5D93C

Oxidoreductase fragment of mouse qsox1 in complex with a fab fragment from a mouse qsox1-specific antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
207
Chain Sequence
b'QVQLQQSGPELVKPGASVKISCKASGYSFTSYYIHWVKQRPGQGLEWIGWIYPGSYNTEYSEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYYCARSEDWFAYWGQGTLVTVSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfhydryl oxidase 1
publication title Overcoming a species-specificity barrier in development of an inhibitory antibody targeting a modulator of tumor stroma.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 43
structure length 207
sequence length 214
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d93C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d93C02
3N50A 5HYEA 1ZLVK 2QBWA 1RZIA 2OS7A 3VI4E 4YPGB 4NO3A 2ESVD 3X3FL 4ZUWB 5C6TH 4Q9BA 3FO9B 1VEPA 1OPGH 3DVIA 4GUPB 4L8SB 1MQKH 4V1DD 4EDXB 1BOYA 3SPVB 4HXAL 4M6AA 1YEKL 3LY6A 3B8YA 5JDSB 4OCRH 4RGMC 1K3ZA 4OZFA 3NGBB 3IVKB 3MRDB 4XWGH 3ARFB 4HT1L 1T03L 1CTOA 4X6DA 3S37X 5FYKH 4KI5F 1UZ6F 3UBXB 5CMAB 4PB0L 3EYVB 3PXHA 5D2LB 3PDGA 3HCVA 3N0PB 2BDNL 4JFZH 2PTTB 5DJXA 3VXQB 3W11C 3SGDI 1NCBH 4ODHL 3RTQB 4QNPE 3TA3C 3LKOB 3EZJB 4OLYL 2Z4QB 1VEOA 2DLFH 1IM3B 2E27L 3PWJB 5I8KL 5FB8A 5ID1A 1DFBH 4OFYD 3SDYH 2X1QA 4LRIA 1J1PL 5KG9B 4EI5C 1T6WA 1F11B 3MRQA 1MRDL 1ED3B 1JHKL 3PJSA 5FUZL 5I76B 4ZFFA 4NIKB 2ZUSA 2F8XC 1RIHL 4I77H 1A6UL 1CDCA 1K5NB 4NRXB 5TGBB 3HG1A 4ODBD 1WAAA 2VLJE 1ZHBB 4HWBA 4PG2A 5DJZA 5DWUH 5DRWA 2ZKHL 4KROD 5D7IE 2FIRT 1ZSDA 5GS3A 1INQB 4K9EC 1RK1A 1TQBC 2VISB 3QDGA 3FQNB 4GG6A 4R96A 2F5BH 4LP5A 5LGJA 4U3HA 4FFWD 2GJ6D 3ARUA 1VDGA 5BVJA 4K71B 4LASH 3EDDA 5ETUB 4LLUB 4IIQC 4PR5A 3EO9H 4BH7B 1QUNA 3FQUA 4QOKE 5ALCH 3VXSD 3W5NA 4UB0H 5F88B 4NJAH 2FR4B 5I1IL 3IU3A 1F4YL 4JFXB 3OHXA 4I3RL 1JZ4A 1MFBL 4UDTB 2LTQC 1E4XH 1HNGA 4A6YH 1J87A 4KUZL 2JELH 3QULA 1CFVH 1B0GA 4PJ7A 3RWEA 5ERWA 2NY4C 2YC1A 4XP4H 1JGLH 1A14H 1P2CB 2DIAA 2B20A 2GIYA 2IQ9L 4TYUA 4I4WB 4G8IB 4H88L 5SX4H 4HIHA 4Z76A 5AZ2L 3GSWB 1OM3H 4NHCL 1PD6A 1GRWA 4HULB 4MXWH 5L8JB 4K94L 5IVXE 3VDBA 1F45A 3KPSD 2X9XA 3WIIL 2Z91B 1HQ4B 1WC7A 4LRNL 5DHXB 3T2NL 3F12B 3MLPA 3IU4L 2XKNB 3T2QA 1KPRA 3QEUB 1FNAA 2X41A 3RZCD 4KKCC 4G8FB 2ARWA 1MJ7H 4DEPB 5JOPD 3ULVH 2Z31D 3KAAA 1W8NA 3QDMA 1IGJA 3GJEA 4F57L 2MCPH 3IFNL 2CLVB 1LE9B 3KPOA 1XZ0A 4BUHA 3GSQA 2P8MA 2XWJA 1R5WB 1HHKB 5TDOA 4ZAKD 1I3GL 4HJGA 1G9NL 4KK9D 2K9UA 3TCLA 3MNWB 2VC2H 1OQOA 4FQXD 4TSBH 1MVFA 5SV4A 4U1HA 4MWFB 3MCG1 3PF2A 1KGCE 4MJ5B 4MJIE 3RHWK 2FGWL 3Q6GH 4G42B 4ZD3L 5I16B 1N6UA 3LN5A 2GFBB 2YD9A 1I8LA 4PJBE 2CR3A 2V2WA 4MSWB 2JJSA 2AKRB 4HUVA 3DHMA 3UYRL 1LO3H 2K3TA 2DTSA 3O4LE 4K8RC 2R0LL 1G7IB 2DM2A 4YLQT 3U7YH 1KT2B 1IGMH 4J23A 4RBPH 5HHXH 4GXVH 4HC1H 5DHYA 1UH4A 2WLYA 1M6OA 1MNUH 4UMGA 4YHLH 4H5SB 5ICXB 4TSCL 4HSQA 3G5VA 4QXUH 1IGYA 2VZSA 4UT9H 1KENL 4NQXA 3BH8A 4DZ8B 5HVHB 5EORH 1DQQB 3EO1A 4PGCA 5EIQA 3CCHA 4G7VL 5JXED 4GRWB 1ACYL 1P1ZA 2ESVA 3A6BH 1CLZH 3EDEA 2PXYC 4HCRH 4LL9A 4V1DA 1NH6A 4EBQL 5GSVB 2Q1EA 1VA9A 4ODTL 3MREA 1X3DA 3C60B 5EU3A 3GB7A 1C16B 5F9JB 3V7MA 5FA4B 2X42A 5I1LA 3WNOA 5D8JH 3MRNB 1JNHA 1RPQA 4AEIH 4ELKB 5AD0B 2YR3A 4KTYA 1JYXA 3SDXB 1S9KC 3MV11 4QXTB 4M4PA 4QWWD 1E28A 1MPAH 2NYYC 4L5FL 4JO1L 2N4IA 4NWTL 4TUKL 2Z9TA 1OCWL 5EBWB 3STZA 2XNAA 4WV1A 3UAJD 3OXRB 5A16B 1D3CA 1X5HA 3LS5L 5I6XB 4R7NB 1QSFD 3BI9X 3MNZB 3RWIA 1YJDC 1NCNA 5I1CL 1QR1B 1TVHA 4OFYA 3TPUB 3IDXH 4JDVA 2NTFB 2R69H 1B4JL 2FLRT 1ZTXH 1CGYA 1S9WA 3BQUC 5IMLB 4PRAB 5JQHC 3SBWA 1BLNB 25C8L 4LDOB 5I75C 3CFIC 4OKDA 5EPMA 3HC0B 5FCUH 4AMKL 5FYLD 2AERT 3VFWB 1Q8MA 3RVVD 4HK0B 5EIIA 5A2FA 5EO9A 3L95B 4G6JH 1JUFA 3IJYA 3RDTA 3GMQA 2A77L 4XNXH 1P4IH 2KQNA 4QHUB 3FFCA 4ELME 1LDPL 1AE6L 1RZ8A 4Y4KC 3ALXA 3KXFB 4YX2L 3S96A 3RWHB 1TJIH 2B7DT 3BPNB 3VA6A 1FYHB 3O8XD 2GJ6A 1AGDB 3PE9A 5KVDH 5LXGL 3G5XB 3WFHA 1IC4L 3GI9L 2OLDA 3IGAB 1VGKA 4JHZA 3VXSA 1F4WH 4Z7NF 4N9GA 2VDKH 4MMXC 1A1NA 1IAKA 2OTWA 4YAQB 1INEL 4GBXD 4HWBL 1J8HE 5EU4B 3RL2B 2DBLL 1UWEH 1CQKA 1L0QA 2FIKB 4IRSD 4YDIH 2VABB 4GRWH 2CUMA 2BMKB 1U58B 3E1F1 4Z95L 3F65A 1QVOA 1GAFL 5CBEB 4YHKL 4QRRE 1R3HA 2GCYB 5EUKA 4EI6B 1T04A 3GEWB 2EIZA 1UXWB 3ULUD 5HTSA 3T65B 5J12C 2E7LC 5DJ0A 3QXDB 1DBAH 3KPSA 1TZGL 5EBGA 1NCCL 4LIQL 5I1KH 4NRYB 4KY1H 4CJ1A 5HI4C 4GMSH 4HX1B 4MNGB 3RZCA 4MS8D 2D31A 3WMSA 3QDJE 1OSZB 1BAFL 3LPGA 3VFVB 2Z31A 1FJ1B 4J12A 4GSDL 3RHWF 1MLCA 4X7TB 3F5WB 4G80B 3HLAB 5HHOB 2OR7A 2XN9D 5BVPH 3BYYA 1MCRA 3VI4F 4OFDA 3L3KA 3ZT7A 1I8IA 4XGZA 2PKDA 4POZD 4ZAKA 5FDWB 5EO1B 4LLWB 4RDQF 1S9XB 1YEEH 3MUGA 3WXWL 4FQXA 5T3XL 3ORJA 2HA1A 2X4OA 3GBLA 2N7AA 2MKLC 5I8OH 5K9KB 3E6FB 4ODSH 4DKFH 4M7LL 5IFJB 5E00A 1DSFH 4HS6B 1J1OH 2R2HB 2E9BA 1MEXH 5FO7B 1A7OH 3RNKA 1R3LA 3BPOC 5DYOA 5I1JH 3SKNB 1DDHB 1R5VB 5DD6A 4ZFOB 3EDFA 4U0RB 1S7WA 4C59B 4CMMB 1ERNA 2N56A 3K74B 4DKAA 4GRMA 4Z78B 5BJTA 5E8PA 1T20A 4LVNC 4BFGA 3TA3D 2FX8L 1XEDA 2VXUL 4LQ1A 1RZKC 1XT5A 3DIFA 3TM6A 4QNPF 4N68A 2C5DC 2ZCLH 1MJ8H 1U91A 1A9EB 4CL7A 5IESL 2W0PA 5GHWL 2R1YA 4PJFF 4ZOEA 3QXAB 3CFEB 1A9BA 1QQDA 5JIIA 4DVRH 5E2JA 3SDDD 1SM3H 4NN6B 1G9MC 2UV3A 4RCAA 4YR6A 5JXEA 1GYAA 4JR9L 2X4UA 2DDQH 2QL1A 3ES6B 4JFHE 4JY4B 3HNTH 4HFUL 4NDMA 4P57B 3UX9B 3F62A 4YHZL 2FL5A 5JNYA 3CZFB 1U8IA 3V5KB 2ADJA 4M3JA 5D7IF 5KVMC 2AXHA 5BXFA 5CJ8A 2R0KH 4OTXL 1YEJH 3S34L 3WJLC 4HGWB 1KN2L 4NNXA 2HP4A 3LH2L 1FC1A 4LU5H 4RBPK 3FMGH 1H8SA 5DUPH 1T1YB 3V6FB 3DOSA 2P5ED 3PP3H 4KRNA 3VDCA 1ROWA 3BFOA 3MRRB 3WLBB 4FABL 1H3GA 4X80H 4H8WC 2FX9L 2WBJC 4JFFB 1D6VH 1MI5E 3L5WB 4M7KH 4OLUL 4OLWH 2HVKA 5DI8A 1QSFA 5J11C 3KPLB 4ODWA 4PJIE 5EDXA 4U1MB 4K7PH 4EIZC 5CJOH 3HE6B 3X3GH 3IB4A 4MA8L 1ZGLM 4N0CD 1C5DA 4HUKB 3CLFL 4I2XA 2APFA 1HI6B 2W0FB 5DMJB 3WXVL 2X7LA 2ZUWA 3N9GH 3TBYA 1U2HA 1SEQL 5HPMA 1E4WL 3MC0A 4U6XB 4R26H 3ARGC 4LEXL 4Q9QH 3D69B 3RY6C 3LKNA 1IKFH 4XP5H 1DUZB 5DLMH 5IVXF 4OLEA 1EPFA 3QO1B 3MGAA 3ZMRA 5AG8A 3V52H 1GZPA 3QNXB 2HLAA 3SDAD 3HC4H 3VRLE 1NGYB 4YIQB 2DLTA 3V4UH 3O8XA 3IDIB 4WTWA 3RGHA 1CR9L 1CTNA 4YDLB 1TPXB 3TVMC 3GSNA 1MF2H 3F58L 4PB9H 1A02N 4PJ8B 5E94B 2C3GA 4LCUA 2AQ1A 3RVWC 1FNGA 4HIJB 1QNZL 3FQWB 3UTPE 3GZKA 2W9EH 5LQBL 4XBPA 4WUUD 1EXUA 1XCQB 2DJ4A 5DD5H 4DGIH 4GBXA 3TBTB 5I1GH 1WWBX 1G7PA 2ATPB 3RP1A 4P2YA 1ZS8B 4IRSA 3HZMB 3K2MC 5DFVD 3MV7A 1ORQA 5T3ZD 4FQIL 1NEUA 2Y9RT 5F7DB 3Q5YA 5ESVA 3FOLB 1IRAY 5DC4B 5GISL 1KIPA 4ZXBC 2BVPB 1LDSA 3LKRA 2FD6H 2OM5A 1Y6MR 2WW8A 3RWGB 3OJDB 3LEYL 5DC9B 4QEGA 4ERSH 4J3OC 1BEYL 4IOSD 1T7WA 1GC1L 1TLKA 4DGYL 5DR5L 4AIZB 1A7NL 2CK0H 3MJ7B 1YEHL 1RUPH 4N5EC 4X98B 2B2XL 4KI5C 5KANG 1J05B 1TVBB 3MLTB 3QUKB 3UC0H 3VE0A 4U1NB 4GKNB 1QFOA 4L9DA 1QTYT 5L7XH 2A1WL 5DJAA 5KSUB 1CVSC 1EZVX 2XN9A 1F58H 1LEKA 1IT9H 4WO4C 4MB3A 4OD3H 5HGDA 1EJOL 3D3VE 4UT6H 1A3RH 3DURA 2BJML 1NCWH 1OQXA 5HYQB 2JB6A 5EFIB 3P0VL 4HPOH 1LK2A 3T0XA 2GKIA 4PP1C 3ZHDA 1FVDA 4HZAA 3B3IB 3V5HA 1ONQB 1JWSB 4M7ZB 4ZOAA 4U1SA 3RIAK 2XZQH 1CD9B 2EEBA 2X4NA 3B6SA 1SJXA 3W81A 2C26A 3IDYC 3TA3A 2VR4A 2X4PB 4UILH 2APBA 1J1XH 1NBYA 4JO4L 2BHYA 5GZNC 3U30B 2ENSA 5DJYA 4LNRB 2DICA 4YHIB 1CGUA 2AJZB 3HMWH 3G6JA 4UUJB 3DSFH 4J3TA 3VXOB 1HH6A 4MCZA 3BE1L 3REWA 1FQ9C 4X5XA 3TGXA 1OAXH 1CDBA 3SDDA 32C2B 4U7MA 1NC4B 3VWJC 3IDUA 3OKKA 4C56B 3BEVA 4OCSH 4JRWA 1C8PA 2AAVA 3TO2A 2BNRB 3JWOH 1NCDH 4LSQH 2KUTA 3JZ7A 5GGQH 2XIDA 4PJHB 2DL9A 3VMOA 2HJKA 3RY4A 2NW2B 4ELMF 2CJUH 35C8L 4IMKC 2I24N 1ORSB 3UYOD 2BSTA 3B9KB 3TWCH 1KLGA 2XWTB 3V5DB 1DL7L 4YBQC 2P5EA 1AD9B 3O45B 3CPLB 1AJ7L 2V2TB 5HHPB 2A0LC 4D0CB 2QADC 2E6QA 1C5BL 5CIPA 3QI9B 3Q5TA 1EV2E 3MO1B 3R4DA 1N59A 2D7TL 3BUYA 1MFEL 4JKPL 1S7TB 1CIUA 2A6IA 4OI8A 1U3HD 3MPCA 1UZ8B 5DS8A 4XCFL 1PKQB 4N90D 4G43B 4NUGL 4QRPB 5I74B 2FH6A 4P3CH 2JB5L 5HDOA 2FATL 4D0DA 2H32A 3X3FH 4EVNA 1S7XB 4CGTA 1V05A 4XNZB 5DRNB 2WIMA 3FB6B 4KRPC 1P7QB 4LLQA 1RV6X 1KB9J 4K7FB 2JCCA 3V6ZA 3MROB 2OJEA 3BAEL 4HUWA 2NY1D 1K4CA 1YEKH 4KVCL 1FHGA 1V3KA 2Z8VC 1P7KA 5FGCE 5DC0A 4HT1H 1T03H 1D5BB 3WFCL 1XFPA 4J7RA 4PB0H 3SE4C 4ALAL 3SDAA 5D2NA 3QCVL 4XH2A 1C12B 5FECA 3WNKA 3D39D 5EOCJ 2BDNH 1D6EB 5E03A 1J9CT 3PP3K 1UH3A 4QKXB 4ZYKA 3P9WB 5ILTH 5IQ9B 4GRLD 3U9UA 4ZSOB 3O2DA 4ODHH 1KACB 4NKOA 3OZ9L 5HDQH 1UACL 4OLYH 1QFWL 4QTHA 4AYFA 2E27H 4UDUB 5I8KH 3OJMB 1VCAA 3LS4L 4LGRB 4P2QE 5FYLL 2ZOKA 1J1PH 5JPNB 2YA1A 4ZS6C 5GIRA 1XGRB 2EKSA 1XF4A 4WUUA 1MRDH 4H1LB 4HKXA 4Y1AD 4Y2DD 3T0EC 1QBLL 1JHKH 3HPLA 3NOIA 5FUZH 4P3DB 3HZYB 5IW1B 4DZBB 3DX9B 2A6DB 1UB5A 2EDLA 4R4FL 1HIML 4JFPB 4EIGB 2EC8A 2R2EB 2X1XR 4X9IA 4ZG1A 1A6UH 4WWKB 3W9EA 3FQXB 4HG4J 4ONHA 3GSNL 3QUYD 2VZUA 3BW9A 5D71L 5EBMA 2VQTA 3QHZL 3DVGA 1T2XA 5FDYA 1XIWC 3VFNA 4E42B 4OCWL 4PG9B 2QHRL 2QJDA 3MUHL 3EYOB 1N6VA 3KPQB 4FQ2L 3D87B 4ACPA 3ECBB 3X12B 1T66D 1IAOB 1WBXB 1A64A 4JFQB 4OZIB 3RPIB 4WTZG 3ZHLA 4DFHA 5LBSL 3KS0H 3WFEL 5I1IH 1KUMA 1F4YH 5DQDL 5KOMC 4I3RH 2VDLL 1MFBH 5J1SC 2F8OA 5IQ7L 1I8KA 3P0YL 3S3JA 5D1ZB 2AQ2A 4NBZB 2DIBA 3ULUL 3RWFB 4KUZH 3ZE2E 3FT4B 1IBGL 2GSIA 3OKDB 2NXZD 2O5XL 2IQ9H 5DJ8B 3GMLA 4H88H 1NGXB 1U2CA 3T0WA 4NHCH 5EBLB 1AC0A 2EH7L 1G6RA 4K94H 5IBUG 3MRKB 3D0VB 2X09A 3NA4A 4MD0B 2FZ3A 4MXVF 3WIIH 3TZVD 2Q20A 3KWWA 4LRNH 3JTTA 2BNQD 3T2NH 3PIQA 3IU4H 4NKDA 4PLNC 3GSOA 4NO3B 1QFWI 2YRLA 1ULVA 4PJIF 4WHCA 3VH8G 5BZDA 5JW3L 1CE1L 1DEDA 1XR8A 3IFNH 2IPTL 5KVEL 1O7SA 5DURD 1KOAA 1YPZE 3AU1A 5DT1L 3FL7A 3I75A 4RQQB 2GTZA 5MEOA 3WHXB 4N0UA 1H15B 5JHDE 4JZJA 4KZDL 4P2OD 4X6DB 4N0RA 1G9NH 1H3PL 1K4DB 1OLLA 3GMMA 4H1LH 4UAOB 3GJFA 3HCVB 2NX5D 3IAQA 5DJXB 1KYOK 3I84A 2FGWH 3AC0A 2KQMA 3AROA 4ZD3H 5BRZD 4AT6A 2EIBA 4LDLB 3PV7A 5T1LA 2H26A 1F3JA 5I18L 2HJLB 2F54E 3TVMD 2MKWA 1GGBL 2H6PB 4XPFL 1BOGB 3ZKMC 4F80A 4KPHL 3UYRH 2OP4L 2RFXA 1T4KA 3MRQB 1NKOA 2IQAA 2R0LH 3V2AR 2BFVL 1FNFA 3L5JA 2NY6D 5IROC 3Q2CA 2CQVA 3AREB 4P4KD 1KCKA 4JFOB 3KHOA 5J13C 1IILE 2YXMA 4TSCH 5HY9A 1B6DA 5TQ0L 3NABL 1LEIB 1QSEE 4RGNE 4NZTL 1KENH 3KYKL 1K6QL 2DD8L 3FHQA 4AL8L 1U3HA 4DN3L 5DJZB 1QOKA 1G0XA 3ZDXF 2VXVL 5J1AA 1ACYH 4KQ4L 2YEZB 4NKMB 1KBGL 3ZTJG 1JGVL 2GW5A 3HZVB 3UO1L 5LGJB 4OZFG 2YD1A 4XHJD 4MNHA 4HZLB 4JZOA 5D7LE 3M1BA 4EBQH 1A6AA 4G5ZL 4ODTH 1VADA 2J8OA 2NY5H 5TH2B 3P9MA 2MQ0A 1HZHL 2JTDA 3D39A 3IU3B 1FNSL 1FZJB 4QO1A 3T8XA 2ICEA 2GY7B 4GRLA 3HN3A 4L5FH 4JO1H 1HH9A 4NWTH 4TUKH 1BP3B 1OCWH 3MFFA 3QULB 4JFED 1B0GB 4LGPB 4PJ7B 3OXSA 3LS5H 4L3EB 5IVOA 5ERWB 3RWEB 2YC1B 4I0PD 3VXTA 1TETL 1OARL 5I1CH 3NFPA 3TT3L 3QBTB 4HIHB 1B4JH 2ZOLB 3GDBA 1AFVL 4RNRA 4Y4HD 1XF5A 3LD8B 4N1CA 4Y2DA 4Y1AA 1EX0A 3HS0A 1BBJA 25C8H 4MA7L 4ENEC 4NQDE 3LAFA 1AD0B 3QH3B 5CGTA 4AMKH 4NFCA 1WC7B 2KKQA 4YH6A 5BS0B 1I1YB 4XCCL 2VZ3A 4HJ0D 2OQJB 3ZTNL 2A77H 5GJSH 3O2DL 1IGJB 3GJEB 3QUYA 1QRNB 1FYTB 1FN4A 3KLAA 1LDPH 1AE6H 3UZEA 3KPOB 1XZ0B 3GSQB 4U6HB 4YX2H 3ARTA 2XWJB 3WIHA 5TDOB 4P48A 4U3XA 5C70A 3PHQA 3WUWB 4MNQD 4KAQL 4B7IA 4DJMA 2CH8A 3LQMA 5LXGH 4XCEB 3KS0J 4FXKB 1IC4H 3ZLQC 5FXCH 3RWJA 3GI9H 3VWJD 5T3ZL 2VERN 3IXTB 3MCKB 3U4EA 2AK4D 3LN5B 4YHNB 4J4PC 2W0LA 3IDGA 4KHTL 1ES0B 1VGEH 2AXFB 5MEND 3NCYP 1PEZA 1X4ZA 3P0GB 1INEH 1VKXB 5E6ID 3MODL 4HWBH 3KLDA 5I1HL 5IFHL 1LHZA 2ENYA 5HHME 2DBLH 4FQQA 4RMVA 1BFOB 1I7UB 1JNJA 5I30L 2WP3T 1HOCA 3CLEL 3O3AB 1KTKE 1MCDA 4Z95H 3QZWB 3JXAA 4NT6A 1WBZA 2E3VA 4YHKH 4XC1L 3VU2A 1M6OB 3W0WE 4OQTA 4N0FA 3O81A 4IRJC 3SGJA 3FT2A 5IEHA 4WY7L 1UJ3A 1RZ7L 3G5VB 2VN4A 3SQBA 3L7FB 2A0LD 5JUEL 5D7JC 1QLEL 4NQXB 3MV8D 5C0DA 5B38G 3LRSA 1TTFA 3BH8B 1HSBB 2F74A 1TZGH 4LVOB 4GMTL 2J8UA 3TZVA 4ZFGL 3D18A 1T1XA 3NPSC 3EO1B 1TZIA 2ARJQ 2P42B 2BNQA 3ISWA 4LLVA 4OLZL 1A7PL 5DSCA 5GQBA 1YECL 1T7YA 1MRFL 3CCHB 5EZIL 5L9DL 4LPVA 2LU4A 4HEME 1P1ZB 1BAFH 2ESVB 4Z7WE 1WICA 4GSDH 1Q9WA 1Q72L 1MCOL 3PHSA 4ZNCD 4V1DB 3QHFL 3BPCB 2BSED 2YXFA 3MREB 1Q0YL 4P2OA 5IR1A 5EU3B 1KCRL 1DLHA 1TNNA 3NH7L 3WXWH 5T3XH 3OAUL 2NX5A 1G6RL 4K23L 1J18A 3VRIB 1MAKA 4GJTB 4QF1B 3CD4A 4M7LH 1YJDL 5LVEA 3T08A 1V5JA 2QSCL 5BRZA 1KN4L 3VWKB 4WV1B 3ARDD 3RWIB 1DUYA 1BFVL 5ISZD 5IHZA 1I1AC 1TVHB 2B5IC 4JDVB 4NQCE 3SJVB 1AHWB 2VXUH 4PLKC 3EYQD 1S9WB 2BVUA 1T89C 3T77A 3HG1E 4IJ3B 4EN3D 1WAAE 4F37K 5C0CB 1AGCB 4Y19B 4FQHB 4P4KA 2JLLA 2FJFB 5IESH 2ADIA 4LEOA 4M62L 5GHWH 4KJQD 1MJJA 4YFLF 3QDGE 2R1XB 4GG6E 2ILLA 1LP9B 3GMQB 1EVUA 5IV2B 4L8CB 2FX7L 5JOFA 5KSBA 1W72A 4QHLB 4JKLA 1PGRB 1K8IB 1RZ8B 1QO3B 3ARYA 4I9WD 5IVZA 2KBGA 4JR9H 4JVUA 5FM4A 5CSZA 4LLAA 4U1IA 4HFUH 5JW4M 3O6LL 3WDJA 4YHPA 4LIQE 3GKWL 3PWPD 3ARFC 3HRPA 3WFHB 1UB6A 4XZUA 4IMLA 1U8OA 4OTXH 3TJHC 1FV1A 3QRGL 3S34H 1ZHKA 5AZEH 1VGKB 5DK2B 3VXSB 1KN2H 3DUUB 4N9GB 1A1NB 1MHEA 3LH2H 2OTWB 3QIWC 3FQTA 2R15A 1FL5A 1CK0L 4FABH 2Q76A 2FX9H 4JFEA 4F7CA 4OLUH 3C09B 1G7HA 4X99A 1AO7D 4G9FD 1QVOB 1UWXH 2JK5A 4I0PA 4JE4B 4X6FB 5EZLB 1Q0XL 1R3HB 4MA8H 4U1JB 3FHAA 3MRBA 3RL1A 4Y4HA 3CLFH 5CZXD 2Y6SC 1NDMA 3VXRB 2KZWA 3ZE2F 5FO8B 1TZHA 3WXVH 5M95B 5DJ0B 3OWEA 1TFHA 3KPSB 3L3DB 1WFTA 2JJWA 4PJCA 1SEQH 2YD5A 2ERJB 1WBYA 2LU7A 2VZOA 3C5JA 2D31B 5E4EC 5TQ2L 4LCWB 4E41B 1QSZA 3KPMA 5ICZB 1BQUA 1FIGL 3RGVB 5BCAA 3SGKA 1YNLL 1ETZA 1LWRA 4W6YB 1CFTA 4E5XA 4F7PA 1QEWA 2EDNA 2A83A 3L3KB 3RX8A 4XGZB 5INDB 4R2GC 4K71C 3NAAL 1CR9H 3MUGB 4MNQA 5CEZD 1YY8B 2VN7A 4FQXB 4RFEA 4HS3A 4AIXA 1WT5C 3F58H 1GSMA 3FKUS 3QUZC 2OR9L 1YPZF 1W2KT 4PRNB 3EKCA 4J6RL 4H0HB 3S4SB 3RNKB 1R3LB 2AK4A 1MLBB 3LQZB 4M9OA 1QNZH 5DMGC 5GRJL 5LQBH 5F7EL 5MENA 2YPLB 5D96B 4GKZA 1S7WB 1I4FA 1Z2KA 5E6IA 5ADOL 4OFVA 1ZMYA 4GRMB 5FCSH 5BJTB 1T20B 3MSPA 5ESQA 4L29A 3D48R 5MI0C 2AV7A 4BFBD 3DIFB 4FQIH 5JMRA 3WIHL 1KC5L 3VGBA 1JE6A 3I3EA 2A6KB 4ZUVB 4X8JA 2J3SA 5GISH 1CICD 5AAMA 4CVUA 5ACZA 2P48B 3BSZL 4WHYG 2R1YB 4PGDB 4OJFL 4PJDF 1A9BB 1QQDB 3MV8A 1OTSC 3L3IA 2P5WB 1BEYH 2EXWC 1GC1H 3EJYC 4DGYH 5DR5H 1FH5L 1A7NH 1YEHH 4DEPC 2B2XH 4PRHD 4NDMB 2F9BT 4HJJL 2FL5B 1U8KA 3WN5B 4CN6A 3VFSA 1K3IA 2YZ1A 3VD5A 3DPBA 2IWGA 3K8KA 1NGPL 4LCYA 4PTUA 2LVCA 3WS6C 4OQTL 2WANA 5F9OL 4HWUA 5BXFB 1EHAA 1IEHA 2B4CC 1EJOH 1FG9C 1RSFA 1Q9LA 3QR2A 4Q2ZA 4YGAB 5F89B 1F3RB 3TN0B 3ZE0F 4NYLA 3O6ML 2BJMH 4PGEA 3VXUB 3FN0L 1T0PB 1IFHL 2FNBA 5CAYB 2XICA 3WFBL 3P0VH 4F37F 3MCLL 3U0TB 3ARDA 4NBXB 2CKBB 5DI8B 1QSFB 5E1HB 2YK1L 3LMJL 3WS3A 1A4JA 5ISZA 4NP4H 5EZJA 4TULL 4GW5A 3ARSA 1MIML 5IM7B 3RVXC 1C5DB 4JO4H 4I2XB 5CEYA 5ID0A 2YPVL 5J3HC 4DCQB 1KXQE 3W9DA 1MH5A 4EN3A 3U0WL 5E6YA 3TBYB 3FFCE 3RX7A 5T5NG 1REIA 5C0IB 2AJ3A 3TBSA 5GGTA 1EO7A 4JQVA 5EU7C 3V6OC 4M8QB 5HVHC 3ULSA 3BE1H 3T4YA 2X1WL 1C7TA 4TUOB 2HLAB 2ARJB 3VXNA 4DTGL 4OV5A 1BVLB 3SGEI 3CSGA 5F71A 4UIMA 2LFGA 4MAYC 2BVEA 3O8XB 1KPVA 1VFUA 2E6PA 3V95A 1T1WA 3BZ4A 1FSKB 2VLJD 1U8JA 3PWPA 5KJRH 1HXMB 5ELIA 35C8H 4P2RE 4PV9A 4F58L 4LCUB 4WRLA 1RUKH 4OZIF 4N8VB 5AEAA 4XBPB 1EXUB 4FG6D 2FJHA 4GBXB 1W72L 1DL7H 1KB5A 5F1IB 1AJ7H 5D6DC 1A4KB 1DQLL 4IRSB 1C5BH 4DW2L 5I6XC 4F2MA 1ORQB 4F7EB 2YRZA 3CX5J 1J0JA 1AO7A 2D7TH 4G9FA 1MFEH 5ESVB 3CH1A 1S78D 4JKPH 3HB3C 1KIPB 1HWHB 4XCFH 4NUGH 4WI7A 3DVNA 3QEHA 1KJVA 3TP4A 2JB5H 4IRJD 4KKBD 2FATH 4XWOD 5A2JH 3C2AL 1DLFL 5D7JD 1EHLL 3T04D 3BAEH 1JZ7A 4KVCH 4KGJA 1UFUA 3QFJD 4RMSA 1EEYB 4P59L 1E6OL 4FQJL 2CKBH 3QWRD 3WFCH 1YN6B 1QYGL 2X4SA 3AAZA 3QCVH 2XN9B 3RKDD 1EEQA 1UGNA 5HYJB 4XXDA 1CDHA 2ZUUA 2IBBA 5EIVA 5IWLC 5GZOC 2J7LA 3HPJB 3MRCB 4X6DF 4RGMB 5D6CA 1GOHA 2KPNA 3BZEA 3OZ9H 5TE4L 1OAUH 1UACH 1UWXK 1QFWH 2JB6B 1KV3A 4R97B 3LS4H 5FYLH 4QHNA 1LK2B 1DE4B 1EMTL 4HLZG 1D5MA 1FGVL 4M00A 5E2TL 5FM5O 3V5HB 4XCYB 1QBLH 3R0NA 1U42A 2X4NB 1U8HA 2ATKB 3TA3B 5C3TA 2I07A 3H9ZA 4MJID 1E4KA 3C6LD 4R4FH 1HIMH 1ZV5A 3S7GA 1I1AD 3FFDA 2EYSA 2Q8BL 1CICA 1XR9A 3TIDA 4X0KA 1BQHA 1XGYL 3HE7D 4M03A 5C9JA 2OL3L 1XF3A 5D71H 1J10A 2X9YA 3O4LD 1ZHNB 2GI7A 3TNNB 3G5YB 3REWB 1I85C 5C0NC 4XMPL 5HI3C 1WAAF 3AB0B 3L5XL 4XRCA 1WEJH 1JF1A 4OCWH 3SDDB 4DKEL 3L3HB 1HYSC 1HNFA 3O9WD 2QHRH 1YDPB 2CO6B 4R3SA 3OKKB 5CLTA 5C7XH 3BEVB 4FQ2H 4PTTA 4PRHA 4HLZH 2P45B 4MXQD 3S3PA 3TO2B 3TPKA 4GG6F 1UQSB 2DQTL 4B53A 1O5DT 4CKVX 2RBLA 2VJXA 4BZYA 4OV6F 1UT9A 1G7LB 1IARB 2HJKB 4Y4FC 4ZO6A 3WFEH 5DA0B 4JREC 5C0AD 1XGUA 5DQDH 1ZEAL 4CN1A 4D9RE 2VDLH 3FB8A 4Q0XL 5IQ7H 3P0YH 3BO8B 1MCLA 2BK8A 1BWWA 4HWZA 4XXCC 3QWOA 4WCYL 3RWDA 3ULUH 2BSTB 4J8RA 4WI4A 1LILA 1KLGB 3CXHK 1HHGA 1IBGH 1QPXA 2P5EB 2CRMA 1A5FL 2O5XH 3CFDA 4A6YB 3QIWD 3F7VB 1QFUL 3UPCA 3T0VA 1RJCA 2LTQB 5C0GA 1N59B 3BUYB 4NQSA 4PJ7F 2EH7H 2W9DL 4KRLB 1C08A 4S11A 4CBPA 2A6IB 3LEXA 4IOIA 5DS8B 1FNEA 2NY4B 3NIDF 3STLA 5D1QD 2NQCA 2ZUXA 4O58L 3TFKC 1XF1A 2H32B 2IALB 4ZTPL 6CGTA 2Y6SD 3NCEB 3CDFA 4LLQB 2JCCB 3V6ZB 1CE1H 1T5WA 2OJEB 4HUWB 2IPTH 5KVEH 1G1CA 1JHLH 4M48L 4BFEA 4AEEA 1JPTL 1ND0A 1EJ6A 4KZDH 4BQBA 4U1KA 1MFAL 4JGMA 4N8CL 5CINL 1H3PH 4MA3A 3EYSL 4XH2B 3ARBC 5FECB 2DJUA 3JV0A 1BM3H 1C1EL 3HI1B 1KPUB 2XWBA 1H5BA 4KMQA 4FTVA 4HQQL 3FAWA 1OT1A 4R8WL 5INCA 4G7YL 3U9UB 2VLJA 4NKOB 4O00A 1HILA 1A6VL 3RQ3A 5DRZA 5D7IA 2CK2A 1GGBH 3QWQB 1PKOA 3MV7E 4KPHH 2OP4H 3DECA 5GGTL 2IJ0C 3JWNC 2E6JA 3VJ6A 5GIRB 4U1LB 2GITA 2IBZX 2AABL 3GBML 2BFVH 3HPLB 2MHAA 4AZ8A 2V5TA 3L6FA 4C57C 5JIKA 2WWKT 4JM2D 2GHWB 3QQ3A 3ULUE 5TQ0H 3NABH 3O2WL 1N5AB 4UV7L 1IEAA 4S1DD 1MHCB 3HE6C 4NZTH 3I6LE 3KYKH 3W9EB 1K6QH 2DD8H 3MJ8A 4AL8H 2VO5A 2R2CA 2FSEA 5TF1L 1MFDL 4DN3H 1J8HD 4DOHB 3BW9B 2YUXA 1P4BL 4JZNB 5KS9E 3QPXL 4H0GA 4OZHB 1WFOA 1FE8L 2VXVH 3I6KB 4KQ4H 4XNQB 3V0VB 3P4NB 1KBGH 1MCQA 3S88L 1JGVH 3VFNB 5IB1B 5CUSL 5D7JA 5LGHL 3UO1H 3P77A 4LHUB 4QRRD 5CEXB 3IFLL 5GRVL 1KB5L 1FBIH 4OD2A 4G5ZH 3QFJA 2ED9A 1S3KL 3BXNB 2OYPA 2NY2D 5CIPH 5IVXA 3QWRA 1AKJD 2HTKC 3BDXA 3DV4A 1HZHH 4QHMA 2PXYB 4F8TA 3EOTL 4KDTC 1FNSH 5IFAL 5DK3A 3NCCB 1TPXC 1UM4L 1N4XL 1D5ZA 2CRIA 2VLKD 2K7QA 4TVSa 4X7CC 1PFCA 5E95B 3WLWD 1UENA 2H32H 5LG1A 2GSIB 1YY9D 5F8QC 5F21B 4KK8C 1CF8H 1F13A 1OARH 1TETH 3BKCL 4PREB 5DDHA 3GMLB 3QG7L 2H1PL 2HFGL 1OGTA 1X5ZA 5KVFL 4TRPL 3LPWA 1AFVH 2JKXA 5SWSE 1UWGL 4MDJA 3OSKA 5FUOL 1G6RB 4MA7H 2D4DA 2DRUA 4LOUC 4MJIA 3G6JE 3FB5A 1BMGA 4S1SL 3H9HA 1FPTH 3C6LA 4K3GA 4P9HL 3KWWB 3DYPA 5TF0A 6FABH 4NKDB 3U46A 1ZA3B 4XCCH 2YD2A 5E2UL 5CEZL 4IDJL 1IAII 1U41A 3ZTNH 4PJBA 3BQUB 3HE7A 4ZDHA 1HEZB 3O2DH 1XR8B 4F33A 4I48B 3TESA 5I75B 3O4LA 3E3QE 3I75B 1LEGA 5IHUL 3G6AB 4N0UB 4RMTA 1PY4A 1DQDL 2CRZA 1FLTX 4JZJB 4UTAL 5DVKA 3L9RA 4M5YL 3O9WA 3BPLB 2ZSVA 3FONA 3GJFB 5DEGA 3GRWA 5GPRA 4Y4KB 2JJVA 1U8MA 5T3ZH 2NY0D 4JY6A 2AJSL 3SKJL 4KHTH 5E9DE 2X70A 1WFNA 2F5AH 1F3JB 3KJ4B 5C0AA 3CU7A 3MODH 2NY3D 5I1HH 1MAML 1F3DH 4WHTB 5IFHH 5KZCD 1AI1L 2RFXB 2HT2C 3PABA 3NPZB 2IQAB 3CLEH 2NTSP 1XGTB 2BXZA 3K2UL 1PZ5A 1YEDB 4L8DA 4XC1H 2Z0BA 4XTRD 4U6YA 4AM0A 2WUCL 4WY7H 1RZ7H 1YEGL 5F3BA 5JUEH 2A9ML 1QLEH 4Z0XA 5E56A 4F9PA 4Z7OE 4P3WA 4GMTH 5D1QA 4OLZH 3ROLB 2Y1VA 4HIIA 1YECH 1MRFH 2VQ1A 5EZIH 3ZYZA 5L9DH 4PYHA 3BP4A 1MI5D 4RIRA 2EDJA 1RZJC 2D0HA 1YEFL 2G9HA 3NCJL 3QJFA 3HFML 5FM5M 1NFDE 1Q72H 2APXA 1MCOH 3IDMB 4CNIA 4FNLL 5D2NE 3QHFH 2NY1B 5J12B 4DN4L 1DVFD 1A6AB 1P5UA 3O6FD 1S7UA 4IM8A 3K1DA 5F7KC 3H3BC 1WIOA 1Q0YH 5KVGL 1KCRH 3NH7H 1XGQA 3MLUL 2Q86B 4POYA 3OAUH 4NRZA 3D39B 4NGHL 5FGBA 1G6RH 5F9WC 4K23H 4LPTA 3OB8A 5ANMB 1ITBB 2X4TA 5FEBA 1EEZB 1YJDH 4GRLB 2QSCH 3GGWA 1KN4H 3IETA 3QNYA 4WUUE 4OM0L 2H2SD 2CLZB 3VXTB 4M6OL 1BFVH 2LABA 3ZHKA 3NFPB 3QIBA 5BQ7A 2IG2L 5T3ZE 5BOPA 5LGKA 3Q6FA 4XB7A 4RNRB 1F8TL 1XF5B 5HHQB 1A7RL 4Y2DB 3S5LB 3BPOB 1BZQK 2EC9T 4I1NB 4JM2A 3DMMD 3GJFH 5J0BA 5DRXA 1VFBB 4LVNB 4M62H 1KXVC 1CE6A 3UTPD 4NQED 1KSRA 1JP5A 2FX7H 2R56L 3QUYB 1CN4A 4DQOL 1DN0A 4BFIA 1FN4B 2GT9B 4RGNC 3PL6D 1KLFA 1G84A 1DBKL 1BF8A 4TTDD 1YA5A 5IVNA 4O4YL 4EUPB 1A6PA 3MRFB 4HMEA 4XVUC 3J8F7 2YPKA 5T5NF 3O6LH 4NO2B 5F9AC 2VLRB 3TBWB 1WV7T 3H7BA 3GKWH 1ZANL 3N1QC 2EYTA 4HKZA 4K94C 4WGWB 3T4AB 3RWJB 1NGWA 1AKJA 3QRGH 3ZKSD 5GRYA 4YC2B 4MX7A 4PV8A 4QRUB 4CDGC 3CUPA 2A74A 4FQQB 2VLKA 4PRDA 1U3ZA 1PZUB 1ZA6B 3OAZH 4JKMA 5IB3B 1JZ5A 4NT6B 1F2QA 4E9LA 4ZQKA 1G9NC 1Q0XH 2V7HA 4N0FB 4PGCB 4CADA 5C07E 4O2FA 3GIVA 5JW5A 5IEHB 4LK4A 1H3TA 1UJ3B 3D3VD 5L8LB 3V4VH 4PRBB 1SYVB 4GW1B 5ICYB 1QA9A 3HR6A 5J11B 2K7PA 5FA3A 3TZVB 1T1XB 2LAAA 4LLVB 5DSCB 2FHFA 3MOAL 2XV6B 4ORGB 5HDBE 5TQ2H 1PKQE 3OR6A 5D1XD 4KJYA 1CQYA 2YA2A 4QRPE 1FIGH 1Q9WB 2OTUB 4GOSA 3CSYB 1ZK9A 4JQXC 1YNLH 4GAYB 2IPUK 3BRFA 2FO4B 2EC9U 2BSSB 1HSAA 2R9HD 4TN9A 1DLHB 3NAAH 3NACL 3QNZA 2Z92A 1OT2A 2V7NA 5HHNA 1DQJB 2IPKA 5EB9A 2J88L 2OR9H 1IQWL 4J6RH 4NCC2 4NC1C 2OCFD 2EDEA 5I71B 5C0EA 1VFOA 2GK2A 1EGJA 5KSVB 3UDWC 2XPGB 4Z77A 4LLMB 3IFOA 1P9MC 2EZ0C 4IEFB 1CFBA 5GRJH 3VXME 5F7EH 1U8QA 1IM9D 5CS7A 2NXYC 5A3IC 1DUYB 3TVMB 5D1ZC 5B8CA 5ADOH 5J6GB 3VGHA 1NMBH 2NZIA 2ICWA 3OGCB 3VD3A 4BSWA 1X6LA 3JVGA 1DN2A 3KLHD 3WIHH 5AAWA 1KC5H 3OKMA 4N1HB 4OUUB 3SGEH 3EO0A 5D72L 3GI8L 3QPQD 2B8OT 4N90E 5E5UB 1G6VK 2EKJA 5GS0D 3BSZH 4BYHA 4UU9A 1FG2A 3HRZA 3GRWL 2J1KA 1MJJB 4XNMA 3ZSSA 4OJFH 4HGMA 5JOFB 5KSBB 1PSKL 3N06B 3N1FC 4S10A 3ZT6A 3GNML 2BSRB 1FH5H 2UZIH 2UVFA 5IVZB 2VIRB 4ZXBB 3ULUF 1F4AA 1RVFL 5CSZB 2WM0A 4P23C 4M1GL 4RWYL 2W60A 4HJJH 1I8MA 1J11A 2G75A 3LCYA 4PJIA 1T2JA 5EC1A 4NO5B 1DVFA 1NGPH 4HUNB 2E9WA 3S98A 3MLRL 3O6FA 4LPUA 1T22B 4OQTH 4Q6IA 3BZFB 5F9OH 3WHE1 1UB6B 1S7QA 4XZUB 1QD0A 1U8OB 4UAOC 3AS0A 1JF6A 1FV1B 3T0BA 5DD3L 1MHEB 3O6MH 4PIRF 4I18A 3RIFF 4M61A 4Y5VA 2BHZA 5F96L 3FQTB 1S9VA 3JV6A 4KKNA 4RA0C 3LHPL 1IFHH 3WE6B 5HYSB 3WFBH 2Q76B 3MCLH 4WO4B 3EGSA 4Y1AE 1G7HB 1S9YA 4P5TD 4X99B 2YK1H 2JK5B 3LMJH 4LRIC 1OAQL 3QCUL 3IDNA 4TULH 1MIMH 3MRBB 4HIEA 1XAUA 1NDMB 3UYPA 2YPVH 2I9LA 1J86A 5HSFA 1TZHB 3U0WH 1KELH 3IRPX 1T83A 1KULA 3DMMA 3MRIA 4P2QD 3IDYB 1YN7A 3C5JB 1A1OB 2HLFC 4NQEA 4PG2C 4D9LL 3KPMB 1RZGA 3L3JA 1DANT 2D7OA 2X9WA 3K0WA 3OPZL 3G6JF 3G08B 1ETZB 2WINA 3PL6A 4Z18A 2PYFB 2FDBP 4DTGH 4MA1C 3VRJB 4E5XB 1QEWB 2A83B 2WV3A 2Y72A 3GM0A 4GH7B 4MNQB 3RVTC 3L7EB 4KI1A 1E4XI 1JTOA 3DGGB 4S2SA 3LZFL 1UKQA 2OL3B 4TUJA 5DEZA 1N64L 4NNYA 1HDMA 3VWJB 3BIKB 4MQSB 2G2RB 2AK4B 2HT4D 5LCVL 5EN2A 2PO6C 2XTJD 4GKZB 4PJEE 5E6IB 2OTPA 1W72H 2QSVA 5TDNB 4PLJC 1YUHB 3QYCA 1KJ2B 1DQLH 2YHGA 2Z35A 5ESQB 3PUCA 3GJFK 1FL6A 4QY8A 2AV7B 4DW2H 1ZGLB 3DRTA 4XXCA 3K8LA 3MRGB 3RNQB 1Q9KA 2J8UE 1YNTA 5ISZE 4YJZL 2V17L 3LD8C 4G6AC 4NJ9H 3D3VA 3QT2A 2QADB 4HKJA 3MV8B 4G6FD 4XI5D 1NGZA 3M17A 4WFFE 3C2AH 1DLFH 4ETYA 1EHLH 3QEQA 4HUXA 4JPKL 2FCBA 4N8PA 2FJGB 5D1XA 2BZDA 1U8KB 3FT3A 4P59H 2B4CL 2HFFB 3FZUD 3LB6D 4FQJH 2CLRA 2NX5E 1QYGH 4LCYB 3EOBB 4CRPA 4PTUB 2C3WA 3ZDYF 4M5ZL 5BRZE 2HRLA 4JG1L 4Q2ZB 3VFTB 3FRPA 1NFDF 5F72S 1AR1C 2WP3O 5H8DA 3OAZK 5TE4H 2Y06L 4PGEB 1DANU 5B3JE 1LE5A 3BP7A 3WKML 5DMYA 1U8LA 1I8LC 1EMTH 1FGVH 5E2TH 2JJSC 4KK5C 4C54A 3T3PE 1IM9A 3DX7A 2I9TA 2H3NA 5ISZB 1U92A 4KKAD 4L3EE 4XMKL 1ACZA 1B0WA 3DSNA 5ID0B 4HDIA 1SEBB 3W9DB 1MH5B 5DJDB 4EN3B 4NN5C 2H2PD 2Q8BH 2R1WA 3DUSB 3BP5A 1XGYH 3T0EB 1SBSL 4D8PA 3V0AC 1TCMA 3SO3C 5HGHA 1RURL 2AJ3B 1EAPA 2OL3H 3DTXA 2AV1B 2H9GA 5DVOA 4LVOC 5T5FL 5CGYC 3ULSB 5GS2D 1EGJL 2Z8SA 4ZUUA 4XMPH 3L5XH 4X9GA 2J5LC 3BD3A 4FFVC 4DKEH 3UTQA 5DEFB 4OV5B 1FYTE 1QSED 5K93A 4LARL 2R0ZL 1KPVB 2DQTH 1JPST 4UQ2B 1M71A 3O0RL 4LSRL 4RMQA 1XIWB 1U8JB 4LLDB 4TNVK 4XVUD 1MVUA 4KDWA 2VLLB 4ZPTA 4LSPL 3TLRA 2A38A 3EAKA 1ZEAH 4PV9B 2XI9A 4Q0XH 2PTVA 4JY5H 4FXGA 3D85D 4JFEE 2APVA 3F7YA 1AIFB 4WCYH 2XTLA 4K7PY 5GGRA 3VCLA 1KB5B 4WV1C 1M7IA 4PJGA 2IAMC 5EU6E 4XBGA 2BVOA 1QFUH 5I73C 1MAJA 2FEDD 4P5TA 4G9FB 3LSOA 3CH1B 2W9DH 3KPNA 4CW1A 1KTDA 3NN8A 4PJCE 4KMTL 5E7FA 4XP9H 3BIAX 1KJVB 3SBWC 4O58H 2DQGL 5DD1L 4UOW0 3UPRB 4ZTPH 4JFDE 1I3RB 1A1MA 4X9FA 1HKLL 3VFPB 4BK5A 4P2QA 2PW2B 4JM4L 3RDTC 2Y36L 4CVXA 4M48H 3R8BB 2C1PA 4L4VB 3BN9D 3I50L 4KROC 3WSQL 3G9AB 1MFAH 2YMXL 4L4TD 4N8CH 5CINH 3EYSH 1MY5A 2X4SB 4JQIL 4NQDD 3AAZB 3WDHA 4HGKC 5F7FA 4FFWC 4XXDB 5C0RL 4LPYA 3PHOB 1C1EH 2GJZA 3MA7B 5D6CB 4HQQH 1P84K 2ZCKL 4R8WH 3MLXL 4G7YH 5MENE 1B0RA 4AENA 4GT7A 5IMKB 1Z5LA 4ODUA 1G0DA 4U0QB 5CCKL 3TBVB 2A6JA 5LWYL 1GC1C 5E1AA 4QHNB 4Z7VE 5EUOE 3OKEB 2I5YL 2KL6A 5GGTH 2L0DA 4PRPE 2ITCA 1JYNA 1U8PB 1I1FB 3RX5A 3GBMH 2AABH 1WVZA 1U8HB 1MCWM 2I07B 2IH3B 2NXYD 5F1NB 3U2SA 1RIVL 5FKAA 3EUUA 4WHDA 4UV7H 4C83A 3MV9E 4WI5A 4PJ5E 1B2WL 3ILPA 1CICB 4X0KB 4DUWA 5F3HA 5TF1H 1MFDH 5C9JB 5I0DA 2MFNA 5HHMD 1MWAB 4P9ML 4F7MA 1PBYA 3QPXH 1CLYL 1GGTA 4Y19E 1FE8H 5J13B 2XA8L 4HV8A 3IS1X 3S88H 5IJKA 4D2NA 4MJ6B 5LGHH 5CUSH 3CDGA 2VAAA 1X5XA 3RZCC 3IFPB 1ZT7A 1LP9E 3IFLH 2F53B 4R3SB 2NZ9D 2Z31C 1KB5H 4JB9L 4LSSL 2O5YL 3CGTA 1UVQA 4KUCF 1S3KH 1S5HA 4JN1L 2VXQL 1CFQA 4P23D 4OAWA 4RMRA 2EDHA 3EOTH 4ZAKC 1XGUB 4KK9C 4P46D 5IFAH 4FQXC 1UM4H 5E8NB 1N4XH 1WUNT 4IOFD 1CXEA 2CIKB 3JWDL 4J8RB 3I6GA 4YDVA 2CXKA 1Q9OA 4NKQB 5C09D 5T1MA 1HHGB 3O3UN 1YPZA 2OMNA 3BKCH 3IJHA 1DEEA 3CFDB 5GGRY 5MEPA 3QG7H 2H1PH 2HFGH 1IAMA 1ODAA 5KVFH 4TRPH 1JPGB 2F8VA 4XX1E 4NQSB 1UWGH 4NQVA 4YZFE 4IHOA 4GAGL 5FUOH 3KYOA 3OGOE 5C0FA 1BD2E 3LEXB 4IOIB 4DKDC 3EYFA 5A2IH 1FIEA 3CVHA 1BQHG 4P9HH 1T0NA 5H37G 1AP2A 5E2UH 5CEZH 4IDJH 3FO1A 4K07A 1AY1L 1CDUA 3H0TA 2XOTA 2ORBL 4P2CG 4FZ8L 3S37L 1RHHB 4NM4L 5L6YL 1T5WB 5EO0A 4S0TD 4NQCD 1XF2A 2PN5A 3GMRB 1OTTD 4K3DL 3MGOB 2PF6A 1ND0B 5IG7A 3A67H 5IHUH 5F7UA 1DQDH 5EG6C 2VZ1A 3CFBA 4U1KB 4UTAH 5KSAC 3JV4A 2HLFD 4MA3B 5JXEC 2BOCA 4AEHL 4M5YH 4LQFL 4LCWE 4KGLA 1QBML 3K7UA 3MBEC 4C55A 2RQ8A 1QSEA 4TPRL 5C8JB 3QDGD 2WQ8A 4L3CA 5INCB 2IEPA 1YC7A 5J6HA 1ZVSA 4HKBA 3SKJH 1HILB 4LHQB 1FNLA 3BDBA 3FO2B 1EEUA 2EYRA 3D0LA 5D7IB 5GS0L 1MAMH 4MLSA 5H37H 3D85A 1AI1H 3QDHA 3HTLX 4X5WB 5DMIL 3U7AA 5IJVB 1AO7E 4JCLA 4PGZA 1U0QA 4QWWC 4OKVA 3K2UH 1CWVA 4H20L 3L6FB 2PO6D 3O3DB 1BIIB 3UAJC 5GS1A 5SV3A 1I7TA 2YPLE 2WUCH 1BQSA 4PLJD 1YEGH 1IEAB 4QOKB 2A9MH 4XCNA 1C5CL 2ZUVA 5JW4Q 4PJEF 1CDYA 4Y16D 2FSEB 1U6AL 2V2XB 3U0PA 4PLOB 5SWQA 2QR0A 4MB4A 4PP2B 4IRJB 1IC1A 4JLRB 1UEYA 1YEFH 3B9VA 3NCJH 1W0WB 3RVVC 5D7JB 3TYFA 3HFMH 3P77B 5CBAA 3ARPA 3K1KC 2J8UF 3CU1A 3H3KA 4FNLH 4NM8L 2QSTA 5GJTL 4DN4H 1JZ6A 3HA0A 4D9QE 1WIUA 3NPSB 5B4MD 1E0OB 4L4TA 4HLJA 5KVGH 4A2MA 5IVXB 1M7XA 3DV4B 5IK3A 4NQDA 3IS0X 3MLUH 3T0DA 1I3UA 4NGHH 3NCMA 3O8XC 5DZNA 1EK3A 1W8OA 3G9VA 3CC5A 1FL3A 5SWZB 1RJZA 3CDCA 3V8OA 2CDFA 4RSVA 3UCRA 1Y18A 1OL0A 4OM0H 3GUTA 1GGIL 15C8H 1AC6A 4M6OH 1CGWA 2QHLA 1XCTB 1NBQA 2IGFL 4OF7A 2IG2H 2YBRA 5FUCC 3P4MA 1G0YR 4GBXC 2BOBA 1F8TH 4PBVC 4FZEL 1A7RH 4G6ML 1HXYB 4MDJB 1R3IL 4IRSC 4YUEL 2Y4SA 1A7BA 4MJIB 4KK5D 3FB5B 3H9HB 4D94A 1KJ3L 1I1AB 1UXSA 2AEQL 2H8PB 2B5IB 3G5ZB 2Z93A 3HUJE 3T3PF 5DQJA 3BX7C 4OF5A 3V6BR 4PJBB 2R56H 1IZJA 4DQOH 4F33B 3ULUC 3RTQD 3NTCL 3O4LB 3LDBC 3DBXB 3Q3GA 1A6WL 1DBKH 3O6KL 3GMPA 4O4YH 2LAGB 3QA3A 3DHJA 3LV3B 3TH3T 4OI7A 2ITDA 4LSDA 3QB7C 4R9HA 4MS8C 2HN7B 3O9WB 5CGYD 3MOQA 4OCYL 2ZSVB 5E2WL 4MHHG 3FONB 3ARRA 1ZANH 4WI6A 3VGGA 4FFVD 3H8NA 4XB8A 4GQ9L 1U8MB 3O3EA 4JY6B 2F15A 4QGTA 4P23A 3IDJB 4JJHA 3L3GB 4POZC 4LPWA 1RUQL 2X70B 2NLJA 1A2YA 4P46A 2M26A 5A40E 1U95B 4O9HL 2GYSA 3PWUB 4Z7WA 3LIZL 1QHOA 1SMAA 4NZJA 5KANI 4WW2F 4N5UA 4HUMB 3P73B 4R97C 5C09A 3C8KA 4UTBL 2CDGA 2HG5A 3LOWA 3VXPB 3P11L 2RB8A 3QIWB 1WQVT 1DTUA 1BJMA 4ZFZA 1KLUB 4W81A 4BA8A 5HVFB 1Z9MA 1TCRA 3LN9A 1P4LA 2IAMD 4Z0XB 3KLSA 1QLFA 1MFCL 1DCLA 2PYEB 3HR5A 1RZJL 4H25A 4ZO8A 4GKSA 4U2YA 5JR1L 5D1QB 5GRVK 2PR4L 3MOAH 1ADQA 2OI9C 3FB7B 4HBQA 2YS4A 2OX5A 3BP4B 2CRYA 4ODXB 1AR2A 3UP1A 5IB4B 1CLOL 4CNIB 2C3XA 4PJCF 1R0AL 4NQCA 1HQRB 1T1ZB 5KBNC 1S5IL 3AB0C 3PWVB 4OIBA 1S7UB 3FCTA 3SDDC 7FABL 3RDTD 4FTVE 5C71A 1T5XB 5E4EB 1QP1A 4NRZB 4LPXA 2J88H 3FFCD 1CL7L 2HVJA 1IQWH 3CVHL 2X4TB 2C3VA 1I1RA 3GGWB 3PWNA 3PQYE 4R2GB 2P43B 2CDEA 4QYOB 3RA7L 3ALPA 3TT1L 1L9NA 4ELMB 1ZVHA 3KVQA 3AMLA 2ZJSL 1AGEB 4NUJB 1MCSA 1FO0A 3QUZB 3KNBB 3Q6FB 4PPTA 5FOBA 5D5MA 1R3KB 3TIEA 1BPVA 2EE6A 3NCFB 5D72H 3H9SE 1P6AB 2PO6A 3GI8H 4JEGB 2AJVL 3MGTB 3CJJA 4XVJL 4P2RD 4Z7VF 5EUOF 5DRXB 4PJXE 2NPLX 4XP6L 4NN7B 3S35X 3GRWH 5AUMA 5IKCB 5MI0B 4CAGA 4G8GE 1KIRB 4N0CC 4Y16A 1PSKH 1J8HB 3CK0L 4R90L 4BFIB 3GNMH 4OD1L 5I1AA 1FFOB 2AJXL 2DAVA 3QFJE 5F6HI 5CP3A 3ARQA 1RVFH 1TITA 1V7ML 4RWYH 2VDQL 4M1GH 2X4QA 2GUOA 4O5LL 2XT1B 4QRRB 2FO1A 2QSQA 1MFNA 2GK0A 3AUVA 4KDVA 3H7BB 3KG5A 3MLRH 2EYTB 5B38A 2BERA 1IGTA 4Z7UA 1JI2A 2E8ZA 1JHTA 1DJSA 1PEWA 5CP7A 3GSUA 5DUBA 3C9NB 1D9KD 3SDAC 1EA9C 5D2NC 1AKJB 4LLYA 2J12B 2D9QB 4ZUTB 5DD3H 4MX7B 2FECL 3OV6A 1CDJA 4U6TA 1Z9OA 1X5IA 5F96H 4KMLB 2XQYK 1JFQL 4QRTB 3LHPH 4L9LA 3QDJB 4DFIA 4YXHL 2P7TA 4X4XA 3UJIL 1YQ2A 3WJJA 1SQ2N 1OAZL 1X5JA 4ZQKB 5I8EB 1CXLA 1OAQH 3QCUH 3FO9A 2V7HB 4O2FB 4L8SA 4EDXA 1CBVL 5JDSA 1D5XB 5GGVL 4UT7L 1CL7I 2VNCA 3O3BA 5DFVC 4BH8A 1QA9B 5JZ7D 1H8NA 1J8KA 1CD1B 1RJYA 4JRXE 1B6UA 2WAHA 3B2UD 5CMAA 5FA3B 5C92A 1NFKA 3EYVA 3KPPB 4W68A 4KK6C 2V5RA 3BOVA 2Y5EA 3MYJA 3VXQA 5C2BL 3OR6B 4KWUA 4D9LH 1J88A 4KJYB 4P4RB 1I3VA 3ILQC 3PDOB 3OPZH 4XNUL 3RTQA 3EOYG 2VR9A 1M05B 2D03L 3LKOA 1BQLL 1I7RB 5HGAB 4PBXA 1HSAB 4IS6A 4HUUB 5CHNA 3PV6A 1G9EA 4WI3A 3MJ6A 3BMVA 5KG9A 1A21A 5IP4A 5KN5B 4DGVL 1F11A 2V7NB 3MRPB 4F3FB 3R1GL 3LZFH 5C0AE 2OZ4A 1ED3A 1I9JL 5KSAD 1GVIA 4KHXL 1N64H 4YHMH 2DYPB 3MBED 5LCVH 2VKWA 4Z77B 3UTZB 4MAYB 1U8QB 3VG0L 2NY3B 2Q87A 5KZCB 2JF1A 4BSWB 2ZSWB 4WFGE 5CWSA 1K2DA 2VISA 3EO0B 5LAXA 3WEXA 4X7FC 4MB5A 4YO0B 2V17H 4D9RD 3V79C 1QG3A 4UU9B 1FG2B 3HRZB 4XNMB 3A6CL 2IAMA 3UMTA 1YC8A 2X1PA 2P44B 4WIQA 2NY7L 5F88A 2FR4A 1Q38A 1MI5B 4QHKJ 2BVTA 1IL1B 1I9IL 4PJIB 2B4CH 3M8OH 4GAJL 5EC1B 1DVFB 1Q94B 5FIEA 2IFGA 4JZJC 2P4AB 2X6MA 1FZOA 3BPLC 4M5ZH 4I4WA 4KXZI 2XY1A 4JG1H 3GSWA 3LRGA 5E08L 5J9PB 4XBEL 3QXVA 5K9OB 4MD4A 2ZUYA 4WI9A 1S9VB 2EO9A 4J3VA 2KDGA 4LFHD 2BP3A 3WKMH 5I1EL 1KFAL 1HQ4A 1ADQL 4DUXA 4ZPVA 1EZVY 3KJ4C 2AQ3A 4RA3A 1JCKA 1AQDB 2XKNA 4LDEB 3QEUA 1S9YB 1JRHL 3H6JA 2COQA 4FQPA 2VXTL 3CAFA 3SEPA 1CXHA 4EOWL 3EYUL 1RULH 4MCYA 5JPMA 1NLBL 2ZUQC 3FQRB 5J06A 4HIEB 1GHFL 4YPJA 4XMKH 1LE9A 1N0XL 2I9LB 1YMHA 2VWEE 2X1OA 5DMKA 1HHKA 2ZUTA 3DI2B 2YWZA 1SBSH 4PJAE 3FTGB 3I2CL 2NW3A 4P2RA 3MNWA 3MRIB 1RURH 1HINL 2RGSA 3MV7D 3DV6A 4MWFA 2C4FT 1U3HC 1T21A 3BD5A 5GSRA 1UJTA 4MZ2A 5T5FH 1PQZA 3L5IA 1EGJH 4G42A 4WDIB 4ODVL 5I16A 1MJUL 1YNKL 3PL6B 1T0MB 1IC5L 2DIJA 4MSWA 2AKRA 3S36H 3W5MA 1FO0L 2EXYC 3HUJF 2R0ZH 4LARH 3SDYL 2NY1C 3QEGL 1OGAE 3I6LD 4PY7B 1BFSA 3O0RH 4S2SB 2P8PB 4QRQA 4S1RL 4P99A 3SO5A 1CT8A 4M1DL 5TDPB 3X11B 2VLKE 1HDMB 2CXGA 5IBLD 1D9KA 4XMLL 1TVDA 3IKCB 4H5SA 1A22B 5ICXA 3C5SB 5EN2B 5C0BE 2DS4A 3QDAA 1OVZA 3KPRE 4GRLC 5JLZB 4U7SA 3UXFA 4Y4FB 1DQQA 4JREB 3AXLB 1UA6L 3DRTB 2EDRA 5FYJU 2K1MA 4KJPD 4O2CB 4KMTH 4Y2DC 3MLWL 2AP2A 3PWLB 3IAPA 5L0QC 3D3VB 4FA8A 5GSVA 2DQGH 4WU5B 2W65B 5DD1H 1NGZB 5IB5A 4RWHA 1KIQA 4TVPE 5JORB 1C16A 5FA4A 1HKLH 1LO5B 4JM4H 2IH1B 2Y36H 3MNVA 1SVZA 3OR7B 3FN9A 1JI1A 4ELKA 1JNNL 1WIPA 2KZ1B 3QUYC 3QQ4A 1T2QL 5D1XB 5SWSD 4QXTA 1LVEA 3I50H 4RX4D 4PRIE 3WSQH 2YMXH 5E7BA 2YD3A 4JFFD 2D0FA 5EBWA 1GL4B 1X9QA 4G8EA 2AEWA 4NBYB 3OXRA 4JQIH 5A16A 5F8RC 1U8NB 4R7NA 3GSXB 1JGLL 5C0RH 1QR1A 4HHAA 3TPUA 1A3LL 5FO9A 1N2RB 2ZCKH 3MLXH 2C4FU 4MXWL 5KSAA 3EJZD 1T66C 5BOZG 1FFRA 1BLNA 3MZTA 3QQ9D 5CCKH 3ARBB 5LWYH 1U8LB 3HC0A 4YC2C 3MBEA 2I5YH 2XY2A 5KOVC 4N1EA 3VFWA 2GY5A 3W39A 1V3LA 5HHVL 3TCXA 2I9TB 2H3NB 1U92B 1KCVL 3KGRA 1MCEA 3K4ZA 4QHUA 4I8DA 2UY6A 2VH5L 3OAYH 2VL5A 4ETQA 2NXZC 4HDIB 5L8KB 4G6KL 3SGJC 3RWHA 3RJDA 1B2WH 5T1KB 5ABDE 5E9DD 4OZGE 3B4NA 1UJ3C 3BP5B 1AGDA 4D8PB 3S9DB 1F90H 4XP1H 2OZ4L 2VC2L 5J7CC 1RK0A 4PD4K 1EAPB 4P9MH 3G5XA 1CLYH 4X6BB 2H9GB 4PJ8D 1IC7L 2XA8H 3GKZA 3TZVC 4ZUUB 3Q6GL 3MV01 5ECJE 3UTQB 2D0GA 3ROOA 4PJXF 4YAQA 3T1WA 3BEWB 2I25N 4JB9H 4LSSH 2O5YH 3RL2A 3C5ZD 4WJ5A 4YWGL 4E0RB 2UYLB 1M71B 4JN1H 3DX8A 3BGAA 2VXQH 1NFIA 4WFEE 2VABA 5ESAB 1R5IB 5I66A 2BMKA 2HT3D 3FRPG 4P2OC 4ZPTB 2HTLD 4LBEA 5CBEA 3GHEH 3SY0A 4OF8A 2VLRE 5CD5D 4EI6A 2IC2A 3JWDH 3K81A 1UXWA 3KPTA 1KCUL 5GGRB 3T65A 4FN0A 5I71C 3GIZL 3INUL 3QXDA 5A43C 5DK0B 4AJ0A 3V7AG 5IMOB 4NWUL 3CFKB 4P5TB 2PCPA 3LSOB 3VFVA 3QAZB 1FJ1A 4GAGH 1P53A 5CJXA 3KPNB 2X89D 3EFFB 4CW1B 1KTDB 3L3OB 5FYKU 4X7TA 2NY6C 3T3ME 2AXJA 4NQEE 3WIFA 2W59A 4P4KC 2XZCH 2R4SL 1AY1H 2DL2A 5EO1A 2XZZA 4LLWA 1A1MB 1PLGH 1JWUB 2ORBH 4FZ8H 3MRHB 3RY5A 4NM4H 3S37H 1R24B 4P2QB 5L6YH 4LCCA 1VPOL 2OJZL 3E6FA 4K3DH 2C1PB 3BT2L 3VD4A 3MQIA 4HS6A 4KK6D 2Q3ZA 4PJBF 1IVLA 5FO7A 5HI5C 4AEHH 4QRSB 1DDHA 1R5VA 5E5MA 1QBMH 2AGJL 3ILQD 4CMMA 4A2LA 4WU7A 2BCKB 4XHJC 1BECA 4TPRH 4Z5RA 1I7ZB 2R69L 2IANB 1LNUB 3ESVF 1B0RB 3QIUD 4NKIL 3SOBH 1Z5LB 4IDLA 5KS9A 1X4YA 1IJ9A 5HYFA 5GS0H 4GKOA 5E1AB 1J12A 1A9EA 4WW2C 1N6QL 1ZHLB 1F02I 1FGNL 2DWDB 5IOPB 4HF5L 2ITCB 5DMIH 2BHUA 3QXAA 3CFEA 1EUTA 5B39A 1NMCB 3AM8A 4H20H 5DVLA 2EDYA 5JIPA 4LGSB 3PNWB 3U2SB 4I0PC 5FKAB 3CSBA 3ELAT 4C83B 1FORL 2QQKL 4P57A 3RUGE 1C5CH 4Z9KB 3CZFA 5F3HB 4Y4HC 1OB1A 1U6AH 4XT1C 5F7HA 3QEQE 3SCMC 3V5KA 1KF9B 3KYMB 1WCQA 4G6FB 4U4BA 8CGTA 4Y5YA 1YEIL 4JPWL 3EHBD 2N7BA 3WO3B 4F15C 3BGMA 2VAAB 4D0BB 4HJ0C 3OX8A 4NM8H 5HJ3B 1ZT7B 1IKNA 3B9KD 5GJTH 5C07D 3MR9A 1PX4A 4Z8FL 3ET9F 2YD4A 2QLVB 1T1YA 3BH9B 3CH8A 3V6FA 2NMSA 2BRQA 1UVQB 3BUTA 4JGJA 5SWSA 4RX4A 1IZKA 3SGKC 1S5HB 1UYWL 3P3YA 5F1KC 4JFFA 4Z7QE 5KTEL 1CFQB 5DQ9B 3OKYA 2W0KA 1EBAA 4HS8L 1M7DB 4B50A 1INDH 1E27B 4U3CA 4K55A 4QRPD 1Z6JT 3I6GB 1KJMB 4YDVB 3VFMB 1OP9A 1Q9OB 1AGBA 2CIIB 5T1MB 1GGIH 1YPZB 3V7AE 1DBAL 1HE7A 4X9BA 1P7QD 5MEPB 5F9WB 2IGFH 5I1KL 3WYRA 5JHDB 3AS3A 5E6IC 1N5YL 4LKXA 1KCSL 4FZEH 2Q6WB 5T1LD 1EAJA 4G6MH 1R3IH 2DQJL 3D69A 3KYOB 4YUEH 4JGUA 3BRDA 2ZNXA 1QKZL 1DUZA 2DWEB 3BN3B 1F5WA 1JMZA 4RFOL 3CVHB 1KJ3H 4LSVH 4JRYE 3QNXA 1T0NB 4JAMB 1MHPL 3G6DL 1AP2B 4FQ1L 2ADGA 4XVSL 5IIEB 1RIUL 5F6IB 3X14A 5E9DA 3VXMD 3H0TB 3IDIA 4XVTL 2F54B 1PX3A 4JM2F 3B2VL 2FBOJ 1FP5A 5DD0L 5EO0B 4LVHC 3NTCH 2XG4A 2Y5TB 5I8OL 5J57B 4PJ8A 3T1FB 4PJDB 3DUHA 2R23B 5IG7B 3OG4B 3O6KH 4J1UA 4XPBL 3CFBB 3E8UL 1A7OL 4RZCA 4HIJA 1WWCA 2BOCB 3D25B 5ACMA 4OCMC 4PJAF 4OCYH 5E2WH 2A73A 1XCQA 3C5ZA 3B83A 1QSEB 1WITA 4FS0A 3TBTA 4GQ9H 4RGNB 2ATPA 4KUCD 4NFDA 4PUBL 3HZMA 5E0QA 3ZKNC 3UTTE 5BZWA 4HKBB 2EXYD 3LKPA 3HZKA 1MCHA 5F7DA 4HXAH 1RUQH 5TFSL 3FOLA 1MJ8L 1SBBA 4KZEL 2FWOA 4PJGE 4O9HH 3D85B 2BVPA 3VGAC 1KTLB 2P8LB 3LIZH 1TDQA 2VSCA 4HPYL 4ONFL 1SYSB 4WW1B 1NFDA 2DLIA 3OAYK 3V9FA 3OJDA 4WEUD 1VB9A 1JGEB 5D7LB 4UTBH 5DVNA 5GS1B 3P11H 3ARDC 1CS6A 5C3LD 1CFSB 1ZT1A 4X98A 1MCPL 4QXGL 4PJ9D 4MVBC 4Q9RL 4XCNB 2V9TA 2X89A 3MLTA 3G04B 3EYQC 2EIDA 5F70A 4U1NA 3U0PB 1RZJH 4GKNA 1RUML 3EOAA 4CVZB 2QR0B 4EN3C 5JR1H 4EXPX 2PR4H 3OG6B 4YDJB 4IRZL 4URTB 1CGSL 1IEBB 4HH9B 5I15L 4R4ND 3TYFB 1CLOH 4KJQC 5CBAB 4JQVC 1R0AH 3QJHB 9CGTA 3C6SA 1RIHH 2EE2A 1S5IH 2VE6B 5IBUB 3C87A 4KH2A 7FABH 1BX2B 3DXAE 3NIGE 3RPKA 1HHJB 2BNUA 4U31A 5IK3B 4NQDB 2ZKHH 5C0JA 2D7NA 1JWSA 4MQ7B 1OAKL 1CL7H 3RWCA 3CVHH 3OMZA 3VH8B 4P49A 2X4PA 5DO2D 1UH2A 3DWTA 1CGVA 2QQLL 3J7HA 2XTJE 3BKJL 3QIUA 3RA7H 3EIFA 3TT1H 4LNRA 5CGMA 2WBWB 4YHIA 1U93A 2O61B 2YBRB 4UUJA 4ZMAT 5GS2H 1DQML 3VXOA 3DROB 4WNQB 2OSLB 1MCCA 3H42L 1KYOJ 5IW6B 3REVB 3SDCD 2AJVH 2NXYB 4UQ3B 2HJFB 1RAMA 4XP6H 2Z93B 1Y6KR 2CD0A 3A6OA 2AJYL 5DJCA 3Q5OA 5CZXC 3B9DA 3CK0H 4R90H 5HHMB 4OD1H 5AZ2H 4C4KT 2V6HA 2AJXH 5EOCL 4OSUL 5D4QA 5F7MC 1K9TA 1NDGB 3T0EE 4O51B 1V7MH 2VDQH 2GAZB 5K9JL 4O5LH 1ORSA 1OTUD 3DX6A 4OZGF 5D9SA 3NZ8B 3W0WB 3B9KA 5C07A 1RZIB 1AD9A 3O45A 5ITBL 3MFGB 2F58L 4D0CA 3ARED 3LEVL 3VFUA 5IHBA 4P9HC 4F57H 4P23B 2VUOA 1AXIB 4WFFD 4Q9CA 4HK3J 3R8QA 4RAUA 5EZOL 4P46B 1A2YB 4J3SA 1JFQH 4OZFB 3N1MC 1OW0A 1PKQA 4Z7WB 1I3GH 1C7SA 4YXHH 4QRPA 3UJIH 4YHYC 1F2XK 4OIIL 4OGAC 1OAZH 1ZE3C 5DJ2A 3C8KB 2CDGB 2HG5B 3FB6A 1P7QA 3FJTA 1H3VA 3ARZA 1H8OA 3KYAA 1CBVH 1RUPL 3OKLA 4WTXA 3T0AA 5GGVH 1TCRB 4UT7H 1P4LB 3MLZL 1NEZG 4KJWD 1E4KC 2YA0A 5FB8B 3VRLF 2DLEA 4KXZH 5ID1B 5L7XL 4GKSB 4OLXL 3ZYOA 3MXWL 1CICC 3TH4T 5C2BH 1W0YT 3PJSB 1KEML 3WDIA 3QUMA 3VXMA 5C6PB 4ZFFB 1YMME 4ZTOL 4XNUH 1Z3GL 4NQCB 2D03H 1BQLH 2HKHL 3TF7C 4L3ED 3FCTB 1L7TL 4HPOL 3HG1B 4JJ5A 1MREL 5JPNA 4MJ4A 4DGVH 4Z6AT 5DRWB 1FZMA 3R1GH 2AXGA 2XZQL 2CKNA 2VSDA 1I9JH 4P3DA 5HI5D 4G7VH 1ZSDB 4AIOA 4KHXH 4HBCL 1HHIA 1RK1B 3QDGB 4GG6B 3HZYA 4R96B 4XAKD 4MA1B 2C3VB 2A6DA 3DX9A 1H3UA 1NUFA 4JFPA 5BS0D 1BVKA 2CDEB 5BVJB 2DOCA 2YN5A 4YBLC 4R0LA 4UBDD 5F6HJ 3VG0H 4M1CC 3QCTL 3SE3A 1FLRL 4PR5B 4LSTL 4ONOA 1FO0B 1QRND 1FYTD 4U1GB 4X6CE 3FQUB 3MLYL 3T2OA 4JFYA 3LQAL 3K3QA 3OHXB 2PO6B 4E42A 4Z7NE 2DTML 1QRKA 3UTSE 4PJ9A 1A8JH 4JKWA 3KPQA 1V7NL 1BREA 2NNAA 5TE6L 3F8UB 4B0MM 3JWOL 4Y16B 3ECBA 3X12A 3DNKA 4M8VA 5KAQG 4K3JL 4QLRA 4DAGL 4JFQA 2ICES 4Z76B 2NY7H 4JPVL 5IBTL 5I1AB 3ZTJH 5EU6D 5FYJE 3WNMA 4OZFH 3SCMD 2X4QB 4L4TE 3RUGF 4KRMB 1N7ML 1NUDA 5C86A 4ORZC 4HAGA 4DUVA 2GK0B 2P1YA 3FT4A 2D4FA 5B38B 1KPRB 3OKDA 2YD8A 4Q7DA 1MCBA 5DUBB 5CP7B 3GSUB 2FLBT 2F53E 3V0WL 3QDMB 5E08H 4JFDD 4XBEH 5CKGA 5FF6A 4D3CL 4J3XA 5B3NA 1H5BC 1CU4L 1NBZA 3MRKA 2P8MB 2VOTA 3SE8L 5HVWA 3DO7A 5I1EH 2EECA 1KFAH 5BV7C 4HJGB 1ADQH 2P7TB 3TCLB 4Z7QF 1A6TA 4P3CL 4FP8L 2W07A 4U1HB 1JRHH 3UZVB 2VXTH 2MOVA 1WWAX 4EOWH 3EYUH 1NLBH 4FG6C 2YD7A 1GHFH 1N0XH 4RQQA 3WHXA 3O3BB 4OF3A 1H15A 2V2WB 4BH8B 4HUVB 3VI3E 1B88A 4NZRL 3SDCA 1RJYB 1K4DA 5FGSA 3I2CH 3VD9A 5F1OB 1HINH 1S78C 3K4DA 1WWWX 4PRPD 3MYJB 1L4IA 2BC4A 1GAFH 3BDYL 4PJEA 2D7MA 5DHYB 4MDIA 5ILTL 3VWKD 4KKLD 4ODVH 1MJUH 4NN5B 1YNKH 1NSNL 4KKBC 5HDQL 2O26U 4XWOC 4RRPA 1IGYB 4MMZC 3SO3B 1IC5H 1UC6A 2HJLA 3C08L 3STBA 1L0XA 4IS6B 1NMAL 1NPUA 5CHNB 1FO0H 1MELA 3PV6B 3MV9D 2H6PA 1BOGA 3QEGH 4PJ5D 3SJVD 1L6XA 4PJFE 2WSKA 1NCCH 4LIQH 4S1RH 3HC3L 2J5LB 2DQHL 4BSJA 4M1DH 2OK0L 5C0CD 4Y19D 3AREA 4XMLH 4F9LA 4JFOA 3RKDC 1HHHA 2XG5A 1LEIA 5C09E 1NBVL 3ZKND 3DYOA 2QV2A 3MOBL 5JTWA 1BF2A 2E7BA 3MZGB 3SKOA 3GB7B 5E99L 4Y8AA 4P0DA 1UA6H 5CP3H 5I1LB 5CWSB 2E9IA 1K2DB 1JNHB 2YEZA 5LAXB 3WEXB 4NKMA 3L1OL 3HZVA 3ARVA 4PJGF 1U3YA 2A9NL 1E28B 5T1DL 3MLWH 4HZLA 3UBXG 3STZB 2UWEE 1K8DA 2XNAB 4YXKL 2EDBA 4GW4A 2IAMB 4X7SL 5I73B 2HAZA 3BVNA 3C6LC 4NZDA 4XAWL 5E8EA 5TH2A 4MVBD 5BW7A 3HMXA 2FX8H 2UZYB 1D5IL 3GO1L 1JNNH 1FZJA 3HE7C 4S1QL 3VFRA 1B90A 1T2QH 5L2KE 3RRQA 5FYKE 5EPMB 1BD2D 1R3JA 4L3EA 5EIIB 5EO9B 1JUFB 3IJYB 3RDTB 3O9WC 1FZOB 2LU3A 1A3LH 2EDFA 3D9AL 1SMOA 4LNVA 4TTGA 2ZOLA 4MXQC 4MD4B 4KROB 3FFCB 2Y23A 5E8DL 3VXRD 3PG2A 3S96B 3BRGC 2IBGA 4YHZH 1AD0A 3QH3A 1XMWA 5C08E 2GJ6B 1L9MA 3U4AA 3NIGF 4ZPVB 5D5ME 5BS0A 1I1YA 5HHVH 3QUML 4FXLA 2XXCB 4LCWD 5SWZE 3H9YA 1FFNA 4E41D 2OQJA 5CILL 5CFHA 1KCVH 4MCYB 3AVEA 1QRNA 1FYTA 5JPMB 2D7PA 3U7WL 3RGVD 1TENA 4OF0A 3WD5L 3QRFM 2VH5H 1BHGA 1YMHB 4WW2A 4G6KH 4U6HA 1IAKB 3DI3B 1JTPA 5DMKB 3Q0HA 2RHEA 3GSVA 3WUWA 5ADPL 4W70A 2NW3B 4P2RB 4AG4L 2OZ4H 3UJJL 4NZUL 4J3WA 1T6VN 2GSGA 4XC3L 3DV6B 4XCEA 1T21B 4F9PC 4FXKA 4Y89A 5GSRB 1IC7H 3HNSL 4FRWA 3VG9C 1PQZB 1SJVA 2DQDL 5D1QC 3IXTA 3MCKA 2DMBA 2JJTA 1WFUA 4YHNA 1N8ZA 4QCIA 1ES0A 5EUKB 2AXFA 4Z7UE 1QACA 1T04B 5EU6A 2YPLD 3GMNA 1VKXA 2EIZB 3SCMA 4YWGH 1BFOA 1I7UA 4CN4A 2DKSA 3O3AA 4QRQB 3OB0H 1E4WH 4Y5XC 3QZWA 3RZCB 1CT8B 4LEXH 1E4JA 4X7DC 1D9KB 2Z31B 4G3YL 2RR3A 4OQ1A 4BK4A 1JZ8A 2R4RL 3BYTA 1MLCB 4JFDA 5FGBC 3CXDL 5B21A 3L7FA 3GK8L 4PYGA 1KCUH 1PG7L 4I3GA 1NGQL 2EE9A 3GIZH 3INUH 1HSBA 1I8IB 4D9QD 2P5WD 5H94A 2VMFA 2Y07L 2YUVA 4ZAKB 5C6WH 5IMMA 3ZYJA 2CMRL 1WTGT 4NWUH 4R4BA 2X4OB 4LMQE 3GBNL 3QIBC 1X6NA 4KVNL 3RU8L 5E00B 4I5BA 4OGAD 5D2LE 5DYOB 4LAQL 3BPCA 5DD6B 3F6IA 1IQDA 5IB5B 4JM2C 1KIQB 2NY5L 2R4SH 3ULVE 1VENA 5E8PB 4NN7C 3B43A 4S1DC 2GQHA 3TN0D 5GRZA 5JA8B 4Z7VA 3MNVB 5EUOA 5GRUL 1VPOH 2OJZH 2VWEC 4M3KB 4PRPA 3VRIA 2PYEE 4M93C 3VXUD 4QF1A 3QQ4B 3BT2H 1WSST 4P5KA 4CU6A 3VWKA 1U91B 4G8EB 2Z8WC 4K3EL 5DA4A 5ITFA 2AGJH 3LEYH 3MV9A 4HHAB 4ONGL 4PJ5A 5FO9B 3SJVA 1AHWA 4JHWL 1RD6A 3CSPA 4APQD 2NY2C 5KSAB 2BXYA 4NKIH 4YR6B 4OCXL 2X4UB 5C0CA 1AGCA 1PVHA 4Y19A 4FQHA 1MUJA 4NOFA 5JNYB 2FJFA 3VFOA 3MBEB 1N6QH 1FGNH 1U8IB 3E6HA 5BO1L 2EDDA 4HF5H 3W39B 1Z9LA 2R1XA 2A1WH 2ADJB 1LP9A 2FHCA 2H45A 4MQXD 5IV2A 5GJSL 4L8CA 2WWMD 3IRZA 4QHLA 1ZWIA 1GGUA 3WLWC 4HWEL 3C8DA 1YY9C 4M1CD 1K8IA 1XH3A 1QO3A 2VL5B 4ETQB 4NNXB 1FORH 2QQKH 1JN6A 4WHYH 2BRRL 2R2BA 1RK0B 2IBZY 4X6CF 2VR5A 2YN3A 2HVKB 4W4NA 4ODWB 3MTRA 3RVUD 3I3DA 3TO4D 1YEIH 4JPWH 2VDML 1PY9A 5F7YC 2OBGA 4BM7A 5DK2A 3ROOB 3DUUA 1VGEL 4Z8FH 1FAKT 2J8HA 4WJ5B 2X7LB 3TH2T 1UYWH 3DX8B 1NFIB 1BD2A 5KTEH 5I66B 1MCFA 3BKYL 5HPMB 4HS8H 1ITCA 4LF3A 4LBEB 3A0OA 4X6FA 1WTLA 3BKML 2ZPKL 3SY0B 5EZLA 1CZ8L 3LKNB 2VL4A 4U1JA 4Q97A 1KG0A 5C1MB 1GZPB 1NAMA 3VXRA 1EIBA 2NY0C 5FO8A 2R8SL 5TPWL 3HMXL 3L3DA 1BFTA 4Y88A 43C9A 4FTVD 1N5YH 5B8CC 2NY3C 3GSNB 3JTSA 5CJBA 1KCSH 2PCPB 4LCWA 4E41A 5ICZA 2B1HL 2DQJH 1QKZH 3JVGC 5I17A 1A6ZA 4RFOH 3RGVA 5HBBA 1VERA 4CMHC 3L5HA 4L8BA 1FNGB 2EO1A 3BESR 2PUQT 3PQYD 1MHPH 1TIUA 2VXSL 3G6DH 4WI8A 3WIFB 5HYJD 4FQ1H 4XTRC 4XVSH 1NLDL 1RIUH 5INDA 4MD5A 4HH8A 1G7PB 5D7KE 1YY8A 4XVTH 5EWIL 3B2VH 5DD0H 1CD0A 4LCCB 3MV7B 1PG7X 4BKLA 4PRNA 1JV5A 3U4BL 4HW6A 1F6AA 5L2JA 4XPBH 1T7ZA 3E8UH 3S4SA 2HFEA 3LQZA 1MLBA 3VI3F 1DR9A 3H9SD 4X9HA 5E5MB 3LKRB 3W11D 1JGDA 5DHVA 2YPLA 5IB2A 3QSKB 4WU7B 4Z5RB 3LDBB 1DVFC 1MCJA 4G8GD 5B22A 4PUBH 3O6FC 1JGUL 4Q6IC 5IEKA 2A6KA 4ZUVA 5TFSH 1RHFA 5KS9B 5EU7E 4EI5D 3V6OE <