5D8HB

Crystal structure of the base of the ribosomal p stalk from methanococcus jannaschii with antibiotic thiostrepton
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
207
structure length
207
Chain Sequence
MAPWKIEEVKTLKGLIKSKPVVAIVDMMDVPAPQLQEIRDKIRDKVKLRMSRNTLIIRALKEAAEELNNPKLAELANYVERGAAILVTDMNPFKLYKLLEENKSPAPVRGGQIAPCDIKVEKGSTGMPPGPFLGELKSVGIPAAIEKGKIAIKEDKVVVKKGEVVSPKLAAVLDRLGIKPIKVGLNILAVYEDGIIYTPDVLKVDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title CRYSTAL STRUCTURE OF THE BASE OF THE RIBOSOMAL P STALK FROM METHANOCOCCUS JANNASCHII WITH ANTIBIOTIC THIOSTREPTON
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ribosomal protein
total genus 46
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d8hB01
3.90.105.20 Alpha Beta Alpha-Beta Complex Molybdopterin biosynthesis moea protein, domain 2 Molybdopterin biosynthesis moea protein, domain 2 5d8hB02
3J7Z5 3JSYA 4V19J 4UY85 4NWBA 5D6GA 2QA4G 5GAHI 5GAEI 5GADI 1ZAWA 3J7YI 5GAGI 5D8HB 1ZAXA 3A1YG 1ZAVA
chains in the Genus database with same CATH superfamily
1G7CB 4OYAA 5KFHA 4CH0S 4QPXA 1T3NA 2FJAB 1TL1B 2EFGA 4O3PA 5HK4A 1VJWA 2KHCA 1EKRA 3SSSA 3UPFA 4Q8FA 2PE8A 4LREA 5D0RA 2QRRA 2ALZA 4NYOA 4WIQA 2YX7A 1E6YA 3D0IE 5HBMA 3I0RB 3I87A 1RYSA 1VI7A 2UUCJ 3LPEA 3FSYA 4NXMF 5F8LA 3ENAA 1FWLA 3RB3A 3BBCA 3BGRB 4AQYF 4ED8A 4KGMA 2BV3A 3ZXWA 3DNCA 1RBLA 1FFSB 3CDBA 3N9UC 3S01A 4UOFA 2XS2A 4PD0A 4YUDA 3TWZA 1HQMD 1NSQA 1X4EA 4WIIA 2UV8G 3DHWC 1HBMA 2C3OA 4C98A 1UPMB 4P73A 2FTSA 4O44B 2WCXA 4A48A 1TKXB 3NGUA 4W90B 3UR0A 5IOLA 2IMWP 5HL7Q 5DGAA 2HQGA 3VGTA 2ZOMA 3OW2R 2FY1A 5HAOA 4RW6A 1KS2A 2V5HG 4CI0B 3SQGA 1VQ8S 2H3EB 2BYCA 1HNZF 3MTJA 2E9RX 3CC4S 2MQOA 1FK9B 4QZVB 1LW2A 4NLYA 2W8KA 3MMJA 2HLUA 4WZQA 1APSA 5GMEA 1OO0B 4ZVPB 2WOMA 2LA6A 4ED4A 3M2RA 2JL9A 3GONA 1RWMB 3P5TL 1DARA 1P27B 1JLCB 4PG8A 3HF5A 4C8ZA 2YKAA 4J90A 4F2RA 4IUFA 1IN0A 2J9EA 1Q8LA 2RE1A 3DXBA 3I5AA 1RWVB 5CYQA 1OQ3A 4X4TA 2QMXA 3W63A 5DS7A 2LKZA 1PBUA 1RAJA 2HVIA 5G0RA 1RUSA 1Z4UA 4PXDA 2A0FB 2F3JA 1ULRA 2OFHX 2Z0GA 1OYDA 2JEGA 4ZPAA 2GVZA 2KI2A 4FS2A 4CNYA 2J9CA 1FA0A 5ETMA 1U1MA 3B82A 3FMBA 1GXLA 3DRXA 2XSFA 3MF5A 4KR0B 3OUYB 3H7HB 4DV0F 1HQEB 3C6UB 3BPSP 2VIHA 1EB0A 2IFXA 1S7IA 3K58A 4KJIA 2HVZA 1NSPA 1DBDA 1S57A 2J9DE 1SVDA 3BQ2A 1V3SA 4R8UA 3C15B 1PAUB 2XBPA 3NY0A 4DLGA 2CJQA 4LF9F 3OHBA 2NRSA 1UFWA 2C2NA 3W2VB 2J8SA 2KT5A 1ZBTA 1SCJB 3M9OB 2BJEA 1AT1B 3IG1B 3DYAB 2Y3YA 4FNHA 2MY8A 1QSYA 4ZVEA 3FGVA 5J1EB 3CCZA 3N6LA 2IC3A 2LP4A 1T9VA 1HNVA 1F5AA 1F3VA 2ZC4A 5HI7A 4U7UK 2MQMA 1NHVA 3BO2A 2JC0A 4DR3F 1YRXA 3CJ4A 2AEFA 2O3DA 2HMIA 3W5ZA 4LF4F 2H5EA 2YTCA 5HMZA 5FIIA 2V2QA 5M2PA 3P45B 1TKTA 1HI0P 4OJ3A 4U95A 3V4MA 2E5IA 5E3CA 2CG8A 2PN6A 4QWAA 1FJGF 1RQ0A 5IQ6A 3TEHB 4DOZA 1VHFA 2E66A 2BJ1A 2CAJA 1X31C 1BQNB 4RZRA 3HT0A 3K2YA 1ZAXA 2OFGX 4M5DB 4FYVB 5L9XA 2X1GA 3R5DA 3ILJA 4H4KA 2OAUA 2K06A 3M6WA 1S48A 4OQJA 2VDIA 3DM2A 5L8RC 2B7BB 1KVJA 1RT2A 1N4LA 3NS5A 2U2FA 1DLOB 4KKOA 4H4OB 3V4IA 2RNEA 3W62A 4ZVFA 4ICLA 3BBBA 3JTOA 4B9LA 2JEFA 3RW6A 2UUBF 4K2XA 1R6YA 1NNDA 1QAIA 3IRWP 5L1JA 4KO0A 3I55S 5T41A 4K4UA 3UN5A 4X4PA 4AXJA 4PWDA 1B4SA 2G1HA 4C6AA 3ZZZA 2R8IA 3R3TA 4JP8A 4K4YA 5E3PA 4X64F 4DX5A 3OTOJ 2QIFA 2VA3A 5ETSA 3MECA 2NQPA 4O3QA 3QFWA 3S6EA 5SZTA 2ZBQA 2XWYA 3UN3A 3EZUA 1PG5B 2G0IA 1N52B 1JQGA 4ECRA 1RU1A 2LDYA 4QR1A 2EFVA 3T9ZA 4FVCA 2ZEJA 2FPHX 3D67A 3VALA 3AODA 5CYMA 4J91A 3MAHA 4Y2MA 2YKMA 1U26A 1UCNA 1RTJB 1O0PA 3FQKA 1ZM4A 3S8SA 4QIWD 2NROA 1T94A 1HW9A 4CYUA 2RDIA 3NS6A 5J2MA 5K9FA 1ZM9A 1U0HA 3RAMA 3EWGA 4BWJA 4MYTA 2GCFA 2F4VF 2GMJA 3OLBA 4OHWA 4USKA 4AUKA 3HHLA 5GMKa 1JXLA 1X4HA 2H48B 2EBEA 4QW9A 3G6YA 2WTFA 4DR2J 4USHA 3R6LB 1R43A 3B6BA 2GS8A 4O3SA 3HHKA 1C0TA 3KLFB 3AOCA 2QLXA 3KHGA 5KFLA 3POTB 1DY3A 3OVSA 4RW7B 2HQ3A 2HBQB 2MEWA 2NXUA 3TP2A 2KM8B 1ZA2B 3D7SB 3ZC4A 4X4OA 4K4WA 3PRBA 5HQMA 2BW7A 2YVSA 4U7UD 4OLPA 3VAFA 2MJUA 4PPZA 3NBPA 2LXFA 2L9WA 3W65A 1SJ3P 1H74A 5EHHA 1MLAA 4UZBA 1YDLA 2PDAA 3MI7X 3ILLA 1SC4B 2FHMA 2C2MB 3LOUA 1FRHA 4L3KA 4ETZA 3QRRA 4UTGA 3O6QA 4RBUA 2DR5A 2LECA 3DMJA 1QY7A 3A4TA 1KBRA 5KFQA 2RIJA 3P5BP 4PCQA 3DGPA 4OV6A 3Q2TC 1S72S 4IKAA 1HBOA 1NSAA 1EARA 2N4DA 1FRMA 1WTBA 2CPFA 1LWCB 1PJ5A 4ZVSB 1T11A 4H4MB 2C2OB 2XY6A 1T9YA 5KG4A 1PCAA 2IJNA 2IDLA 3X1LB 1A7GE 2R3VA 2AYEA 2LQJA 3DLKB 1U2RA 2B7CB 1S1VB 2XM3A 2QSWA 3AY0A 4ZN1A 4ZCKA 2N82B 2MXYA 2AF6A 2QT7A 1W7WA 2Q6BA 5CCMA 5DLFA 3PO5A 3N6NA 3OHAA 2VFVA 2O66A 1A9NB 3PCOB 3PW5A 2JEJA 4F4XA 4DMZA 5I42B 3OTDA 1RAIB 2B8PA 4HI1A 4O0IA 5KFKA 4USMA 2BJ3A 1KVIA 2Z30B 4DR7F 5KFOA 3ENWA 3N5FA 2BXJA 2Y8YA 2EKNA 3NS7B 3M9MB 1ZTTA 2E5GA 2AWZA 2XLJA 2DJWA 3GTYX 5B0GA 4OHXA 4NI2A 1S6UA 2DNKA 1LWEB 2LCWA 1ZPVA 4OX9J 4P2FA 1RXOB 2FLLA 3T5HA 4ZCMA 2VODA 4GVBB 3U7JA 1WG1A 3N0VA 1SKWA 3W7BA 4ZVGA 4L75A 1H0HB 4TU7A 4MYUA 2ZH8A 2MZRA 3GU0A 2HWHA 2B8QA 3ILIA 2VQEJ 3OTEA 2LVWA 4J37A 4I69A 1S4FA 2ZWOA 4X62F 3I32A 1Q79A 5D4NA 2CQ1A 2WZ1A 3LW5C 4P75A 1EJ7L 4DHVA 4RW8B 3E01A 2ZD1B 2AW0A 1WORA 4M94A 2KB2A 3TO8A 1HNIB 2I1RA 1RA7A 3BM7A 3VV2B 4IRKA 3BQ1A 4ZS6A 3UFCX 4URSA 3CWJA 1AW0A 2IBKA 3BB5A 4R5PA 2GQCA 4GKKF 4RW9A 3DGVA 1Q8IA 3C16A 3Q8QB 4QJVA 5LXYA 4NX9A 4IG3A 1XMOF 1AUDA 2Z4PA 4HTIA 1VQMS 2BQRA 5CHCB 4ED3A 4NLGA 4A8XA 5D0EA 3TA0A 4NLRA 3TA1A 3FSXA 5KT3A 1CJKA 2HEKA 2MZSA 4NLXA 2YNFA 1D0EA 1KLMA 5D3GA 4QR0A 1R27B 1NDLA 2XCPA 3HVRA 1UJ5A 4NLVA 3MMCB 2VG5A 4ECZA 3GIKA 4QW8A 2DGXA 4HLBA 1S76D 1RAOA 1BE4A 2LEPA 1SKSA 2NUHA 3MM7B 1WDTA 2RU9A 2OH2A 2CPJA 1D3WA 3BDEA 2FJXA 2PFFB 2OSRA 4B3SF 4Y34A 2W9BA 3GFXA 4HH1A 3C6TA 4IH5A 4I6WA 2HBRB 1DTQB 3H20A 2HBYB 4Q5VA 1VQ7S 1X4FA 4CDIA 3BSOA 3GE9A 1I94F 5E7OB 5L39A 2VASA 4TU8A 1RBOB 2ZZMA 3RBXA 3K8VA 3H90A 2Y1LB 1N0VC 2V4JA 1A0OB 3OD2A 1Q53A 4RJVA 3G8TA 2ZH4A 2V8PA 3TJ9A 1WG4A 4ED1A 2B9EA 3RB0A 5AJ3F 2CA9A 1LWFB 2HNZA 1P1TA 1IQTA 4ELUA 1B7FA 3B8HA 3MD1A 5HP1B 1ZM3A 1X9WA 2VG7A 3U1MA 5F9NA 5CZXA 2Q6CA 4IOCQ 1YJTA 3NNCA 3X3UA 4LBIA 5KG0A 1IBKJ 4DR6J 3GSDA 2X3LA 4JI6F 4CT8A 1REGX 5ETRA 2OPPB 2DR7A 3GJQB 3AFGA 2ZJPQ 4WKRA 2GW8A 2F63A 1M5SA 3CMAS 3DRPA 2NLWA 3BKUA 5A6PA 3KK2A 4NE9C 2XC9A 1U48A 4DL4A 1TQLA 1QD1A 5A2QY 3JXOA 5KFMA 4M8LA 4F36A 1CG2A 4KHPF 4Q2LA 4BC7A 4EI2A 4IFYA 1VFJA 1IKXA 4ILMA 2DO0A 4PXEA 1FWPA 1I3OB 1S6QA 2GAHC 2LFVA 2O01C 4O0NA 3NEKA 2GA7A 4ZVHA 3EXYA 3GYGA 3BSNA 5HANA 2LEAA 1X4CA 2KVQE 2RQKA 5DQHA 2GQ2A 3MMBA 3MPVA 1N5VA 3TX0A 4JI4F 3US5A 2DB1A 4Q0BB 1TMMA 4IH6A 4LF5F 2K2PA 1JK9B 1MNEA 3ISND 1CVJA 2UXDJ 2ZE2A 3OVAA 2PFDA 2ZH7A 4R25A 2VQFF 2BJ8A 2OKQA 4YEAA 4IG0A 4C3LA 2YWGA 2HRYA 2PEBA 3LTOA 3RGIA 2MB0B 4FP9A 4G1QA 2BM1A 1O6XA 2VF3A 2I6WA 2V8HA 2AYMA 4B9TA 3HHLD 4RKUC 2VOOA 2J7UA 2ROEA 2UUAF 5JMNA 2OGUA 1XMBA 1SL2A 4DV1J 1KNZA 1S99A 2DY9A 3VCDA 3W2WA 2D3UA 9ATCB 4D3GA 3PDNA 5K5MA 3MPWA 1S1UA 4K7QA 3QGPA 4CO5A 5DDQC 4QIVA 1IKVB 3D3CJ 3H2VE 3UVJB 4QYZJ 2B6AA 2WK4A 2V0NA 4ERDA 2YNHB 2HBZB 2PMHA 1VDHA 3D6HB 4HHJA 3CCTA 2ATCB 3E51A 2DK2A 2YKOA 1MU2A 3TZXA 5ETKA 1YJ9S 2IM2A 2HWIA 1U1KA 3HZEA 2C3PA 2AMCB 4RUCA 2A2CA 5LMNF 3ONQA 3TUZC 3I0RA 4UQGA 5E3RA 1YZ7A 3KDOA 2V4QA 1FRXA 3OJSA 1RTIA 3D28A 4OHYA 4Y6IA 5GAHI 8ATCB 2OO4A 4NEYA 3PV8A 4F0KA 2GMHA 3OBIA 3LP1A 4OL8A 4MK7A 2RDJA 1F0XA 1HI1A 4JI8J 2FQQB 1S5ZA 1F6TA 2V2VA 4LIRA 4YB5A 3MHYA 4I2PB 3G6ES 2ZH5A 1D9DA 1QVFR 4HEA9 3K7RA 3OXGA 1EP4A 4LUBA 3H2LA 1NUEA 3HVAA 1OJ4A 4NXNF 4EYIB 4JI1J 3UI3A 1UWBB 1QUVA 4ZA1A 7AT1B 3ZZTA 2MSSA 2W2NP 5AXNA 5J2QA 3J80U 1R0BG 2V68A 4B3OA 4O44A 3G96A 2CVIA 2VC0A 3CCRS 2E1PA 1WC3A 2VONA 4UY8T 4LRBA 2FVCA 2DISA 3MMAB 4KH0B 1U8SA 1KRPA 4B3TJ 3BGUA 3KNAA 3CJ5A 4JI2F 4J9OA 2DNPA 3W8PA 3TUPA 4I1TA 1W2IA 1VQOS 1MG7A 1TELA 3QSIA 2J6SA 4LRFA 3IC1A 4OZ2A 4YP3A 3CCQS 4LBHA 2BE2A 5HJYA 2LQ5A 1XK8A 2GJIA 3QIPA 5KAKA 4Q45A 1F60B 2MDAA 1DAXA 3F56A 2HHHF 2RQCA 4YHHF 1P9YA 2DGVA 4KV8B 3MUVP 4EFAC 3LQVA 4USTA 5KFGA 3PYEA 1REVA 3MCOA 3K0JA 2OJ3A 2ZKUA 3FFIB 2DHXA 1WEYA 2AJQA 1T7PA 1NJXA 5FDLB 3Q8RB 2G4BA 2XZDB 1SC3B 2CQ4A 1YJUA 2KVIA 3BS9A 3BGOP 3W5YA 5KT2A 5J2NB 1CJVB 3PO4A 3MM8B 2D7SA 1SJQA 3WX8A 1X5TA 2MKSA 5K14B 2MLZA 2WBRA 1VQ4S 1L5UA 1L3UA 2BRLA 3QT6A 3KLIA 4A47A 1JLGB 2J5AA 4LVOP 3KLHA 1KDNA 4KQZA 3DDIA 3DC2A 4X4NA 3OUYA 3A12A 1KHWA 3L3CA 4F4KA 2WRMA 1HQEA 1EAYC 1RA6A 5DETA 3OFFA 1O8BA 2WAQD 5KG1A 5KFTA 3A1YG 1N33J 1G4CA 1RT4A 4LF7F 1WG5A 4UOGA 1PSDA 1AUSL 3SDEA 3A3OB 3W2VA 2J9DA 4A4JA 3AJDA 3FCWA 4K4XA 3NNHA 1MN9A 4Y0FA 2BVZA 1U45A 3FBBA 2Q66A 3TW0A 3T1AA 5ETQA 1E6YB 3D0HE 2HVEA 3NXZA 5HBMB 3DYAA 2E44A 2BANA 2RH3A 2E7XA 5C5JA 1VLOA 2VFTA 3A8KA 5ERVA 4F3QA 2VV5A 4TQSA 1N32F 3QNWB 2F8HA 4YB1P 1SIWB 2YWFA 4DCJB 2CZ9A 1JJCB 1N36J 3IAM9 4EBCA 3LGHA 3HVTA 4FKYA 2M88A 4OJ1A 1SQGA 3Q83A 2CQIA 1HQUB 2CIMA 4RX6A 2ZZTA 1J27A 1HBMB 1Y5LB 4DR4J 2D74B 2JH3A 5DG8A 3G9CA 3HHDA 4ZLPA 4NCGA 3L9ZA 4ELTA 5A8WB 1KEKA 3EDQB 2NRPA 3KJVA 2WONA 3OL9A 1HKAA 4BBYA 5KFEA 4YFUA 2V8VA 5B08A 4CTAA 4DQPA 4RW6B 3D5MA 1WD6A 3SQGB 2NR0A 1DLOA 4K5SA 4H4OA 4DPUA 1XEZA 1PC5A 4LRAA 3PIOQ 1WACA 2XMVA 3RG6A 1RAHB 1VISA 4UOCA 2MHNA 1F1BB 1GT8A 2RF2B 1LW2B 1RHKB 4HHUA 1TAUA 3AHPA 4MMOA 2WOMB 2X1BA 2ZWPA 3ELHA 2CNOB 1ZA1B 2MJNA 4DEZA 5AE1A 4ZJOA 4A8YA 3Q2SC 1NZAA 4WE1B 4FZVA 2DR8A 4PAAA 4PD1A 4RL1A 1R0CB 4EO8A 4HDGA 3FNNA 5CYQB 3UD3P 4USVA 2OLWA 1WTFA 4LFAJ 2ZVIA 4FF4A 5G0RB 3CCJS 4DX7A 3NGKA 3I0SA 2AJ1A 2B4PA 3GILA 4TLRA 3FDSA 3TUJC 3HSGA 1N5YA 2C3UA 2UXCF 4WP3A 1HQ2A 5E3AA 2M70A 2WVBA 2N7YA 2GVZB 3PXGa 4ZVRB 1YQHA 2XI2A 2ZKTA 3GG0A 2V63A 2GNKA 2HIYA 4G6VB 5JJBA 5EWFA 5J1PA 2R7TA 2AJFE 4LFBF 4QWCA 5RUBA 2F40A 1Q5YA 4CO0A 4M5GA 1HNXJ 4PQUA 3M8YA 1KD1T 5KFPA 2O67A 4C7QA 5FLXY 3L09A 1BUXA 5D4PA 4ES2A 1SUQA 4CLZA 3M30A 2DITA 1WOPA 3O5TB 3MGJA 5HO4A 4F4WA 2FD2A 4B08A 5GMDA 4DF8A 3KLFA 5HLFA 2HG4A 2I5JA 2M52A 1TKDA 2E9TA 2IC3B 4OZ5A 3JSYA 1WF2A 5F8GA 4Z2XA 3NGTA 4OYBA 2B56A 1QAJA 3GIIA 1QE1A 1FWKA 2HMIB 5LMUJ 2LLZA 5KFUA 3B54A 2DH9A 1IM6A 3BJYA 5ETTA 4YN3B 4DR1J 4MKYA 4ZK7M 2DYAA 2L41A 1ZAVA 3SMZA 3QPIA 2DH7A 2LA4A 2V2KA 1DQ8A 3RJMB 2FJDB 2MKCA 1IBMJ 5CA5A 1K9MT 4GRSA 2V34A 1R8AA 4B3MF 4WP9A 1Q86T 5KT4A 3DM2B 1R89A 3PZPA 4ENOA 1LWCA 3ZTRA 1RT2B 3IGNA 3N6MA 1JKHA 4CNZA 4ZVUB 3V4IB 3KMSA 2QL7B 2HGNA 5D0GA 1YVFA 2X3DA 4URGA 2OP5A 2DRAA 2H9ZA 2KFYA 1K73T 1KOOA 1N34F 4JI3F 1U1LA 2HAIA 2IVMA 4FNIA 1EETA 2NXEA 2H1YA 2JJ4D 2MGZA 4CLKA 2D9OA 3HSDA 3TA2A 4F04B 2HSEB 4B02A 5B0AA 4ZPDA 4KO0B 2NQKA 3CDEA 4PWDB 5D78A 5LL6d 2WVCA 3HK2A 1JLFA 3CEDA 1HNWF 5E41A 5I42A 1SPBP 2HVDA 4NA3A 3TAPA 2BE7D 4J5OA 3MECB 2KJWA 3M32A 1U4BA 4ID5B 4LF2A 1NXIA 2FZGB 1PKUA 3R5AA 2FVRA 1NCLA 1SV5A 3WC2A 1VOMA 4F4YA 3FCVA 1UEVA 4IOAQ 4U96A 2VKZG 5KG3A 2CQPA 1RAEB 3CIMA 4Q43A 1ZZFA 1F9EB 4TLQA 1WC5A 2XTJP 4EEYA 3HFKA 3K8WA 3MR5A 5LOQA 2CPEA 1QAYA 1U6FA 5CYMB 5IM0A 1UVMA 4N47A 4RBVA 4QWBA 2CQCA 2W7OA 4IRDA 4K0KF 2YKMB 3MAQA 1S12A 1S0OA 2DKOB 2W24A 3M8WA 4Z37A 2YX4A 3KYLA 2DIUA 1SBRA 2AGQA 2BKPA 4NLQA 2J7KA 3HLUA 4DV4F 3AB4B 3A3PB 1R0AA 3W5XA 2XYHB 4X65F 4CYUB 5BR8J 3VAJA 3QT8A 5J2MB 1RWNB 2RT3A 3QGGA 1U0HB 3LO3A 4U7CA 4ZIVA 2D1CA 3BN4A 4KY3A 1HL6A 4P2XA 1KKHA 1OQ6A 4JI5J 1LW0A 2VFUA 4QIGA 3PYGA 3BN7A 1CEZA 3Q22A 4FF1A 3TEGA 4DSLA 5A0YA 3T1YF 3D1OA 5I3PA 5IWAJ 2HWTA 1C0TB 1UW4A 2R7XA 2BE9B 3H4BA 3HHNB 4YMEA 2D3ZA 3DXSX 2NQUA 1HD0A 1FNOA 3EVMA 4QYZK 1X0PA 1G1XA 4F50A 1WEZA 1KVKA 2P9EA 3W64A 3DCAA 2HQFA 2MKIA 4HACB 4C8NA 2ZVSA 5LJ3Y 3EGWB 1I5OB 2WBMA 2J0SD 3H5YA 4LF6J 2DGOA 3M05A 3LP0A 5F8HA 1VIOA 1BGXT 4NMXA 1VBZA 3DMJB 4M63A 3PEHA 2DO4A 3DGPB 3IAS9 2H5JB 1OSDA 3MMCA 4HKQA 1HBOB 1YKWA 1BY9A 1NK5A 1JMTA 3CC2S 5HVFA 4MFBB 3G6VA 4AD6A 2LU1A 3UWTA 1NPKA 1RP5A 2UP1A 4GKJF 2AP6A 1PAEX 1B0TA 4F3MA 4NCAA 3PW4A 1GTEA 3IWXA 2JVRA 4ZJQA 1QAXA 2HHWA 3CD6S 2F4FA 3BGFA 1T9XA 2XZWA 3VAMA 2HFNA 1QUPA 2Z2MA 2Y1JA 3W9IA 4DV2J 4DSIA 3FBCA 1QVGR 1C0UA 4F26A 3TRGA 4CLFA 4ZMMA 1IR0A 1TV6A 1VIXA 2K1RA 2PGCA 4NA2A 2IM3A 2A6MA 3AOBA 2DHGA 2HAFA 1NMEB 2X3GA 1C4CA 2XWXA 1JLBA 5IT4A 1YRUA 1HA1A 4EK2A 4KGZB 3KJNB 2R7UA 2K8GA 3EGNA 3TZWA 5ETLA 2OPPA 4K4SA 4EO6A 3K89A 1FXDA 2ZNZA 4NI2B 1H2UX 3DLBA 2KRRA 3FRYA 4U9RA 2RS8A 4DSKA 4FXVA 2D69A 3SV3A 1U1PA 4Y2KA 3MEEA 4YY3J 2YWWA 4MKVA 1TMJA 1HWIA 3QT7A 4C8OA 3C2PA 2DD8S 2I2YA 3H8YA 3NP5A 3T41A 1TK0A 2FHJD 3R27A 3L7PA 9RUBA 3N01A 4P74A 5CH7B 3K5PA 4ZLJA 1DFDA 4LR8A 2ERRA 1HFEL 4Q44A 3TZZA 2FDNA 5FD1A 3JSBA 1F5CA 4EYHB 2VG6A 3G71S 1KC8T 2HNYA 2RRAA 4FF3A 4CLUA 1YK9A 4LSNA 4X4UA 4F7VA 2GVDA 2QTWA 2DNQA 4DS5A 2EG2A 2E5HA 4ITSA 1K0TA 4U91A 2KU7A 4R5PB 3EX7B 1R8BA 2BBEA 3T1HJ 4RW9B 2HK3A 1OWXA 2QLFB 3CJQA 2AD9A 5DDRC 2FJBB 4L6V3 3EGVA 3BO3A 4IG3B 4WCEQ 3C14A 2IJRA 3PFOA 4WFNQ 1M0SA 3G82A 1URRA 2E1AA 2XCAA 3IN5A 4MK9A 4DDFA 3TNVA 2H51B 1CJKB 2FJWA 2YNFB 1KLMB 5D3GB 1TUVA 3LGMA 1KP6A 3AD9C 2CDQA 2AJ0A 4KE5A 3OLAA 1W25A 4XPCA 4LF1A 4YR3A 5D8HB 2ZM6F 4ZPBA 2LQ8A 1UETA 1TK5A 2YNIA 2C2EA 2E9ZA 2W9BB 1X8DA 4EU0A 1W26A 3C6TB 2AT1B 2IM0A 3A8JA 1WSVA 1EIYB 3UW1A 4X66F 1VYAA 2HHPA 5M2UA 3TX8A 4K2JA 2W8LA 2VKRA 2APOA 2ZH2A 3MURP 1VQ6S 3PVXA 4QR2A 3RBZA 4F0HA 1J5EF 2EI5A 3RBDA 1GXUA 2V4JB 3RU0A 5ETOA 4OYZA 3IA0A 4NLOA 4DV3F 2HNZB 3PHTA 3CCUS 2DIVA 1BQMB 4QYRA 3MTKA 4JI0F 3QRPA 2VG7B 2YPZA 1FI4A 4DUYJ 3UO0A 1JWWA 1TFYA 1PGZA 4I2PA 1X4AA 3PRVA 4JV5J 3J81j 2BQUA 2WB4A 3FMWA 3QBCA 3PYFA 4WKYA 1FD2A 3CULA 2BJ7A 2NYIA 3IGVA 3UDCA 2R7VA 3L4BC 3DRPB 3A8IA 1LWXA 3GYNA 2E5LF 3KK2B 2W01A 3AD7C 3RR8A 1CC8A 2BX6A 2AJ4A 4Y3CA 1RWPB 3LA0A 3MDFA 2CPIA 3B4DA 2GFFA 4C0HA 2NPIA 2GQQA 4IFYB 4DL0C 1SB6A 4I64A 1LEOA 1RTHB 1BC6A 4KGVB 4KB7A 5J2PA 4IFVA 4OMFG 1MWZA 1S6QB 1N5TA 4MIWA 2W25A 3KLEA 4KFBA 2DR9A 1C4AA 4FF2A 3CGIA 1YBUA 1HR0F 3OFGA 2MHEA 5SUHA 3UD5A 3ETMA 4DCOB 3MMBB 5DM6Q 4TXSA 2D41A 2D3OR 5KG6A 1ZYQA 4OI1A 5F8IA 4ZVOB 2YKPA 1XC9A 4FXDA 2FB0A 2HS3A 2HHVA 4Q7AA 4KV8A 2P9GA 5KFCA 1YSJA 2ZE2B 3EZOA 2HK2A 4IG0B 5CYJA 4OHVA 2QLBB 3JB9k 3KHRA 4G1QB 1XWLA 1S0NA 2Q1LA 5CD4H 1XNRF 1LXJA 2YQ1A 1UFLA 4ATNA 2CQGA 3CMQA 3VGUA 1CJVA 2FVQA 3MXHP 4JI7J 1LFWA 2AZ1A 2H54B 1K0VA 1YJNS 3DDKA 5JXSA 5ERQA 5D15A 4FN5A 3W2WB 5HROA 5AT1B 2QJ3A 4EUVA 3TOQA 2KXFA 5I4MA 1FKAF 3WBZA 3I82A 2XGQA 4EGLA 3P4UB 3LH2S 2B6AB 4WP8A 2VZ9A 3R7NB 2V94A 3G8QA 3RB4A 2CJ9A 1RWOB 1TL3A 1FKOA 4OLOA 3D1QA 1NB2A 1IW7D 4O3RA 1H7XA 2GIRA 3CD7A 3CJKA 5EWEA 1L3KA 2JX2A 2VBYA 2IIHA 3HX9A 3NGRA 3I31A 3KLVA 1MU2B 3J81U 1NH7A 1S1WA 3IWNC 4HDHA 1NDCA 4L3NA 1Y9OA 4NZ6A 2R42A 2VL1A 3GJSB 3R2CJ 2NS1B 3BV8A 2XMJA 1RTDA 1WI8A 4LFCF 1N54B 4DG1A 1RTIB 1FNXH 1Z1ZA 4A8SA 4A46A 3LP1B 4X4VA 1GMWA 1JLQA 1PBAA 3SBMA 4WYLA 4CO1A 3QGHA 4DV7J 3PKMA 1M5PC 3ADAC 2C3YA 1EP4B 4JV0A 1UPPA 3QIDA 2IYGA 1Q78A 1HQUA 3IMQJ 3SCIE 4C2MA 4KGKA 4AXIA 2EC0A 3QQCD 1TVRA 5J2QB 2IPOB 4FBUA 1YJRA 4QIFA 4P7TA 4M5MA 2UXBJ 4B3OB 1AFIA 5A8WA 1HI8A 3J7AN 4ANCA 3FZ2A 1VK8A 2D3O1 3T5KA 5H9FK 2LDIA 1IBLJ 2K7KA 4ZPWR 2A2DA 4DUZF 1X4GA 1H98A 4DX6A 1S9GB 5DG7A 1WF1A 3D3BJ 4ANDA 3IM8A 1S79A 3IS9A 5MLCV 3QATA 3T5LA 3ZZPA 3KNGA 3QAUA 4OYWA 1RCOB 1UZDA 2RF2A 1I51B 1WF0A 2NXNA 3U1NA 5B09A 2A10A 2JWNA 3RYLA 1UP1A 1U8WA 1YIJS 2ZJRQ 2BE2B 3KK3A 1FE0A 1NRKA 3CCVS 3GP9A 3QIPB 2KZMA 2QA1A 2PA8D 3CD5A 1NM2A 3KK1A 1FTCA 4FPRA 1XR5A 1SQFA 1NPPA 4A8FA 4AT1B 2IRUA 1O5JA 4CCHA 2KRBA 2YPYA 1REVB 4WE1A 4RPFA 2DXFA 4UY85 2VHGA 4EZ9A 4ZP9A 3KG1A 1N5QA 1DHMA 2MKHA 3MOZA 2Y0BB 2DNOA 3D9BA 2AEMA 4DL5A 2HHSA 1WNEA 4RW4A 4Q8EA 4JV1A 4FPIA 3EPIA 5F0UA 4WFYA 3V6DA 2XULA 3WC0A 3KLIB 2OSQA 3DRYA 5AE3A 2PT0A 4J9VA 2XG8A 4F0MA 3KLHB 2DRDA 1ITPA 1ZS6A 5C25A 3GCXP 1Q16B 3NKYA 1SXLA 1H73A 1P9QC 1FX4A 1HMVA 2UU9F 2FGCA 2HHXA 4CZCA 1U1QA 1RJJA 3HKWA 4HVZA 1NSKL 1T8EA 2KG1A 4PXBA 1RT4B 5EX3A 2QLJB 4ZKAA 2VH7A 3SDEB 3KFWX 2FGOA 2CADA 4JB8B 3HM9A 4L72B 4NLWA 2MQLA 4F25A 4DF4A 2QG9B 1HIYA 4YR2A 2BANB 1QM9A 1WKJA 2G1DA 3PEJA 3EJMA 1RU2A 2AEJA 1IKYA 1RKIA 3GV5B 1K8AT 4EZ6A 2CDRB 2DGUA 4F4ZA 2HRUA 4LF8J 2PI5A 2ALYB 3QT5A 3HVTB 3CCLS 3KKFA 3MM6A 3V6JA 3AD8C 3JAMY 2X1AA 1XNQJ 1EKSA 4DR5J 4UUXA 1IR1A 5LJ5Y 1WKKA 4PYDA 2RQ4A 2IDEA 1X60A 5KFAA 4NCGB 5K8MA 3M2UA 5AXLA 4OZLA 3KJVB 2WONB 3G2XA 4NYZA 4FYYB 4WTOB 4DUTA 1B0PA 4CTAB 2JZ5A 2G9OA 4YS2A 4TK3A 4JYAJ 1Y00A 3N79A 2QSFA 4OI4A 3QMQA 2C1EB 2X51A 2EWHA 3GV8B 3EUNA 1U7LA 2YXLA 2UUCF 3H2UB 2DTJA 2MQQA 3BEGB 3ZNJ1 5DJBA 3OL8A 3DLGA 4OYOA 5LSOA 1YI2S 1D1UA 1RT1A 4F3OA 4DPTA 4Y2AA 1IJFB 1YWXA 5T7LA 4C8MA 3VWSA 3LANA 1UVJA 4HH0A 2QC3A 3K59A 4RNFA 1CLFA 3I9ZA 2FJEB 4IR1A 3UCUP 3CJ2A 1RAGB 1X5OA 4DL3A 4NLUA 4XDDA 4V19J 4E8UA 2FLOA 1HARA 5CAAA 5IT9Y 3AXKA 2IVYA 2GV1A 1ZH5A 1BMQB 2DGWA 1F9HA 3GCWP 2CWXA 4RLEA 4PZVA 4ID5A 1YLXA 1G8RA 4PRFA 5H9EK 1G2EA 1TFWA 3A13A 1IVZA 4M5HA 3I0SB 3H42A 4KAIA 1NDKA 2DNRA 3HHEA 2DY1A 1N5YB 3D6FB 1N5SA 3Q86A 2QLWA 1CC7A 1MSWD 4AL7A 2CPZA 4PG6A 1T9WA 1S1XA 2NYHA 3N5BA 3GIRA 3U02A 1PC4A 2W4DA 3HO1A 1RAAB 2K7JA 3MR7A 4PQUB 1XMQJ 3P49B 1ZM2A 5HQLA 4QIEA 3BDPA 3ZTSA 4AL6A 2XZTB 2BRKA 3HFZB 3OTBA 5L1IA 1SUQB 4OI2A 3NG8A 2DVIA 3J7Z5 2ZDPA 3M30B 4I4BA 1HHQA 2VD3A 1FKPB 3CCMS 1P6TA 1PJ6A 4DV6J 2PMWA 4B3RJ 5HLFB 1RB0A 2I5JB 2FYXA 5DGBA 3IBFB 4ID8A 2VU5A 3PW0A 1NJZA 1RKJA 2ZUAA 3Q24A 3TI0A 4ZHRB 4M5KA 2F1FA 3ET6B 1RWWB 3DHXA 1QE1B 3ULHA 1UKUA 2OPRA 3IBWA 4AE5A 4HACA 2C2KB 3CTRA 2VB6A 4DSEA 1EQMA 2HW3A 2W2QP 3T9NA 4FVMA 2QMWA 3EYZA 2EFNA 1M1KT 1Y3KA 2MY7A 1B99A 3CO9A 4QU7A 3HCXA 4A8WA 3UDLA 3M7VA 2E29A 2XI3A 2ZITA 2EK1A 4P52A 5B0FA 2F9JA 3K17A 3EE3A 4J7CA 2JSXA 1C1CA 4MFBA 1GMWD 2FU3A 1XERA 3C66A 3RR7A 2RSQA 3NNAA 1JKHB 3IP0A 2HFVA 2HFOA 2ZJQQ 2OI2A 4P71A 4U8VA 1S0MA 1AB8A 5EX0A 3M8SA 5CABA 1TL5A 3HFVA 4DV5J 3CJ8A 1X5SA 5IT9U 1U02A 1KN6A 4UOHA 3PJ9A 3TARA 2MZJA 3M1VA 3MEKA 1EETB 3PIPQ 1N6QA 2MGZB 5IS2A 5F41A 3DLHA 1OY8A 2PSZA 2XNRA 4DQQA 3ZZOA 4O4GA 5C2CA 3IRXA 5DZ6A 1JLFB 4K5RA 5A8KB 1WKLA 3VAKA 2EFPA 3OTCA 3R5JB 2V67A 4C8YA 2BUNA 3ZNUA 3OQ2A 4K8RA 2R2RA 2VPWB 4NXMJ 1XIQA 3HXMA 1TL7A 3M32B 4LRDA 3TR5A 2DPIA 2EW9A 1NHUA 1SV5B 4ED7A 4DWIA 4NASA 4MIBA 2I9SA 4CLLA 4AQYJ 2RRNA 2QZ8A 1LOUA 3TAMA 2GC8A 4FKXA 4WZMA 2LYVA 2HZCA 4B17A 1HWJA 3M4XA 2Y0SD 4USIA 3CB4A 3CVKA 4X2BA 4K4TA 4KHMA 5F3ZA 3HI9A 3QAEA 3RTVA 2R2TA 5IM0B 3DLEA 2JLFA 2OMLA 2C22A 4WFZA 3HHLC 5C24A 1FNMA 5IC4B 3MZIA 4Y28C 4NMLA 2RU3A 2IMOA 1X5PA 4KBIA 4TVAB 1W2BR 1R0AB 3OR1A 1FFWB 2NQVA 1FDNA 3UD4P 2UUTA 4TN2A 2DEJA 2BKNA 2OIHA 3AH6A 3ILOA 2P5VA 3K5OA 1NEEA 3P6YC 2R9LA 5F9LA 2G13A 1LW0B 1S6OA 1HNZJ 3DU5A 4LQ9A 4KIAA 2H5IB 5A0YB 3OTOF 3QWUA 5LXRA 3I4PA 1MMDA 4CH7A 1M5KC 1U0SA 3O8WA 4ECTA 1KSPA 2G0JA 3KJFB 3VAHA 5HMXA 3TVZA 2KXHA 2YNGB 5KFDA 4A8KA 4X4SA 5CD4A 5KOWA 4CO4A 4WXOA 2DT9A 1FRIA 1OS5A 2WSCC 4ECQA 4DN0A 2BOPA 1DQ9A 4ETXA 1C2PA 1XR6A 1JJ4A 3MEDA 3DOLA 3V2UC 2ASYA 4EWTA 2CJBA 4GC7A 1EQ0A 3I9V9 1FT8A 4ZOSA 3BF4A 4XIUA 3NOGA 3LP0B 2C2RA 2J6TA 1VQPS 1RHJB 5J1NA 4TK4A 4OFZA 1FD8A 5GVQA 3H5UA 4QU6A 1Q82T 5IQQA 3D54A 4OJGA 2FHOB 1VRTA 2KKHA 3QWPA 4FDFA 2HGMA 3ITHA 5CXTA 4WJBA 1IR2A 4AFFA 3J7YI 2LU2A 4DR2F 4DFJA 2HFSA 2HZAA 2YX1A 2CQHA 3RUBL 5K8PA 1FDBA 2Z57B 3N28A 2GAGC 1QDUB 1GTHA 1BQXA 2KT2A 3BH6B 4DV0J 4PXCA 4NLTA 4F8RA 2OUGA 1NK4A 1P8GA 4LIWA 1RHUB 1C0UB 1WSRA 1RACB 1M5VC 1URNA 1F3FA 4LF9J 2FTRA 2NSCA 2XO6A 5I3QA 5C7PA 2EFOA 2CPYA 4ZCIA 1UVIA 1TV6B 1KQKA 3W3SA 2K1RB 2HRTA 2UZAA 1DURA 1NJIT 1V5VA 2QX0A 1BQMA 2JDJA 4NZ0A 2V8DA 4OZJA 4PQAA 1S0VA 1CQMA 1YG0A 1FC5A 2GGPA 4BDPA 4UT4A 1JLBB 1Q95G 1YJVA 5JVHQ 1N8RT 2BJ9A 4RWXA 2CUYA 2KH9A 3KG0A 4RNOA 3RB6A 4DR3J 2BW2A 2RAQA 3MFHA 1NHKL 4LF4J 2KXNB 3KTQA 3MEGA 5KFFA 4ED0A 2ZBPA 5F0WA 5B7WA 3CF5Q 1R7IA 2ABYA 3HMJG 1FJGJ 3V81A 1T02A 3DI6A 4UW2A 1J2VA 2ROGA 2B3TB 3MFIA 3MEEB 2VPZB 4K59A 3U1LA 3MPYA 1GX5A 1NJWA 1H38A 1Y5IB 3EMTA 2HS0A 4LQ3A 2R7RA 2NQQA 3E8OA 1XN9A 1B64A 3ZZRA 4Y00A 4N41A 4CLSA 3DN9A 1AYEA 1FDDA 1RTHA 2RDDA 1VS3A 2YH0A 2VBXA 4J9QA 2BR0A 2HKEA 4OYPA 2OPSA 5DO2A 1FCAA 3WIUA 1KQSR 2J0QD 3BBFA 4OYMA 4TQRA 2EEYA 4KHRA 2RMLA 2VG6B 5JUMA 2HNYB 2OTLS 2UUBJ 5U47A 2IAJA 4LSNB 3M6UA 4CP5A 4GC6A 5KFNA 4KRWA 2GJ2A 4TYAA 2GVDB 2F7VA 1YBAA 3FEXB 1HHTP 2DHAA 1UA1A 1YHQS 4B9UA 2O1PA 3SCKE 1LKZA 4DL7A 3RBEA 4PG4A 4CWBA 3SQOP 5ADZA 3CJTA 1Q8BA 4OX9F 2D9PA 3C14B 4CQ1A 2G0CA 1T3OA 3G82B 4X64J 3HJVA 1VBKA 2E1CA 2K3KA 5E5NA 2BABA 4HYKA 2HPUA 5KFJA 2OELA 1P1LA 2DXEA 3T3FA 1RDRA 3GPAA 1FJCA 5KG5A 1RT3A 2VQEF 2GHWA 4GO5X 3TQ1A 2JFDA 3GSIA 2BM0A 2RS2A 2RUGA 1BWVA 2P6SA 2MQPA 1TR0A 2YNIB 1GAOA 1VGYA 5KFZA 4QQBA 2I38A 2MKJA 3BZQA 1RT7A 4BCAA 3GYXB 3J7A1 2QYCA 3CCWA 2L9NA 4OX7A 4C3KA 1H6KX 3GZ7A 3DLJA 3IWLA 3H98A 2FUG9 2HQDA 3EPGA 4DFKA 1CQNA 1JLAA 1U25A 2R8GA 1UA0A 1S6PA 2F4VJ 4WFXA 3SSQA 1UWAA 3RAXA 1VMBA 4XAKA 2XS7A 4BHQA 1TUGB 3BQ0A 3GIJA 1QTMA 1T3EA 3R2DJ 3C19A 2QV6A 3DFEA 5A2QU 4O4RA 3MR2A 4MAKA 1TKZA 3KLGB 3P96A 2CJAA 4C4WA 2MLXA 4IO1A 1JXVA 1FTRA 4MIAA 2HHTA 4XDCA 5KFRA 5LSRA 1HYSA 4RWWA 2XEXA 4USWA 1FEHA 3MCSA 3VTIA 2MKYA 1M1HA 3JSMA 4DPOA 5D0HA 3I5BA 2DHHA 3JTPA 5KT6A 3M6VA 3GFHA 4DQRA 4K4ZA 2CRLA 3NL0A 2J6UA 3V6KA 1QSLA 3DOMA 3LALA 3QO9A 3FEYB 2YQ3A 1TZ0A 4QOTA 2Z2YB 1CJUB 2DHSA 1Q0NA 4L73A 3MAAA 3PG9A 1S9GA 5J2PB 4IFVB 4WK1A 2ASJA 2N7CA 5HMWA 4N77A 3UCGA 1RWKB 3KLEB 2ZZNA 3GFZA 4KFBB 4NEZA 5CQGA 4KT0C 1WHXA 4ZP8A 1YJWS 2PA3A 1D09B 2DGSA 3PRDA 2L48A 1DTTA 2A1BA 3T19A 4ED2A 3MM9A 2IYIA 3G8SA 2FLNA 3NGSA 2W7AA 2Q79A 3PR4A 3AT1B 2GIFA 4C11A 2P2CB 1KLNA 4X4RA 2B0GA 1IBKF 4DR6F 1CJTA 4B9NA 1Q1KA 4CRJA 1L3SA 1WDDA 2RB7A 2RJZA 2ZUGA 1ELOA 3GG1A 5GAGU 2JC1A 3LF0A 3BSCA 2QO3A 3M8QA 3CUNA 2PC6A 1Z2LA 2A6OA 4DR7J 3G87A 2CXEA 3TANA 3H5SA 2E7WA 2LQ9A 1WHWA 3R5GA 2ILZA 5HROB 4F67A 5HVHA 2ZBRA 1S9FA 4OIXA 3PX4A 5GADU 5BXIA 1MMNA 4RNMA 1PYOB 1YRTA 3M8RA 2EBGA 3MR3A 2ZH1A 1U2FA 2CFXA 1N0UA 5KFXA 2M9KA 1TL3B 3HKZD 3TAQA 1FKOB 3NCPA 2M8HA 3PYDA 3GMGA 1WHYA 2B51A 1FVQA 1CULB 3CSKA 3CJKB 3NMRA 4I2QA 1T9TA 4WYWA 2JFKA 1CS4A 2V8GA 5ERTA 3KHLA 3K5NA 3DKDA 3WZ0A 2UXDF 1S1WB 2VPXB 1B7YB 4OX6A 3DOKA 1RT6A 2NREA 3AAWB 4X62J 4OYIA 3CXCR 4M1KA 5A76A 2VUGA 3MD3A 3FKBA 4NA1A 3THPA 1M5OC 3LWMA 4PUOA 1RTDB 4RO0A 3OJUA 1NK8A 4KH1B 4DG1B 4W92B 1UVLA 2VBWA 4MKBA 4WF9Q 1U6BA 2YKNA 4TU9A 2FC8A 4USJC 3QFHA 1JLQB 4UZCA 4DV1F 1S59A 1C1BA 5KFWA 4GKKJ 2MPUA 3NLCA 2W2MP 1JXEA 5KT7A 2FVSA 2FJVA 4NWBA 3JSRA 4OJHA 1XMOJ 2PO4A 1WELA 1TVRB 5L9NA 1X9SA 2ZC3A 4XTTA 3TJAA 4KPCA 2B43A 1PYTA 4RUBA 3OSPA 2WSEC 2QN6B 5KG7A 2E7VA 3NGDA 1QLNA 5AE2A 1R31A 3NOCA 5C42A 3TJ8A 2OEJA 1NLKL 1RHRB 1JB0C 1GX6A 3MWBA 3IS9B 4KSEB 2J0XA 3CC7S 4J9SA 2W9CA 4DXLA 2HYIB 5L1LA 2HQIA 1KHVA 4B3SJ 4E0DA 4OYXA 2W2PP 3QGIA 1S9EA 2WVFA 1V3ZA 1VQYA 5F8NA 1T03A 3KK3B 2B9XA 4JI8F 2YBVA 2XSJA 1Z2ZA 2FIUA 1BWEA 3KK1B 2VPYB 4TY8A 1I94J 1RAFB 1IM4A 2CQ2A 2IA6A 1S49A 4HR2A 1SC1B 4JI1F 4D3HA 2B9WA 2QE5A 5K20B 4DSJA 4Y65A 2B5JA 5AJ3J 2IVFB 7FD1A 1WC4A 4DL2A 3UCZP 1F9FA 5LSLA 1S77D 4RW4B 2JNJA 3CDAA 1U47A 2MSTA 4P10A 3QJLA 3V6DB 2DNHA 1SJ4P 5DQIA 4B3TF 4JI6J 1VQ5S 4IO9Q 1JJHA 2AX0A 5GAEU 1RWXB 5C25B 3BKTA 3OR2B 4NCBA 2NSBA 1R8HA 3KHHA 4CT9A 3T6JA 1HMVB 3BREA 2G2ZA 3R8YA 3QZ7A 3S7RA 2L9DA 2M4MA 2ILYA 4LVNP 3B4MA 5LT5A 4DPWA 2HHQA 3AB2B 4NLDA 4I7FB 3LP2A 1KOHA 4KHPJ 4ED5A 2EKYA 5THWA 1FESA 2MZQA 3IM9A 1ZOTA 4LSLA 1IUJA 4ZLLA 2YH1A 3PX0A 4ZP7A 3GJRB 1WC1A 1S4EA 5I3UA 4Z7YA 4ILRA 4C97A 1FKPA 3VF0B 3NWRA 1EHWA 3QRQA 1VRUA 3RRHA 2KT3A 3PX6A 2IRXA 1WEXA 1L3TA 5EWGA 3H5XA 1IKYB 4JI4J 2WVDA 4RUHA 4ZHRA 1KTVA 4LF5J 1RLDA 1OPIA 3ET6A 3VZHA 4TNOA 1NU4A 5HATA 3R6GB 1LQ9A 1WOSA 4PYAA 1ZTWA 3GLJA 3N4WA 4ECVA 1VQNS 1RGVA 2VQFJ 3AOAA 3MM6B 5HVGA 1D9AA 4O23A 5KFIA 2RILA 1J5OA 4FYDA 3A8EA 3F73A 1X4DA 4EBDA 4A8QA 3UR3C 3JS9A 4JV2A 3MM5B 2UUAJ 3M2UB 4YQWA 3AQOA 3ETOA 2W9AA 3WQPA 2F9DA 1T05A 1N33F 4DI6A 4N5SA 3E3XA 3FUYA 1V9OA 4IQXA 2W1BA 1QTNB 2QA4S 3SXLA 5IFMA 2DNLA 3CO0P 2R7QA 2HHUA 1NPRA 2F8MA 1HHSA 5DLGA 3B78A 3DRSB 3I5CA 2POKA 3CCES 3IR5B 4QPTA 2JEIA 2LXIA 3PJXA 2XHWA 8RUCA 2ZNYA 1OYEA 3PHEA 1SJ1A 2XS5A 3DLGB 3ZZUA 1OSCA 1RT1B 4N56A 1YJ7A 3MPUB 4N7TA 5H9FJ 2C28A 4ZLNA 1R8PA 5T7LB 5IXUA 4WTYA 2NXCA 4B9SA 1N36F 4DZDA 3NMAA 6FD1A 4PEOA 5LMNJ 2KO1A 5A8KA 3PACA 4ELVA 2QA2A 4I56A 1NO8A 4ECWA 1IJEB 4DR4F 2CYYA 3KG4A 5D4OA 2PEHA 2B4UA 4ANEA 1RTZA 3C8YA 2C42A 2KN4A 4KYZA 3IXQA 2ZHAA 5KFBA 4EBEA 1S1TA 1NZ8A 5FLXU 5D4LA 2NXJA 3OV7A 1NK7A 1B70B 2CNKB 1YITS 3J7YU 4NXNJ 1TTHB 4AYBD 2X7IA 2R7SA 2L08A 5E0OA 1S1XB 1HBUA 4LSZB 3W9HA 3M8PA 4ZITA 1HBNA 1I6VD 3OFEA 2PIIA 3M8ZA 3MUTP 2V2ZA 2IRYA 3AXMA 1CPZA 1GH8A 1MROA 2CWKA 2OD4A 4PKDB 3G6XA 2P9CA 2KM8C 2AZ3A 4L74A 1FEEA 3P8BB 4OZNA 1RT5B 2RKIA 4BC9A 4JI2J 3FEZA 3D6MB 3SIPB 3ZZ0A 4WU2A 5DRKA 2RHQB 3JYTA 2JRSA 2OMOA 3CJRA 3JQMA 4CLTA 4NLPA 5DZ7A 3W66A 5MAOA 4J9KA 1NH8A 4BWMA 4NZ7A 4LFAF 2V6AA 5HN0A 2R8JA 2CG4A 2YNGA 1NKBA 1E6VA 4IDKA 2XO7A 4ZVTB 1TU0B 2IJFA 3V5RA 4OI6A 3ZZYA 1AZSA 3QJPA 2HHHJ 3UDVA 4YHHJ 3EVWA 1JNRB 2OPRB 5H1SV 3KOAA 1UVNA 2QGFB 2XMTA 1PIEA 5M2RA 2OEMA 1UAWA 2FLPA 3I6PA 2GMLA 2H4YB 4M5IA 3SCJE 2VJVA 3PFEA 1B0VA 5KTQA 1DZ5A 2EPIA 1Y11A 2XYGB 1HNXF 4ER8A 4FXWA 1WHVA 4V1Ak 4DFMA 1R8CA 2PD1A 2MMYA 2NQNA 3W60A 1IXKA 3CJ0A 1C1CB 3FCHA 3THVA 4JUZA 3NAIA 3J80Y 1JLEB 1KFSA 1H72C 4S0MA 4DPXA 2VDHA 2JHEA 5AXKA 2P8IA 3GIMA 2L3MA 3M2VA 2N3LA 3JTNA 4OZ3A 2NZCA 5D6GA 1SC6A 5IC6B 1MW7A 1M90T 4Y2CA 1AROP 3M1VB 2V4RA 1HPZB 4U67Q 5DG9A 3FBEA 3RRGA 1N6QB 2DR6A 3WDOA 1KR4A 2GJFA 3VGSA 3L7OA 4LF7J 5LMUF 4GO7X 2ADCA 5FJ4A 4F2SA 3GR0A 4O4GB 4DR1F 4LR9A 3IRXB 3KWMA 2ATLA 2I8EA 2HNDA 3HJFA 2JVOA 1RK8A 5BJRA 4ZPCA 4ZDNA 4OI3A 3ISZA 1TL7B 5ERSA 3AA9A 1RCXB 3V6HA 1IBMF 2KHDA 1FJ7A 1N32J 1QSSA 2KYZA 1Y7PA 3TAMB 1VCTA 3PTWA 2AV5A 5A8RB 3U27A 2YKQA 3BKFA 4DJBA 1SH3A 2AU0A 4LMZA 2FHKA 2FZCB 1V3RA 3MCMA 1FRKA 3JQKA 2M5YA 2DPJA 3DLEB 4UQTA 5D77A 2KZZA 2XY7A 5C24B 1T0TV 1FJEB 4XPEA 4IYQA 2E1RA 1KTQA 2NPFA 2M8DB 3HP6A 3OR1B 5H9EJ 4RNHA 1TL1A 2OPQB 3QLHB 2XHCA 1N56A 4OHZA 4I6YA 1ICEB 1PO6A 2J7WA 3OXFA 4P2MA 1XJWB 2BZ2A 2G2YA 3I4HX 4J9UE 1GMVA 1TAQA 1WC0A 4F02A 2ZFHA 1FX2A 3R5CA 4DLEA 5BYRA 2GO8A 3IBCB 2WSFC 3NCQA 3BGRA 4ECUA 4CO3A 4NYPA 3SCLE 4PG7A 3HSZA 2MZTA 4U8YA 2UVUA 2VOPA 3GV7B 3A3NB 1VHIA 3EVOA 3F41A 3R9LA 4MKAA 2WW8A 1VQSA 1PJ7A 5T14A 3MEDB 5L38A 3VAIA 3DOLB 1TK8A 2ZH3A 4LBPA 2QFJA 5BYSA 1TP7A 3K57A 2Q43A 3ZFVA 4G65A 4I0WA 2ADBA 1EZZB 1TKXA 1U09A 5BR8F 1MWQA 2EK6A 2RHSB 1SKRA 3IR7B 1X4BA 1VRTB 3WHIA 1FXLA 3ITHB 2UXCJ 1IKWB 2J8AA 4MTPA 5G4DA 1HLWA 4JI5F 1WI6A 2JLEA 3HPOA 2Y9HA 5KFSA 1FK9A 1F2GA 4O3OA 4QWDA 4M5NA 5IWAF 4BLGA 3PR5B 2H65B 4LR7A 4WWSA 4LFBJ 3ZTOA 3FZBA 1Y10A 2WHOA 2BKOA 3GJTB 2W7PA 4OZ0A 1GXTA 5G2RA 1RLCL 1JLCA 1NBEB 3H40A 4MJKA 3ZO7A 2QEXS 4WK3A 2EC2A 1DQAA 3KUEA 1JX4A 2ZDOA 3D6TB 1Q5VA 3TVYA 5LM7E 5KFVA 5HSPA 4YR0A 3LWLA 3PY8A 3SFGA 4XK8C 3SZ2A 2JLGA 4LF6F 4ILLA 2IA0A 4X4QA 2DGQA 2KFNA 1XI8A 2QL5B 1Q7LB 5IZHA 3QJJA 1WC6A 3CJ3A 2GGPB 1BXNA 5E2QA 3VQTA 3KLGA 2YWHA 1KQGB 4NLSA 3NCRA 3R7SB 2EG1A 4QCLA 4KC5A 4FS1A 2GHPA 3EZ5A 3MEGB 2HFUA 3FJ2A 3GFYA 2F8EX 2CNLB 1SKUB 3V81B 3DRRB 3DI6B 3PJWA 4CLPA 6FDRA 2GIQA 4J9PA 4TYBA 3CDWA 3C6UA 1M5HA 3FC9A 4K4VA 1VR6A 3FVYA 4FBTA 1DJ0A 1NAQA 4DV2F 3DLLQ 1CJUA 4RUAA 3OT9A 1X0FA 4B3MJ 3C15A 4WBFA 4WFBQ 4J9RA 2NQMA 2M2BA 2BACA 1RISA 2OPSB 5ITHA 3CD0A 2ACMA 1VBYA 3IG1A 2XLKA 3UDEA 2DNNA 1JIHA 1FVSA 4ALZA 1VRQC 5J1EA 1UMJA 2R8HA 3VVUA 2IAJB 2DCLA 1N34J 2GHVC 4JI3J 3EDRB 5EN1A 4C8LA 2XMUA 3ICLA 3K5MA 2GX8A 3HD1A 4ZVQB 4HTJA 4TKTA 3O2IA 1U1NA 1FF2A 2BEFA 1T95A 3E2EA 3QZ8A 4DU8A 1BLUA 4ZP6A 1KWMA 1SH0A 1HNWJ 4C8KA 1R3NA 1SJRA 3RRKA 4PABA 2DEIA 4YY3F 3PW2A 1BQNA 2HGLA 4U6PA 4M5DA 4Y2IA 3R5BA 3TYTA 3IR6B 3UN2A 2UVWA 2VICA 1EX8A 1FDAA 3BPDA 3D1HA 3Q8PB 1YX2A 2DH8A 1RT3B 2CQ3A 1VQLS 1FE4A 4KPYA 3AJ2A 1ZETA 4AL5A 5E3QA 3BGLA 1ZPWX 1H2VZ 3H25A 1U1RA 3G4SS 4K0KJ 2GZOA 1RT7B 3G86A 3OSNA 4DZ6A 4NL5A 1CULA 4OZ1A 2ZHOA 1HWUA 4DV4J 3M2RB 4X65J 2Z2ZA 4YDXA 2R7OA 2XMWA 2ZHBA 5F3TA 1VJQA 3T1HF 4G1IA 1BD6A 1Y5NB 3UNYA 2AIRB 1JLAB 2IM1A 2BOAA 1S6PB 5G2SA 4DN9A 3ZTQA 2CJKA 3CW2C 2WB1D 5KG2A 3KUHA 3T1YJ 2N4CA 2FHJA 1GFWB 4PPDA 2KYXA 2VFSA 2V9WA 1OY9A 1NKEA 3D2WA 5ETPA 2X1FA 4B9MA 3J7ZT 3W8GA 3D4JA 1TKZB 1QJHA 3UQSA 3VGVA 1LXNA 2CNNB 3THTA 1R6VA 1HYSB 3AQPA 4XO0A 2W4PA 3KXDA 3JSMB 2DNYA 2KDOA 4IOBA 1FERA 1RTJA 3RZAA 4RR5A 1RI7A 2W4CA 3LPYA 3DOMB 3BR9A 3QO9B 2IHR1 4LJMA 1RSCA 4E2FB 1HW8A 5IV4A 4R8UB 2MYFA 3MAAB 2ZH9A 1TUWA 3Q8VA 5B0BA 3TUIC 2CPHA 1V6HA 3FQLA 4CH1A 3R1LA 1WUUA 3T5JA 4GKJJ 4YB7A 3KMQA 3SEOA 2E5JA 1KONA 1XQIA 2ZBIA 1LNQA 4CO2A 1DTTB 2XY5A 4DUYF 3MM9B 2ZOFA 3POTA 1CBKA 5DDPC 1H7WA 1HNVB 4RW7A 4GMKA 2DNMA 1A6LA 4ECYA 1U1OA 4C11B 1UEUA 1AFJA 4ECSA 2RUSA 4E98A 4JV5F 1CJTB 4B9VA 3GQCA 3OL7A 4DX8H 1YBTA 4ECXA 3PW7A 1TKTB 2XYPB 2B4VA 1D9FA 3VQSA 2ROPA 1RHQB 3M8QB 4WU3A 3HULA 2MLYA 3KDNA 4EMDA 4W98A 2MQ8A 1KFDA 1U24A 3JQJA 4ZPVR 2J0WA 1GK8A 1Q7YT 3M6XA 3FSIA 5DM7Q 1ACMB 2AJ2A 3KUGA 4ZIWA 2KTQA 2BMBA 1UW9A 3HT3A 1VQ9S 4KKOB 4H4MA 4KGXB 2HZVA 4CM2A 2MKKA 2JOQA 3OR2A 1UJ4A 1YTYA 1D8YA 4ICLB 3GB0A 4U90A 2HVHA 3EGZA 1IWAA 3DLKA 2QFIA 5K8NA 5HMYA 3D0GE 1S1VA 2RVJA 4I7FA 4RU2A 4P9SA 3UE2A 4I2QB 4IH7A 5DQGA 3OXLA 1N88A 2CPXA 1CS4B 4P6QA 2DNGA 1Y0HA 3DOKB 3EM1A 1RT6B 1K44A 2PI4A 3UNGC 1YGYA 3OVBA 4HHHA 4PUOB 1U49A 2UVRA 3ENQA 1UTAA 4LT6A 2DBBA 5ETVA 1RE1B 2KG0A 1Y3JA 2YKNB 4DU7A 4J9LA 5ERUA 5F8JA 2MTLA 4JI7F 2XMMA 2DCUB 1C1BB 2A3JA 2YWEA 5IT0A 2XMKA 1XTZA 3FRZA 5A6WA 2AKWB 2EVZA 3NRBA 3O44A 1K1SA 3TQEA 4JBCA 1LFPA 1LK5A 4DS4A 5GAGI 3CCSS 1LWEA 3BR8A 2O5DA 4CIOA 4I6AA 2FVPA 3MOJB 4RBTA 2W2OP 3MUMP 2GO9A 4OV1A 2AHOB 2K3IA 3MM5A 4GVBA 1UEKA 2V9KA 3HD2A 1SQEA 4KTQA 1G3OA 2FC9A 3IFEA 3LGNA 5B0DA 4ED6A 1XR7A 5C42B 3HVWA 3SV4A 4ES1A 3WIVA 3VZIA 4R0JA 3CE8A 4I68A 2ZM6J 4MH8A 5GADI 3DRSA 2IBOA 2I0XA 3HHLB 4JOUA 3PKYA 1G8LA 1OPZA 2W9CB 3H59A 2NZ4A 4RW8A 2Z58B 4P2SA 3Q8YA 2DRBA 2ZD1A 1F2HA 2WVEA 4NPOA 2LMIA 2ASDA 1VC6A 1S9EB 1HNIA 2KFZA 2G2OA 1VK3A 4IR9A 1T03B 1K47A 3D68A 3R1HA 4X66J 4I67A 3Q0AA 2XSJB 1RYRA 4Z7CA 4DV7F 4TY8B 2BJDA 3ZTPA 2COLA 3NBPB 3OL6A 2FZKB 1J5EJ 4DFPA 2DXDA 3DDNA 1OIAA 1UZHA 4OX8A 1FRLA 4G1PA 4R0EA 2M0GB 2B5JB 4DV3J 3Q8SB 3SSRA 1JJ2R 3W1YC 4DL6A 1F5BA 1GQEA 2QA4G 2UXBF 3SI8A 3T6BA 4JI0J 1U2CA 3AA8A 5F8MA 2M7SA 3D66A 4C3MA 3VR1A 1WU2A 2VJUA 2R4FA 2Z2LA 4G3IA 1NKCA 1D8ZA 1IBLF 1H3DA 1Q81T 1RZMA 3MR6A 2HQCA 3MPDA 7FDRA 2R8KA 5L1KA 3MM7A 2M3DA 1S7HA 3EXCX 1UVKA 1OY6A 2E5LJ 2Z8QA 3CPWR 2V69A 4HT5A 4WFAQ 1DTQA 3VAGA 1LK7A 2F65A 3LP2B 2KL8A 4C0OC 1FFGB 1ZAWA 4DBQA 1NK6A 8AT1B 4LRCA 4RU9A 2CPDA 3BH7B 3GWCA 2HIQA 3NWGA 5ETNA 1FXRA 2CVEA 1RT5A 4LSLB 2YY3A 4OI0A 4ZCLA 3H4DA 2CJXB 5I3UB 3PNIA 2YQ0A 4DQIA 2UVVA 4F4AA 3C46A 1NB7A 1LWFA 1MN7A 1YZ6A 2CQDA 3JAMU 1HR0J 1OMSA 2ZOGA 1VRUB 3CMES 2Z56B 5HP1A 5HQ8A 4YB6A 2UV8A 3CJSA 2C3MA 3QSYB 2HFZA 2NQRA 2LEBA 1Q8KA 1MMLA 4K50A 1X7VA 1VBXA 5KOXA 2MQNA 4H4KC 2AGPA 1I1GA 2VBZA 5CCLA 1WWHA 2CZ4A 2J76E 3Q8UA 2HS4A 3BSAA 3HSJA 3HDSA 1J5OB 4W4MA 2QL9B 1KQFB 4GVLA 2DNZA 4ES3A 1SL1A 1XNRJ 1H2TZ 1CSJA 5DDOC 3VVTA 1K1QA 4DQSA 1T05B 2CJYB 4ZN3A 2VC1A 4CLYA 2QYGA 2VA2A 2ZBCA 4USUA 4ZJLA 3LUYA 3GR1A 4TK1A 1I6JA 1AXQA 2F5GA 1MWYA 3W61A 1O51A 1JLEA 5GAEI 3FBFA 4UUWA 1Y4ZB 2V50A 2OTJS 3E01B 5GAHU 4N8OA 2QMUB 4N8NA 3P3DA 2DGTA 1HPZA 5EUHA 4Q0BA 1VLYA 5HJXA 3HZGA 1HWLA 4HT7A 3BO4A 1LV5A 1NK9A 1DRZA 4LF8F 1FO1A 4WPAA 2IY5B 3C16B 2Y1RI 1HWKA 4QWEA 4P7VA 1XNQF 3CDUA 1G6BA 4P72A 2BDPA 4DR5F 4A8MP 4BS2A 2VFRA 2YWKA 1AA1B 2CQBA 3W9JA 2AYGA 4LFCJ 3Q23A 3AJ1A 1M1GA 3BYRA 4J9NA 2XQCA 2P6TA 4M5JA 3C3LA 4YOEA 3ISNC 2ASLA 3F44A 5IV3A 4C0BA 2R2UA 2PMZD 3H0PA 4Q2MA 1RBAA 5A8RA 4L76A 4FYXB 5AXMA 2VG5B 1S1TB 2FY8A 3R7BB 2RQMA 2UUWA 4NRUA 5JVGQ 4JYAF 1UFKA 1IBCB 2CQ0A 1SIZA 1IKVA 1SL0A 3UVJA 2BQ3A 5ERRA 1ZZNA 4A8OA 4IRCA 2MZ1A 2N3OA 1HBUB 3F0NA 2YNHA 4PWUA 3FK4A 3M8PB 1NJYA 1HBNB 5BYQA 1IWGA 4J9MA 3ENVA 3Q89A 5K8OA 1SJFA 3O1LA 1MROB 2OEKA 4DPYA 2OPQA 3QLHA 2R7WA 4C9DA 3BYPA 2ACYA 3R97A 2E1MC 4QBUA 4DUZJ 4YDDB 5B0CA 1UZ5A 2RKIB 1RABB 3PM9A 4H54A 2CZVC 3TVKA 4MT1A 3JYTB 2Y1IA 2HURA 4X84A 2LXUA 3LAKA 4PG5A 5EDWA 3OFHA 2EXUA 3LAMA 4N76A 1E6VB 4IDKB 3J81Y 1UL3A 2EFQA 1V5IB 1AZSB 1S97A 5CZVA 1WOOA 2U1AA 2ZH6A 1NK0A 1X9MA 2XLIA 2NUUG 4MK8A 4TY9A 2XGPA 4V19X 4DCPB 1JNZB 1T9UA 1UJ6A 4HI2A 2C2ZB 5KFYA 1UWBA 1GNKA 2XMAA 4C48A 1WJ9A 1ROFA 2Q3PA 4IQMA 2OHDA 1B3TA 4ZPTR 3I56S 3CT9A 3QYYA 3L95X 2RD5C 2R2SA 1U6ZA 1PYSB 1XMQF 4NOHA 4DSFA 5KT5A 1N48A 4CLWA 4NRTA 2SXLA 2CKWA 3L7UA 3O3LA 1SI9A 3SYZA 3MMAA 1IKXB 1IKWA 2B4OA 1XBWA 4M5LA 1SH2A 1L3VA 1GEHA 4M95A 4CM0A 2AYBA 3CNQP 3NAHA 1VC5A 1RWUA 3M9NB 1HD1A 1FHTA 2AQ4A 4DV6F 1BHNA 4B3RF 3M2VB 2UU9J 2AGOA 4HL9A 2H4WB 1VC0A 3S1TA 1Q4RA 2NCKL 1S10A 5C2GA 4FYWB 3EICA 5B0EA 2AX1A 3CIZA 3VHQA 2WW4A 2LQBA 2Y8WA 1RADB 3TZYA 2HNDB 3FFIA 1RHMB 1TL4A 1IQZA 2B9YA 5FDLA 4O3NA 1GMUA 3SFUA 2A18A 3IO1A 2RRBA 4UF4A 5J2NA 3MM8A 2XNQA 4RNNA 5K14A 1VQKS 5L46A 2BA9A 1JLGA 1S1UB 2HLTA 3MCNA 5E33A 4URQU 1PILA 5EGYA 2XB2D 6AT1B 3DU6A 2OD6A 1FRJA 1NDPA 3KJQB 2C2DA 4PWWA 3I96A 3DRRA 3K5LA 3RAQA 4DV5F 4PR6A 2NQSA 3WX4A 3RW7A 3OPKA 4WXWA 2KJVA
chains in the Genus database with same CATH topology
4PQUB 1PC5A 3J80Y 1JLEB 1G7CB 1KFSA 3PIOQ 5KFHA 3P49B 1ZM2A 1WACA 2XMVA 4CH0S 2JHEA 4UOCA 4QIEA 3BDPA 4QPXA 2MHNA 1T3NA 1GT8A 2RF2B 4AL6A 2FJAB 1TL1B 2EFGA 5AXKA 3GIMA 1LW2B 4O3PA 2L3MA 3M2VA 2N3LA 1TAUA 2BRKA 1VJWA 3JTNA 3OTBA 1SUQB 5L1IA 2KHCA 3AHPA 4MMOA 5D6GA 3SSSA 1SC6A 4OI2A 3NG8A 1MW7A 1M90T 2DVIA 3UPFA 4Y2CA 4Q8FA 2WOMB 3J7Z5 2PE8A 1AROP 3M1VB 2V4RA 1HPZB 2ZDPA 3M30B 4U67Q 2QRRA 5DG9A 2ALZA 4I4BA 3RRGA 1N6QB 4NYOA 2YX7A 1E6YA 3WDOA 2VD3A 1FKPB 3D0IE 5HBMA 1KR4A 3I0RB 3CCMS 1P6TA 3I87A 1RYSA 1VI7A 2X1BA 3L7OA 3FSYA 5HLFB 4NXMF 5LMUF 2I5JB 5F8LA 4GO7X 2ADCA 2MJNA 5DGBA 4F2SA 5FJ4A 4DEZA 5AE1A 3GR0A 4O4GB 4DR1F 4ID8A 3IRXB 3KWMA 3PW0A 4A8YA 2ATLA 1NJZA 3RB3A 3Q2SC 2I8EA 1RKJA 3Q24A 1NZAA 2HNDA 3BGRB 4WE1B 4AQYF 4FZVA 3TI0A 4ZHRB 2DR8A 2JVOA 3HJFA 4ED8A 4PD1A 1RK8A 4KGMA 2F1FA 2BV3A 3DNCA 4EO8A 4HDGA 3FNNA 5BJRA 3CDBA 5CYQB 4ZPCA 4ZDNA 3DHXA 1QE1B 3N9UC 4OI3A 3S01A 3UD3P 3ULHA 3ISZA 2XS2A 1UKUA 2OLWA 2OPRA 5ERSA 3IBWA 3AA9A 1WTFA 3V6HA 4PD0A 1IBMF 4FF4A 4AE5A 5G0RB 4YUDA 3CCJS 2KHDA 3NGKA 3CTRA 3I0SA 1FJ7A 1HQMD 2VB6A 2AJ1A 1X4EA 2B4PA 3GILA 4DSEA 1QSSA 4TLRA 2KYZA 1Y7PA 2HW3A 3FDSA 3TUJC 3TAMB 4WIIA 2UV8G 3DHWC 3T9NA 1HBMA 2AV5A 4FVMA 5A8RB 1N5YA 2C3UA 2UXCF 2QMWA 2C3OA 3U27A 4C98A 3EYZA 2EFNA 1M1KT 5E3AA 2M70A 2N7YA 1Y3KA 2YKQA 4DJBA 2MY7A 3PXGa 1YQHA 2XI2A 2FTSA 4O44B 1SH3A 3CO9A 2WCXA 4A48A 1TKXB 4QU7A 4W90B 3UR0A 2ZKTA 4A8WA 2IMWP 2AU0A 5HL7Q 3GG0A 5DGAA 2ZOMA 3OW2R 4LMZA 3UDLA 2FHKA 2XI3A 1V3RA 2E29A 2ZITA 2GNKA 2EK1A 1FRKA 2M5YA 2DPJA 3DLEB 4G6VB 4UQTA 5B0FA 2FY1A 5D77A 2KZZA 2XY7A 5JJBA 2F9JA 5C24B 4RW6A 5J1PA 5EWFA 2R7TA 2AJFE 4LFBF 1KS2A 2V5HG 1FJEB 4QWCA 2JSXA 1C1CA 4MFBA 4CI0B 2F40A 4XPEA 4IYQA 2FU3A 1XERA 3C66A 3SQGA 3RR7A 1VQ8S 4CO0A 2E1RA 1KTQA 2RSQA 2NPFA 3NNAA 1JKHB 2BYCA 1HNZF 4PQUA 2M8DB 3MTJA 2E9RX 1KD1T 5KFPA 3CC4S 2HFOA 2ZJQQ 3HP6A 3OR1B 2O67A 2MQOA 1FK9B 5H9EJ 4QZVB 1S0MA 4C7QA 4RNHA 5FLXY 3L09A 5EX0A 3M8SA 1TL1A 1LW2A 4NLYA 2OPQB 3QLHB 5D4PA 2W8KA 3MMJA 1N56A 4OHZA 2HLUA 1TL5A 4WZQA 1APSA 4I6YA 4ES2A 1PO6A 1SUQA 2J7WA 1OO0B 3OXFA 1X5SA 1KN6A 2BZ2A 3TARA 2MZJA 2WOMA 2LA6A 3I4HX 3M1VA 3M2RA 3M30A 3MEKA 2DITA 2JL9A 1EETB 3PIPQ 1N6QA 2MGZB 5IS2A 1TAQA 3O5TB 3P5TL 3MGJA 5F41A 4F02A 5HO4A 4F4WA 1DARA 1P27B 2FD2A 2ZFHA 1JLCB 4B08A 4PG8A 3DLHA 4DF8A 2PSZA 3KLFA 5HLFA 3HF5A 2HG4A 2I5JA 2M52A 3R5CA 4DLEA 5BYRA 2GO8A 1TKDA 2E9TA 2XNRA 4C8ZA 2IC3B 4DQQA 2WSFC 2YKAA 3ZZOA 4O4GA 4F2RA 4OZ5A 3JSYA 3IRXA 1JLFB 4IUFA 3NCQA 1WF2A 1IN0A 4K5RA 3BGRA 4ECUA 2J9EA 5A8KB 4CO3A 3VAKA 1Q8LA 4NYPA 2EFPA 3OTCA 5F8GA 2RE1A 3SCLE 4Z2XA 4PG7A 2B56A 2MZTA 3DXBA 3I5AA 4C8YA 2BUNA 1QAJA 2UVUA 3OQ2A 3GIIA 5CYQA 2VOPA 3GV7B 2R2RA 1QE1A 1OQ3A 2VPWB 4X4TA 2HMIB 2LLZA 5KFUA 3HXMA 2QMXA 2DH9A 3M32B 5DS7A 3BJYA 2LKZA 3TR5A 2DPIA 3F41A 4MKAA 2EW9A 1RAJA 1VQSA 2WW8A 5G0RA 2HVIA 1NHUA 1SV5B 5T14A 1Z4UA 3MEDB 5L38A 4MKYA 4ZK7M 4ED7A 4PXDA 3VAIA 4DWIA 4MIBA 2I9SA 3DOLB 1TK8A 2L41A 2RRNA 2QZ8A 2ZH3A 2QFJA 1LOUA 1ZAVA 3SMZA 3TAMA 3QPIA 2GC8A 4WZMA 2LYVA 2F3JA 5BYSA 1TP7A 3K57A 2DH7A 2LA4A 2V2KA 1ULRA 2HZCA 2OFHX 4B17A 1HWJA 2Q43A 2Z0GA 3M4XA 2Y0SD 4USIA 4ZPAA 3ZFVA 3CB4A 2JEGA 1DQ8A 3CVKA 4X2BA 2KI2A 4I0WA 4K4TA 4KHMA 2FJDB 2ADBA 4FS2A 2MKCA 1TKXA 1U09A 5BR8F 5CA5A 5F3ZA 4CNYA 1K9MT 3HI9A 2J9CA 1FA0A 1U1MA 3B82A 2EK6A 3FMBA 1GXLA 3QAEA 3RTVA 3DRXA 1SKRA 1R8AA 2XSFA 3IR7B 4B3MF 1X4BA 2R2TA 5IM0B 3DLEA 2JLFA 1VRTB 2OMLA 4WFZA 3HHLC 2C22A 1Q86T 3MF5A 4KR0B 5C24A 5KT4A 1FNMA 3DM2B 1R89A 3OUYB 3PZPA 1FXLA 3ITHB 4DV0F 3MZIA 1IKWB 4Y28C 1LWCA 2J8AA 1HQEB 3C6UB 4MTPA 5G4DA 4NMLA 2RU3A 1RT2B 2IMOA 1X5PA 3IGNA 3N6MA 4JI5F 1JKHA 1WI6A 2IFXA 4KBIA 3K58A 1W2BR 4KJIA 2JLEA 4CNZA 3HPOA 2HVZA 1R0AB 3V4IB 3KMSA 5KFSA 3OR1A 2NQVA 1DBDA 1FDNA 2J9DE 3UD4P 1FK9A 2HGNA 1F2GA 4O3OA 4QWDA 5IWAF 3BQ2A 1V3SA 4R8UA 3PR5B 2UUTA 2XBPA 4TN2A 1YVFA 4DLGA 2CJQA 4URGA 2OP5A 2DRAA 2H9ZA 4LF9F 2OIHA 3AH6A 2KFYA 3OHBA 2NRSA 2P5VA 1UFWA 1K73T 3K5OA 1KOOA 1NEEA 3P6YC 2R9LA 3FZBA 1N34F 5F9LA 4JI3F 2G13A 2WHOA 3W2VB 1U1LA 2HAIA 2IVMA 4FNIA 1LW0B 2KT5A 1S6OA 1ZBTA 1EETA 3M9OB 4OZ0A 2W7PA 1GXTA 3DU5A 2JJ4D 2MGZA 4LQ9A 4KIAA 5A0YB 2D9OA 3TA2A 5G2RA 2BJEA 3IG1B 4B02A 5B0AA 4ZPDA 3OTOF 3QWUA 4KO0B 5LXRA 3DYAB 4FNHA 2MY8A 1JLCA 1MMDA 3I4PA 4ZVEA 1QSYA 3CDEA 2NQKA 3FGVA 5J1EB 3CCZA 4CH7A 3N6LA 1M5KC 4PWDB 3H40A 2IC3A 4MJKA 5D78A 5LL6d 2QEXS 3O8WA 4WK3A 4ECTA 1DQAA 1HNVA 1JX4A 1KSPA 2ZDOA 3HK2A 1JLFA 5HMXA 3VAHA 1F5AA 3CEDA 3TVZA 3TVYA 5KFVA 1HNWF 2ZC4A 2KXHA 5HI7A 2YNGB 5KFDA 4U7UK 4YR0A 3LWLA 3PY8A 5E41A 5I42A 2MQMA 4XK8C 1NHVA 3SFGA 4X4SA 4A8KA 3SZ2A 5KOWA 2JLGA 3BO2A 4LF6F 2JC0A 4NA3A 4CO4A 3TAPA 4ILLA 4WXOA 2DT9A 2IA0A 4DR3F 1FRIA 1YRXA 1OS5A 3CJ4A 2DGQA 2WSCC 4X4QA 2KFNA 1XI8A 2O3DA 4J5OA 4ECQA 2HMIA 3MECB 4DN0A 4LF4F 2H5EA 2YTCA 2KJWA 5FIIA 5HMZA 1Q7LB 3M32A 5M2PA 5IZHA 2BOPA 3QJJA 1TKTA 1U4BA 1DQ9A 4ID5B 4OJ3A 3CJ3A 4ETXA 1C2PA 1HI0P 1XR6A 2GGPB 3V4MA 2E5IA 5E3CA 3R5AA 2FVRA 1JJ4A 1SV5A 3MEDA 3WC2A 2PN6A 4QWAA 1VOMA 3DOLA 4F4YA 3V2UC 1FJGF 2ASYA 1RQ0A 5E2QA 3VQTA 1UEVA 4EWTA 2CJBA 4GC7A 5IQ6A 4IOAQ 4DOZA 1VHFA 2E66A 3KLGA 2VKZG 5KG3A 2CQPA 1KQGB 2YWHA 3I9V9 1FT8A 4ZOSA 4NLSA 3BF4A 3NCRA 3CIMA 4Q43A 1ZZFA 4XIUA 4TLQA 3LP0B 2EG1A 2C2RA 1BQNB 4QCLA 4KC5A 2J6TA 1VQPS 4FS1A 4RZRA 3HFKA 4EEYA 3K2YA 2GHPA 1ZAXA 2OFGX 4M5DB 5L9XA 3EZ5A 2X1GA 3MEGB 3K8WA 3R5DA 3FJ2A 3MR5A 5J1NA 2CPEA 4H4KA 4TK4A 2OAUA 3GFYA 1FD8A 4OFZA 5GVQA 1QAYA 1U6FA 3H5UA 2F8EX 4QU6A 5CYMB 3V81B 1Q82T 5IM0A 3M6WA 3DRRB 3DI6B 4N47A 1UVMA 5IQQA 1S48A 3D54A 4OJGA 2FHOB 1VRTA 2KKHA 2CQCA 4RBVA 4QWBA 4OQJA 2W7OA 3QWPA 3PJWA 4IRDA 4K0KF 3DM2A 6FDRA 2GIQA 2HGMA 2YKMB 3MAQA 4J9PA 4TYBA 5L8RC 2B7BB 3ITHA 1S0OA 2W24A 5CXTA 4Z37A 4WJBA 2YX4A 3CDWA 3KYLA 2DIUA 3C6UA 1M5HA 1KVJA 1SBRA 1RT2A 1N4LA 2AGQA 3NS5A 4NLQA 2U2FA 4AFFA 2J7KA 1DLOB 4KKOA 4K4VA 3FVYA 3HLUA 4H4OB 4DV4F 3AB4B 1R0AA 4X65F 3V4IA 4FBTA 3VAJA 1DJ0A 2RNEA 1NAQA 5J2MB 4DV2F 3J7YI 2LU2A 4DR2F 4DFJA 2RT3A 3DLLQ 2YX1A 4RUAA 2CQHA 3QGGA 3LO3A 4ZVFA 1X0FA 4ICLA 4U7CA 5K8PA 1FDBA 3JTOA 2D1CA 3BN4A 3N28A 4B9LA 2JEFA 4WFBQ 1GTHA 3RW6A 1HL6A 2UUBF 1BQXA 4J9RA 2NQMA 2M2BA 2KT2A 1OQ6A 4K2XA 1R6YA 4PXCA 2BACA 1RISA 4NLTA 1NNDA 1QAIA 3IRWP 1LW0A 2OPSB 2VFUA 4F8RA 4QIGA 1NK4A 1P8GA 4LIWA 5ITHA 3BN7A 1CEZA 3Q22A 3CD0A 4FF1A 5L1JA 4DSLA 5A0YA 3T1YF 1VBYA 3IG1A 2XLKA 3D1OA 4KO0A 5I3PA 2DNNA 3I55S 2HWTA 5T41A 1JIHA 1FVSA 1C0UB 4ALZA 4X4PA 4K4UA 5J1EA 1UMJA 1M5VC 4AXJA 1URNA 2R8HA 1C0TB 4PWDA 1UW4A 2R7XA 2IAJB 2FTRA 2NSCA 3H4BA 5I3QA 2DCLA 2EFOA 2GHVC 3HHNB 2CPYA 3ZZZA 4YMEA 2R8IA 4ZCIA 3R3TA 5EN1A 2D3ZA 4K4YA 4C8LA 2XMUA 1UVIA 1TV6B 5E3PA 1KQKA 3W3SA 3DXSX 3ICLA 2K1RB 3K5MA 2NQUA 1HD0A 4X64F 2GX8A 1FNOA 2UZAA 1DURA 4HTJA 2QIFA 1NJIT 1BQMA 4TKTA 3O2IA 2JDJA 1FF2A 1U1NA 1T95A 2VA3A 3MECA 4NZ0A 2V8DA 2NQPA 4O3QA 1X0PA 4OZJA 1G1XA 4PQAA 4F50A 1S0VA 1CQMA 1YG0A 3S6EA 5SZTA 1FC5A 2GGPA 3E2EA 1WEZA 3QZ8A 2P9EA 4BDPA 2XWYA 1BLUA 4ZP6A 3DCAA 2MKIA 1JLBB 1SH0A 4C8NA 2ZVSA 5LJ3Y 3EGWB 1YJVA 5JVHQ 1N8RT 3EZUA 4C8KA 1R3NA 1SJRA 4RWXA 3RRKA 2WBMA 2J0SD 3H5YA 2KH9A 3KG0A 4RNOA 4YY3F 2DGOA 3M05A 1N52B 3LP0A 3PW2A 3RB6A 4ECRA 5F8HA 1BQNA 2BW2A 2HGLA 3MFHA 2LDYA 1VIOA 4U6PA 1BGXT 4M5DA 4QR1A 2KXNB 4Y2IA 3R5BA 3KTQA 3MEGA 3TYTA 5KFFA 4ED0A 2EFVA 3T9ZA 1VBZA 4FVCA 3DMJB 4M63A 5F0WA 3IR6B 5B7WA 2FPHX 3PEHA 3CF5Q 1R7IA 2DO4A 2ABYA 3VALA 3IAS9 3HMJG 2UVWA 5CYMA 3V81A 3MAHA 1FDAA 1OSDA 1T02A 3DI6A 3MMCA 4UW2A 4Y2MA 3D1HA 4HKQA 3Q8PB 1J2VA 1HBOB 2B3TB 2ROGA 1BY9A 2YKMA 1U26A 2DH8A 3MFIA 1NK5A 1JMTA 1RT3B 3MEEB 1RTJB 2VPZB 3CC2S 1O0PA 2CQ3A 4MFBB 3G6VA 4K59A 1VQLS 3FQKA 1ZM4A 3U1LA 3S8SA 2LU1A 3MPYA 1GX5A 3UWTA 1NJWA 1Y5IB 4QIWD 1H38A 2NROA 1FE4A 2HS0A 4KPYA 1RP5A 1T94A 4LQ3A 1HW9A 2UP1A 3AJ2A 2RDIA 3NS6A 2R7RA 4GKJF 5J2MA 2AP6A 1ZETA 5K9FA 4AL5A 2NQQA 5E3QA 3E8OA 3BGLA 1XN9A 1ZM9A 1B64A 1ZPWX 3ZZRA 1B0TA 4Y00A 4N41A 3RAMA 3DN9A 1H2VZ 4F3MA 3H25A 1FDDA 1RTHA 1U1RA 3G4SS 4NCAA 3PW4A 1RT7B 1VS3A 1GTEA 2YH0A 3G86A 3IWXA 4NL5A 3OSNA 4BWJA 2JVRA 2VBXA 1QAXA 4J9QA 2BR0A 4MYTA 2HHWA 3CD6S 2GCFA 2F4VF 3BGFA 2GMJA 3OLBA 2XZWA 4OHWA 4OZ1A 4AUKA 3HHLA 2ZHOA 2OPSA 5GMKa 3VAMA 1JXLA 1HWUA 2HFNA 5DO2A 1X4HA 2EBEA 3M2RB 1QUPA 4QW9A 2Z2MA 2Y1JA 3G6YA 1FCAA 2WTFA 4YDXA 1KQSR 2R7OA 4USHA 2XMWA 1R43A 2J0QD 2ZHBA 4DSIA 5F3TA 3T1HF 4O3SA 4TQRA 1QVGR 1C0UA 4G1IA 1BD6A