q8UA 2VFVA 5FDLB 3W63A 3BBCA 1RAGB 4ZCLA 5KFJA 5F8GA 2PA8D 3N79A 3HM9A 3OW2R 2UXDF 3O5TB 1T95A 2GQ2A 4LF8J 1I94F 3IGNA 4KH0B 3SBMA 2Y0SD 1FDDA 2QSWA 1WTFA 2OFGX 4L3KA 4P72A 2CPXA 4RPFA 3K5NA 2ATLA 3OD2A 1WOSA 3GTYX 1U0HA 1FWPA 1LW0A 2AIRB 2VG7A 3WHIA 4YR0A 4ZVGA 3PZPA 2HNZB 5ETTA 1ZTTA 1YGYA 3JXOA 4MH8A 3DLHA 4OI0A 4OYOA 4ZA1A 2X51A 2JEJA 1B99A 3CEDA 3DMJA 4IDKB 4J9QA 3SYZA 2UVUA 4JOUA 5C42B 4IFYA 1R0AA 1NRKA 1RT1B 4OHZA 2ZKTA 1C0UA 3QFWA 3NGTA 2DGUA 2HQGA 3IG1A 4N77A 4NX9A 1FRIA 2B4VA 1NDPA 3FEYB 4RWWA 4USKA 3FMBA 2AJ4A 2GIQA 4UZCA 2BBEA 4A8OA 3WZ0A 4LMZA 1T05B 1FKAF 1IBMJ 4UY8T 1KWMA 4UOHA 3QZ7A 2FLNA 3X1LB 3I4PA 4UY85 5AXKA 2K3KA 4UZBA 4EU0A 4LJMA 3UW1A 3NS7B 1SC6A 6AT1B 1ZETA 2E1CA 4C11A 1U7LA 2OSQA 5AXLA 1FERA 1JLBA 4OQJA 1HKAA 3D0GE 4G1IA 3H4DA 2VJUA 1QTNB 1HBUA 2X1BA 3I6PA 3UDLA 2IBOA 3ZTPA 2L41A 3AHPA 3FQLA 4ED7A 2CJXB 5FIIA 4M8LA 4ZVFA 2ZUGA 2IA0A 4A48A 4DHVA 3KLVA 3M8SA 4ECXA 3QBCA 5EHHA 2VA3A 4DL3A 2VPYB 3NKYA 3D1OA 3RGIA 4X64J 4A8WA 3IO1A 1YTYA 1OPZA 2HFUA 1IJFB 2ZWPA 3X3UA 4ED2A 1NK9A 2H4WB 4WK3A 2HHQA 4DV5F 1FE0A 1ZPVA 2N7YA 4NLYA 3RUBL 5KT3A 3MWBA 3QGGA 1YBUA 4Y34A 1VOMA 3ETOA 3QAEA 2G9OA 2BMBA 2C2KB 3EM1A 4IH5A 2CPIA 3QGIA 4L73A 4KC5A 4ICLA 2V8HA 1ZYQA 2F1FA 2LECA 2XY6A 1R43A 3GWCA 3G2XA 4FS2A 2HBQB 2QA1A 3T9ZA 3MUMP 3B4DA 4PG8A 3HD2A 1HBOA 4YY3J 1SBRA 1GMVA 2I9SA 1S6PB 3GV7B 2HZAA 3I87A 1X0PA 2XMKA 5KT5A 3CUNA 4WKRA 4JI3F 1S49A 2DHGA 2L9WA 4XDDA 3D68A 3C16B 4X4PA 4K4SA 1U09A 2XYPB 1Q8KA 3HJVA 2O67A 4RUBA 5ETNA 2RS2A 5AXNA 3DXBA 1YJVA 2CWXA 3NBPB 1RKJA 4DWIA 2HK3A 3UI3A 3J81j 1G6BA 2NQVA 4M5LA 3KK2A 2KTQA 3M9NB 1KD1T 1M0SA 1OIAA 5IT9Y 1FHTA 3H2VE 1WWHA 4NZ0A 4B3RJ 3BPDA 1H2UX 3GPAA 1NDKA 3P45B 4KGXB 1WEXA 1ZBTA 2CQHA 3QJLA 2DT9A 2WVEA 3NCQA 4LF9J 1VIXA 1M5KC 2PEBA 2DY1A 2WSFC 1ZM9A 2R42A 2ROEA 3HF5A 3Q2SC 4F0KA 2HW3A 1SB6A 1VK8A 3L9ZA 5D8HB 1TUWA 1IN0A 2J6TA 2ROGA 1JWWA 1RT4B 1R6YA 4DPXA 3IR6B 2OELA 2GAHC 3A1YG 1Q1KA 1OY6A 2PE8A 4YUDA 1VQLS 3HHNB 2IAJB 2R7RA 1FXLA 2O1PA 4D3HA 4C8MA 3W61A 4DUYJ 3DLEB 2CJQA 2F63A 4ZCKA 2KXHA 2CXEA 1S79A 4OZ0A 2ZH2A 2PIIA 4ZIWA 2IFXA 2KZMA 1YVFA 4M5NA 4NZ6A 3PYFA 4YY3F 2PI4A 3BKUA 2XSJA 4NASA 2ZD1B 2RU3A 4DV1J 4PUOB 2F7VA 2R3VA 2RQMA 2HQ3A 3DRPA 2Q43A 3VALA 4ZOSA 5BYQA 2BQUA 2CNKB 3PDNA 2BE9B 3SCJE 4YEAA 4TU7A 1K0TA 1WG4A 4WBFA 1SJ3P 1S1WA 3P6YC 2DNHA 2IA6A 5G4DA 1X5OA 2DH7A 1G8LA 3JSBA 4ZPVR 2AF6A 3NLCA 2DIVA 3BSAA 1L5UA 1JX4A 1K0VA 1BY9A 2J0WA 2E5LJ 1DQ8A 1HWJA 4IOBA 1VQNS 2WONB 3THPA 3TW0A 3OHAA 2KG0A 2JLFA 4B9LA 1X5SA 4USJC 1OPIA 4I69A 4CO0A 1WACA 2I5JB 4FZVA 3DOLB 5CQGA 1KEKA 2BQRA 1QSYA 5DZ7A 4G65A 2P9CA 3FUYA 3IAM9 4OX9F 4FYYB 1RWNB 2EVZA 5KFSA 4KV8A 3VV2B 1Q7YT 1U1NA 3D6MB 3BGUA 1S0OA 3AD9C 3KLIA 1U1MA 3CCSS 2LXFA 1Q81T 1QDUB 3KJNB 4CLUA 1N0VC 1FF2A 2KYXA 3PACA 3I32A 5D0HA 3US5A 5HVHA 4X62J 4TYAA 3K7RA 4B9TA 4RO0A 2AQ4A 1VK3A 1XR7A 3FJ2A 3GIJA 3IGVA 4JBCA 2HWIA 2OSRA 3T1HJ 4FKYA 4CZCA 5E3CA 4FDFA 1PGZA 1FFWB 5ETLA 5JVGQ 3SSRA 3D6HB 2OEKA 1U1KA 2K7JA 1D9DA 2J6SA 4GKKF 3QIPB 1YHQS 3KLIB 2IHR1 3LWMA 3C14B 4ZP6A 1M5OC 1FEEA 3NWGA 1S1TA 2EG1A 4GMKA 2MDAA 2DNZA 3UCGA 1UJ5A 3M32B 4N8NA 4QW8A 2YNIA 3EZUA 2QV6A 5DS7A 4XPEA 2E5LF 5EX3A 4MKBA 3IG1B 3A8KA 1VC5A 3G9CA 4DV4F 3MR6A 5D78A 1J5OA 1KVKA 3M8RA 1YWXA 4Y65A 3CMAS 3TAQA 3I9ZA 4YHHF 3RAQA 2RILA 3AJDA 3MM5B 2ZOFA 3CJRA 5C24B 1U4BA 4C8ZA 4J9MA 4QOTA 1CVJA 2CVIA 3D1QA 1YK9A 3EJMA 3G82A 1FK9A 3A8JA 1RAHB 3GIRA 3ZC4A 1H72C 3L7OA 1U24A 5M2PA 1IJEB 1FE4A 3I5CA 3MEEB 2KXNB 1ZM4A 3OTDA 1QAXA 3QT5A 4LSLA 5ETSA 4DQQA 3DLKA 2BVZA 2HWTA 3LPEA 2JWNA 1NPKA 2K1RB 4DG1A 4ZLLA 2GJIA 3EWGA 2P6TA 3IA0A 4J90A 1N36J 2AJQA 3HSDA 2YX7A 1DBDA 1SV5B 4PKDB 4RUAA 1XK8A 1CQMA 2O66A 1HNIA 1MROB 2RS8A 2XMAA 3R5GA 4DV6F 3T1YF 4GKKJ 1PSDA 1T9XA 4LSZB 1WI6A 3I5AA 5K14A 5J1EA 3FSIA 3CXCR 4USUA 4ZVTB 1JXLA 2AGQA 1QVFR 4C0HA 2LU2A 3AAWB 2IJRA 4KT0C 5F8NA 3FZ2A 1BXNA 3OUYA 1DTQB 2OPPB 2XNQA 5U47A 2QL5B 3TOQA 3VGUA 1A0OB 1RTZA 1TL7A 1ULRA 2XMUA 1ZPWX 3AT1B 4ATNA 1KP6A 1VCTA 2W24A 1S0NA 2OUGA 2IPOB 2PC6A 1B0VA 3WBZA 3BBBA 3N0VA 4WFXA 2C3UA 3PYGA 1VQ9S 4P10A 3BQ1A 2ZBCA 1CULB 1URRA 2UZAA 2KM8B 2LQBA 3I0SB 4P9SA 2B4PA 2ZZMA 4I67A 2G0CA 3ISND 2VB6A 5F9LA 1SJ4P 1H3DA 4X84A 2R7SA 4WFAQ 1IR2A 1QM9A 1SQFA 1X31C 3PX4A 3CJ8A 1VHIA 3UVJA 3BDPA 2DTJA 1KVJA 1SPBP 3ZZYA 1MMNA 1UZHA 2V5HG 5IOLA 1N36F 2AKWB 5CYMB 4C2MA 4NCGB 3EGZA 3HFVA 1MU2B 4E8UA 3QQCD 3V4IB 1NKBA 5CXTA 3C2PA 2LQ5A 2WOMA 4LFBJ 3BZQA 1XNQJ 1O8BA 2XS5A 2HGLA 1HNZF 4P2XA 3FDSA 3KG1A 2CUYA 3GYGA 1R8BA 3M2UA 1PCAA 1XMQF 1NBEB 2O3DA 3BM7A 4OI4A 1X7VA 2YKMA 1I5OB 2DNLA 4ZS6A 2DISA 3AXKA 3NGRA 3PYEA 4YDDB 2WHOA 5G2RA 2HHSA 4TNOA 4AYBD 4Y0FA 3DRSA 3W9JA 1CBKA 3C15A 1X4CA 2G2OA 3L4BC 3POTA 2PSZA 4FNHA 4QIVA 3TAMB 4A46A 3V6KA 1CQNA 1KTVA 1R8CA 3OXFA 3MEGB 4O4RA 2Y3YA 5B0AA 4QR2A 3CDAA 2GFFA 1PBAA 1NPPA 3Q8YA 4I0WA 4QIGA 4DU7A 3ELHA 5F8JA 2XCAA 1NK4A 2XNRA 2FGCA 3MM7A 4DV0F 3DRPB 1UMJA 5A6PA 2M88A 1UFWA 3SDEA 2GQCA 7FDRA 5DM7Q 4F8RA 3BN7A 1OJ4A 3GMGA 3GG1A 5C25A 4PG6A 2ERRA 5GAGI 4FYWB 5I42B 1U1LA 3RRGA 1X4AA 4J9KA 1Q95G 1AYEA 1JJHA 2VBXA 4DR4J 3AQOA 1BGXT 4I6YA 1REGX 2CQDA 2E66A 5BR8F 4EK2A 3R6LB 3Q83A 3LWLA 2H4YB 2ROPA 4J37A 5J1NA 3OXLA 3PX0A 2YNGB 1XWLA 2CPEA 2FJAB 4A4JA 1RCXB 2IVFB 4DSLA 4CLPA 1HNZJ 4V1Ak 2VODA 4PXBA 1ZZFA 2OPSB 2C42A 1SC1B 1RHUB 1AUDA 4J9UE 1MNEA 4QYZK 2CVEA 2E1RA 1FD2A 2Y9HA 1KBRA 2XCPA 2QA4G 3KJFB 2APOA 3GJRB 4X4QA 4LF8F 2K06A 3J7Z5 3OHBA 4B3RF 2I38A 5KFAA 3RZAA 4YOEA 1UEVA 3CJ4A 4WXWA 2CJAA 4OI1A 4K4XA 1K44A 2BV3A 1N5TA 2CQPA 3HX9A 3NCRA 3TWZA 4DX8H 1PAUB 3GFZA 1N34J 4M63A 2HRUA 1UAWA 3PEHA 1KQFB 2HQCA 5BYRA 2GQQA 2BRLA 4NXMF 4OZ2A 3PKMA 3VAHA 3ZNUA 5A8WA 1RTJB 2DYAA 2E7VA 3R5JB 1X9SA 4PQUA 3NGUA 3ZZTA 4QU7A 4OIXA 1IKXA 1IXKA 5CCLA 3R1LA 3I0RA 3EDRB 1CJUA 1H6KX 2N3LA 3K5MA 3V6JA 2AGPA 4LF5F 3W5YA 4QR1A 3DM2A 2ASYA 3ZFVA 1AZSA 4DZDA 2PFDA 3TAMA 3RR8A 3CCZA 1J5EJ 1BQMA 1Q5YA 3G6XA 2KVQE 1YJNS 1YDLA 4JV5J 2R8HA 1WG5A 4R0EA 1UCNA 2W4DA 3A3NB 3C3LA 1JLGB 3MM7B 2MKYA 2DHHA 2MHEA 3IWNC 1HD1A 2C2OB 3CCQS 3KK1A 3C6TB 1Z2LA 3DI6A 3P5TL 5FLXY 1S9FA 5CHCB 5DDRC 2R8JA 4OLPA 1BUXA 3HHEA 1O5JA 1K73T 4JI2F 1WF2A 3TP2A 1RBOB 3ADAC 1N5VA 2UUCJ 2OD4A 3PFOA 4IO9Q 3GILA 3C6UA 3ZZPA 4Q7AA 4PUOA 3MM9A 3R2CJ 3CTRA 4NOHA 1V9OA 1TKZB 2CG4A 3DHWC 2L3MA 5KFHA 2GS8A 1SUQA 1UWBB 1S9EB 3DOMB 3ILOA 3FK4A 2JRSA 2ZE2B 3TVZA 1LK7A 3R27A 2G2YA 3KHLA 4C0OC 5G2SA 3EPGA 1RWUA 2A10A 4ZCIA 3AY0A 2IRUA 2ZBIA 3PHEA 4AFFA 4JI7J 2XB2D 3JSRA 2DXEA 2MLYA 3RU0A 1V5IB 2M70A 2ZOMA 4BC9A 1YSJA 2MKCA 2OKQA 2HFZA 2RDIA 4IFVA 2HK2A 1EARA 4PCQA 2MZTA 2W9AA 5D3GA 3I4HX 1LQ9A 3E01A 3DDKA 2FZCB 4X4NA 4TK1A 3R5DA 1BD6A 2CDRB 3H0PA 3U1NA 3M2VB 4K5RA 4FXVA 4WFYA 2V4JA 3CULA 3LP0B 2OO4A 2UV8A 4JI1F 3DC2A 5C2CA 3KHHA 1N4LA 3VGSA 1Y5NB 2I6WA 3UVJB 4RW7B 1FCAA 4AQYF 2Y1RI 3OV7A 2DHAA 2V4RA 2LXIA 1VMBA 2RQ4A 3PKYA 4M5JA 2F4VJ 3WC2A 2MY8A 1VJQA 1AFIA 4DFJA 3H2LA 2AEJA 2G1DA 4NI2A 4DF4A 1TUVA 1X4BA 4PEOA 2BXJA 1TP7A 1LWXA 3A13A 3M8PA 1HQEB 3DFEA 4NLWA 3CCES 2HZCA 5EN1A 2IRXA 1MMLA 1F2HA 2Z58B 1NXIA 2B5JB 3BDEA 3NBPA 1FTCA 2DNRA 5B0EA 5LMUJ 2IJFA 2DGVA 2EKYA 4BLGA 3NP5A 5IQQA 4HDGA 2RQKA 4PXEA 5G0RA 4YR2A 1T9WA 3D2WA 3J80U 1FTRA 2P8IA 3ZZUA 5B0FA 2R2RA 3RBEA 2FJEB 2EFPA 2RIJA 2VG5A 2Z2LA 5DQIA 1WTBA 2NQPA 4AUKA 3C6UB 5KT4A 1FT8A 3VGTA 2KJVA 3GFHA 2XLJA 1V3ZA 3BGRA 3M30A 4QWBA 1T3NA 3MM8A 3T3FA 1IWAA 3NOGA 4NEZA 3QSIA 4NLRA 2W7PA 3PRDA 3WX4A 1HW9A 1KHVA 4HACA 2OPRA 4LSNA 5KFCA 2GZOA 3TYTA 2YWWA 3N6LA 4X2BA 2F40A 1NH8A 3MCNA 3MECB 1TKXA 1RI7A 2ZM6F 3FBBA 2RHSB 1NSPA 2V0NA 4EBDA 5HVFA 3W2WB 1Q86T 4WZQA 4X4VA 3EVOA 2CQ2A 4F67A 1X4GA 4U91A 4EMDA 4U96A 1FRXA 1SJRA 4F3QA 1FKPB 2OAUA 5HJXA 3PX6A 4KE5A 3E01B 1RKIA 5BYSA 4X65J 4C4WA 2FYXA 3MCMA 3W8PA 4Y2AA 3OSPA 1KVIA 2QL7B 2G2ZA 3KXDA 4B3MJ 3BQ0A 2XULA 4F25A 2UXCJ 3W9IA 2YPZA 2MQPA 1WHYA 2UV8G 3KLHA 3H5YA 4XPCA 2ZJRQ 4ED8A 3MECA 2HYIB 4JI5F 4ECSA 5IWAJ 2E9RX 2POKA 2YWGA 1RTIA 1SQGA 3BS9A 4RWXA 5LL6d 1F3VA 1RWWB 1Z4UA 2CFXA 3CMQA 3ENAA 4WIIA 4UQGA 2LQJA 1OSCA 2QZ8A 3FBCA 4X4TA 2ZH3A 2QJ3A 1NB7A 2V2ZA 4CCHA 4C9DA 1U6ZA 2MQOA 1C0TA 3A3PB 4EBCA 2HMIB 2FVCA 2MY7A 3G8TA 3P5BP 4HHJA 4TLQA 1UWAA 3JQJA 1RLCL 4RW9B 2QSFA 3D66A 3GB0A 1IKXB 1FWKA 1VR6A 4ICLB 4MT1A 3W5XA 3ZO7A 4ETXA 1UZ5A 5IT4A 2DNQA 2VBWA 1FJCA 3L95X 2C1EB 3HVWA 4XO0A 5MLCV 2GCFA 2MPUA 1VQPS 4QW9A 2NSBA 2W9CB 4F50A 4DCOB 5KFQA 3CCRS 3BO2A 4A8QA 3V4IA 5IT9U 1LXNA 1S1UB 2KHCA 3LGNA 1OSDA 1L3SA 3MF5A 2HURA 3QIPA 2ZH4A 5J2NB 3PJWA 5DDPC 2RMLA 3FGVA 3R97A 1XBWA 2UUBJ 2BEFA 3LUYA 5DQGA 2FVSA 4A8FA 1PYSB 2ZFHA 3PYDA 2CNOB 2YWKA 3SEOA 1RABB 3BB5A 1HBNA 4IQMA 2LEBA 2MZQA 2FB0A 1OQ6A 2DGWA 2D74B 2E5IA 2WVBA 3EXYA 3HMJG 4YP3A 4F3OA 4JI7F 4DR4F 4W98A 3R7NB 4NCAA 4TK3A 2LCWA 3M8ZA 1G4CA 4DR3J 3M4XA 1X4EA 3H40A 2GVDA 2J9DE 3MEDA 4EFAC 2F65A 1XN9A 1V6HA 4JUZA 3M9MB 5E0OA 2FPHX 3DYAB 2P9GA 3F44A 4USHA 3H5UA 3ZTSA 5E41A 3MPDA 1FKOA 1NDCA 2KFYA 1HQ2A 1RT3A 2G13A 3AD7C 1TQLA 3GSIA 2F3JA 3MMBB 1FNMA 5CYQA 3RB0A 1S57A 2HFVA 4CP5A 3GP9A 1HBNB 4ZPBA 1S99A 2ZH9A 4MFBA 4P75A 2VPWB 4DXLA 1VQ5S 2QX0A 3LGHA 3IBFB 2DXDA 2R7QA 4MJKA 5E2QA 2KT5A 3G6ES 1H73A 3TZWA 4MYTA 4H4KC 2H1YA 2VOOA 3HPOA 1YZ7A 2JDJA 1LFWA 2B4UA 2JHEA 3OFGA 2MQLA 1ITPA 4I1TA 3CCWA 3H2UB 3PXGa 1URNA 4M5DA 3KLFB 3VGVA 1PIEA 3HKZD 4I6WA 1P1TA 3DLKB 3DLEA 3AA9A 1V3RA 5F3TA 5HJYA 1SKWA 1C0TB 2E7XA 2J7KA 4DV2F 2XYGB 3BH6B 4WU3A 1UPPA 3FKBA 4MYUA 3D4JA 4X4OA 1EZZB 2MJNA 1QY7A 2VC0A 1R8HA 4OFZA 1KN6A 1MWQA 1VHFA 2FVQA 3HXMA 4DS5A 1WSVA 1L3UA 3VAMA 8ATCB 2Z4PA 1T94A 1S1XA 2EI5A 2YKNB 4HH0A 4DS4A 3ILLA 1NJZA 1S7HA 1NK0A 2FHJA 5HMXA 2FDNA 1CJVA 2VZ9A 3DXSX 4RNFA 3JSMA 4M5HA 1WC6A 5F9NA 2OHDA 1S97A 2JEGA 1AT1B 4CTAB 4I6AA 4L74A 3OVAA 5HI7A 3ZXWA 2CJKA 2LU1A 1RT5A 3KJVB 2ZHAA 3Q8SB 1RWXB 1X4HA 2V9KA 5ITHA 4Y2MA 1TL4A 1WC4A 5A0YA 5MAOA 2VFTA 2AYGA 3BGFA 2RUGA 1OS5A 2QMWA 2W4PA 2CDQA 3W1YC 4ZPDA 3LGMA 3FFIB 4DI6A 2MKHA 1HNVA 2V2VA 4CLTA 5KFPA 1N5YA 3TJ8A 4U8YA 1YBTA 2AJ0A 4MIAA 1TELA 1H74A 2WBRA 3QFHA 5DZ6A 5EWGA 1WD6A 1N5QA 4EZ6A 2WOMB 1N34F 1V5VA 4H4OA 5GAHU 1KC8T 1GX6A 3KUEA 5I4MA 3PV8A 1LWEA 1JLEB 3CCLS 4DV2J 3VVTA 4CM2A 3V6DA 4OYAA 1U47A 6FD1A 3PRBA 4ZVRB 2GVZB 4MK8A 4OV1A 1Q82T 4DL5A 3LQVA 2HIYA 4CQ1A 1R6VA 1RK8A 4DDFA 1Y5LB 4I64A 3V6HA 2NQKA 2B56A 4O4GB 2ZBPA 3MPUB 2GNKA 4DBQA 4TU9A 1WKKA 2IVYA 2MMYA 1NSAA 5HSPA 3Q24A 1FDAA 5JUMA 3TZXA 2EFQA 3DLLQ 4F36A 3TQ1A 1YJWS 1U6FA 2XO7A 3M9OB 2GVZA 2VOPA 1RUSA 4OHWA 4JI8J 4PWDA 4QIEA 1FJ7A 4ELUA 1HWKA 4OHYA 4C3LA 2AZ1A 1S48A 2PD1A 3D6FB 4DV7F 2U2FA 2AYMA 2AEMA 4IRDA 3LO3A 2GMJA 1SL0A 4UQTA 1TL1B 1L3TA 4E2FB 4ES2A 5DQHA 3NS6A 3MDFA 5THWA 4C8YA 3CF5Q 1CS4B 1SKUB 5K9FA 1NJWA 1HNIB 1AA1B 1MROA 1RU1A 3DKDA 3EPIA 4O0IA 2HBZB 5B0GA 2ZKUA 9ATCB 5ETKA 7AT1B 3T5HA 1VQMS 3NCPA 1M1HA 1R8PA 1WHXA 4X4RA 1VISA 5J2PB 2DPJA 3IM9A 3NG8A 2K8GA 4KHPF 3FRZA 4USTA 5GAEU 4DCPB 1U1RA 1KTQA 3J81Y 2DBBA 4GVLA 3V81B 1KOHA 2BW7A 1TL1A 4PG4A 3K5LA 1MMDA 4DR3F 2DEIA 2JH3A 2J9CA 3I56S 1J5EF 2ZOGA 1F5AA 4QCLA 4W92B 4PXCA 3W3SA 5EWEA 3ISZA 1WF1A 5C7PA 1FXRA 5L38A 4YB5A 3QMQA 2ZC3A 3ZTQA 2GIRA 2NXUA 4X66J 3DOKB 5KFBA 1HQMD 5ETPA 2LDIA 2NCKL 4AD6A 3JSYA 3B4MA 3IR5B 3KUHA 1B3TA 3QLHB 5E5NA 5IC4B 2OPQA 2GHVC 1Y3JA 3NNCA 2LLZA 2HHHJ 2XWXA 5IZHA 1KOOA 5KFXA 5IXUA 1APSA 3JTNA 3MAHA 4U90A 5KG3A 3V4MA 1S0VA 2IDEA 4F2RA 1VQ8S 4K0KJ 3IFEA 2RRBA 1X4FA 1XR6A 1Q8BA 3FNNA 3CO0P 1N8RT 1SXLA 1RB0A 5K8PA 1FKOB 2HG4A 2KB2A 3K5PA 1HL6A 3OVSA 4K5SA 4RR5A 2BANB 5SZTA 3J7AN 3MM8B 2KRRA 1P27B 2QFIA 1XQIA 4B3MF 3IMQJ 2UXCF 4NCGA 1GTEA 2BA9A 3C6TA 2EFGA 4LFCJ 5KTQA 4UF4A 4DV3F 1UFLA 4WK1A 1VBZA 3MHYA 4U6PA 3EICA 2HPUA 2YBVA 3AOAA 3GSDA 3PG9A 4MKVA 4O23A 2ZJPQ 4B9VA 1RAEB 3D28A 2E1MC 1EKSA 3HD1A 3DU6A 3LP1B 1DLOA 1Y7PA 4BHQA 5KG6A 5AE3A 3K0JA 2UUTA 3PJXA 3E8OA 5KFDA 1RT7B 1VRTA 4DR5J 2YKPA 4AT1B 3HT3A 3MR7A 2QLWA 5EDWA 3NAHA 2BACA 2LA6A 4D3GA 4YQWA 1X9WA 3VCDA 4DSFA 3C46A 3QWPA 5HP1A 1A7GE 2XI3A 4E0DA 4ED1A 1N48A 2QLFB 1GX5A 4F04B 2VICA 1IBCB 4DSJA 2OLWA 2QG9B 3MM9B 1NJIT 4R5PB 4FVMA 3HVRA 4B3TJ 2QA2A 3IS9B 3H59A 1VBKA 2VONA 3NMAA 2EFNA 4Z7CA 4FPIA 4KO0B 2MLZA 5AE1A 1S76D 3G86A 5ERVA 3R7BB 2WAQD 2BJDA 3OFFA 4KB7A 4R25A 1RHJB 1C4AA 3KG0A 1N33F 4QPTA 2R7WA 5KFVA 1N0UA 1NJYA 2VG6B 3QRQA 2B6AB 4USIA 3I96A 4TY9A 2WTFA 1S10A 1TFWA 2NSCA 3DOKA 1RAOA 2QT7A 2B0GA 3M2VA 3P96A 1JJCB 5T41A 4RW9A 4CT9A 4LF9F 4EUVA 1F3FA 2CQ1A 2YNGA 5B7WA 1TAUA 3K58A 1N56A 2H9ZA 1RP5A 3VWSA 4YR3A 1TTHB 2ZC4A 2VPZB 3CCUS 5E3AA 1N88A 4Y2KA 1FDBA 3WQPA 4DR1F 3AH6A 4LREA 3OSNA 4ED5A 3THVA 3IBWA 3ICLA 2VFSA 3UE2A 1YJ9S 4NI2B 4NA1A 1SIWB 2JSXA 2VHGA 4Y2IA 1RZMA 5L1JA 4Z2XA 2HQIA 4A8KA 1ZH5A 3G96A 3A12A 3HKWA 5EWFA 3VQTA 1U2CA 1E6VB 3FCVA 3BEGB 4PABA 2I2YA 2KH9A 1OQ3A 3EZ5A 4ED4A 4IQXA 4LT6A 3TVYA 2BM0A 1RQ0A 3BSNA 2CJ9A 1SJQA 1UVKA 2W4CA 3Q23A 4RW4A 1KSPA 4DQIA 2J8SA 1Y3KA 3QT7A 2XHCA 3N6MA 4ZP9A 4RJVA 4P2FA 4Z37A 2AJ2A 3J80Y 1I6VD 2CNLB 5A2QU 3QGHA 4KRWA 1NK6A 2M3DA 4W4MA 5KFIA 1T3EA 3MD3A 3UDEA 2W2MP 2Y1IA 2ZVSA 3NOCA 2K7KA 3LAKA 1HARA 3CIZA 2HFSA 2J9DA 2W2NP 3CD0A 1AZSB 3MMCA 4JI0J 3KOAA 1DQ9A 1QAYA 4PAAA 4N41A 2WK4A 3N9UC 3CC4S 1NNDA 2WW8A 2ZHOA 4UTGA 1IKVB 2V9WA 4JI5J 1EJ7L 2BE2A 2MHNA 5KG0A 4JV2A 2EBGA 1JKHA 4DSEA 2HLUA 3RB3A 4CH7A 2XY5A 4JI6F 2D3OR 1S77D 3DHXA 3HFZB 1SJFA 3HHDA 1TKTB 2AX1A 1VQ7S 1XC9A 2DPIA 5I3UA 2DR5A 2XGPA 4GKJF 3MAAA 3OLBA 3QJJA 2R7UA 2HAFA 2V8PA 1VBYA 4U95A 3O44A 4X66F 1IR1A 1UA0A 1QUPA 3CDEA 3TA1A 1SKSA 1TVRA 3G4SS 3EVWA 1WKLA 1C1BA 3HVTB 1WOPA 5ETMA 3UFCX 3CJ3A 4O3QA 1SVDA 1LXJA 5HROB 5HLFB 4TXSA 1RDRA 5C2GA 2X3DA 2XLKA 2QYCA 3RAXA 1CC7A 1RT6B 1S1XB 2CQIA 2QLJB 2YKNA 3FMWA 3FRYA 2X3LA 3MEEA 1H7WA 5ETOA 1ZAWA 1NO8A 1U6BA 2PFFB 2L9DA 2QTWA 1U8WA 1T11A 4OI3A 5DJBA 5GAEI 4B9UA 3KK3B 5GADI 5JXSA 2WW4A 2D3ZA 2DNOA 2OPSA 2ALZA 2ASLA 2NQMA 1S5ZA 1T05A 1GMUA 4IFVB 4KR0B 1EB0A 3T5LA 3T41A 1ROFA 1JK9B 4LFCF 5KG7A 2QL9B 1JJ2R 4ZLPA 1H98A 1FA0A 3CIMA 8RUCA 5AT1B 2FLOA 5DGBA 3MCOA 1NMEB 4MK9A 1CJKA 4LQ3A 2N82B 1LEOA 3CJ5A 1P8GA 3AODA 1KONA 1NK7A 1GNKA 3Q22A 4PZVA 4DR5F 1DAXA 2DIUA 4GC6A 4WYLA 3M8QA 4J9OA 2DJWA 4DQPA 2HVDA 1CULA 3FEXB 4ZK7M 1IBLJ 1OYEA 2IYGA 4CM0A 2F8EX 3VHQA 3TUPA 3QGPA 2QLXA 4DV7J 1YJTA 4NWBA 2HQFA 2X3GA 4RBVA 1VYAA 2VKRA 1U1OA 1EIYB 2BABA 1RHMB 3B54A 4GO5X 4M5MA 3ZZOA 5LMNJ 4DSIA 3E2EA 1CLFA 3VAKA 2N4DA 2NYIA 3LANA 3GZ7A 1DLOB 5L1LA 3M7VA 4XDCA 3NAIA 1HNXF 1UVNA 2RDDA 3K89A 1H38A 3W9HA 1Q8IA 3BGRB 2HHUA 4FVCA 4CRJA 2YQ3A 2R4FA 3BGLA 3BYRA 3M2UB 4LFAJ 1HBOB 2MKIA 2AP6A 2GVDB 4EEYA 3GCXP 3ILIA 2Y1JA 1AUSL 1T02A 2VG5B 2MB0B 1K1SA 1QJHA 3P8BB 3S6EA 1B64A 2NQSA 1UEKA 1BC6A 1XR5A 1JXEA 4LIRA 4K8RA 4YMEA 3MM6B 4DFMA 1JLGA 2XZWA 4CLWA 2V4QA 4F3MA 2NR0A 1FX4A 2DNMA 2DNGA 3EXCX 5JJBA 5KOWA 4CO5A 1XMOJ 1DZ5A 2NQRA 3KMQA 1WELA 3PVXA 1R31A 3W64A 3FQKA 4ZVQB 4DQSA 3N01A 4CNYA 4DL0C 3OTOJ 2DY9A 4JP8A 5CYJA 2M8DB 2R8GA 5K5MA 2W9BB 5FD1A 1UFKA 2NUHA 4G3IA 2RU9A 4C7QA 2AYEA 4DF8A 5CZVA 1T9YA 5ETRA 2JEFA 1VLOA 3PR4A 2YX1A 4K2XA 4M94A 5HANA 1WEYA 1VRQC 3MM5A 5C5JA 3CCJS 3A4TA 1HPZB 3N6NA 3W5ZA 4KFBB 1EKRA 3D0HE 5L9XA 4CLFA 4IKAA 4KAIA 2F8HA 2EFVA 3OPKA 2WVCA 4CDIA 5HMYA 4F4WA 2E9ZA 2DR7A 1GAOA 4V19J 4ZVHA 1HI1A 4IFYB 1VFJA 3BSOA 3Q8PB 1R0AB 4ITSA 4V19X 1V3SA 1YLXA 4HTIA 4P73A 1HNXJ 4NMXA 1JIHA 1T9UA 3IXQA 1U49A 4NLQA 1BMQB 1ZM2A 2XZTB 4NPOA 1RGVA 4YN3B 4BWMA 1SKRA 5HMZA 1N52B 5KOXA 1RTIB 1T9VA 2YKQA 1T9TA 5KFRA 5F8LA 1HIYA 4DSKA 1FJGF 4YB1P 2E5HA 5HAOA 3BKTA 3LALA 4ZPCA 1LOUA 2K3IA 5J2QB 5E33A 3UCZP 2IY5B 4CTAA 1T03A 4RUCA 4RLEA 1ACMB 4PPZA 2UVRA 2NRSA 4URSA 1JLCA 4R8UB 1EETA 2FJXA 3A8EA 2PMZD 1IQTA 4ELTA 3LP0A 2GGPB 1NCLA 3AOCA 1QD1A 2IC3A 1MN9A 3ITHB 3CB4A 3TO8A 4ANCA 1NKEA 4I2QB 1D09B 1HNVB 4CH1A 1RYSA 1N5YB 3M8PB 4DX7A 4P7TA 2DD8S 5BXIA 4IH7A 1JLAB 1F9HA 1NLKL 1TV6B 2HKEA 2OEJA 2RF2B 1SJ1A 3UDVA 3T5KA 3K57A 3DNCA 5J2QA 2JVOA 4F0HA 2CPHA 2KL8A 3HSJA 3ONQA 1FFGB 1SL1A 4A47A 2KJWA 1HR0F 1U8SA 5HN0A 4NYZA 4DZ6A 2FUG9 2U1AA 3AB2B 4Q8FA 5F8IA 1LNQA 3K5OA 4NL5A 5EUHA 3Q89A 4QZVB 4ALZA 4B3OA 5D0GA 4B3SF 4IDKA 4TQRA 2VASA 2KFNA 4FYXB 1RBAA 1DARA 3OT9A 5T14A 2DGTA 1S72S 5M2RA 2B43A 4R0JA 2HAIA 3CD7A 1SC4B 4IR1A 4OZLA 4IOCQ 4KHPJ 4FXWA 1BQMB 3I82A 1DJ0A 3BGOP 3R5AA 2HVEA 4KH1B 4LRBA 5E3QA 3OJSA 1R27B 4F4YA 3CJ0A 4LBHA 3NNAA 3CDWA 3SQOP 2LMIA 2NXJA 5SUHA 5HROA 5HLFA 5DM6Q 1PJ5A 1S6UA 2VFUA 3GLJA 2ACYA 3HHKA 1TKXB 4OZ3A 4ZPAA 3W65A 3PIPQ 2YKMB 3CCVS 4FF4A 3LAMA 4UUWA 2ADCA 2G1HA 3UD4P 1D0EA 1OY8A 1Y0HA 2M7SA 5KFYA 3JS9A 1VIOA 4CO3A 2DHSA 2W01A 2DEJA 5FJ4A 2VUGA 4DR7J 2A6OA 1IBLF 3O1LA 2PI5A 4I4BA 2LVWA 1PJ6A 3KG4A 4TYBA 5D77A 2RVJA 1VBXA 4EYIB 4LVOP 1TKDA 1F0XA 2YNHB 4JI3J 1XNQF 4ZHRB 3RBZA 4GVBA 4KGKA 2IRYA 1OMSA 4OZJA 2MKKA 2JNJA 1TK0A 1TUGB 2MQ8A 2R8KA 1HD0A 2ALYB 3VTIA 4Q45A 2KG1A 2FQQB 2HLTA 2NS1B 2QIFA 4ID8A 2IAJA 4KYZA 3JSMB 2ZITA 1YRXA 3J7YI 5CH7B 3ZNJ1 5D15A 4USMA 2JEIA 5ERUA 2HS4A 4KPYA 1U1QA 5GVQA 4JI0F 4F7VA 3SQGA 3RYLA 3GFXA 1ICEB 1IKYB 4P2SA 5D3GB 3GR0A 4NA2A 4WU2A 1ZM3A 3QLHA 4DFPA 3MD1A 4HT7A 4CI0B 4JI6J 3CC7S 4RW8B 4HEA9 5KT7A 2W7AA 3M05A 3F73A 1LV5A 1M1GA 2RB7A 2QFJA 4ECVA 3AQPA 3CT9A 4RZRA 1XERA 2EK6A 4G6VB 2QA4S 4F4XA 2Q3PA 5CCMA 1KKHA 3N5FA 3R7SB 2RKIA 2DGSA 3NEKA 5BR8J 4NMLA 4QWAA 1CEZA 2MGZA 1AXQA 3GIKA 4DV1F 3TVKA 2OFHX 2XZDB 5F3ZA 3VVUA 2FLPA 1SH3A 3T1YJ 5LSRA 2RH3A 5CD4A 2E44A 1HWIA 2MKJA 5H9FJ 2EC0A 4ZP8A 2CNNB 1REVB 2HNZA 3PIOQ 3FVYA 2ASJA 2V2KA 3AOBA 1RTJA 5HQMA 5F8MA 2DGXA 1F5CA 3HULA 2FVPA 4HI2A 1TKTA 1GH8A 4GRSA 3E51A 4DPYA 4JI1J 2ZH1A 4IOAQ 2FC9A 1NPRA 2HQDA 3KMSA 5G0RB 2J7UA 4OYIA 3KYLA 4UOCA 2GC8A 3UQSA 2C3PA 3EZOA 2HGNA 2VKZG 4B17A 2R9LA 3IR7B 3HHLC 1MU2A 1Q8LA 4LSNB 2NXNA 3RB4A 4CLSA 3PW5A 2FGOA 4UOFA 3BO3A 4G1PA 2JOQA 1C1BB 3HVTA 2C22A 2DNNA 5KFUA 4C8OA 5D4OA 3SSQA 4W90B 1I1GA 2Q79A 5GMDA 4ZHRA 2LEPA 3D3BJ 4L76A 3Q8QB 4DR1J 1UA1A 1S1TB 4KO0A 1S0MA 2DR9A 1IW7D 4LF4F 2XY7A 5K20B 1S4FA 2DCUB 2L48A 3B8HA 5J1PA 1AB8A 4X62F 1C1CA 4NLSA 4CYUB 1KFDA 4NLDA 4LQ9A 3ULHA 5CD4H 2DR8A 1HBUB 4QWEA 4LF5J 2B6AA 1PC5A 3L7UA 1BWVA 3UWTA 1QAJA 4OI2A 1ZA2B 4QU6A 3PW4A 3GFYA 2HBRB 2YQ1A 2P6SA 1NSKL 2EW9A 3HFKA 4ID5B 1HW8A 5HBMA 1VRUB 1KR4A 3JTOA 3LW5C 4ECWA 4J91A 2CPYA 5AXMA 2YKOA 3V81A 1U2RA 3IP0A 1LWCB 2KN4A 4H4MB 3PO4A 3HCXA 3KJQB 1RT2B 2ILZA 2KVIA 2V50A 2XMMA 2ABYA 2J0XA 1CJKB 2LKZA 4DPTA 5C25B 5HO4A 3L3CA 1Y5IB 4K4ZA 2NQNA 1FI4A 1TMMA 4TN2A 4ERDA 3KKFA 2UXDJ 1GK8A 3M2RA 3H90A 3ITHA 4L3NA 2NREA 2AD9A 2C2DA 2Z30B 1MG7A 2M9KA 3DRXA 1SV5A 1FFSB 2XHWA 5IC6B 1K8AT 2QEXS 3L09A 1WHWA 2Z0GA 5LJ5Y 2VQFJ 2BR0A 2KU7A 4A8MP 3QAUA 3MFIA 4DV0J 2IYIA 4FF2A 2PDAA 2JLEA 3MMJA 2AYBA 1KFSA 1D8YA 3MXHP 3KFWX 4DR2J 1X8DA 2JVRA 1NHVA 1P9QC 4PPDA 5A0YB 1U48A 2Y8WA 2ZZTA 2W7OA 3PFEA 2V8VA 4AL7A 2AHOB 2LFVA 5KFNA 4RW7A 4MK7A 5HK4A 4PYAA 2C2NA 4A8SA 4OZ5A 1MSWD 2XMWA 4P52A 2EPIA 2JFKA 3Q86A 1D3WA 4FKXA 2H5IB 3ET6B 2CQ3A 4RX6A 3TANA 2IBKA 4B9NA 2ZH8A 3J7ZT 2NZ4A 1KLNA 1F2GA 3PW2A 4YB6A 4EWTA 5B08A 1RHRB 2GJ2A 3GONA 2YQ0A 4PXDA 1NZ8A 3TUZC 3VAIA 1TK5A 2RHQB 3QRRA 3MR2A 4YB7A 1RT4A 2BKOA 2DO4A 4DL4A 5CZXA 1X0FA 2MSSA 4IG3B 1CJUB 5A8RB 1RT3B 4ES3A 3W62A 3BYPA 2MLXA 2SXLA 3G8SA 2W8KA 2D69A 4XTTA 5CYMA 3BN4A 1VQKS 2N7CA 4C8LA 4WYWA 1J27A 1U25A 2VQEF 4CO2A 2D9PA 3MAAB 3PTWA 3SMZA 1HWLA 2XMTA 4GVBB 4DMZA 4DR2F 4QIFA 4RNOA 1HNWJ 1WSRA 3M6UA 1SCJB 3HK2A 5KFTA 2OPRB 4X4SA 3HDSA 3U1LA 1L3VA 2PA3A 4TK4A 1M5PC 4QPXA 1PAEX 4M5GA 4JI4F 1IKWA 1NSQA 2VV5A 2NLWA 3RRHA 3H98A 4CWBA 2FU3A 2RUSA 2WONA 4WCEQ 1UVMA 3S8SA 4IO1A 4PG7A 1CS4A 1HHSA 2D3UA 4I7FB 2I5JA 4X4UA 2GIFA 1GXTA 2Z57B 4ECQA 1T7PA 3N5BA 1FC5A 1JNZB 5KT6A 1LKZA 1UWBA 2LXUA 3AJ2A 4WTOB 1B4SA 1MWYA 2VC1A 1FK9B 4LUBA 1T8EA 4BS2A 4WJBA 1UPMB 1RWPB 3SI8A 3HHLD 3RG6A 2F9JA 1Y11A 5I42A 2Z2ZA 1FJEB 2CA9A 1IKWB 3BBFA 1KQKA 4ED6A 3SV3A 1I94J 1S9GB 4WTYA 3ILJA 2FHJD 4IRCA 2WSEC 4WFNQ 5A2QY 2HZVA 2UUCF 1E6VA 4IH6A 1I3OB 1CJVB 5H9EJ 3KWMA 2EKNA 1FO1A 2CKWA 2NZCA 3ET6A 4I7FA 1QSLA 2V2QA 1VQYA 3MTKA 1ZS6A 4PG5A 4RL1A 3EYZA 3G71S 2VQEJ 2BOAA 3AFGA 1NH7A 2CPZA 2KRBA 4XIUA 2ZH6A 3ENWA 1HHTP 4P71A 4LF4J 1YKWA 4K59A 4ENOA 5EGYA 3KLGB 3D0IE 2QGFB 1HYSA 3FFIA 4JI4J 4HLBA 5A8RA 4NLUA 1RAAB 2R7XA 1JLEA 2JZ5A 1L3KA 3ETMA 2MZ1A 4OJ1A 3TUJC 2OMLA 4O3PA 2D3O1 1IM6A 3GR1A 1X60A 2F8MA 3K8VA 3LOUA 2HSEB 3MOZA 4DUZF 5ERRA 2D41A 4LF7J 1BQNA 1HBMB 1VJWA 1NKCA 2BQ3A 4C97A 1RJJA 1PJ7A 5LJ3Y 4ZKAA 1TL3A 5KFMA 4O44B 2FTSA 1UJ6A 2LEAA 4QR0A 3LA0A 4TVAB 3PEJA 3ZZRA 4NRTA 2NUUG 3ZTOA 4U9RA 1RAIB 1RLDA 3DMJB 5DG7A 1A6LA 2MSTA 3E3XA 3KLGA 4MKYA 5ERTA 2J76E 4F02A 3W60A 4ILMA 3OFEA 1H0HB 2DXFA 3GIMA 3QWUA 4FBTA 2XYHB 4LSLB 5M2UA 2UUWA 3DM2B 2UXBF 3F0NA 3NGDA 3SFGA 1RHKB 1DHMA 4LVNP 4Q0BB 2BJEA 1ZA1B 4MIBA 4ED0A 2XSJB 3Q8RB 2X1FA 2XG8A 3BSCA 3MMBA 1YI2S 3HT0A 4ILRA 2CRLA 1R3NA 2MQMA 4KGMA 2Y8YA 2RAQA 2UUBF 1AW0A 4DFKA 3HHLB 2O5DA 1TVRB 2F5GA 4N47A 3SCIE 4AL6A 2FY8A 1WI8A 3DRYA 5F8HA 1JLBB 4OYBA 4P6QA 5KAKA 4CO1A 4ZN3A 1FESA 1D9AA 4KGZB 2Q1LA 4DUTA 4ILLA 2ZBRA 1PG5B 4LR9A 1DTQA 2OPPA 2NPFA 1SH2A 1GXLA 2DNPA 3T1HF 2HHXA 3KUGA 4B02A 3CJTA 3HZGA 3OL6A 2LA4A 1JJ4A 2FVRA 2DGQA 4LF7F 1HFEL 3PJ9A 5IS2A 4DL7A 4LFBF 2R7TA 5DLFA 4CH0S 5IT0A 2C28A 5A76A 2NYHA 4KHRA 2H3EB 5D0EA 5J2MB 2KFZA 2B7CB 3SIPB 2W25A 1O51A 1VQSA 2GO8A 3C66A 4ZVSB 4Q43A 2EBEA 4K2JA 2A2CA 4NLPA 2YVSA 5DDQC 2FLLA 1NAQA 2CAJA 3NY0A 1GMWD 1Q78A 3JB9k 1U1PA 2K2PA 2R2UA 2M2BA 4DJBA 1U45A 2IMWP 5L1IA 3RR7A 2EXUA 4JB8B 1Q0NA 2RKIB 2YY3A 4LRAA 2RQCA 4K4WA 2A1BA 5GMEA 1JLQA 1FVSA 2MZJA 4Z7YA 2GGPA 3LP2A 3W7BA 1B0PA 4GC7A 1RT5B 3TJAA 2XTJP 2FJBB 4N56A 2XM3A 1PYTA 2RRNA 3UCUP 1RBLA 2IIHA 3FCWA 5D4NA 2J0SD 2IVMA 3U7JA 5D6GA 1TFYA 3D5MA 2X7IA 2JJ4D 1OY9A 4AXJA 1ZTWA 1B7FA 1BLUA 1WORA 5B0CA 2W1BA 2GJFA 4DR7F 3DRSB 1XNRJ 2CZ4A 4O3RA 4JYAF 3CDUA 4ECZA 1PILA 4U8VA 4U7UK 2UP1A 2JLGA 4EGLA 1JLQB 1IBMF 5IM0A 2E5GA 2J7WA 1WJ9A 3IRXB 1KQGB 1XMBA 3CO9A 2P2CB 4WP9A 3MI7X 3UN3A 4DV6J 4OYXA 2BOPA 2DNKA 1GFWB 1UW4A 4K7QA 4CO4A 3VAGA 2UVWA 3RJMB 2VH7A 1G3OA 3SDEB 3CMES 1MLAA 5L9NA 1E6YA 3OTEA 2PN6A 2B5JA 4IG0B 4MTPA 3W2VA 1NK5A 3UN2A 4HHHA 2GX8A 4WE1A 4YDXA 1RT1A 3EVMA 4WXOA 3W66A 3DU5A 3BR9A 4DU8A 5I3UB 1Q4RA 3OQ2A 4QYZJ 4AQYJ 4DL6A 5JVHQ 3IWLA 3UR0A 4RU9A 1K47A 4HI1A 1NHKL 2KXFA 3DYAA 4URGA 5JMNA 4CLKA 1FNOA 1XEZA 2PT0A 4ID5A 4Q5VA 2AZ3A 2B3TB 2B9YA 4KKOA 5D0RA 4ETZA 2YH1A 4RU2A 5CYQB 4BC7A 2LYVA 4DV5J 1BQXA 2ZBQA 4NXMJ 2HRYA 3ZZ0A 2J6UA 3KK1B 1EQMA 4ECRA 4C11B 3H8YA 3JTPA 4OJHA 1RWVB 4OX7A 1WDDA 1FEHA 4Q2MA 4DPUA 3PW0A 4KFBA 3GV8B 1T03B 1NHUA 2AU0A 2A3JA 3H25A 4N7TA 4JYAJ 5DRKA 1M1KT 3MMAB 3TNVA 1IKYA 3QNWB 4I2PB 4HT5A 4F4ZA 2ZJQQ 2OTJS 4DOZA 5DO2A 2VDIA 4B9MA 1KLMB 5BJRA 3RB6A 3NGSA 1F9FA 3GV5B 2QMUB 2R2TA 1FX2A 4HYKA 2W2OP 4K50A 2V8GA 3MPVA 2BX6A 3CJSA 3GCWP 4KHMA 1N6QB 4Q2LA 3OTCA 4KGVB 4RKUC 4S0MA 5RUBA 4RUHA 3NNHA 2ILYA 3T5JA 3MGJA 4CIOA 2PMWA 2UVVA 2QC3A 5KFWA 3D7SB 2XQCA 4K4YA 2RF2A 2D1CA 2RNEA 3L7PA 3IRXA 2C3OA 1YRUA 1S4EA 3FZBA 2FZKB 1BE4A 2IC3B 4LBIA 1C2PA 1X5PA 2YH0A 4I2QA 1Z1ZA 3B78A 2VA2A 1WU2A 4CLLA 2IMOA 4KY3A 3FCHA 1H2VZ 1Q16B 2I8EA 4HACB 3D9BA 4ZCMA 1SL2A 5FDLA 1KQSR 2IJNA 2ZUAA 3NMRA 2VJVA 4QQBA 2HFNA 4J5OA 1REVA 3F56A 2OEMA 2R8IA 3T1AA 2X1GA 4CNZA 4DN9A 3NWRA 4LRCA 4BBYA 2RJZA 1LK5A 4OX8A 1LW0B 2HFOA 4DEZA 1NJXA 1ZAXA 2IM3A 2Z2MA 4E98A 3HLUA 4OJ3A 5D4PA 1IQZA 1TMJA 2R7VA 3A3OB 3CJKA 4P74A 2YWEA 4B08A 7FD1A 2CPFA 4Y3CA 1WUUA 2BJ7A 2ZWOA 1RWKB 2ZE2A 2CPJA 3H5SA 1C0UB 4M5KA 1U02A 1GMWA 3MM6A 3Q8VA 3O6QA 1R7IA 1UZDA 2OMOA 4OV6A 3QZ8A 4C8KA 2RD5C 2HEKA 2WRMA 1FRJA 4ZJLA 4F26A 3S01A 2HHHF 5ERSA 1HLWA 1VI7A 2J9EA 4Y6IA 1SI9A 3D54A 3LP1A 3AD8C 4FN5A 3SFUA 2HHVA 1J2VA 2EWHA 4FXDA 4U67Q 1JB0C 2V8DA 4QYRA 1C1CB 2JL9A 2O01C 4HTJA 4I2PA 2AEFA 4CYUA 5B0DA 5LSOA 2OH2A 3SV4A 1PO6A 3H7HB 1RT6A 1RT2A 4PWDB 1FNXH 1D1UA 5KFOA 3M8WA 2V4JB 3OL8A 2MTLA 5AJ3F 4HHUA 3IM8A 3HI9A 1EX8A 3K8WA 4OLOA 4DV3J 1RHQB 2HNYA 3IAS9 1IUJA 2DB1A 3R6GB 2FJVA 4O3OA 2NRPA 2DVIA 2OI2A 3MPWA 4ZVEA 4DUZJ 2KDOA 1H7XA 1WNEA 2RSQA 3R8YA 3M8YA 1TK8A 5E7OB 2EEYA 3O8WA 4K4UA 3RTVA 2R2SA 4JV0A 1GT8A 1IWGA 3EGWB 1RU2A 3JYTB 4ZDNA 1YX2A 2UUAF 3OBIA 5LSLA 4KV8B 2Y0BB 3IN5A 2W2QP 4A8YA 1QVGR 3DGPA 3EDQB 1F1BB 1SH0A 2FZGB 2M0GB 2YNFB 3DCAA 4IYQA 5K8NA 5H9FK 2DITA 4PWUA 3MUTP 1FD8A 4ELVA 4WP3A 2MXYA 4JI2J 2WB1D 2HNYB 4Y28C 3I0RB 3PY8A 3EE3A 1UVJA 2UXBJ 1JLCB 2B8QA 4R8UA 4K4TA 1LW2B 4LF2A 2AJ1A 4RW8A 2JC0A 4RNNA 4YHHJ 3FEZA 1LWFB 4J9RA 3BF4A 2B7BB 4DPWA 4ZIVA 2FTRA 4L75A 3EX7B 5CABA 2AJFE 3R1HA 3B6BA 2IM0A 3JQKA 2QMXA 3FBFA 4NLOA 3BV8A 4OI6A 1DTTA 2AV5A 3QO9A 3M30B 3WIUA 3C14A 2G4BA 3A8IA 3NXZA 2BM1A 3RAMA 5LXYA 2HVZA 2WSCC 4J9NA 3D67A 3H42A 2GO9A 1Q79A 1S6PA 2D9OA 3DI6B 4WWSA 5AJ3J 4TLRA 2DRBA 2QLBB 3I9V9 2G0IA 2E5JA 2E1PA 4RNMA 2YPYA 5IWAF 2GMLA 3GIIA 1VQOS 2NQQA 4TY8A 1RE1B 2WVFA 2XMJA 2V6AA 1YJRA 3WDOA 3KHGA 4KTQA 3NL0A 1NM2A 4L6V3 4ZJQA 2YNIB 2XGQA 2HNDB 2HIQA 2KI2A 2YXLA 2J5AA 1SUQB 1S6QB 3JQMA 4ECUA 3PW7A 2FJWA 3TA2A 1RTDA 3QATA 3SCLE 1WC3A 1Y4ZB 1R8AA 3R5CA 4G1QB 1OWXA 5D4LA 1WOOA 2EFOA 2NXEA 3PCOB 5IQ6A 1S6OA 3J7YU 3QSYB 4FPRA 2AGOA 4WP8A 1WC0A 4DQRA 1UVLA 2BW2A 3C8YA 1FRKA 5C42A 1IM4A 3PO5A 3QYYA 1VC0A 2DK2A 2YNHA 5F0WA 2MKSA 2RRAA 5EX0A 1Y9OA 4C98A 4LFAF 4OYMA 3LPYA 1M5HA 4LR7A 4KSEB 3RW6A 3AJ1A 5LMUF 1X9MA 2YNFA 2H5EA 3CJ2A 4DR6J 5HATA 1ZAVA 4GO7X 4OX6A 3SCKE 2A6MA 2Z8QA 4R5PA 3QJPA 5L8RC 4ZPTR 2LQ8A 3RRKA 3UNYA 1XNRF 3KLEB 4BDPA 2H65B 4OZNA 1KRPA 4P7VA 3SQGB 3RBDA 1K1QA 2AMCB 4Q44A 4M1KA 2UU9J 1GTHA 4AXIA 2XO6A 5GAHI 1TAQA 3T6BA 4OYZA 3BQ2A 3DLJA 2DR6A 1S12A 1S1VA 4KIAA 3OTOF 5T7LA 4IRKA 1FRMA 2HVHA 3HSGA 4F0MA 1S9GA 2VL1A 3CVKA 3I5BA 4RBTA 3IBCB 4HR2A 1DTTB 1HQEA 3QO9B 1CJTB 1JQGA 3LH2S 1TL7B 2COLA 4MKAA 2ZHBA 5DGAA 4NXNF 1SIZA 2BE7D 3NS5A 2J0QD 2H51B 3M6WA 2XC9A 4PQUB 1GEHA 2KZZA 4WFBQ 2MEWA 1VGYA 2HRTA 3TEGA 4CT8A 5A8KB 4C48A 3H4BA 2XS2A 1OO0B 2M52A 2CADA 3GE9A 4CLYA 1GXUA 3FSYA 2N3OA 1QSSA 1SQEA 4HVZA 1Q53A 4AE5A 1MN7A 2H54B 1NB2A 1S1VB 3D1HA 4TQSA 3TZZA 1C4CA 4O3NA 1DFDA 3JAMU 4EYHB 2XBPA 3MCSA 4C3MA 1EP4A 1VC6A 2KYZA 1M90T 2DH9A 4K4VA 4OJGA 3UO0A 2ADBA 3CJKB 1JLAA 1F9EB 1TV6A 3THTA 1NZAA 3BR8A 1FJGJ 3O3LA 1T0TV 2GA7A 1RA7A 2V63A 3M6XA 3MFHA 4WF9Q 1XI8A 3MZIA 2NROA 1CC8A 1AFJA 2BYCA 2WZ1A 2DO0A 4ER8A 5L1KA 1YZ6A 4PD0A 4RBUA 2LQ9A 4EO6A 3Q2TC 4ZVOB 3OLAA 3H20A 2ZNYA 2GAGC 4C8NA 3WC0A 2OTLS 4TU8A 1EAYC 2C2MB 4J9LA 4DPOA 2EC2A 3M6VA 5LM7E 4QBUA 3S1TA 4OZ1A 3M1VA 2Q6CA 1KDNA 4N76A 3SXLA 2ATCB 3I31A 1S9EA 1XTZA 2GV1A 2NXCA 3DOMA 4NZ7A 3K59A 1RWOB 1J5OB 1HA1A 1QAIA 3TEHB 5IV4A 4ZVPB 2VG7B 1P6TA 2VBZA 3U02A 3UPFA 1JKHB 3FBEA 1UKUA 3MURP 3MR5A 2YWFA 1HHQA 5IFMA 1UVIA 3P49B 1RISA 2QYGA 3G82B 3HHLA 2X1AA 3TZYA 2E7WA 1O6XA 5LMNF 2RE1A 3MOJB 2CQ0A 2PO4A 1VRUA 3V5RA 6FDRA 4HH1A 1D9FA 2BKPA 4K0KF 1RT7A 1VRTB 2CQCA 1ZZNA 3ISNC 3TX0A 1FDNA 5KG1A 1Y00A 2CPDA 3JAMY 1N5SA 1KLMA 3HO1A 5LXRA 4QWCA 2M5YA 2OD6A 4I68A 3DGPB 1N6QA 1RACB 2A0FB 2WB4A 3S7RA 1HPZA 1Q7LB 4J9PA 4LF1A 5K8OA 4OYPA 2L9NA 3IS9A 1VS3A 2F9DA 5J1EB 3OL7A 2FC8A 3I55S 3TRGA 1B7YB 2G0JA 3UDCA 3VAFA 3R9LA 4JV5F 3T6JA 3CDBA 1UETA 2BJ9A 1I51B 4H54A 4NLVA 1RXOB 5DG8A 4UW2A 3BKFA 2VF3A 4NLTA 1B70B 3GJTB 3ENVA 4DCJB 1NK8A 1U0SA 2B4OA 2E29A 3MPYA 1WDTA 3WIVA 2ACMA 5DDOC 1MW7A 4XAKA 4RW6B 1PC4A 2FJDB 2MYFA 2WVDA 3DDIA 4KQZA 1QUVA 3CE8A 3DDNA 1VQ6S 3GJSB 5KT2A 3MUVP 3PHTA 1DRZA 1NDLA 1K9MT 3GYNA 4J7CA 2KT2A 2XEXA 5KFKA 1HYSB 3OL9A 3D6TB 1VQ4S 5E3RA 1S59A 1UW9A 2ZM6J 2QE5A 4LIWA 3R5BA 1YITS 1LFPA 3GU0A 2AW0A 2MGZB 3CD6S 3TARA 1X4DA 2M8HA 4ZITA 1JNRB 4URQU 2PMHA 4DX6A 4TKTA 3KNAA 2CJYB 3AA8A 1TL3B 5CA5A 4RW6A 3M1VB 1OYDA 1YG0A 4F4AA 4M95A 3OVBA 1YJ7A 3CCMS 4QJVA 1RTDB 3OFHA 1HQUB 5L46A 1G7CB 4IUFA 2KO1A 1W25A 4IG3A 4X64F 2DRDA 2HGMA 1RSCA 1UJ4A 2KKHA 3TQEA 4Y2CA 3TUIC 3K2YA 5GAGU 3CD5A 2EK1A 4WPAA 4U7CA 2DCLA 2GMHA 4P2MA 3UD3P 2E9TA 2LDYA 3N28A 1S7IA 3W2WA 2CJBA 2IM1A 5GMKa 4L72B 3F41A 4WE1B 4QWDA 1UEUA 3QPIA 1RYRA 3AXMA 2OGUA 2VBYA 2I1RA 1ZOTA 2BANA 1HWUA 1UP1A 2BJ8A 2P5VA 2HHWA 2VG6A 4H4KA 3DLGA 4FF1A 2RDJA 4QIWD 5J2PA 3G6YA 4NLGA 3PNIA 2L08A 4N8OA 2B9XA 1HR0J 2OIHA 2YWHA 3CC2S 4UT4A 2K1RA 2MJUA 4DG1B 3KLEA 2NQUA 5ETVA 3CPWR 2DKOB 3B82A 4CLZA 8AT1B 2F4VF 1DQAA 1FVQA 5I3PA 4OHVA 3KDNA 4ES1A 2ZD1A 4I56A 1WG1A 3PR5B 1YIJS 1IVZA 1QLNA 1M5SA 1TU0B 1WKJA 3JYTA 2MZRA 4PQAA 5T7LB 1VDHA 5J2MA 5K14B 5HP1B 1Q5VA 2GW8A 4YS2A 4LRFA 2Q66A 3VZIA 1WC1A 1WEZA 1N32F 2JC1A 4AL5A 4EO8A 3VAJA 4OYWA 4NLXA 3DRRA 4OHXA 1U26A 3M2RB 2CG8A 4N5SA 4DLGA 5B09A 4KJIA 2AX0A 1NUEA 2BZ2A 2OPQB 4WIQA 5A8KA 2C3YA 2C2RA 1I6JA 1WC5A 2FHOB 2WBMA 3K17A 1G8RA 5F41A 2VIHA 3CNQP 2CQ4A 2J8AA 3DOLA 4PWWA 4ZMMA 3GQCA 2B51A 3EGVA 3VZHA 2QN6B 3MEKA 4BWJA 4B9SA 3LF0A 4Y00A 1FRLA 2ZNZA 3UNGC 5DG9A 5A8WB 1FXDA 2IM2A 3MMCB 1RWMB 3T9NA 1G2EA 1RTHA 1O0PA 3OR1A 1F5BA 1RAFB 3TA0A 4ANEA 2V69A 3V2UC 2YX4A 4B3TF 4WKYA 3R3TA 4UOGA 1VLYA
chains in the Genus database with same CATH topology
2XSFA 2Q6BA 3TAPA 3OJUA 1HI8A 1H2TZ 4NCBA 4X65F 4NYOA 3HJFA 2XWYA 1KNZA 2HNDA 3MTJA 4O44A 2CZVC 5ERQA 4F4KA 1KHWA 5K8MA 1E6YB 4DR6F 3DLGB 3KTQA 5F0UA 3N4WA 3VQSA 1BQNB 1HBMA 1QE1B 4KBIA 1R89A 5B0BA 3IWXA 4C3KA 2YKAA 3CGIA 2ASDA 1KS2A 5L39A 4ECYA 3VF0B 3MEGA 2N4CA 3PM9A 2DRAA 2M4MA 3UR3C 2DH8A 1G1XA 2BRKA 3M32A 3H5XA 4KKOB 3CWJA 1YRTA 5GADU 3CCTA 1FKPA 1ELOA 3POTB 5KFFA 4ED3A 4ZPWR 3MR3A 1HMVA 3GG0A 4NA3A 3KNGA 4A8XA 2W8LA 3IC1A 2HHPA 3ZZZA 1UL3A 3CSKA 2HS0A 2I0XA 1U2FA 1CG2A 4EBEA 1HI0P 4FNIA 4O3SA 2VD3A 3DN9A 3BO4A 2XLIA 2QO3A 3NRBA 2A2DA 3KJVA 1GQEA 2XI2A 5HMWA 2OJ3A 5HBMB 3NGKA 1BWEA 4DN0A 2P9EA 1RTHB 3OR1B 4MAKA 4WF9Q 1T3OA 2YTCA 1W2IA 3Q0AA 1NU4A 3EGNA 3KHRA 3EUNA 1NEEA 1S1WB 2JX2A 3BJYA 1HNWF 5HQ8A 5KG5A 3OTBA 4YFUA 3LP2B 3P3DA 1M5VC 3OUYB 1S1UA 3TR5A 3AB4B 1B0TA 2A18A 2WCXA 1JMTA 1Z2ZA 3OR2B 1QTMA 1LWEB 1RA6A 3VR1A 2GHPA 3V6DB 2BDPA 2DNYA 3I0SA 2EG2A 4DL2A 2B9WA 2XS7A 5ADZA 4WFZA 1LWFA 1HQUA 5KG4A 1QE1A 4IR9A 2FHMA 1FRHA 2DGOA 1IKVA 3G6VA 2BE2B 4O4GA 1WF0A 4DLEA 2CQBA 2CYYA 4FP9A 2GHWA 3MEDB 5IM0B 2PEHA 4RNHA 1YQHA 2QRRA 3HP6A 2PGCA 3QIDA 2W9BA 1S6QA 2VPXB 4PR6A 4TY8B 2NPIA 3FSXA 4J9SA 2FD2A 5KFZA 2ZH5A 2KT3A 1HMVB 2VQFF 2ZDOA 3O2IA 3ENQA 5A6WA 1IR0A 4ECTA 1D8ZA 4FF3A 3OXGA 5AE2A 4B3OB 4IG0A 3W2VB 4FS1A 1MWZA 2UU9F 4MFBB 4MIWA 4EZ9A 3KK2B 4WZMA 1TKZA 4PRFA 4G1QA 3KK3A 3G8QA 3DLBA 4C0BA 2FIUA 2KM8C 4Q0BA 4FYDA 1A9NB 5HL7Q 4NYPA 4OL8A 1TZ0A 5KFEA 3IRWP 4M5DB 3DRRB 4ZP7A 1F60B 5C24A 2BUNA 4BCAA 3KLFA 4F2SA 1TL5A 1YJUA 3T19A 2MQNA 2HWHA 2XMVA 3BREA 1EETB 3GYXB 5DLGA 1X5TA 5DETA 4LF6F 1RAJA 2VFRA 2R7OA 3U27A 3J7A1 2ZH7A 5LT5A 2FY1A 3SZ2A 3OR2A 2ZDPA 1W2BR 2HMIA 4OMFG 3M8QB 1TR0A 1YBAA 2HS3A 3MMAA 2CQGA 1JLFB 3TI0A 5I3QA 2V94A 4UUXA 1LWCA 4H4MA 4Q8EA 2RT3A 2HVIA 1XMOF 3TX8A 3U1MA 4RW4B 2MQQA 1LW2A 2C3MA 5KFLA 2FHKA 3MAQA 4MMOA 4PD1A 4FBUA 1IBKF 3HVAA 1N54B 3SSSA 2E1AA 1AROP 1CSJA 2D7SA 2OP5A 5H1SV 2C2EA 4DUYF 2CIMA 5J2NA 1CPZA 5KG2A 3RW7A 3KLHB 4JI8F 1JLFA 2JFDA 2W9CA 4HKQA 4HDHA 1DURA 2DHXA 1P1LA 2MZSA 4H4OB 4XK8C 2KHDA 3HZEA 5E3PA 4JV1A 1EP4B 4HL9A 4NRUA 5KFGA 1WHVA 2HHTA 2AWZA 1I6JA 2VFVA 5FDLB 5KFJA 4ZCLA 5F8GA 2PA8D 3N79A 3HM9A 3OW2R 2UXDF 3O5TB 1T95A 2GQ2A 1I94F 3IGNA 2Y0SD 1FDDA 2QSWA 1WTFA 2OFGX 2CPXA 3K5NA 2ATLA 1LW0A 2VG7A 3PZPA 4YR0A 4ZVGA 2HNZB 1ZTTA 1YGYA 4OI0A 4MH8A 3DLHA 4ZA1A 2X51A 2JEJA 3CEDA 3DMJA 4IDKB 4J9QA 3SYZA 2UVUA 4JOUA 5C42B 4IFYA 1R0AA 1NRKA 1RT1B 4OHZA 2ZKTA 1C0UA 2DGUA 4N77A 3IG1A 4NX9A 1FRIA 2B4VA 3FEYB 4RWWA 3FMBA 2AJ4A 2GIQA 4A8OA 2BBEA 3WZ0A 4LMZA 1T05B 1FKAF 3X1LB 4UY8T 3QZ7A 2FLNA 3I4PA 4UY85 5AXKA 2K3KA 4EU0A 4LJMA 3UW1A 1SC6A 1ZETA 2E1CA 4C11A 1U7LA 2OSQA 5AXLA 1FERA 1JLBA 4OQJA 4G1IA 3D0GE 3H4DA 1HBUA 2X1BA 3I6PA 3UDLA 2IBOA 2L41A 3AHPA 3FQLA 4ED7A 5FIIA 4ZVFA 4M8LA 4DHVA 2ZUGA 2IA0A 4A48A 3M8SA 3KLVA 4ECXA 5EHHA 2VA3A 4DL3A 2VPYB 3NKYA 3D1OA 4A8WA 3IO1A 1YTYA 1OPZA 3X3UA 1IJFB 1NK9A 5CXTA 4WK3A 2HHQA 4DV5F 1FE0A 1ZPVA 2N7YA 4NLYA 5KT3A 3MWBA 3QGGA 4Y34A 1VOMA 3ETOA 3QAEA 2G9OA 4DSLA 4IH5A 2CPIA 3QGIA 4KC5A 4ICLA 2V8HA 1ZYQA 2F1FA 2LECA 2XY6A 1R43A 3GWCA 4FS2A 2QA1A 3T9ZA 3MUMP 3B4DA 4PG8A 1HBOA 1SBRA 2I9SA 1S6PB 3GV7B 3CUNA 3I87A 1X0PA 2XMKA 5KT5A 4WKRA 4JI3F 1S49A 2DHGA 2L9WA 4XDDA 4X4PA 4K4SA 1U09A 2RS2A 2O67A 5AXNA 3DXBA 1YJVA 3NBPB 1RKJA 4DWIA 3UI3A 1G6BA 2NQVA 3KK2A 2KTQA 3M9NB 1KD1T 1M0SA 1OIAA 5IT9Y 1FHTA 3H2VE 1WWHA 4NZ0A 1H2UX 1WEXA 1ZBTA 2CQHA 3QJLA 2DT9A 3NCQA 1VIXA 1M5KC 2WSFC 1ZM9A 2ROEA 3HF5A 5D8HB 3Q2SC 2HW3A 1SB6A 1VK8A 1IN0A 2J6TA 2ROGA 1RT4B 1R6YA 3IR6B 3A1YG 1Q1KA 2PE8A 4YUDA 3HHNB 2IAJB 2R7RA 1FXLA 2O1PA 4D3HA 4C8MA 3DLEB 2CJQA 4ZCKA 2KXHA 4OZ0A 1S79A 2ZH2A 2PIIA 2IFXA 2KZMA 1YVFA 4NZ6A 4YY3F 2PI4A 4PUOB 2XSJA 2RU3A 2ZD1B 2F7VA 2RQMA 2HQ3A 3DRPA 2Q43A 3VALA 4ZOSA 5BYQA 2BQUA 3PDNA 3SCJE 4TU7A 4YEAA 1K0TA 1WG4A 1SJ3P 1S1WA 3P6YC 2DNHA 5G4DA 1X5OA 2DH7A 1G8LA 3JSBA 4ZPVR 2AF6A 3NLCA 2DIVA 3BSAA 1L5UA 1JX4A 1K0VA 1BY9A 2J0WA 1DQ8A 1HWJA 4IOBA 1VQNS 2WONB 3THPA 3TW0A 3OHAA 2KG0A 2JLFA 4B9LA 1X5SA 4USJC 1OPIA 4I69A 4CO0A 1WACA 2I5JB 4FZVA 3DOLB 5CQGA 1KEKA 2BQRA 1QSYA 2P9CA 3IAM9 4OX9F 5KFSA 2EVZA 1Q7YT 1KQSR 4KV8A 1S0OA 1U1NA 3BGUA 3KLIA 1U1MA 3CCSS 2LXFA 1Q81T 1N0VC 1FF2A 2KYXA 3PACA 3I32A 3US5A 4TYAA 3K7RA 4B9TA 2AQ4A 1VK3A 1XR7A 3FJ2A 3GIJA 3IGVA 4JBCA 2HWIA 2OSRA 4CZCA 5E3CA 1PGZA 5JVGQ 3SSRA 1U1KA 2K7JA 1D9DA 2J6SA 4GKKF 3QIPB 1YHQS 3KLIB 2IHR1 4ZP6A 1M5OC 1FEEA 3NWGA 1S1TA 2EG1A 4GMKA 2MDAA 2DNZA 3UCGA 1UJ5A 3M32B 4N8NA 4QW8A 2YNIA 3EZUA 2QV6A 5DS7A 4XPEA 2E5LF 5EX3A 4MKBA 3IG1B 1VC5A 3G9CA 4DV4F 3MR6A 5D78A 1J5OA 3M8RA 1YWXA 4Y65A 3CMAS 3TAQA 3I9ZA 4YHHF 3RAQA 2RILA 3MM5B 2ZOFA 5C24B 1U4BA 4C8ZA 4J9MA 4QOTA 1CVJA 2CVIA 3D1QA 1FK9A 3ZC4A 3L7OA 1U24A 5M2PA 1IJEB 1FE4A 3I5CA 3MEEB 2KXNB 1ZM4A 3OTDA 1QAXA 4LSLA 4DQQA 3DLKA 2BVZA 2HWTA 2JWNA 2K1RB 4DG1A 2GJIA 2P6TA 3IA0A 2AJQA 2YX7A 1DBDA 1SV5B 4PKDB 4RUAA 2O66A 1XK8A 1CQMA 1HNIA 1MROB 2RS8A 4DV6F 3T1YF 1PSDA 5J1EA 1WI6A 3I5AA 5K14A 3FSIA 3CXCR 1JXLA 2AGQA 1QVFR 4C0HA 2LU2A 3AAWB 4KT0C 5F8NA 3FZ2A 3OUYA 1DTQB 2OPPB 2XNQA 5U47A 3TOQA 1ULRA 2XMUA 1ZPWX 4ATNA 2W24A 1S0NA 3WBZA 2PC6A 1B0VA 1VQ9S 3N0VA 4WFXA 2C3UA 3BQ1A 2ZBCA 1URRA 2UZAA 2KM8B 2LQBA 3I0SB 2ZZMA 2B4PA 4I67A 2G0CA 3ISND 2VB6A 5F9LA 1SJ4P 1H3DA 4X84A 2R7SA 4WFAQ 1QM9A 3BDPA 2DTJA 1KVJA 3ZZYA 1MMNA 2V5HG 1N36F 5CYMB 4C2MA 4NCGB 3EGZA 3C2PA 1MU2B 4E8UA 3V4IB 1NKBA 2LQ5A 2WOMA 3BZQA 1O8BA 2XS5A 2HGLA 1HNZF 3FDSA 3KG1A 1R8BA 3M2UA 1XMQF 2O3DA 3BM7A 4OI4A 1X7VA 2YKMA 2DNLA 4ZS6A 2DISA 4YDDB 2WHOA 5G2RA 2HHSA 4TNOA 4AYBD 4Y0FA 3DRSA 3POTA 1X4CA 4FNHA 3V6KA 4QIVA 2PSZA 4A46A 3TAMB 1CQNA 1KTVA 1R8CA 3OXFA 3MEGB 4O4RA 5B0AA 4QR2A 3CDAA 2GFFA 5F8JA 4I0WA 4QIGA 2XCAA 1NK4A 2XNRA 2FGCA 3MM7A 4DV0F 3DRPB 1UMJA 5A6PA 2M88A 1UFWA 3SDEA 2GQCA 7FDRA 5DM7Q 4F8RA 3BN7A 3GMGA 3GG1A 5C25A 4PG6A 2ERRA 5GAGI 5I42B 1U1LA 1X4AA 4J9KA 1JJHA 2VBXA 3AQOA 1BGXT 4I6YA 2CQDA 2E66A 5BR8F 3LWLA 4J37A 2ROPA 5J1NA 3OXLA 3PX0A 2YNGB 1XWLA 2CPEA 2FJAB 4A4JA 2IVFB 2VODA 4PXBA 1ZZFA 2OPSB 2C42A 1AUDA 1MNEA 2CVEA 2E1RA 1FD2A 2XCPA 2QA4G 2APOA 4X4QA 4LF8F 3J7Z5 3OHBA 4B3RF 2I38A 5KFAA 3RZAA 4YOEA 1UEVA 3CJ4A 4WXWA 2CJAA 4OI1A 4K4XA 2BV3A 1N5TA 2CQPA 3HX9A 3NCRA 4DX8H 3GFZA 4M63A 2HRUA 1UAWA 3PEHA 1KQFB 4NXMF 5BYRA 2GQQA 2BRLA 3PKMA 3VAHA 5A8WA 1RTJB 1X9SA 4PQUA 3ZZTA 4QU7A 4OIXA 1IKXA 1IXKA 5CCLA 3R1LA 3I0RA 1H6KX 2N3LA 3K5MA 3V6JA 2AGPA 4LF5F 4QR1A 3DM2A 2ASYA 3ZFVA 3TAMA 3RR8A 3CCZA 1BQMA 3G6XA 1YJNS 2R8HA 1WG5A 4R0EA 3C3LA 2W4DA 1JLGB 3MM7B 3IWNC 2MHEA 1HD1A 3CCQS 3KK1A 3C6TB 1Z2LA 3DI6A 3P5TL 5FLXY 1S9FA 5CHCB 5DDRC 2R8JA 4OLPA 3HHEA 1O5JA 1K73T 4JI2F 1WF2A 3TP2A 1N5VA 2OD4A 3PFOA 4IO9Q 3GILA 3C6UA 3ZZPA 4PUOA 3MM9A 3CTRA 4NOHA 1V9OA 1TKZB 2CG4A 3DHWC 2L3MA 5KFHA 1SUQA 1UWBB 1S9EB 2JRSA 2ZE2B 3TVZA 1LK7A 3R27A 3KHLA 4C0OC 5G2SA 3EPGA 1RWUA 2A10A 4ZCIA 3AY0A 2IRUA 2ZBIA 3PHEA 4AFFA 2XB2D 3JSRA 3RU0A 2M70A 2ZOMA 4BC9A 1YSJA 2MKCA 2OKQA 2HFZA 2RDIA 4IFVA 4PCQA 2MZTA 2W9AA 5D3GA 3I4HX 1LQ9A 3E01A 3DDKA 4X4NA 4TK1A 3R5DA 1BD6A 3U1NA 3M2VB 4K5RA 4FXVA 4WFYA 2V4JA 3CULA 3LP0B 2OO4A 2UV8A 4JI1F 3DC2A 3KHHA 1N4LA 1Y5NB 4RW7B 1FCAA 4AQYF 2Y1RI 3OV7A 2DHAA 2V4RA 2LXIA 1VMBA 2RQ4A 3PKYA 3WC2A 2MY8A 1AFIA 4DFJA 3H2LA 2G1DA 4DF4A 1TUVA 1X4BA 2BXJA 1TP7A 3M8PA 3CCES 1HQEB 3DFEA 4NLWA 2HZCA 5EN1A 2IRXA 1MMLA 2B5JB 3BDEA 5B0EA 3NBPA 1FTCA 2DNRA 1YJWS 2IJFA 2DGVA 2EKYA 3NP5A 5IQQA 4HDGA 2RQKA 4PXEA 5G0RA 4YR2A 3D2WA 1FTRA 3ZZUA 2R2RA 5B0FA 3RBEA 2FJEB 2EFPA 2RIJA 2VG5A 2Z2LA 5DQIA 1WTBA 2NQPA 4AUKA 3C6UB 5KT4A 1FT8A 2KJVA 3GFHA 2XLJA 1V3ZA 3BGRA 3M30A 4QWBA 1T3NA 3MM8A 3T3FA 4NLRA 2W7PA 3PRDA 3WX4A 1HW9A 1KHVA 4LSNA 2OPRA 5KFCA 3TYTA 3N6LA 4X2BA 2F40A 1NH8A 3MECB 1TKXA 1RI7A 2ZM6F 4EBDA 4WZQA 2V0NA 4X4VA 3W2WB 1Q86T 2CQ2A 4F67A 1X4GA 4U91A 1FRXA 1SJRA 4F3QA 1FKPB 2OAUA 4C4WA 3PX6A 4KE5A 3E01B 1RKIA 5BYSA 4Y2AA 3OSPA 1KVIA 3BQ0A 2XULA 4F25A 2MQPA 1WHYA 2UV8G 3H5YA 2HYIB 4XPCA 2ZJRQ 4ED8A 3MECA 4JI5F 4ECSA 2E9RX 2POKA 2YWGA 1RTIA 3BS9A 4RWXA 5LL6d 1Z4UA 2CFXA 4WIIA 4UQGA 2LQJA 1OSCA 2QZ8A 4X4TA 2ZH3A 1NB7A 4CCHA 4C9DA 1U6ZA 2MQOA 1C0TA 4EBCA 2HMIB 2FVCA 2MY7A 3G8TA 4HHJA 4TLQA 4RW9B 2QSFA 3GB0A 1IKXB 4ICLB 1UZ5A 4ETXA 5IT4A 2DNQA 2VBWA 1FJCA 3L95X 3HVWA 4XO0A 5MLCV 2GCFA 2MPUA 1VQPS 4QW9A 2NSBA 2W9CB 4F50A 5KFQA 3CCRS 3V4IA 3BO2A 4A8QA 1LXNA 1S1UB