5D93C

Oxidoreductase fragment of mouse qsox1 in complex with a fab fragment from a mouse qsox1-specific antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
207
Chain Sequence
QVQLQQSGPELVKPGASVKISCKASGYSFTSYYIHWVKQRPGQGLEWIGWIYPGSYNTEYSEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYYCARSEDWFAYWGQGTLVTVSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Overcoming a species-specificity barrier in development of an inhibitory antibody targeting a modulator of tumor stroma.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Sulfhydryl oxidase 1
total genus 43
structure length 207
sequence length 214
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d93C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d93C02
1QBLL 3RL2B 5A2FA 1KG0B 1UZ6E 3BHBB 1I9IL 2MQCA 3BUYB 4FFYH 2R69L 3MLUH 4MWFB 4U1NA 3PWJB 4LLQA 3T09A 3W39A 2WQ8A 4KK8C 3ARQA 5L2KB 2QADD 1L6ZA 3RWHA 3L3DB 3NCYS 5C07A 1ZGLB 4XNXH 3B43A 5KOVC 1L9NA 3J7HA 3I85A 2RJMA 2BHZA 4OGXL 1QKZL 3O4LA 3PWNB 3UMTA 5IK3A 4EUPG 1T83A 1G7MA 2R0LL 4ODXA 4P2RD 5ISZA 4GH7B 5BRZD 5I1EL 1Y6NR 4GG6B 3MROA 4KKCD 2PTTB 4TVPH 4G6JH 3QEGL 1M6OB 3V4PH 2YD9A 5C6PB 3FQWA 1C5CH 1I7TB 4M8QA 3EOTH 4RFNC 2CDGB 3FFDA 5I1HL 4WI2A 5DFWH 1F8TH 2Y4SA 4ZQKB 2G9HA 4EQ3A 1OB1B 4FXGB 1GGBH 4LVNB 3GSNA 2R15A 4U3XA 1I3UA 4HUVB 2IG2H 3GSXB 4LSUH 1IGFH 2YN5A 4KUZH 3E8UL 2X7LB 4XPGL 2EC9U 5I8EA 4FQQA 4MNGE 3TO4B 1OGAB 4W4NA 4L1DA 2D31B 4PG2A 3I9GL 3HNTL 3B5GA 5I17B 5F88B 3HUJE 4X6DA 3FB5A 1FG2A 4JDZB 4JHAH 1JGDA 2YMXL 2XACC 2HP4A 3C5ZC 4ZUWB 1E27B 1AGBA 2I60L 1KENH 4X8JB 4TTGA 5E9DD 3S35X 2J2ZA 4N5UA 4CVXB 1R5WB 4UILL 3S96A 3ECBB 1A6VH 1FPTH 3PHOA 1R5IB 2CKBA 5AWNH 1U0QA 5D7IE 3WIHL 1NAKH 1SY6L 3K2UH 4OSUL 1BLNB 2C4FT 3W2DL 5H35A 3VFUB 1J8HD 5EG6C 1U3HD 4LEXH 2IC2A 4FXGA 4NN6C 4DN3L 1GH7A 4EI5C 3EYSL 1XF4B 5B22A 4XBGA 3IDXL 3CX5J 2VQTA 4DAGL 3U36A 4HJJH 4P46B 2EE2A 3LKRB 2XG4A 3VXNA 5ACMA 3U30C 1OD9A 4G9FD 3DI3B 3KPRA 1CN4A 5L2JA 1N5YH 1FH5H 4NQEA 4RSVA 1P4IL 2VDOL 5DK0B 1CDBA 3Q6GL 4JFEE 3QUYD 1W0VB 2FEDC 4LHUA 3QXWA 3TWCH 3WL9A 5DHYB 4OZ4A 3S3JA 4OBSA 1QSFB 1YNTA 1BPVA 4EI6B 4LDEB 4Z7WA 3WFEH 5HHPA 1GZQB 2D0GA 3ZMRA 4JGMA 5T1LA 3EOAA 5DFVC 2W65B 4MZ2A 1U8NB 4JFED 1C12A 4YDJA 3IJYB 3PDOA 3OX8A 3SE4C 1RU9L 1UB5B 1U8LA 4BQBA 4UINH 3DBXB 1L7TH 3S7GA 4XPAH 4M61B 1A6ZA 2MWCA 2EDQA 4WTXA 1A22B 5GZND 1SVZA 3WNNA 3KYOA 4IOIA 1J8HB 1TXKA 2BY1A 3QZWB 4QXTB 5IF0B 1H3PL 1LILA 2ZCLL 4PD4K 2MFNA 5D93B 1YPZF 3SKMB 5I8CA 3LKPB 3SE9L 1BX2A 5D1XA 3EO9H 4WHTA 2NYYD 5F89A 5CIPB 2KDGA 2VXQH 4ZFOB 4X4XB 1EZVY 2P8PA 1MHCA 4YE4H 4MMXC 3GJFK 4HXBL 5SX4H 3BP5A 2IQAA 4UNVA 5JHDD 4U1JB 4K3DL 4J1UB 1Z9OA 4JFQA 4P3CL 3GKWH 3SE3A 1ES0B 4I3SL 2BJML 4D8PA 2XT1B 4HFWB 4X6BA 1CICB 1RVFL 1TNNA 2BVPB 3CFCH 4LLWB 4PY7A 4C56D 4WUUD 3MMEB 4OV5B 4U6VH 1S7UA 1IL1B 3C6LA 3EO9L 4NO2A 3LKNB 3SE9H 2J88L 1A1NA 5A1AA 3FJTA 3SGEI 3DO7A 1OP3H 3RAJL 3OX8B 5EH1A 4LGPB 3RX5A 3ARGA 3EHBD 4NCC2 1NMCC 2NX5B 3QPXH 3CC5A 5DJ6B 2L4OA 4TTDC 2Y07H 3P4MB 4N8PA 4HK3N 3O2DA 5I1CH 3MV7D 2ZSWA 4FXKA 2XFXA 3L1OH 4WV1A 3PWPA 5MENE 4U1LA 2FR4A 4YR6A 1T1ZA 5M7QA 1OHQA 1WLHA 4DFHA 2P48B 5DRNB 1EJOH 3SGJA 4HT1H 2PYEB 2CJUL 1R24A 2E3VA 4QRTB 4U0RB 4HJ0C 3AREA 5ENWA 1BQHB 3UYRH 4PJEF 4LDOB 1UB6B 2COQA 4B5EA 3HG1A 4PJBE 1XF4A 4RA3A 3BMWA 1XMWA 2BY2A 4R0LC 4UDTA 2XNAB 1ITCA 3V9FA 2ITDA 3KPRB 2Z4QB 4UAOC 4QRPE 3QH3B 5HY9B 2ZP0T 3WFZA 4WFFE 1CFTA 3L9RB 5JDSA 4IM8A 2V5YA 2Y5EA 1NCAH 1U8NA 4LAQH 4NQVB 1XGYH 4NGHH 4KXZH 2VDPH 4BELD 2HWZL 1ONQB 1NDGB 4Z7WB 2UZIH 3H9SA 5TE7L 3WKMH 3OXRA 5ETUB 2HYMA 3KPMA 1XGTA 1FL3B 2LE9A 3QEUA 4IIQB 4GS7C 1FNLA 5EIIA 4IHOB 1UT9A 1F2XK 4M1GH 1WWAX 3HMXH 2Q76B 3EIFA 5J56B 2JJWA 3HRPA 3WEXB 2BVUA 5IMMA 5JIPA 3RTQD 5CZVH 4QF1A 5KZCD 5F7HA 3E6HB 2WUCL 5D1ZD 1NAKL 1TCRA 2B5IB 1X5FA 4UTBH 3AS1A 4B53A 2IAMD 3UBXI 3LKSA 4ZAKD 1A6VL 4KK5C 2EC8A 3TBSA 1IC1A 4C4KT 2OCFD 4NUJA 4XVUD 4P59H 1OAQL 1J5OH 4OLVL 3JWDC 3T3PF 4GO6B 1EIBA 5GZNC 3PHOB 2A74A 3WUZA 4OFVA 1D5MA 5DD0H 1VACA 4MJ2A 5J1TC 4OF6A 4X0KA 1NFIB 3S34H 2VZOA 3WYRA 3OJDA 3L5WB 3WHE1 2EXYD 5I73B 1EERB 5MP6H 1PKQB 2HRLA 2AV7B 1ZT7A 3UTQA 4WWKA 1LK3L 1RJCA 4RMWA 1N8ZB 4YGVB 4IRZL 5F6IB 1LP9A 1KC5L 1DBKH 5HYFA 3DSFL 5JW5B 3SKJH 1FL3A 3QEUB 2VXQL 1X4YA 4IIQA 4L3ED 4NM8L 4WJ5B 4X9GA 4PRDA 5J9PA 3MRCA 1OB1A 3W5NA 4ZSOA 1X6LA 2JLLA 1S5HA 3OF6A 3BUTA 1U8PA 2VN7A 1IFHL 3D3VD 4AK1A 2DOCA 4HLZG 1FLTX 1FNHA 3QG6B 3X11A 2LV4A 1MCSA 4JFHD 5JOPE 4PGCA 3OKEA 4ZUVA 3RVWC 1QSEB 2Z8RA 4QNPF 4FQQB 2R0LH 3K3QA 5F1NA 5JORA 2R2EA 1NGQL 4HMCA 4LCCB 4PJ9C 4JE4B 2A6IB 1RU9H 1FN4A 1S7TB 1KPRB 2WW8A 1OWWA 2BCKB 4U49A 4ONFL 1UWEL 3QEQA 4KMTH 4L8SB 5ID1B 2LU3A 4Q2ZB 5CJOL 5DC4B 2EDXA 2P8LA 3VW3H 2FO4B 5D5MF 2WANA 3SOBH 2P46B 1IGTB 4JZOB 4EVNA 3HHRB 1D9KB 3FRPG 3SO3C 4WHYH 3S97C 4MXVE 1PG7L 3Q6GH 1A7QH 2I27N 1MCNA 3BT2L 5F6HI 2ICWJ 1GGYA 4TN9A 3BRFA 3GSRB 2QSQA 4JDVB 3MX0A 3TM6A 5L2KE 4RFNB 1PQZB 1ND0B 2VE6B 1ZLVH 5DK2B 4I18A 4LVNC 4HUWA 2ADFH 2ORBH 2PCPB 3TJHD 3AUVA 2Y06L 4CAGA 1RFDL 2H2PD 3H3BC 3VWJB 3KPSA 3VFVB 4HAGA 3VD5A 2FL5A 5L6YH 3NCEB 4S0TD 4MA3A 1MHHA 1DBJH 3CCHB 4G8GE 3IDMB 4OAWA 2AQ3A 4WEMB 5T1MA 2PN5A 4PJAA 1C1EL 3HMXA 2AEPH 5ITBL 1NCCL 4JHWH 4XNYH 1H15A 4YFEA 3AXLB 3D39B 4QRRA 5KVEL 1X7QA 2FSEB 5D1XD 1KLGB 3MV9B 1I1FA 1XR9A 3DMMC 1BIHA 1XCTA 2F54A 2BHUA 2DQCL 3VWJD 3ROLA 1BFVH 3EGSB 1FE8H 1TLKA 4WW1B 2FRGP 5DUBB 3WCYA 5FB8A 1ETZB 3L7EA 4Q9CA 4LVOC 3IJHA 1V3MA 1QPXA 2XY1A 5ESVA 4NQXB 4G6FB 3R8QA 2PETA 1DVFB 4NUGL 2X1QA 3JUZA 3NZ8B 4GUPA 1N5AB 2XV6B 2GITA 1U3JA 2EIDA 5INDA 5LQBH 2D7MA 4OTXH 4NQDE 4IRSB 3GSWB 4APQB 2VH5L 3OHXA 2GYSA 1KSRA 1OTUD 1VCAA 4OT1H 1JMZA 4JANB 2BNRB 5ITFA 3QQNA 4KROD 1TZGH 3NA9H 3QXVA 5SWSD 2Z4QA 1I3RB 5SV4A 5BO1H 4J3VA 1AD9B 3CDGA 4ORZC 4D9QD 1CXEA 3V5DB 2HFGH 4XC1H 4XRCA 3CU7A 3P3YA 1BZQK 4M00A 4Q9QH 4XNXL 5EZJB 4RQQB 4MCZB 4Z0BL 4OZIF 3KPPB 1MCWM 4S2SB 5T3ZL 4G7YH 2J8UA 1EMTH 2P5WE 1WTGT 2R69H 2OL3H 3QFJD 1CLZH 4F9PA 5FGCE 3ARGC 5CKGA 4I13B 1KCSL 2QTEA 3EFFA 2FHFA 3OHXB 5TPWH 3VI4E 4X4ZA 1RZFH 4GFTB 3FQRA 1KTLB 1OAKL 1S3KL 4GKZB 3VWKB 3F6LA 4C55A 4F15B 4DN4L 4Z7OF 2XKNB 5IMKA 5C09B 4OGAD 3HZYB 1R3IL 2DD8L 1X5JA 3RWFA 5GJSH 1YUHA 2DI7A 1I1AC 1ZK9A 4RAVB 5KAQG 5JXAH 1AGEA 4N8CH 1FRGL 3TZVD 5JW4N 3BXNA 3ESVF 3TA3C 2AVGA 1MRFH 3T65B 5FUCE 4PRHA 4JCMA 5I74B 4ODWB 1RZ8B 2F8XC 4H25B 3M17A 2OZ4H 1B0RA 3CFJA 5DMGC 1W72B 2IAMB 2ZKHL 4XWGH 3LQMA 1UWXH 1DEEB 4O2FB 2GUOA 3MLSH 3DVNA 3EBAA 1A9EA 4X4MA 3GMNA 3WUWA 3FT4A 4EZMA 1WFTA 3H0TB 4IS6B 1LO3L 4M43H 4M43L 3IJHB 3G5VA 1CLOL 3VXSB 4OLEA 5JW3H 3FAXA 4ZAKC 5EU3B 1JN6B 3QSKB 4JM4L 1E4WH 5EBWB 3THMH 4CVUA 4C56B 4R4NC 2QEJA 1IE5A 2MKWA 1CGUA 3RY5A 1KCRH 2ADGB 1YEHL 5E8OA 1MVUB 3BWAB 4MJ5B 5L9DL 3D3VE 2CK0L 3A67L 3X13A 4UNTA 4GRLA 1HDMA 1I7TA 2DKMA 1I75A 4MSWA 3UTSE 3OGCA 3KS0H 3FFCE 3SDDB 1EFXA 3MRIA 4IDJH 1GGTA 4R4BB 1A6UL 3BKJH 1R3JB 3STZA 4R7DA 3ZSSA 3JWDH 1RZ8A 4JM2B 3L3IB 4HKJB 4Z7NF 4Z5RA 3U9PL 4KJPD 4DGVL 3FT3A 2V5SA 4JVUA 4NZRH 5DGQA 1CYGA 5I0DA 1CT8B 2XZQH 2YUXA 4LBEB 3EDDA 4FQCL 5FOBA 5IVZB 4XHQA 1WFNA 1G9MC 2JJTA 5I1AB 2O5YH 5K9JH 4X80L 1OAUH 3FN0L 5KN5A 1C12B 2IANA 5HVGB 3MRPA 2A83B 3BIKA 2K3TA 4R90H 1OGAE 3SGDH 2OP4H 1A4KA 4WV1B 3IXAA 5DJCA 4G7YL 3RWDA 2E8YA 3HUJB 3IU4H 3DRTB 4EBQL 2NZ9D 4ONHA 2IALB 4LVHB 4L4TE 1KTLA 1T1WA 1XGUB 2JE8A 1P6AB 1SEBA 5LGHH 4PRNB 4YEEA 2CR6A 3H6JA 3OAUH 2P24B 1OLLA 2BP3A 1N7ML 3F6IA 2J8UB 5DEFB 3HG1B 3C6LC 4N0YL 2R1WB 3T0EC 1NANI 3K4AA 5I8OH 4Z18A 3GJEA 2YHGA 4LRIA 4N0YH 4WU7A 1BAFL 3GSNH 4RNRA 5DJ8A 2JB6A 1AKJA 2EKSA 3VRLF 3V5HA 4L4VB 3ARDA 5KS9E 1BEYL 1YEEL 1G1CA 4HMEA 3NCBB 4OLWH 2VLRD 3IGAB 1EGJA 2YC1A 3QQ3B 4NUGH 5A2LH 2ARWA 1QHPA 1U8OA 5C8JB 4OV5A 1I4FA 3NFNA 4NZUL 2C9AA 2WBWB 3LD8C 5FHAH 4WEBL 5DUMH 3LEYH 3QCUL 3UTTD 1CDGA 1B0RB 3CFJB 3OR6A 4PJXA 4HGKC 4P5TC 2I9LB 4XWOC 2AQ1A 5C08E 1XCQB 4BYHA 3RZCA 1KB5A 2HKHL 4NP4L 1J8KA 5H94A 4NKMB 5MEND 1OGTA 3RX8A 4JFEB 2I07A 4Y7MA 3ARFA 4OZGE 4IOFC 4NQSB 2C7UA 2ZUTA 1U91B 3GMNB 1P69B 3V4VH 4XNYL 1A6UH 3CH1B 1UEYA 4MA3B 4FQCH 4I8DA 2F19L 2HLAA 3BPLC 32C2A 5EOTB 1C5BL 1FL6A 1T7YA 1WBZA 1JZ2A 4E0RB 3RDTA 4QXGL 3RGVD 4TQEH 4LKXB 5DFVD 2NY7H 2EICA 2VOTA 2V5MA 3HE7C 3PNWA 3QIWA 5E5MB 3VXSD 2X4OA 3QQ3A 4LF3A 2SEBA 5ICXB 2XNAA 4C56E 2IAND 3PDDA 4MXWL 1N0XH 4P4RB 1T7ZA 4M6NL 2EIZA 3NPZB 2N56A 2W07A 3C60D 1S9KC 3BKCH 1UM6H 3QNXA 2DIAA 2X4TA 4OJFH 5SWQA 4PS4L 3JTSB 2XZCL 1BIIB 5DVKA 1E4WL 3VFNB 2E7HA 3FCTB 4Q6IB 1N59A 5TE6H 2WINB 1MFEH 5IHUL 1CT8A 4M62L 1WBYA 4KV5F 4I0PD 2A73B 4XMLH 1CGTA 3M07A 4LLDA 3RKDD 3R06A 4BKLA 2E7LA 3P0VH 2ZPKH 1B2WL 2BERA 3QUYA 4NT6A 3BN9C 5F70A 4KKAC 1I7UB 3MUJA 1FBIH 4MD4B 5E5MA 3KPOB 1DSFL 2YOCA 3ZTJH 2HJFA 4XRCB 4HF5L 3VFOA 1ADQH 1AXTL 1RZFL 1MJUH 1U8MB 3QT2A 4KROC 4WU5B 4M5YL 1INEH 1X6NA 4ZDHA 2X10A 4JRWA 4RAHA 3KLAB 4PJHE 3ULVH 4XC3L 3DX9A 1EH9A 3FOLB 4EKXA 1QBMH 3WLWD 2AAVA 4CJ1A 1P2CB 1OM3L 2APTA 1EGJL 2R23A 4JO1H 4Y4HC 1RUPL 3QI9D 2DLIA 3FB8B 3IDMA 2VQUA 3TH2T 2GIYA 4ACPA 4NKIL 1OSPH 2HH0H 1WZ1H 4BFGA 5IVXA 5BO1L 1J5OL 2AK1H 4HWEL 1J8HE 3O4LB 2BSRA 5DR5H 3O8XB 5T3XH 4K7PH 5F6HJ 1KPVB 5F7EH 4ZD3L 4WHDA 4WW1A 5D7KE 5D96C 1KJMB 1Q9KA 2YUVA 4GRWB 1J12A 2Z8SA 1N4XH 3KS0J 3BP4A 3NCMA 4XP5H 4R7NA 1CIUA 2H9GB 4F57H 4NKDB 5BV7H 4XPBH 1KB5L 3HUJA 4P5KB 5IIEA 4X6DE 4KTDL 3QWOA 3TBWB 2EXWD 3CVHH 3TBSB 4ENEC 2EYSB 5F71A 3WKML 3Q5YA 3HA0A 3I6KB 3U7YL 5BOZG 5IEKB 1EZVX 2XA8L 4MXQD 2P24A 5E5UB 3S36L 1YMME 3IT8D 5FA4A 5ALBH 4X4YB 1IVLA 4MCZA 2HTKD 3VDAA 2IPTL 3FMGL 4BA8A 4F37K 5JO5A 5FKPB 3QDHA 3RVVD 3SDAA 1JGUL 1SYSB 3OGOE 3BPCA 4JHWL 4YBLC 1A4JB 4K3JH 4PGBA 3IJSA 4F9LA 5HHME 4Z0XB 3SQBA 4A2MA 1FFNA 1JHKL 2ESVB 2RR3A 1EO5A 4LLQB 4H1LB 2P49B 3KPLB 1IZJA 4NRZB 4MD0B 3SDAC 2AW2A 4K9EC 2AEPL 2R1YB 4Z5RB 5F96L 4PJFF 4PLKC 7CGTA 3R4DA 2ZNXA 1CXHA 4NKDA 4LCYB 1G7HB 2EH7H 5F72S 1HCFX 3QHZH 3VG0L 4C83B 4PJ9D 3QJHA 1DQQA 2P5EE 2WWKT 3FFCA 4JFEA 4RIRB 5IW6A 3VJ6A 3BSZL 1SEQL 4U7MA 1MWAH 4Z8FH 3BEWA 2IADB 3G5ZA 4WNQB 2NY6D 4HPYL 3HC0A 2VRAA 4WU5A 2V5TA 3QHFL 5ESQA 1FV1A 3VFRB 2ERJB 4PB9L 2QL1A 3VGAB 3CFDB 2P5ED 4M8VA 3G5YB 1ORSB 5EOQH 2X1XR 4JHBA 1FYHB 3UTZB 3WFBL 1FZKA 4WFFD 3OB0K 4KZDL 4X0KB 5IESH 5C0AE 4CNIA 5L0QB 1CFNA 4H8WL 1HSBA 3C60A 4PRBB 5EBMA 1M05A 4GQ9L 2YEZA 3KYKL 4KGLA 3U7WH 5D1QD 4PRAB 4DEPB 2QSTA 3QUXC 1EA9C 3IVKA 1RPQA 2ZCLH 4M4RA 4X6EB 1ZEAH 3T2QA 3UJTL 4YXLL 3QDME 4PP2B 1XIWB 3LEXB 2JCCE 2VAAA 4L4VE 1MRDH 3NIGF 3DETC 3HZVB 3WO4B 1YC7A 3HPLA 1AI1L 3A6BH 5HDBF 2A73A 4ETQB 3BOVA 4LLMB 2BOCB 4DKFH 4HUNB 2C1OA 3GBLA 3NCYP 43CAA 1ZE3C 4LVHC 3F7VA 4LLDB 1K5NB 2KBGA 4JVWA 5FM5O 2AP2A 1YMMD 5HGAA 3GK8L 1FSKB 1IGYA 1KC5H 4OD3H 1P9MA 4NT6B 3NPSB 2EDYA 1RHFA 2C3HA 3QFJA 4L8SA 4PBVC 5ID1A 3C2SA 1DQLL 3KJ4C 5DJXB 5MP6L 2E7LC 5DGRA 1S5IH 3PL6D 4PJXE 3W81A 3AAZB 1V7ML 3EOBA 5C0JA 5D72H 4CDGC 3K7UA 5FO8A 5ANMA 4OQTL 4D9RD 1E6JL 1H5BA 2FWOA 4YHOH 2WLYA 2YEZB 1JCKA 2AEIT 2VDMH 6FABL 3OJMB 4B0MM 2Z31C 3QIWB 2BFVL 4ZPVB 1MJJA 4OGYL 1D9KA 5F3BB 4LPUA 5EU6B 2VNCA 3LCYA 4NFDA 4PREB 1WQVT 4HKBB 4PJCF 1LEGB 3QYCA 4HCRL 4LEXL 5EUOB 1BVZA 3B2VL 4KU1A 2ICWI 1JWSB 5GS1B 1A0QH 1BM3L 2OTUB 3HMXL 4OCNC 3PP3H 5I0ZA 5EU3A 3UYPA 2A6KB 3TEUA 2HT3D 3P73B 3K46A 1FIGH 2C4FU 1OAYL 3MRHB 4UIMB 3KR3L 3ZKXC 1QSZA 2VDPL 4NIKB 1DQML 4C83A 5TJWK 1U8QA 2YMXH 4NKMA 3QQ4A 4XMPL 1NC4D 4HT1L 3RWCB 1ZSDB 3HNTH 4CNIB 1R5WA 5J11B 4GS7B 3GNMH 4RAUA 1XCTB 2F54B 2JELH 4NO3B 3OKMB 4K7PX 3TVMC 1IGFL 1HKFA 1ZT1A 3FN3A 3NIDE 2F74A 4G8GB 3K4ZA 3C5ZA 3IDIA 4L8SC 4LU5H 1KB5B 4YQXL 3T4YA 3ROLB 5GSVB 3Q0HA 3MUZ1 4QRUB 5LJYH 5GRWA 5CGYC 2NY6B 4OCXL 4UNUA 1H5BC 1RJLB 3CUPA 4F7CB 5FO7A 3QEGH 2ADJA 3VGHA 4G6JL 3KYKH 2YZ1A 1UA6L 3OPZL 5I15H 5E1HB 5EU7C 1UKSA 3OZ9L 3BPOC 4PGBB 3MRMB 1KCLA 3BQUA 5T1LD 3UC0L 1JF1A 1A6AB 3HPJA 4J4PA 4HKXB 4TULH 3N85L 3WS3B 3FFDB 1LP9E 1NEUA 3DJ9A 3WFBH 3ELAT 4H88H 2HFEB 4QHLA 2Y72A 4JFPA 4XNUH 5KVGL 3D18A 2X1WL 5KSAB 3PHQB 3ARED 2EH8H 3TNMA 2C3GA 1QFUH 2XKSA 1D9KD 3VXSE 2UV3A 5D1ZC 1NUDA 4ZOBA 4M5ZH 1XEDA 2R2HA 3HLAB 4MNGB 1EHNA 3I6GA 4JO2H 3JTSA 1Z9MA 4X98B 4HX1A 5JLZB 3ZSTA 4TOYH 1UA6H 2ZUQB 1S9VB 1L7TL 1P7HL 1SY6A 4JRYA 1WIUA 4KVNL 5IB4B 1Q94A 2VERN 2CKBL 4OCXH 1MVUA 4H26B 1RJZA 5ERWB 3PWLB 3VDCA 3HNSL 4OGZA 4IRJC 4R97C 2ZOLB 3CDYA 5H35B 3QUMH 3NIFE 5C08D 4ZFGL 1OP5H 5IBTH 1UENA 4KTEL 3SDXA 3QFDB 1ES0A 2JKXA 1FH5L 3LZFL 3ISWA 2NXYC 3RHWF 4NN7C 1IAKA 3SN6N 5T5FH 5JHDA 4EIGB 1A9BA 4D94A 4KRPB 4DAGH 2UUDK 5GRVL 3M17B 1KCVL 3FOLA 3PP3K 5IUSA 3SDCD 3ZL4H 1FIGL 4R26H 1JP5A 3G6DL 1AXIB 4XB7A 4XNQB 4L3CB 2E9JA 3L6FA 2GJZB 5E08H 2R1WA 5HYJB 3H0TA 1BJ8A 5E6ZA 3FFCB 4RIRA 5IR1B 3UPRB 1L7IL 4X6DB 1U8LB 5EZIL 3VD3A 5LCVL 1ORQA 3TO4C 3HRZB 1FFOA 5DQJA 2A74B 5IHZB 2F54E 2BRQA 2EXWC 1F5WA 3QEHB 3PIQB 1QFWL 5HI3D 3QXAA 1WBYB 3BPNB 1OGAD 2ENSA 2X4UA 3VGDA 5CEZH 5GSRA 5IVNA 1A3RL 3MRLA 2XTJC 3CNKA 3H8NA 1MVFA 3UYOD 1EFXD 3MRMA 5F7YC 4HSQA 4L8DA 1YMMB 1WZMA 4XPTL 2VUOA 4GXUM 4JQVA 2FH6A 4XPGH 1S7VB 3VXMB 4LEOA 4YDIH 3RHWK 3D39E 2E6PA 5J6HA 3V6BR 3T0BA 4NO5A 5BJTB 4XBGB 4BJLA 2QADC 1G7JA 4GKOA 1QBBA 5IHZA 1WEJH 1CF8L 4JR9L 4EXPX 3E8UH 4FOMA 3O0RH 3RNKB 3QG7H 3DO7B 3UPRA 3WLWC 3NN8B 1IGIH 1JHLL 5GRYA 1P6FA 4DVRL 3PG2A 2Q8BH 4LKXA 4D9RE 43CAB 4OB5H 3FRPA 1RIHL 4P5MB 3WJLC 2VLME 1ED3A 3WSQH 4EDXA 4UTAH 2DQTL 3SJVA 1S9YB 5CZKA 5HYIA 2JIXA 5I1EH 3CVIL 5D7KD 4FZEL 3L3JA 2EDDA 3DX6A 1ZT1B 2V9RA 2Q6WB 4G6FD 3TBVB 3VFRA 3QI9A 4QT5B 5T1MB 1RJZB 4ZXBD 4I18C 1K4DA 1NAMH 3LS5L 1IM9D 1NBQA 4HIJA 2NY4D 3PP4H 3BFOA 4I48B 2RB8A 3H3PH 4LLUA 3L95A 4HKZB 4ZUSB 3QHFH 2YR3A 5JHDB 2JJSC 1N0XL 1NUFA 4JFFB 5GGUA 4F7EB 4Z8FL 1YY8A 1A1MA 4JQVC 1G6RA 5CJQH 1G84A 4PJAB 4WWKC 5FYKL 5K93A 1UGNA 4OI7A 5J1AA 2FGZA 1IAIH 3ARVA 4TQEL 5HD8C 1CE6B 1N2RB 3O2WL 3T3PE 2J3SA 3D25B 1C5BH 4FZ8L 2EYTA 3DETD 4KJYB 4G42A 4LSVH 2Z8VC 4JGJA 1CFQB 2P5WD 3QA3A 4XCYB 3VFPA 1YEGL 4Q2ZA 3D69A 1JHKH 1FDLL 4PJDA 2PTUA 5IW1B 3O3AA 1A7RH 3H2WA 1F6AB 2D7OA 2VL5A 1E28A 4YHZH 2LTQC 3O11B 5DVNA 4LPXA 1KN2L 4HX1B 5JLZA 1QSFD 1EVUA 2EEAA 3O3DB 3GO1L 4GG8A 5EIQA 5IBUG 5GS0L 4MX7B 2YSSB 3GSUB 4HWBH 4CL7A 2MPAL 1MIML 1GAFH 2MCPL 1YC8A 2IGFL 4AMKH 3U6RA 2G5BA 4QKXB 2ZUVA 1KIQA 3OB8A 2QQKL 5CZXC 1WT5C 2DQJL 2HT4C 4X7DC 4YGVA 3DXAE 3X13B 1NGYA 1U8PB 3I02A 3HPJB 1J11A 1F4WH 2GAZB 2IANE 2D0FA 2FJGB 2FZ3B 5T1DH 1EO7A 1JGDB 5FYJH 1S78C 1G1YA 1I3GH 3IDGB 2CO6B 3L3IA 1PD6A 3OAUL 2QSVA 4MNQD 3V79C 8FABB 5DD5L 3EYVB 2X4NB 4L4TA 3GM0A 1IZKA 5F9WC 1JPGB 2OSLA 5DO2D 5EC1B 1RZIB 2E8ZA 3REVA 3WUWG 3G5XA 5BW7A 1CFNB 2MSPA 5IQ7H 4OFIA 2FBJL 4RMUA 4AM0A 3V7MA 2B1AL 5I71C 5FM4A 3MFFA 2IH3A 4OCSL 2YXMA 2PW1A 3VH8G 1IM9A 4JPVH 2AEQH 5F21B 5JQ6L 3INUH 4ONOA 4OQ1A 5I1KH 1RQ5A 1XFPA 4XTRD 1V5JA 3BX7C 3Q48A 5H37G 5K9JL 5EU7E 4PIRF 4UOW0 3G9VA 4TPRH 1S9VA 3FOMA 3Q6FB 2HVJB 4HMDA 1CDHA 4WCYL 1KIQB 1W72A 3ZYJA 5T33L 3VXSA 5C7XH 5FGBC 3SDCB 1XGRB 1P5UA 4U1GB 3BPOB 4GRWE 2O26U 5DJAB 7FABH 1Z6JT 2DBLH 3BJ91 4KJWD 3V8CA 1LE5B 4IJ3B 5LWYL 1YEDA 3E6FB 3R0NA 1HHKB 3UJIL 5KZCB 5IB2B 1RJYA 1FZJA 2K1MA 5GGTA 4I3RL 5J3HD 2BDNL 4HUVA 2C1PB 5JZ7D 1KTKE 4PJ8A 4RWYH 3QUZA 5CGMA 3WS3A 3BISA 1F6LL 2NW3B 2YD5A 2VLLB 4PGDA 3TZVB 1HOCB 5CEYB 4AEFA 2BNQE 3HC4H 1F02I 3LH2H 4LQFH 5IHUH 3TBYA 4F7CA 1MY5A 5TQ2L 1RULL 1S7RB 4JFZH 1JWUB 5IHLB 1JPST 2CMRH 2VDKH 2BVTA 3BD5A 3B9KB 3EFDL 4P2RA 2OZ4L 3KJ6H 4XNZC 2KQNA 3BKCL 4R0LB 2A9MH 3L3DA 3P4OB 3QAZB 5C07B 3QPQD 3QRGH 2ED9A 4GMTL 4HXAL 3F58H 3MACL 5MEQA 3FT3B 4H8WC 4KVCH 4NQED 1WBZB 1FN4B 3KPQA 1SVCP 4MJIA 1OAXH 1JZ3A 1AR1D 2NY7L 1M05B 4AEIH 2DD8H 1CG9A 1FZOA 1CD8A 2R8SH 4X9HA 1U8QB 4XP4H 3DI2B 4Z7WF 3P9LA 4NN7B 4U6YB 4Z77A 3EYFB 2BVOB 3PV6B 4KK6D 1AR2A 3ZDZF 4NDMB 5HHOB 1T1YB 3V52L 3TT1H 1J0KA 5HD8D 2IFGA 4KC3B 2BNRA 2K7QA 1A1NB 3E3QE 1AO7D 4MLSA 3OKMA 4QEGA 3RFZC 4HJGA 3LMJL 5JUEH 2O93L 3GDBA 1HI6A 5DZOA 1G7LB 4Z7OE 4K23L 4NC1C 2DMKA 2ZOLA 4KTYA 5CJBA 3MV9E 3UO1L 4MJ4A 2X89A 1UEMA 2NLJA 5E2TL 2BK8A 5I8CB 3SHSA 4NN5C 5KSAD 4AEIL 3D39A 5CIPA 3LDBC 4JG1H 1S7XB 5GQBA 2BVOA 3PV6A 3PQYB 3C09C 3HE6D 1CXLA 3OR6B 3ZO0A 4HXAH 3VGEA 5CJ8A 5DFTA 4FNLL 3RI5F 5EBGA 3TYFB 1U58B 2UWEA 1MHEB 4JZNB 4QGTA 5TDPA 3STLA 3KYOB 1KELL 2VDLL 3MRNB 1RUML 1YDPA 1PEWA 1AQKH 4G6AC 4MJ6A 4NDMA 1IAOA 3H42L 3GBMH 5EU6A 1I8KA 1A6TA 4YIQB 3W0WE 1DFBL 1MAJA 1JGVH 1U2CA 1VFBB 2Y9RT 3RWIB 3VXUD 3D2UB 1OAZL 3UTTE 4YH6A 1Q9LA 3I50L 5KVDL 1MLCB 3QDGB 3VXME 2HTLD 4FQJH 1FE8L 4DK3A 1K4CB 5CILL 3SKUD 3W0WD 5C0RH 4HLJA 2D9CA 2B0SH 3NMEA 1DQTA 1HHJA 4PGEA 3DROA 3DX8A 4M1CC 4IRSC 4F33A 3MRFA 4Y88A 2WM0A 1PKQE 4PRNA 5L2JB 1HH9A 2H32B 4YDKL 5LVEA 2VXSH 3UJJH 2OX5A 3S5LA 1M1SA 3ZT7A 5JXED 5GSRB 3PQYD 2AGJL 4J2XA 2APXA 2WZPD 3S9DB 3DVFA 2HFTA 1Y0LB 1EO8H 2JCCB 3MLWH 2HKFH 5MI0C 1JRHL 1H3GA 5JXEC 4S11A 1JN6A 5CUSL 5IKCB 4KQ4L 3DX7B 5EZOL 4U1LB 5C0DB 2FR4B 1T7WA 4KRNA 4NNYA 4MJID 4P2OA 1QACA 1RZKL 4PPTA 1X44A 5T33H 2PW1B 1L9MA 4WCYH 4R6UA 3QWRD 1DBMH 4Z76B 5D71H 5JA9A 3HCVB 1FO0B 1HE7A 5SWSB 5DMKB 2IEPA 3PE9A 1NC2B 4HIEA 4I77H 2OK0H 5D7LA 5E4EB 2J4WL 3JV6A 2C3XA 4P2OC 4HJGB 5T1KB 3RUGF 5HHQB 3KLSA 3GBNL 3QI9B 3VFTB 2CGRH 5EO0A 4X99A 2H6PB 4WI3A 4GBXD 4X8JA 3AS0A 3V8OA 4LVOB 1A7OH 4QTHA 4QO1A 3LKOB 4WGVB 4GT7A 2VC2L 2GTWA 5FYLE 4Y8DC 3P77A 4GRLD 5IM7A 2XRAH 4HKZA 5ADOL 4OV6F 5GGQL 1BQSA 1KGCE 3HN3A 4ONFH 2I5YL 1HZHH 1I1AA 1DFBH 1F3DH 4YHNB 4PJGF 4XWGL 2AERT 3LQZB 2D7TL 1GGUA 3FB8A 4OGAC 3HCVA 1J88A 4AZ8A 5DQDH 1IAII 4FXLA 4K7FB 4UV7L 3JWNC 3QQ9D 3P11L 5I1LA 3DRQA 5TF0A 4FNLH 4Y5VA 2G75B 1M6OA 1YPZB 3KLAA 1FRGH 4C54A 4F7TB 5DHXB 4L8CA 1UZ6F 3SDYL 3WFDH 5GJSL 12E8L 1DZBA 2VMFA 3DXAA 1I9JH 4NM8H 1IC7H 2N7BA 4ZAKB 3GGWB 1F90L 1UB5A 3P2TA 3C9NB 4YHKH 2Q3AA 1TETH 4HEME 4FG6D 4KI5F 4EI5A 4EQ2A 1LK3H 2X2YA 3QIWC 3CXDH 5FV1L 3WXVH 3O4OB 3ZKQD 4OF5A 1YDPB 2EDKA 3FHAA 3D85B 1HHJB 4PGEB 5D8JL 3D25A 1GZQA 4NQCE 1Z3GH 2JCCF 4PRPA 4R7NB 5DD0L 3VU2A 5FGBA 3AS3A 4DCQA 3UDWC 5C6TL 2VLKA 4GAYA 3ETBF 4P2QB 4V1DB 3QO1A 3V52H 1CGYA 5F1SA 2PKDA 3IU3B 1V05A 4IMLA 3UPCA 4D3CH 1MI5D 3EO1A 4YBHA 4QRSB 4O2CA 3AM8A 1JK8A 2BCKA 4QOKB 2GFBA 3MJ6A 5CZVL 4E41D 4NQDB 3D0LA 2VLMD 2GSGB 5TGBA 5A16B 1GGCH 1Z0MA 3QRGL 4FQ1L 2IAMC 5FHBL 3QFJE 1BOYA 1TJHH 2YUWA 4N0CC 2GW5A 1XIWC 5C9JA 2I07B 5FYJU 3R1GH 4OD1H 4XNMA 4G80B 2YRPA 4AT6A 3C8KA 4ODTL 3WO4C 1E4XI 3HB3D 4LAQL 2XTJD 3U48A 5ANME 4JFZL 3CGTA 1JL8A 3LOWA 5JZ7C 3Q5TA 3CH8A 4HH9A 1P7QB 5E4IA 2DQFA 4W6XB 1FGNH 1TPXB 1OD7A 5IM7B 1X9QA 2H3NA 3HAEG 4NSKA 2VZTA 5BQ7A 1OTTC 1PX4A 1BBDH 2W9EH 2BNQA 1T5WA 2VDRH 5SWSE 3TO4D 4P3WA 1DBAL 1EJOL 4OAWB 4WTZG 4PJCA 1Q0YH 5B3JF 4XXCA 4EDWL 3MOAH 5JPNB 4JJHA 4Y2DA 2IBZY 4NQDD 1S7SA 4BSWA 4CU6A 3L3OA 1IQWH 2D03L 4PLJD 4RA0C 2X4SA 1IGIL 1TTFA 2OTWA 3DUUA 4P2RE 1JTOA 1QVOB 4Y4KA 5C09E 1CFVL 3VWJA 2Q87A 4OCYH 4P2YA 5TGBB 5L88L 1J9CT 1KEML 4ZS6D 5EU4A 2VZ1A 2YRZA 3B8YA 4KKBD 4P5TB 1UACH 4MD4A 2GT9B 5CD3B 4OZHA 2X41A 4MJIE 4F33B 3OJ2C 3ZDZE 4ZS6C 3RAJH 2NXYD 1X4XA 4GW1B 2R39A 4Q9BA 2IPKB 2WBJB 5D7JA 3WBDA 3L5XH 1JWMA 1IEAB 1KEGL 5I1KL 3D85A 3CXHK 5E2WH 5ALCL 5MEPB 1I7RA 1YYLL 4FQXB 4XT1C 4PRPB 4I3SH 1YY9D 1QEWB 3PXHA 1F13A 1MCHA 4CUCA 4JJ5A 1J1PH 2P47B 4NHCH 1ZVSB 4LLVB 5IG7B 1N6QL 4RCAA 5HYSB 4JAMB 1QR1B 1KOAA 5E8PA 2FX9H 4Z7QF 3TNNB 2J5LC 3N1MC 2C1OB 2EIZB 5MHSE 2FB4L 5DJXA 3NZ8A 4YHML 1NBZB 3BDYH 2QQNL 1J87A 3T4AA 1DLFL 2AV7A 4OIAA 4JFFA 5C6WH 4O58L 4YNYB 2MJWA 3V0WL 3M1BB 1QLEL 4NOBA 2LFGA 3MRKB 3RY4A 3IB4A 1MNUL 2NY3B 5FO7B 4K8RC 3MV7E 2R56H 4QRRD 1G7QA 4MAYB 3TA3A 2IADA 3G5ZB 2BRRH 2DL2A 3U0TB 1GAFL 4LSSH 3Q6FA 5J8OA 3RRQA 4GOSA 2FBOJ 3L5WA 5I1DB 4IRZH 2DJ4A 1FG2B 5F44A 3ILPA 3VFUA 3MLYH 5FF6A 2AXGB 4AENA 1P4IH 5CP7B 2AS5M 4GKSA 3MGAA 4J23A 4LPTA 3AM8C 3HMWL 3TA3D 2FHCA 4JCLA 5KW9H 2OTUA 1CGVA 2XKNA 3QDJD 4XAWH 5FA3A 5HGBB 4HWBA 1DCLA 5KOMC 4CDHA 5KAQF 4JFHE 4NRYB 2VZUA 3KDMB 4PJEA 4FZ8H 4HCRA 1P4LA 4Z76A 1U41A 1VFOA 3DVNB 1YNKH 4IHOA 4OZFH 1CU4L 4QHUB 2ZG1A 3ULVD 2E7MA 1Y18B 1KJVB 2NY0D 4F8TA 4M8QB 3IXAB 3MFGB 4HV8A 1YY9C 1MH5A 3IDGA 5T3XE 1LO0H 2B1HL 2ESVD 1OP3K 1CI5A 4NKOB 1GIGH 1ZLUK 1F2QA 3RZCC 1YNLL 2AJVL 4CMMB 3RGVB 4K94L 1J18A 2DQUL 4XZUA 5HGHA 4BFBD 3C2AL 3B6SB 4LSRL 4R96B 1MLCA 4V2BA 1HQRA 2M26A 1DJSA 5H37H 4PD4J 1CD1B 4FQIH 3MPCA 1CLYH 5GIRA 3N85H 1QSFA 5GGVY 5BRZB 2XN9B 5IQ9A 4ISVB 5MI0B 4G5ZH 4GW1A 3ZE2F 4BH8B 3SDDA 5FO8B 4OUUA 4E5XB 3ZDXF 3T4YB 2JJUA 3OPZH 5I15L 4WW2F 4KUZL 3WE6B 5HSFA 3F7PC 1CVRA 4NCC1 3T0AA 2YSSA 4ZPTA 5F9AC 3WNLA 5IEKA 4TTDD 3PHQA 2Z91A 4NFBA 1R3LB 1QOKA 4P9HC 3V4UH 3V4UL 4ZFZA 4YQXH 1P84J 2HFFA 5FB8B 3ZE1E 3MA9H 2DQEH 3S88L 3E6FA 4UMGA 1WZLA 3BP6B 4TVPL 2V17H 5CD5C 4NO2B 4DJMA 1MCPL 1TJIH 3LEXA 1MOEA 1QLFA 1U8HA 3GMLB 5ABDE 3MRHA 4OFKA 8CGTA 4HG4K 3VA2C 5E8EA 3DYMA 4YBLB 5D6DC 2VN4A 1N6UA 3NGBB 3T1FB 3VGBA 3MUHL 1OWRM 1MCWW 5ADPH 3C2AH 4LSRH 5C0ND 4U0QB 3DHJA 2NYYC 4JKLA 3MRKA 5D1QA 4JFXB 1CLYL 2C3WA 4DVBB 4ZOAA 1WCBA 5CHNB 5JR1L 4R2GB 3H9ZA 3NFSL 5FF6B 5CEZL 2VJXA 2ILLA 4P3CH 2CUIA 2ZSVA 5DJDA 4IDLA 2IBBA 3KAAA 4ZPTB 4NO0D 3IS1X 3V6OE 2AJ3A 3AFLA 5BXFA 1RZIA 3KLHD 4JDTL 1H8SA 5DJ8B 4BQ9A 1OCWH 3ZT6A 1MPAH 3VXOB 5MEQB 2HT2C 1J0YA 3KNBB 1KPUB 4Y5XA 2W59A 5E8EB 3DLQR 4YHPB 6FABH 25C8H 3I3DA 3QH3A 4KUCD 5FUCC 2OR8A 1IILE 2WINA 3I6LE 3O4OC 4XAWL 5IFHL 2X09A 1E6JH 3WHXA 4XPAL 5AD0A 3S37H 2DKUA 1IAIM 2Y5TB 1YYMH 1JZ4A 1DQLH 5GRXG 1XGTB 5FUZL 1DQJA 1LEIA 5E8PB 3MXVL 4QHLB 4HS8L 4NFCA 3TBTB 1Y18A 4WUKH 4N8VB 2CPCA 5DEGB 3H7BA 1QFHA 4ZMAT 4IRJD 2ICEB 5AYUH 4LSSL 3PWVA 4HS8H 3QUXB 4K2UH 3VGAC 4MVBC 4WFED 2ZUSA 4G6KL 2NY2B 3OKDA 1MCEA 2V7NA 1AI1H 4HK0B 4ESKA 1VERA 1T3FB 3QEHA 4N90E 3S37L 5BRZA 5C0CE 5HHVL 1MRDL 3H3KA 4UIKH 2FIRT 5B38B 2OTPA 1U6AL 2V2XB 3RKPA 4F9PC 1TVBA 3MZTA 1JYVA 4KV5E 1MF2H 1YQVL 3B83A 3K1KC 2Y23A 3GRWA 1MNUH 3BDYL 5CP3H 2MCG1 1A6WL 1F97A 1KT2A 1A3LH 2C4XA 1BIIA 2FB4H 4PJDE 2AXGA 5F9DC 1PW3A 3STLB 3CLFL 4P2CG 5C9KA 4X99B 3CZFB 4UQ2B 4ODSL 3CMOH 3AREC 3OXSB 3NPSC 3MCKB 3FTGB 1ACZA 4X9FA 5EOQL 5I8EB 3IKCA 5AWNL 4PJFB 1A47A 2FX9L 3WN5B 1QFUL 1KJMA 2NNAA 3MV8B 4UILH 4MXQC 1A7PH 5ALCH 2O5ZH 1J1PL 1P4LB 4XNUL 1FSKC 1P84K 5I2IB 4X6CA 3ZHKA 1IAKB 5T3XD 4HDIB 3E2HC 4IOFD 4H88L 1U3HA 1EUUA 4S10A 1LNUB 1NCDL 3N9GH 4K9EH 4WO4D 3X14B 1D5XB 3T0DA 3OZ9H 4JY5H 2IWGA 3L5XL 4MA8H 4DEPC 2KL6A 4K8RL 1EXUB 2UYLB 3MRGB 3G6JE 3EUUA 4KKCC 3EYQC 5C0FA 4G8EB 2IG2L 4HS3A 5EOCJ 3M45A 5J0BA 4NPYB 3BGMB 5BS0D 3O6FC 1U42A 1GGBL 2I26N 3QDJE 4RRPG 1O7SA 1ZLSL 1NGYB 3U4EB 1Q0YL 5TFSH 5IBUB 5EZLB 5IR1A 1C5CL 1SYVB 2XXCB 15C8L 3ZDYF 4KAQH 1BREA 2AXJA 4JFFE 3KPLA 5D7JB 3ZYIA 4BQCA 1WISA 4ZYKB 1JGUH 3MOAL 2P8LB 4EDWH 4HUWB 4R3SA 3VD7A 1XH3B 2FJHB 2A1WL 1J05B 2FGWL 1ND0A 1FLRL 4KJYA 1LK2A 4P46A 5JA8B 1AQDA 2IALA 1BJ1J 2HVKB 5CSZA 3A6CH 4XGZA 1PJ9A 3GZKA 1UQSA 2OYPA 3VXPA 3TIDA 3JWOL 5DHYA 1OF2B 3FL7A 5TE4H 2DQUH 5A2IH 3CIQA 3KR3H 3L3HB 1ZVSA 4LLVA 5HDQH 1FO0L 5B21A 1A5FL 1T89C 5E8DH 3QUXA 3QDMD 1WF5A 2YPVH 1B0WA 3T0XA 5ILTL 4C4KO 4G8FB 2LVCA 4ODTH 1F42A 4GG8B 1QUNA 5MHSD 5IB5A 4O2EA 2DMCA 5DO2C 2GSIA 3BKYL 4FQ2H 1YNKL 1ZA6A 2EDHA 4O9HH 1GVIA 4KFZC 1JPSH 1NDMA 4Y16C 1A6AA 3O45A 1D5IL 1F3RB 1IT9L 4M3KB 1ORQB 3HI6H 3PABB 4ONGH 4XPHL 4FP8H 5ESVB 1A9BB 1QRND 2I24N 4JN1H 4NBYB 5EA0L 2GJZA 2X4QB 4YHOL 2DLEA 1ZLUH 4UBDD 4X4XA 3AY4C 3O6FA 3FRUB 3NVQA 4X6BB 1NCWL 2XWBA 2GJ6B 2VQ1B 3MV8D 1Z0NA 5CCKL 4XCNB 1RUPH 4Y1AE 3HTLX 4HZAA 4LARH 2QHRL 1OM3H 3BEVA 1RURH 5C0CD 4Y2DB 4Z6AT 3M1BA 1H3TA 2WV3A 2IH1A 1KFAH 2IQAB 2AXFA 3E0GA 3FQXB 4XC3H 3TT3H 2KUTA 3RVXC 1EUTA 4HQQH 4KWUA 1WT5A 1F3DJ 4KPHH 4P2QD 4V1DD 3O6ML 3T0WA 1IL1A 5HVFB 4KK8D 4J7RA 5E56A 2WWMC 1T03L 1F3JB 1HSAB 4RMVA 3TO2A 4YHKL 1CCZA 4OFDA 1K85A 3LQAL 3KYNB 4O58H 1IC7L 2NY1B 3MRDA 3T2OA 4KDTC 4CGTA 4HD9A 1KXTB 4LGRB 1KBGH 4TVPE 2CH8A 5C0CB 4FTVE 5HGDA 3TVMB 2DQGH 5BCAA 3C08L 4X5XA 1FFRA 2Q86B 5EDXA 1OT2A 4FFVD 3DMMA 2PTVA 3A6OA 4XMLL 4OZGF 3MLVL 3RNKA 3WIFA 3W9DB 2UUDH 2ATKA 3EOBB 5IOPB 2D7TH 1W8NA 2GSGA 2HJKA 1S7QB 5I8KL 3DO3A 1HZHL 1LEGA 1A6ZB 5TE6L 4PB0H 1HQRB 4E42B 3Q2CA 2G5RA 5GGQH 3RWFB 3B9VA 1KIPA 3QNYB 5TQ0L 1Z2KA 1Q72H 4WHCA 1UM6L 1S8DA 3TPKA 2P8MA 4RGNC 2GK0A 3HAEA 1TMCB 4XXCC 1MJ7L 3LDBB 1BQLL 3UAJC 3MNWB 2K9UA 1ZHBA 4LCCA 1UJ3B 4MHHG 5C0BA 1PEZA 1D3CA 3QDMB 3L5HA 1JNHB 5INDB 1XF1A 1YEDB 5EO1A 3C60B 4PJXF 5FYJD 4JY4A 1JYWA 5EU6E 1AP2A 4PP2A 3B3IB 1LMKA 4DZBA 5D71L 5EBLA 1F4YL 5GRUL 2YPLE 3S35L 5IB1A 2XQYG 1PY4A 3F5WB 4AYFA 5B39B 1XR8B 3ARFC 1ZT4B 4G7VH 2ED8A 3UTTA 2VLRE 5EU4B 4NNPH 2X4UB 2XZAL 3ARUA 3TYFA 5LXGL 4LLMA 3OB0H 1G6RL 1FFPA 3DUUB 1MI5A 4YHYB 2XWBB 2SEBB 3D3VB 3KWWB 5JPMB 1PKQA 2B0SL 1F58H 2QJDA 1JNNH 1CE1L 1NC4B 2RFXB 2IH3B 3MBED 1QP1A 4HK3J 2YZ8A 3I84A 1XF2B 4U6YA 4Z77B 4ODBD 1RD6A 3HAEH 1S78D 3V95A 1FNSL 5D1QB 2DQHH 4OZFA 5FHAL 3F8UB 5C0RL 3VD4A 4NZUH 2QR0A 4QXWA 5BZWA 1GGIL 4HGWA 1BWWA 2GJ6A 1HK6A 4OD1L 1VADA 1T5XA 3UTTB 1DLHB 3QP3A 1TJHL 3BQUD 3OAZH 1HINH 4L1HA 3TLRA 3RA7L 1BEYH 1WGOA 1YEEH 3G5YA 4XWOD 4HKBA 2GKIA 4NNPL 2A6KA 4XPBL 4JZJA 1GHFL 2X4RA 4L5FH 1HXMB 5I8OL 5GRUH 2BOBB 1F4YH 2PO6D 1PLGL 3VXUB 3PWJA 4IRJA 3EDFA 4FQLH 1N7MH 2YA2A 4ZD3H 1WAAA 1YEJL 3U6RB 2Z35A 2W38A 1ZXQA 5FGSA 3HLAA 5CINL 4NBXB 1U8IA 2YD1A 2X70A 2ZCHL 4TSCH 5DZLA 4Z0XA 3QI9C 2CLZB 3TN0B 1MRCH 4WI4A 2AK4E 2ESVA 1W72H 5FKAA 4NWTL 1OP5K 4HWNA 2BSTB 4OFPA 4Y0GA 5BMFL 4MA1B 3ZKMD 1G7IA 1JFQH 4Z95H 2FDBP 4JDVA 1HYRC 4YX2H 4YHLL 5E4EC 1OAUL 1MQ8A 5L7XH 4MAUL 1CD0A 1PBYA 3WDJA 1CS6A 4LPWA 3LN9A 1HXMA 3PQYA 1FNEB 4NZRL 3MO1A 3FB6A 1G6RB 4X6CE 4MJ6B 3U9PH 4M7LL 1A8JH 1B0GA 1INQB 4M5YH 3NAAL 1OP9A 4NWTH 4WVRA 4I0PB 3T2PA 3C08H 2B8OT 2X70B 4I3GA 4KVCL 5D2NC 1SYVA 1C08B 3MLPA 2ZCKH 3F58L 3VD9A 4QRTA 1EAPB 4B7IA 1DN2A 1U8KB 5J6GA 1II4E 3QDJB 5DVMA 5DQDL 2PO6B 4PV9B 1Q9KB 3LQAH 2F53D 2LTQB 3QRFM 5BV7C 3RWEB 3TPUB 2CLZA 2ZPKL 4L5FL 3ULVC 3MACH 5E6IB 1XAUA 1WCBB 5FAAA 3MC0A 4PRPE 3TBWA 5ESAB 2RHEA 3STZB 5TQ2H 1AGCB 3UTOA 2NY5H 1VKXB 2VLKE 3LB6D 4QXUH 1ZA3A 2NZIA 5JIKA 3OKEB 1CD9B 1XR9B 4LPCA 4PJFE 3GMOA 3ES6A 1YEIH 1CFBA 5DRZA 4XVTL 4LARL 2NW2A 3UTZA 4QRRB 1NEZB 4LCWA 4WRLA 1AE6L 1IGJB 4UU9A 1MHCB 4PTUA 4PS4H 1U93A 3MQIA 2J4WH 3WEXA 5IMMB 4J8RA 4UDUB 4J3OC 4HHAB 4NZTL 1S7UB 5GGSA 5EA0H 1CE1H 2PF6A 2QR0B 5DUBA 3MJ8A 3MJ9H 4HIEB 4RWYL 4BSVA 3SGEH 2AJUL 1IKFL 1C08A 1MHPL 5I2IA 1ZANH 5MENB 1OY3B 1UCBL 1JK8B 4H1LA 4XCEB 1KV3A 4N1HB 2ITCB 4KQ4H 3GSNB 5F9WB 1RUAH 2A6DB 2DTMH 2X9XA 2Q20A 4G7VL 3QNYA 4JLRA 3RUGE 4GXVH 2CDGA 2Z8WC 1BVKA 3VFNA 1BOGB 2BNUA 4G43A 2AGJH 1Q0XL 3VXRD 4LLYB 3MSPA 1A5FH 1FZOB 1BBJA 1K5NA 1KIRB 4LEOB 5C09D 3VMPA 1Z9LA 1WFOA 4EUPH 1QFOA 3QXUA 1AJ7L 3OKOB 4JKPH 2NTSP 4PJCE 5CILH 4TSAH 1T1ZB 4OZIE 2HKHH 5D1ZA 3INUL 3UTPE 2AEQL 3TN0A 4M7JH 5FIEA 4MWFA 3LEYL 3QCUH 3H9SB 4RQQA 5HHOE 2Y6SC 3ULSB 3BHBA 2PYED 1ZVHA 4JLRB 3NA9L 1LE5A 2X4PA 1RUMH 4HUUB 4NQSA 3U83A 2VH5H 1SM3H 2FJFA 3JTTB 3KYMB 1HOCA 5CEYA 3U9UA 4ZXBA 3L6FB 4OZHF 1R3HA 1UYWL 3NFPA 2ZUXA 4Z7VB 5BS0B 4PRAA 3PNWB 4I48A 2DQGL 4NC0B 1S7QA 1CICA 2BVPA 4LLWA 4PY7B 2ZUUA 4JG1L 5CAYB 2V6HA 2IGFH 4G8GD 4LLYA 4P0DA 3Q3GA 3J8F7 5E2TH 1MCOH 5E2UL 4KJQD 3EOYG 1N5AA 5LGHL 4KRPD 3D48R 4ZO8A 5LGKA 5E6IA 2DB8A 4PLJC 5TF1L 3FT4B 4DTGL 2YWZA 1ZAGA 2L7UA 1EEYB 3IFNH 4UU9B 2NY3D 2NQCA 3IETB 4OM0L 1ZSDA 3CAFA 2XOTA 2CIKA 2Y6SD 3OTTA 5ESAA 1UG9A 2EDLA 2O5YL 4PRID 4P3DB 4XHJD 1NCCH 3RPIA 1X5KA 2UWEF 1HYSC 2E9WA 2CSPA 2HT4D 4BK4A 1NCWH 3RWGB 1DBJL 5IMLA 5C8JA 4ODSH 3NIGE 4Z9KB 4NYLB 1LO4H 2IPUK 3MV7A 3V2AR 4BQ8A 3HB3C 3MR9A 1EVTC 2VZVA 3GSOA 4ODVL 3KG5A 5JQHC 4MB5A 3OF6D 4Q9RH 2EDFA 4Z78A 1K6QL 2OI9C 1AQDB 4AEEA 1HH6A 5EUOF 1E6OH 3WJJA 4ODUA 4X8XA 3RY6A 2EXYC 5DD1H 1FNEA 1DE4A 3CFKA 3L3HA 4S1RH 3C9NA 1VEOA 4G6KH 3TN0D 3UCRA 2OXGA 4JM4H 1G7PB 2AJZB 4X7CC 2OXHA 5LAXA 4Y19D 1ZHLB 4Y89A 3REWA 4PLNC 1JGLH 5HDQL 2A83A 3BIKB 4U1KA 4P23D 1QFPA 4PY8I 4G6MH 1J0JA 1KGCD 3VXQB 3CVIH 5I1AA 4C58B 2O5XL 5FYLD 1MCQA 3H9SD 3TZVC 4P4KD 4Y4KC 2GT9A 2X4OB 4K7PY 1P1ZA 1Q1JH 2IF7A 2ZKHH 4PTTB 3IKKA 4Q74A 2F58H 1ZWIA 2KPNA 4Y4FC 4FZEH 2XQYK 4FFWD 4GW4B 1CE6A 1VDGA 3ULUH 1W0VA 15C8H 3ULVF 5JXAL 2NY5C 4DUXA 5ISZE 1BVLA 3LN5B 2H9GA 1EHAA 3VXRE 4DKEH 2QQQA 3EDJA 2Q8BL 3GB7A 4KI5E 3T8XB 43C9A 4G8EA 3CVHB 3DSFH 4F37F 1QRNA 2EYTB 2R0ZL 5D7SH 5IFAL 4HV8B 1QSFE 3GHEH 2ADGA 3SDXB 4WJ5A 1B88A 1XF3A 4YHNA 2D9QB 3F12A 4N9OB 3HC3H 1HSAA 4K71B 4PJIB 3MCKA 3P9MA 4ORGB 3QG6A 2LVEA 3X11B 1NCDH 5EO9A 4XMKH 2M8XA 4RFEB 3L3GB 3ARBB 4Y4KD 3K4DA 2R4SH 5J89A 2RBLA 1B6UA 4Y8AA 4KRMB 2O5ZL 1QFWH 3EJZC 1G9MH 3SKMA 1TJIL 3VXMD 1DQDL 3MLZH 4PJGE 1NSNL 4GW4A 3MROB 3DURA 3PGFH 4CVWA 3B8SA 3FN9A 5HI4D 3VXUE 1IGML 2BHYA 3AB0B 5I1DA 4QY8B 4U1IA 5I30L 1A9EB 3LSOB 3G6DH 4X9BA 5D1ZB 3Q5OA 2P45B 5TE7H 5LQBL 4GBXB 3C5JA 1S7RA 2VWEC 1MQKH 1H3WM 1G7PA 2AJZA 2W92A 1KXVC 1MWAB 4R26L 2MCPH 4L9LA 2A9NL 3HNVL 2QSCH 3PWPD 1MIMH 4W6YB 5D2NE 1DE4B 3T77B 3ZTJG 1F4XL 3UYRL 5EZJA 3PDGA 2DQCH 4X9IA 5B3JE 2CJUH 1RY7B 5TDOA 1A7RL 3VWKA 4QTIH 1YNLH 4WWID 4JAMA 1TVDA 4PJ5D 3O11A 3LKQB 3AREB 2FIKA 4ZUUA 5IB2A 1LO0L 4I0CC 3CX5K 2ZOKB 1QPPA 4WENB 2G75A 4Y4HD 1TJGH 2EE3A 2ITDB 4QLRA 4XCCL 3MGOB 1XGRA 2VLLA 4ZSOB 1IAIL 4KJQC 3QCTL 4KZEL 25C8L 4L9LB 1AKJD 3WO3B 4X5LA 2CLRB 3WS6C 1RFDH 4JKKA 1IGCH 3DSNA 4FTVB 3MRDB 5CGTA 1MPAL 1V8HA 4QYOA 3OAZK 1AO7A 4YO0B 3VFGL 5JMRA 2APWA 5DC9B 1MFNA 1N3NA 2X89D 1XT5A 3O81A 4TOYL 2E6QA 3QXDB 2DAVA 4PJHF 4JO3H 4WDIA 1NCUA 3H3PL 1QRNB 2DS4A 3PP4L 2CXGA 4G9DB 5JIIA 1GPOL 1EFQA 2VISB 1GYAA 1F4XH 4CMHB 1PG7H 3AROA 1OQOA 2GJJA 5DMYA 5H2BB 4XAKD 2X4NA 4L4TB 3FRUA 3D0LB 3UC0H 1PZUB 2X9YA 3SOBL 2A9NH 4MJIB 4YDVB 1MCBA 2GK2A 2R4RH 3TIEA 2JB5L 5ACZA 4OFYD 3O6KL 3TJEH 1ACYL 3RDTC 3PDOB 3RIFF 5FDYA 1XZ0B 2EKJA 5D93C 2BVYA 1NGWA 3IDNB 2NR6D 5HHOA 4AQOA 3ES6B 5HPMA 2APBA 4PJ7A 1I8MB 4LMQE 5ESQB 3PJSB 1JHLH 3ABZA 3CLEL 1IM3A 4QXTA 5IVXF 3MA9L 4FFVC 5KSVB 3AXLA 5LGJA 2WMPA 4QCIA 4DUVA 3DTXA 3HS0A 4HEPG 3P9LB 1A14H 3DX8B 4N9GA 5K9OB 1N6QH 1JRHI 4W70A 4J6RL 4XMPH 3G6JF 4NHUB 4OZIB 2NY2D 4Y16A 3RWDB 1G9EA 1PSKL 1JI2A 1W8OA 3LKRA 4MCYA 4JFPB 1P7KB 4QWWC 4JM2A 4WEUD 2DDQH 4JZOA 1JZ8A 3HC3L 3U0PA 5FOBB 1CQYA 3MJ7B 2EIBA 4NQEB 3MV7B 5GXBB 1AFVL 1GZPA 4WI7A 5I9QB 3DGGA 1NH6A 4U6TA 3K80A 3QUYC 5DXWA 3V6FB 4GKNA 5I75B 1FNFA 3PL6A 4L8BA 3X14A 3ZTNL 4P5TD 4APQA 3BIBX 4HFUH 4LCIH 3SO5A 4DOHB 5AD0B 2RCSH 1ZVYA 4OCYL 1CFVH 5EORL 5HDLA 2RCSL 3B2VH 5D7JC 5E08L 1IQWL 2D03H 1CU4H 4YIQA 4HFUL 3BH9A 3PXJA 5CP7A 3WDIA 4Z7VE 1SJXA 1RK1A 5HHXL 4FTVD 4OQTH 2F58L 4KRLB 4TNVK 5EZLA 1DBAH 5I17A 1NLDH 5F93C 1S5IL 5I6XB 4MD5A 2VDRL 5HGBA 4EN3B 2VDML 3D5OF 3SKOB 4KKNA 5HGGS 2FYYA 2HLFC 1J0IA 4JHAL 1BWMA 3ZDXE 4GRLB 1CBVH 1NJ9B 1X7QB 2YWYA 4L3AA 2V5RA 4W68A 1P7QD 1QFWI 2V9QA 4JFOA 3U46A 1SJEA 5JPMA 2FH8A 3HE6B 3KXFD 4YJZL 4P9MH 5H94B 3DIFA 1K8IA 5I71B 5DHVA 3SE4A 2WSKA 5C0EA 1UKQA 3D6GA 1A14L 1J0HA 1I1FB 3KPTA 4OFYA 2BRRL 3TV3L 2FX7H 3MV8E 4POZD 4YK4B 5I66A 1EEYA 3PWUB 4MDIB 4M48H 2I9TA 3CVHA 4MAYC 4CVZB 3PHSA 3CLEH 3UAJD 4UQ3B 4KK9C 3IKCB 4GAFB 1LDPL 2Y07L 5DJZB 3QPXL 3K74B 5FM5M 1C8PA 1T66D 3UJTH 5J6HB 5HYJE 1M7IB 3VXRA 2X4TB 4IJ3C 1R3LA 4Y16B 2D4FA 1XF5A 5EFIA 2BOCA 4BSJA 1PDKA 2OR9L 1V3LA 1Z3GL 4G9FE 4PB9H 4WW2A 5FK9B 1CGWA 5IESL 5HVWA 3C60C 1UFUA 4TVSa 5ICXA 4UAOB 1FJ1A 3QEQE 5CWSA 3F7VB 1ZLWK 3CSGA 1PG7W 4JANA 4RX4A 1FVCB 4LFHD 5ITFB 3KPPA 4YAQA 4KI5C 1UB6A 2OJZH 1T3FA 3AMKA 3T1WA 4WFHE 3CFEA 1OTSD 3L5IA 2XG5A 5IVOA 5CP3A 4F7TA 4L8CB 2YPLD 5MEOB 4YBQD 3QHZL 3OG4B 1F45A 3LSOA 2BSTA 1MWAL 3DRQB 3WFDL 3SDYH 4PJ5A 3L3KA 2LAGB 4J8RB 4UDUA 5DT1H 3T0EE 4YBQC 1KLUB 5DI8A 5E7BA 3MNZA 4KZEH 3RL2A 3K8KA 3OKYA 5IMOB 1T6VN 2DQFB 1BP3B 3GJFA 4CVXA 1WBXA 2N7AA 5F96H 2DI9A 3GEWB 4X5XB 1HHKA 1NPUA 3MGTB 1QQDA 2N4IA 1T5WB 1UM5L 4U1GC 3FO2A 4WWKD 3KPNA 2VC2H 4HFWA 4N0UA 1OARL 2FX8H 1MCDA 1D5BA 3MMEA 3T2NH 3I3EA 4QRRE 1S7SB 5D96B 4YXKH 3K8LA 1AGCA 1U3HB 3PGCB 2ZG2A 5C0EB 4DKDC 4KK9D 1T22A 3S36X 1MCFA 3T08A 3ALPA 3WUWB 2VDQH 4LCWB 3RL1B 4WUUB 1QLFB 1U8HB 4U31A 4XP5L 4F57L 5J7CC 2VUYA 4YPJA 4OF8A 4ORGA 4P2RB 1RK0A 5HHNB 1HXYA 1LHZA 4Y5YA 5FHBH 4D0DB 2BVEA 3ULSA 4M61A 5FECB 4LSQL 5GPRA 1GGCL 1FC2D 5T3XL 5BV7L 2HKFL 1RZ7L 4NQDA 4PYHA 3TGXA 2AJUH 1FC1A 4E41B 2H32A 3LIZH 3MGTA 3PGFL 4EDXB 3HI1B 5TH2A 1NLBL 3NTCH 1DQDH 4LOUC 3RGVC 3MXWL 4U05A 4NKIH 4HBCL 5IF0A 1VSCA 2RIKA 4RZCB 2AQ2A 2AEWA 4DGIH 4P23A 1EGJH 5C6TH 3QIUB 1DVFC 5HHMB 3DMMB 4YHIA 1H0DA 1QTYT 4GG6F 5EC2B 3OGCB 4HS6A 5FEBA 3TVMA 3HRZA 4NN6B 2NY5L 1SMOA 4M02A 4APQC 1WFUA 4NQTA 2PO6C 3VXNB 4NO0B 3I3BA 4ZFOL 4H0IA 2C26A 5IFAH 2BY3A 5EOTA 5KJRL 4P46C 1C7TA 1P4BH 2WBKA 2D2OA 4BSWB 1BZ7B 1F8TL 4X5WB 4NRXA 4YXLH 3FAWA 5HHMD 1L0YA 1T7XA 4APQD 3BE1L 1C7SA 1DSFH 1MIEL 4PG9B 3SE8H 4JFOB 2XFXB 1V3JA 3EZ8A 1DUYA 1ZTXL 1FBIL 2LAAA 4MA1C 3BRGC 2RAMA 1IC5L 3C5SB 2Z35B 1VACB 4H8WH 4D9LH 1FV1B 5GISL 3JV6B 4MAYD 2R2BA 4X7FC 1QA9B 2H2PC 2O5XH 1IBGL 3BH8A 5FYLH 4H1LG 4YX2L 4MXVF 2B7DT 3MLUL 2BXYA 1C16A 2GEEA 1W0WB 3OKLA 4X4ME 4M9OA 1BX2B 1BFOA 5D1XB 4X5WA 1I1AB 3MODH 3Q3GB 3EGSA 1T2QL 4R2GD 5DQ9B 4MXWH 3BZFB 1FFPB 3GBNH 4HH9B 3TT1L 3LS4H 4S1RL 4E41E 5HVHC 5DD1L 3JVGC 2W91A 4NOFA 1JYXA 1NC2D 3VWKC 1YEJH 2UZYB 2HLFD 2R8SL 3P0YL 1Z9SA 3DARA 1QYGH 2HRPH 4ZFFA 2EH7L 3D9AL 1OAXL 3X3GH 2Q76A 2ADIA 2YD8A 4ELMA 1GOHA 5TDNB 1FVDA 2GAZA 1QA9A 3D3VA 2YKLH 1FAIH 3KWWA 4QF1B 1SMAA 2F19H 5INCB 5ISZB 3ARGD 4ZO9A 1G7QB 4KHTL 4MZ3A 1IC4H 4AIZB 1JRHH 4P57B 4LCWE 3RX7A 4ZXBC 1YA5A 1KJ2H 2P1YA 3KPMB 4M7KL 2QQLH 1HNGA 1TCRB 4QRSA 2XA3A 1VFMA 3ARDC 5CD3A 3FQTA 3GRWL 1RUKH 3ARZA 3FQWB 4NM4L 4LQFL 3P0GB 4Y4FD 4OM0H 3GSRA 3GIVB 1KJ3L 4Z78B 3C6SA 3G04B 4NP4H 4P4KC 1JNNL 2E7BA 3MLRL 1U2HA 3E2HB 4JRXD 3I50H 5KVDH 2ZG3A 4FMFA 3KPRE 4HS3B 4F15C 1I3RA 1KPVA 4WEBH 5D5MB 1QEWA 5FKAB 4AJ0A 1U95B 5KTEL 3QWRA 1NGZA 5AAWA 2HN7B 3DVGB 1NFDF 1U8IB 3VMOA 1N4XL 5I6XC 1S9WA 3KYNA 4Z7UE 4ODHL 5IIEB 4N90D 1R24B 1QNZL 4Z7QE 5F1IA 5E70A 2R1XB 4NJAH 3BZEB 2ICWA 4K7PL 2LABA 2C3VA 1G0XA 4MQ7A 1K2DA 5IBLC 4DUWA 3OBAA 1T22B 5GS0D 5KS9A 3ZE1F 1UH4A 1MY7A 3H9HB 5B8CC 3VGGA 1CICC 3BH8B 3TIEB 1OSPL 1BZ9A 4UT6L 2W1NA 2J6EL 5HYJA 3KHQA 4IIQC 4M7JL 1A2YA 4R90L 3RPKA 1AIFA 2J6EH 1I1YB 4U6XA 1JGEA 1WJ3A 4WHYG 4ZOEA 1TNMA 4TSAL 4EBQH 4JKPL 3VRJA 3I6LD 1QBML 1AJ7H 1FYTB 1B4JL 3MRQA 5GGRB 3C8HA 4XVSL 3K8MA 2DICA 3LRSA 3TPUA 4LASL 1INEL 5B38G 4BUGA 4RFEA 3BZEA 1T0NB 5FYJL 3WE6A 3QQ4B 3MLTA 2DJUA 5DURD 1HIMH 2XIDA 3B9KA 4U6HA 1E4XL 3SDDC 1S7WB 2XY2A 4HJ0D 2F8OA 3MV11 4OI9A 3KPSB 3GSXA 3VFVA 3T0EB 2HT3C 1A64A 4I5BA 5CJXA 3RBSA 3RIFK 3ARRA 4KGJA 4LKCB 5BS0A 1NBYB 5F7NC 4L4VD 3HG1E 5DD3L 2YC1B 4MLIA 5E99H 3DBXA 3CSYB 3QBTB 1T03H 3A67H 3EOAB 5DHVH 5F8RC 4I2XB 5L9DH 1TVBB 2A9ML 4LLAA 3MNVB 1MREH 1EV2E 3WLBA 4AY0A 1DANT 4HWBL 5F1OB 3TCXA 3MREB 2VDNL 1BVKB 4YFLI 1JF6A 4JFYA 4NCDA 5CEXA 1A7NL 2ZUQC 1YEIL 4G9FB 2VDNH 4R8WH 3DROB 2EO1A 3BQUB 5JW3L 2XZCH 3EJJX 3I6KA 5D7JD 3FB6B 4X7EC 1AXSB 3N50A 2WUBH 1YEGH 4JN1L 2W0KA 4FP8L 2R2EB 5HJ3A 2YKLL 3G9AB 4JN2A 2C1PA 1D5IH 4UOJA 2BDNH 3D9AH 3OJVC 5HPMB 1BOGA 3UX9B 5T3ZD 5TH2B 1KCUH 4FQ2L 2YK1L 3LPGA 3MV9D 3L7EB 3FQNA 1T5XB 1HIML 2BVQB 3EO0B 2R0WL 4IMKC 4ZUSA 3IFOA 4ETQA 3VFTA 3U36B 4RMQA 1KUMA 3TYGH 3N1GC 5E8DL 3QFDA 1YN6A 4DN4H 4TNWF 2GITB 4W4OA 1CLZL 3LKOA 5I16B 2BOBA 2OL3L 1B4JH 3JWOH 4WFGD 3DUHA 5KSBF 4Z0BH 1AD0B 5EO0B 4K7FA 2W0LA 3MRGA 1IQDA 5C92A 1N0LA 3LQZA 4XC1L 4OI8A 4JPVL 5JQ6H 5EC1A 1O5DT 4NWUL 3QNZA 5DJ0B 1AKJB 1J0ZA 4YO0A 1IC5H 2B1AH 3Q1SH 2V2XA 1C5DA 1JNLH 2UY7A 2VIRB 4KAQL 1FZKB 1KB9K 1MRCL 2DJSA 3WV0A 1O7VA 3QULB 2NXZC 2ED7A 4OLWL 3QIWD 2Y25A 1RIHH 3GMMA 3SCMB 3CFDA 1I7UA 5IKCA 4OKDA 1GZPB 4LHUG 1WWCA 3UBXB 3MBXL 1EX0A 2J8OA 3WN5A 4Q6YA 1TZGL 1EEUA 2F9BT 5KJRH 1V7NL 3PL6B 4X83A 3VFSA 5IROA 4E9LA 4AIOA 3TFKD 3O2DL 2DWEA 4FRWA 1FVCA 3B9EA 4WY7H 2YN3A 3GIZL 1VGEL 1RI8A 5IK3B 5L2KA 2XN9E 5DRWB 4JFYB 5C3TA 4DGIL 1QLRB 3VWKD 3IU4L 1CDYA 2FLBT 4LRNH 1CVSC 3RVTD 5I1IH 3OAYH 1DANU 3QNXB 4ISVA 4F7PB 1T20B 4JVPA 2W9LA 4LIQL 4HBCH 4NHUA 1URLA 4KKBC 3VXUA 3FN0H 4Q97A 1A3RH 4X80H 5J1AB 3FB7B 1JZ6A 3UBXA 3VMNA 1QO3A 4AH2B 5ITBH 1CXFA 1QRKA 4QCIB 3HZVA 5IHBA 2XZQL 1KJ2L 1UJTA 4G8GA 1T6WA 1CGXA 5KVEH 4FXKB 3VXQA 4PJAE 5CEXB 1CFQA 1M7XA 2EIEA 5EUOE 2AJYL 4KQ3H 1U92A 3TN0C 3O8XD 1C1EH 4LSVL 1MSPA 4AIZA 4KDWA 3REWB 1L7IH 1T83C 1G7IB 3U4BL 5ICZB 1F6AA 2W60B 4Y2OA 5A2KH 1MFAH 2B4CC 2ZUYA 1VESA 3OG6B 5F6IC 2VDQL 4KK5D 3GMPA 4KROB 2YRLA 3QCVL 5B39G 5I1LB 1HDMB 3JSSA 4M93B 4QRPB 5GGRA 2Q6WA 3KPSE 1A1OA 1DDHA 4N1EA 1FYTD 5KG9A 2WK2A 2L0DA 2DYPD 4CRPA 1CICD 3CMGA 5AUMB 4K2UL 5MERB 4PJGB 3IFLL 3RTQA 3QUKB 5SX4I 1NQBA 5GS0C 4TRPH 4N0CD 5B3NA 5HYQB 3WNPA 5DS8B 1BD2E 1R3KA 3MRBA 4YHYC 5JPNA 4PJ9B 5KSUB 4KMTL 1EK3A 1IBGH 5EU5A 3MLSL 4JHZA 2ZSVB 5DJDB 4TUJB 4C59B 5ELIA 4H0GA 4Y2DD 4D9LL 1N6VA 4IMLB 4HUXA 4O51A 1NL0L 1XGQA 2Z92A 4CBPA 1U8KA 3MCLL 1TVHB 2R29L 4JQXA 1ZTXH 5D1QC 1MRFL 4P2QA 4V1DA 5C0AA 3WSQL 5DT1L 4D0BB 4EI6A 1JZ7A 4OM1L 3JV4B 4HWZB 3RWJA 3LHPH 2EDOA 4OB5L 2DWDB 5DK0A 4FN0A 3S5LG 2G9HB 5I18L 2YPLB 3RNQB 1P4BL 5J06A 1DQQB 2J8UE 4O02H 2YD3A 1WBXB 1DBKL 4FQXA 1RMFL 5BJTA 9CGTA 5CIPH 5IW3A 1VEMA 1P5VA 4JY4B 1KB9J 4L4VA 5B38A 4JR9H 1X4ZA 3TNNA 3WL9B 5JR1H 3LB6C 3ZE2E 2DWEB 1M71B 4ALAL 2Z31D 3FHQA 5KVGH 1I7ZA 1HH9B 1MAKA 3QB7C 4LNVA 1RURL 1X5GA 3VFPB 1UADC 4Q9QL 1MWAA 2XQBL 4UDTB 4P57A 1OAQH 3IRZA 4CKVX 2BXZA 5F7DA 2NTFB 3S34L 4UV4H 5L8JB 2H1PL 1MCPH 4BZYA 2VL4A 3QQ9C 3SDAB 4PRDB 1FZJB 1WWBX 1R5IA 2CKBB 1KIRA 5D2NB 4PRHE 3JV0A 3TO2B 1T2JA 3NABL 3SPVA 3T77A 1LD9B 4M1GL 2CRIA 3OKOA 4O9HL 3WFCL 3TZVA 4LSQH 4XNQA 3OAYK 4LL9A 4UTBL 4OCRL 1X5HA 4M6ML 4YPGA 4HGWB 3I75B 2ATKB 3SJVD 1S7TA 1KLFA 3FO1A 4GRWF 4TSBL 2V2WB 3G5XB 1VA9A 2YPVL 3P4MA 4JM2F 4YXHH 4MAYA 3TA3B 5AUMA 1XF3B 1UH3A 5DMIL 2G2RB 3IXTB 3FO0L 4QTHB 5M94B 2XPGB 1CFSA 1DDHB 1CBVL 1UWXK 2F5BH 3ILPB 1JPFB 4H0HB 2PW2A 3GMMB 1J86A 4PJBF 1FZMA 3C6LB 4YXKL 3SCMA 3WD5H 3A6CL 4K8RD 3ARBA 3K81A 5T5FL 1RIVL 4RFOH 5D70H 5D7LB 2Z0BA 2XWJB 2FGWH 1UKTA 1IEHA 1OAYH 2QHLA 5CGYD 1I1CA 3LZFH 3RVXD 4XAKE 1FCGA 3GSQA 1GOFA 5DD6B 1NMBL 3FO2B 4Z7VA 1BM3H 2CK2A 5IW6B 1JVKA 5ICYB 4LCUA 4YDLC 1T1YA 4M6MH 5C3LD 2X42A 3B2UC 3QUYB 1N3NB 1AP2B 1CFTB 3L9RA 5L6YL 4MHHI 1HYSD 3WFCH 1EEZB 2G2RA 4G8IB 3NBNA 3O3DA 5HHOD 4MB4A 3QZWA 1T20A 1NDGA 2Y06H 1NCNA 1ZWIB 3IDJA 3S5LB 5ENWB 5FA4B 4X4YA 4I0PA 2H1PH 4NQEE 3DECA 1GOGA 2FD6L 4OD2B 4ZNCD 4JO2L 4TNWK 1EPFA 1EHLH 3GGWA 5CKAA 5CBAB 4U1NB 2OMBA 1SQ2N 4Z7WE 5KSVA 2VLKB 4GAYB 1YJDC 2Y36H 5B8CA 4BUHA 2JK5B 4J6RH 3O9WD 1RVFH 3CFCL 4XH2A 1WITA 3QXAB 5C0GA 4ALAH 3PWNA 1UVQB 1MELA 1FIEA 2OR9H 3HI5L 2CUMA 3HI1A 3GJFH 4UT9H 3ZDYE 2J1KA 2R56L 1YY8B 1PAMA 3GMQB 3MRNA 5GJTL 4LHJB 3SDDD 5JXEA 5K9QG 2B2XH 4HXBH 4MQXD 3CMOL 4FS0A 2BMKA 1OL0A 4P23B 2F53A 3BMVA 5GSVA 1LE9A 4MCYB 1IEAA 2VKXA 4EIZC 2PNDA 1RV6X 1SBSH 4OM1H 2VSDA 5DVOA 2NY4B 3V5DA 3CX2A 1U36A 2GTWB 5GJTH 4YHMH 1SBSL 1IFHH 1AIFB 4Y4HA 4MYWB 2GQHA 2HMID 3QA3B 1AD9A 2B5IC 3CDGB 2R29H 4YR6B 4QHKI 4ZFFB 1KULA 4TUJA 1DUZA 1ZHNA 4CU8A 1BLNA 4PP1C 1JYNA 4G80A 4AT6B 5I16A 1I9RH 3G6AA 1B90A 3WJLA 2FECI 3S8WA 4F7MB 1JHTB 4LIQE 1GPOH 3GI8L 1QHOA 3GNML 4BFIA 5LKNA 2OS7A 5BVPL 5EOCH 3EO0A 2HJFB 1L0QA 3SDXE 4PJCB 3BXNB 2NLJB 2OM5A 3SJVB 3BI9X 1N5YL 2DM7A 4OLVH 3BSZH 3DX6B 1YYML 4PV9A 1XGPB 1NLDL 5E0QA 3DX9B 3PV7A 3LN5A 4DN3H 1UACL 4M03A 2EC9T 3VG0H 3LKQA 3RP1A 4ZFZB 5FCUL 2A6JA 3DHMA 3GSVA 3N1FC 3NA4A 2HA1A 3U4BH 4LOUD 4OKVB 5DJ2A 4YEFA 4RDQF 1D6EB 2V7HA 4ZTPL 3TBYB 1HHIA 2KQMA 4KI5D 3MGOA 4N0UE 1AC0A 3IJSB 3BO8B 3AS2A 3QO1B 5D9SA 3ZTNH 5HHPB 3DXAD 5ISZD 2IPUG 2OMNA 1ZGLP 2EDEA 1UZ8B 3BESR 4Q58C 4RFOL 2EKSB 2N1KA 2ARJA 5D70L 1NCAL 2FL5B 4IMKA 1BBDL 2W9EL 5KBNC 2WLZA 2NR6C 5EBLB 4KY1H 4C57C 3AAZA 4QHMA 3RKDC 5I1IL 4N68A 2P8MB 2RQ8A 5ID0B 3SO3B 2I60H 5GZOD 5DMIH 1RIVH 3FT2B 3BYYA 4Y4FA 4HZLA 3H9SE 4GW5B 5EFIB 4YXHL 1KYOK 3MZGB 3S36H 3WD5L 1UJ3A 4MDIA 4U1SB 2F5BL 4OD3L 4D0BA 5FUOH 1RJLA 3CUPB 4TYUA 2H2SD 3U7YH 3EJYD 5FO9A 5J13B 5DSCB 3LPWA 4OCRH 3MRIB 4RBPK 4F80A 3C5JB 1FP5A 1MCKA 3D69B 3FOMB 3SDAD 1KB5H 5A43C 3L1OL 1MFCH 4LSUL 4M93C 2IANB 3DGCR 1UJ3C 2DLHA 4GBXA 2WP3O 4GRMB 4WW2B 3LRSB 4XZUB 5FK9A 3VGFA 4X6EA 4PJHA 5I1CL 3S4SA 3WHE0 5BQ7B 2ITCA 4JRXE 4CU7A 1NSNH 1HI6B 5F7UA 4LNRA 1IM3B 1ZEAL 4CN4A 1TDQA 4OGXH 3HPLB 4PYGA 2CIKB 4J1UA 1JNLL 1CTNA 5EBMB 2PR4H 2HTKC 5C08B 2WBJD 2M2DA 2CD0A 1QKZH 1BD2B 1WICA 5D8JH 2FJGA 2BJMH 1I9IH 2FZ3A 4LCWD 4FQIL 4FQHA 4RAUB 5T1KD 4ENED 4JO1L 2W0FB 3EW3B 2OL3B 2R1XA 3BP7A 1NC2A 2ATPA 3L7FB 1FG9C 5DA0B 1CWVA 4GUPB 1TETL 3UZEA 3F65A 2JIXD 3ULUC 4UOW1 2CLVA 4M6AA 5DI8B 3VH8A 1GIGL 4N0UB 4F7MA 2QV2A 2DM3A 2B1HH 4GKSB 2XI9A 3LHPL 2XYCA 3VWJC 3DMMD 4GRMA 3ILQC 5HYQA 4AG4L 1FORH 4HUUA 3MJ7A 4WI6A 4QYOB 5KVFH 3MUY1 1CDCA 5IWLC 4RGNB 3MCLH 1D6VH 4WNQA 4BH7B 4JO4L 1IARB 3SGJC 4GKZA 1J8HA 4QRQB 1ONQA 3KPQB 5DRXB 1G9NL 2P7TA 4Q0XL 2B39A 4EOWH 4P4KB 3EFFB 2I5YH 1T2XA 1U8JA 5KSBB 1UWGL 5F9JB 5JOPD 1NL0H 3QXTA 3GMQA 4G6ML 1P1ZB 4PTTA 4JGUA 1EBPA 1NBZA 4E41A 1AHWA 1UCTA 4H5SB 3T04D 2NPLX 3PGDA 4XBPA 3VRIB 4YAQB 1UQSB 5C1MB 3MNVA 2IBZX 3EYUH 2QADB 1SBBA 1HXYB 3CSYA 1YMMA 3FMGH 4R96A 3MOBH 4M6NH 3IFLH 1T7VA 4NYLA 2R9HC 1T04A 1TZHB 1FVEA 4KKAD 3MRLB