5D93C

Oxidoreductase fragment of mouse qsox1 in complex with a fab fragment from a mouse qsox1-specific antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
207
Chain Sequence
QVQLQQSGPELVKPGASVKISCKASGYSFTSYYIHWVKQRPGQGLEWIGWIYPGSYNTEYSEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYYCARSEDWFAYWGQGTLVTVSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfhydryl oxidase 1
publication title Overcoming a species-specificity barrier in development of an inhibitory antibody targeting a modulator of tumor stroma.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 43
structure length 207
sequence length 214
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d93C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d93C02
3VXTB 5I73B 4HMDA 5IBUB 5B8CC 3LQZA 1YY9C 5LG1A 3IDNA 4Z0XB 4Q9QH 5F9OH 3QQ3A 5DVLA 3OX8A 5JO5A 3QCVL 5I8EA 1IGIH 4I8DA 4GRMA 3WFEL 2VXQL 4J1UB 4ZAKD 4ONHB 1DVFC 2IADA 4GKOA 4OCRL 5F7LB 3CFIC 1YPZF 3RZWA 4OUOA 3LN9A 3RJQB 4D0BA 1GZPB 3OAZK 4JQXA 3MYJB 2EICA 4UDTB 2X4NA 5CBAB 4DOHE 1OB1B 1XT5A 3T2NH 5J0BA 3LRSA 2FDBP 5KSAC 1FZKA 5DQDL 4HUNB 3KG5A 3IS1X 3LH2H 3NTCH 2DAVA 4LRIC 3BGMB 2JCCF 3MV9A 3IDIA 3HLAB 1MIEL 2VLRD 4F3FA 1N0XH 1BQLH 4RNRB 3ZTNH 2F8XC 2DDQH 1J7VR 1I4FB 1WJ3A 5EUOA 1ES0A 3U36B 3KPSE 5FUOH 1FIEA 4D9RE 4QRUA 4HIJB 5CHNB 4WW1A 3GNML 4M1CD 4OTXL 1RIVL 1EGJH 1PY4A 3PV6A 5C0FB 4Y88A 1GRWA 1B0RA 1KJVA 2RBLA 5I15H 5L7XL 4G9FD 1NEZB 1R5WA 1TZIB 5LGHL 4Z7OF 2NTFB 1C5DB 1VA9A 3N9GH 4G6MH 5E70A 1NLBH 3IKCB 2LVCA 4WI7A 3BH9B 2HH0L 4DOHB 5I16A 3ES6B 1GZQA 3GSVB 1S9VB 4K94C 3LKPA 3CSYA 4ZNEA 5IB4B 5J4MA 3CH1A 4JDTL 1EBPA 3QPQC 5C0GB 5JOFB 5L2JB 1P5UA 3D0LA 1I7ZB 1T1YA 3V7AG 3QUXC 4QOKA 3QRFM 4TYUA 3TZVB 1SYSA 3QXAA 4DAGL 3KPSB 2GHWB 3WIIH 5C6TL 5GSVA 4HJ0D 1GHFH 4HDIA 4PGEB 2Z93A 2EDDA 4RMUA 4ZFZB 4QRPE 4XMPH 5AZEH 2XWBB 5FA4B 4LCCA 1CXFA 1GOGA 1ACYL 4NYLA 5E6ID 4TOYL 3QDMB 4KK5C 4LSVL 3VG9B 1BM3L 1J0IA 3ULUC 5JORA 2JB6B 2HJKB 3O9WC 3MV7E 2APBA 1OAZL 3KPNB 3THML 5F9WB 3VXPB 5LBSL 1GIGH 3HC4L 4ZG1A 3IB4A 5FYLH 3F58L 4Z7VF 1B9ZA 4ZOCA 3BUTA 4ACPA 2NW2A 2ZOLA 5BQ7A 2OR8A 3LS5L 2P8PA 4F7PB 2G60L 3T0BA 4XP4H 1KLUA 3MRHA 5D1QA 2V17H 3VI3E 1H3TA 2PNDA 5LGKA 3WMSA 1NANH 1YN6B 4JFEA 4RQQB 4XX1E 5DEFA 4QRPB 1G7IB 4XPHH 3L6FA 5CBEB 1DBBL 1D3CA 1P7QD 1GGIH 4RGOL 4U05A 4NQCA 4LDEB 1Q94B 3FAWA 1MHCB 4P9MH 5T3XL 2WIMA 5ITBL 4BSVB 1R24A 1FE8H 1S3KH 3TA3C 2JB5L 1LO5A 3CVIL 1NBZB 3NABL 1KIRB 2R0ZL 3BGFB 1KBGL 2LFGA 3FFCB 5EIQA 4AIOA 3R0NA 4BFBD 3IF1B 1D7FA 4UOW1 5D7JB 3GI9H 3QCUL 3C9NB 5F1IA 4PJCA 3D3VD 2W0KA 1KCUL 3MLTA 1N7ML 4L3EE 4X7TB 4ZQKA 5HGBA 5GJTL 1MFCH 5K9JH 3GKWL 4E41D 2P44B 1HH6A 3NPSC 1V3LA 4JPWH 4AENA 4BELD 1A1MA 3G9VA 1CD0A 1TTFA 5C7XL 1S7XA 4ODTL 2CLZB 2VZ1A 3BP7B 4K8RH 4U3HA 3EAKA 4JFOA 5H37G 1F4AA 5J56B 4OFYD 2NR6C 4Z76B 1OAQH 4UNUA 3LKSA 4OZFA 1JWMB 43C9B 2HTLD 2VL5B 5FUZH 1HEZA 4HHAA 4U1KA 5GZNC 2G75B 3B6SB 3RWGB 4BFGA 1KC5H 4X0KA 4Y5XA 1KTDB 2ZUYA 3NIDE 5J6HB 5FYLE 3M17B 3OKYA 2YOCA 4X4ZA 5I18L 4F7CA 4JHAH 4YDKH 2J8HA 4S0SD 2DI9A 4I48A 3TPUB 5FEBA 2B1HH 4NKDB 4MVBD 4FQCH 3IFOA 3QQNA 2AKRB 3Q48A 1A1OB 4OM1L 3DSFH 5E5MA 4OLWH 3A67L 3RWIA 5KOVC 3RL1A 1TLKA 1PKOA 5EU5A 5HY9B 3O6FB 4M7JH 4MJIA 1YEKH 2BSSB 5TDNA 3PWVA 2IPKB 3BT2H 1FL5A 4QRQB 4EI5B 1CE1H 2R1XA 1P84J 2R1WB 2A6KA 5ICYA 1H15B 1QHOA 4OZGE 2YC1A 3VXME 4Q2ZA 3T77A 5M94B 1A6AA 4JM4L 1NGWA 1T7XA 3QUZC 3Q6FB 4WJ5A 4JDVB 2R56L 1NCCL 1T4KA 4LRNL 4OBRA 2AJ3B 1DDHA 5I1GL 1NAMA 4P5MB 1SM3L 4FOMA 4YIQB 4P4KA 4RSVA 3DNKA 1PG7W 2AQ1A 3TNMB 5DK3A 1XR9A 1B4RA 3S97C 5CD3A 3C08H 4DW2L 1MJ7H 5H94A 3JWDL 2P8MB 3BP5B 4JQVA 4E42A 4IIQC 1KT2A 2VAAA 4LFHG 2BNQE 4RZCB 1ZEAH 5LXGL 3W11C 5IB1A 4L8CB 2BSRA 4X9FA 2H6PB 4GW4B 2ZSVB 1F8TL 4JFDD 2YKLL 1J8HA 1MHHB 2ENSA 4JRYE 1N4XL 1MOEA 3LN5A 4URTB 1OARL 2VKWA 3BWUC 1EXUB 3ARUA 4XNQA 3BW9A 4KQ3H 3PL6A 4IDLA 2UY6A 2VDPL 4NWTL 5HGGS 2EKSB 4IS6A 3RGHA 2VE6A 3GM0A 3LEVL 1DEDA 2WWMC 4LHUB 3U30B 1NBVL 1T1XB 4KJWD 2O61B 1I1AA 3ARED 4NIKB 3G5ZB 2QHRL 5ETUA 3JVGA 4M9PA 5DHVH 3QFJE 5HI4D 3PGDB 4Z95L 4K7PX 1EUTA 4HSQA 4LK4A 2EXYC 3L3HA 4MAYA 3HI1A 2NMSA 4XWGH 4P3DB 3X11B 4XAWL 1EAJA 4XPBH 2IANA 3BPOC 5KVFH 1A7QH 3K7UA 5CILL 3PABA 3ARBD 5E9DA 2VKXA 4KMTL 4YO0A 4F9LA 2Q86B 4WNQB 1MAKA 1JPTH 4HKBA 2EDYA 1XCQB 4R7NA 4S2SA 5GXBB 3ZDZF 5DUBA 3TJHD 5FGRA 3MXWH 4IRJC 4LCWB 2FECL 1NCWH 2VXUL 2VABA 3MNZB 4YHLH 3LKQA 4ZXBD 4N1HB 2IAMB 3HPJA 3QFJB 2AGJL 5DHYA 3KWWA 1G0DA 5HHQA 4RMQA 4LPVA 1G7LB 6FABH 3DI2B 1T83A 1NFDA 4Q6IC 4V1DE 1X6NA 3SEPA 5HYJE 1UM4H 1T1WB 2IJ0C 4TNWF 3UTQB 5CEZH 4NM4L 2FJGB 2QKIB 4KHTL 3SE8H 4J8RA 4LIQL 3QWOB 5H8DA 2XG5A 3CFJB 2LV4A 5GRUL 2Z31C 1MI5E 2R2BA 4M5YH 4C55A 1S7VB 1C7SA 4P2RE 4HX1A 4P23B 1FFOB 4PV8B 1EHLL 4NDMB 2FHCA 3UDWC 4A2MA 3BIKA 2A6DA 4YFLF 3FTGB 5H2BA 5TDPB 1H8NA 5BZDB 1L9MA 5KW9H 4UZGA 2H1PL 5CZVL 1IEHA 5GS1A 1CLZH 2J88L 1KN2H 5ICXB 1SY6H 3D39A 4QHLA 2CDFB 1R3IH 2RR3A 3G5YB 3FOLA 3TBYA 1QFWH 3IXTA 4EXKA 3UMTA 4V1DB 5D96C 1MAML 4GRLD 5HYJB 1MF2H 1OGTB 2E9IA 4JY5L 2P1YA 4WWKB 1BLNB 3HR5B 1WSST 1RIUH 3QCVH 4RX4A 2BX5A 1NEZG 1MIML 2V2WA 3MFFA 4FFYL 4O2CA 3WFEH 4PR5A 4M6AA 5ILTL 1YUHB 5KVEL 4OCRH 2X4RB 1XGQA 5D9SA 2VRAA 1D6EB 3MLSH 4FTVE 3AB0C 4XBGB 4C83A 1D5IL 2E6QA 1EV2E 1MI5B 3NGBB 5ANMA 3FQWA 1CL7L 2BMKA 1FBIL 4X5XB 4DVRH 1TENA 5DQDH 3WIHL 3CSBA 3QEUB 5T3ZH 2R29L 5DHVB 5ERWB 4LASL 1MIEH 2IGFH 4PRBA 2F58L 4MXQD 2ZKHL 1PQZB 5DR5L 1KJ2B 1QBLL 2D2OA 3RBGA 5TPWL 3WIFA 4AM0A 1TQCC 2D7OA 4MYWB 3BD4A 1ZLWH 1ZOXA 5E94B 1V7MH 1CG9B 5CEZE 5DC9B 4L3AA 4PGBA 5L7XH 1CU4L 2D7MA 4YBLC 2Q76A 3GMPB 2P5WD 3QJFB 4WO4C 5ISZE 1UB5A 4MJ5B 2MOVA 3D9AL 2BXZA 2AI0H 1VFBA 3EYVB 4NRXA 2P24B 1NC2D 1JL8A 4JDTH 4XCYA 3FO2A 3WFHA 2M8XA 4O2FA 3CDGB 4UI2A 3U7WL 2ZUSA 3GMQB 3GSQB 4U1LB 1EEZB 4P46D 1OP9A 2E9BA 2GUOB 4Y5VC 4Y1AA 4DAGH 5IQ9B 2F54D 3GMRB 5IHLB 1QLFB 1FCGA 2G9HB 5L8KB 4RGNE 3MLVL 5GGRY 2CPCA 5IMKA 4CVUA 4EUPG 2XNAA 3MGOB 3OJDA 1ACYH 1T20B 1U3YA 5GGVY 3MBXH 4TOYH 2MQ0A 1XF5A 5TGBA 5CD5C 3TO2A 5ISZB 4PRPA 1U93A 3TPKA 2Q7NA 5L2KD 5ESQA 4PJBE 5EC2B 4NN6C 3MBEB 1D6VH 5E56A 4P2OA 3D18B 4I3RH 3L3JB 5EG6C 4OD1H 5T3ZE 3F58H 3GZKA 3NPZB 5IR1B 2AEQL 3QIUD 4IJ3B 4U49A 2IQAB 2Y72A 3S3SA 3O8XA 1CFQA 5INDB 2G60H 2CDEB 4Z18A 3MUGA 4M7KL 1U95A 1FAIL 2FWOA 2HFEA 1JHLL 4HF5H 3ZMRA 4Z7WF 4XX1G 2X1PA 1FFPB 2AK4E 4OFPA 1YEGL 3CSPA 3H9SB 4KH2A 4ODWB 4NRZA 5J6GA 2EDQA 3HZMB 2WBJD 1DBBH 5SWQB 4RGOH 3K8KA 5HTSA 5ITBH 3U7YL 4UB0L 3NZ8A 3L9RB 3SE9L 3WXWH 1A7PL 1QRNA 4PJBB 4G8IA 3NABH 5KSBE 4X6CF 5KVGH 1AHWC 2FX7H 3OKNB 4X6FB 1BHGA 5EDXA 1QSFA 3WNKA 3QCUH 4ELME 4V2BA 4N8PA 5J57B 3MZGB 1AE6L 4RFEB 2Z8SA 1Q9WA 3UTSD 1N7MH 4HIIB 5GS0D 3VG0L 5F1KC 3CFEA 2DQEL 2VLME 3SKMB 4HG4J 4L4VB 4CU6A 3CUPA 3TN0B 5JUEL 2XTJD 3GKWH 2GJ6E 1R5VB 5DJZB 4JY4A 1OT1A 3K0WA 1Q8MA 2AK4B 1ZLVK 4QY8B 5C7XH 9CGTA 4ODTH 2VYRE 3I02A 4HLJA 1CTNA 1OQXA 1KUMA 5IIEB 3C6SA 5EOQH 3T4AA 3ULVL 5D2NB 3G6DH 1U3ZA 5D8JH 2FSEB 1NC4B 1QFPA 4G43A 1JWUB 3LOWA 1MWAH 5CEXB 3WJJA 4MLSA 5KSBB 4PGDA 2WUBH 5C71A 3C2AH 5CKGA 3KYOB 4WI9A 5M7QA 3SKOA 1KCSL 2EYSB 4Z7NF 4LDOB 2B4CL 3MC0A 1LO4H 3DIFB 2HFGL 4NUJB 4E0RB 3QWRA 3D69B 3VWKA 1HXYB 2BOCB 4AJ0A 4JREB 2X42A 4D0CB 1F11B 5HYQB 1ZT4A 1E4KC 5JW5B 2GJ6B 2HYMA 4Z7QE 2B39A 1HI6B 3OGOE 4QOKD 5DTFA 3BJ91 3H0TA 3OL2A 4OM1H 1GH7A 5EUKB 1ONQB 5BW7A 3DWTA 3GSNL 3P4MA 1RVFL 4UDUB 2AQ3A 3G5XB 4EIZC 4HS8L 5T33L 4PJ9A 3RPIB 4D0DA 1EZVX 3BYYA 3MRGB 4HUXA 3U46B 4UINL 2I24N 5FAAA 2HT2D 4GBXB 5MEOA 5C0CA 3FRUB 3IYLW 2ZCKL 3ALWA 4ONFL 8FABB 3PNWA 4LRNH 5I1GH 4OCNC 3QNXA 4APQC 4CMMB 2D9QB 3VGEA 3GIVA 3NH7L 5D7IE 1JP5A 3GMOA 4BZ2L 1QFWM 3T0DA 5HVHB 4W70A 3JWDH 4OGAD 1IMHC 3EO9H 2W65B 1F4HA 3LPWA 5HYSB 4CU7A 4OLEA 1ZANL 5E6YA 2FBOJ 1DZBA 4JZOB 4OQTA 3HNVL 3QIWC 4NN5B 4GO6B 2YKLH 5D1QD 1ZHLB 3SJVE 3CX2A 3HNSH 3BPNC 1N4XH 2NXZB 4NC2B 4Y4FB 4HCRA 4C56A 1U3HA 4KV5F 1R3KA 4JFED 3SGDH 1FL3B 3QYCA 4JE4B 1OAUL 2FATH 4JZJB 4O58L 1N2RA 4NWTH 4PJHE 5I1IL 5JPNA 1K5NA 5C08E 1CTOA 1SQ2N 5DRWA 1NBVH 4M1DL 4N5EC 1ZT7B 2OM5A 3GMNB 3QUYA 2QHRH 2RIKA 4HV8B 4N9OB 1HHKB 1RI8A 2UY7A 4NGHH 5IWLC 3NCFB 1TVHA 3KS0J 2EE3A 2E7MA 5D7IB 1BJ8A 3UEZA 4WUUB 2HFFA 5FYJD 3UP1A 3EYFA 2R0LH 1EHNA 3AS3A 3CSGA 2ZUWA 4NP4L 3TNNA 5AAMA 4UTBH 3P9WB 5ENWB 3VXTA 3OKMB 2AJSL 1CD8A 2NNAB 1U58A 3D2UA 1J0ZA 4TSBL 4YHOL 1RJLB 4Y4HC 3SJVB 3F7VA 2NY1B 4YHPB 3NFPB 5CILH 1KPUA 3AY4C 3O4LB 1CS6A 4X6DE 5J1AA 3SDXE 4KMTH 2OR9L 1GZPA 1U8IB 3GJFK 1OGAE 3C2SA 5SWSE 4PJHB 4LAQH 3VRIA 3IFNH 2QR0A 4UIKL 1MWAB 3MYJA 3GJEA 1KLFA 4UDTA 3U0PB 1T5XB 3F12B 1ZVSA 1J1XH 1OSZB 3PGFL 2WSKA 4R3SB 2VXUH 5EOTA 2B1AL 4ZPTB 5E6ZA 3QI9B 3VGFA 3L3IB 2HT4D 5FHBH 1ZA3A 1JZ5A 3IRPX 5GGTA 3RTQD 4L5FL 2EECA 2B0SH 1PX4A 1J88A 2VLJE 4I4WA 1A9BA 4N8CL 4WW2F 2NY0C 4RNRA 2VDLH 1UCBL 5ID0B 4TTDD 1U91B 5JXAL 5B3NA 1WC7B 5KAQG 3IDXL 1Y18A 2A6IA 3BZ4A 2A9MH 1QA9B 1QO3A 3MOAH 1R0AH 5FB8B 2X6MA 1MY5A 5C0FA 5IEHB 1A21A 1IM3B 1IBGL 5EO9A 2Q8BH 5JW3H 1RK1B 5J11B 1A6VL 1NEZA 4P5KB 1TZIA 1EHAA 3SDXB 5EORL 3CD4A 1TETL 3O4OB 4RMSA 5SWSB 3T0WA 3Q6GL 2VZ3A 4LLWA 4MJID 3QXWA 3QCTH 3MJ8A 2VLLA 4LCUA 3IDJA 4PB0H 5JW4Q 4XVUC 4TUOB 5IBLD 3X13B 2APTA 1I1FB 1T7ZA 3ES6A 4XAKD 3RWDA 5IB4A 3R4DA 2Z91B 3FZUD 3BKJH 4M61B 4PJXB 1T03L 3U4EA 2V7NB 4KJYA 3RIFF 4N0CC 3D6GA 1I7ZA 3MRQB 2H1PH 4O02L 1DN0A 2VLJB 3TZVA 5EZIH 1R3HA 1MCIA 2GTWB 4XGZA 3HMXL 4PGEA 1W0WA 4KJPC 2FZ3B 4FQXD 3C8KB 4FFYH 4EN3B 3ULUE 3NA9L 5ILTH 1MRDL 5KVEH 3HG1D 1J05A 4JFYB 2YSSB 3ZYIA 3RY4A 1CL7H 1J8HD 4ZUWB 1FBIH 2E9JA 3WEXB 4JR9L 1QQDB 3BX7C 3GSUB 4YQXH 5I75C 4G8GE 5F96L 5L8JB 2BY1A 2H8PA 3PL6D 4P2YA 2YN3A 3VXPA 3WIHH 4JDZB 1MEXL 3PDGA 4K3EL 2N4IA 1EO7A 4LASH 2X9WA 4S0TD 1F6AB 3ZE0E 1RUAL 3CLEH 5HSFA 4PJ8D 1NPUA 5TQ2H 3K81A 3ULVF 5DR5H 5BXFB 5KSUA 1QBLH 5J06A 4HPYL 2DJUA 5TPWH 5D6DA 1PKQE 3LZFH 4I0PC 5HJ3B 1I85C 1YN6A 4RQQA 4K07A 1IL1B 4FXLA 1G7IA 4NQDE 4P2QD 5F7FA 3MRDA 3MJ9A 4MAYD 4EUPA 1H5BB 2AV1A 2DQCL 3DOSA 2GIYA 1EFQA 1Q94A 4HUWB 4XNXH 2HLAB 2P45B 2XWTB 4X4ME 1G6RL 2IAND 5DMKA 3S37X 4H26B 1V7NH 4OD3L 1A6PA 3RGVC 1BQHG 2IG2L 3MV7A 1BFTA 1J1PH 1WITA 2ATKB 5E9DD 3MA9L 5T1MB 2JJUA 4XNYH 3STZA 1RULL 3BP6B 3TBWB 1URLA 3WNMA 4F58L 2E8ZA 3QDJE 2P42B 1EAPA 4HEME 5I66B 5DDHA 1S7TB 2PW2A 4HC1A 5CIPA 1E4JA 5I1DA 3TIDB 1B2WL 4JPVL 1F3JA 5BZWB 2BNRE 2CLZA 1YY8A 2X05A 5GZOD 1KTLA 3X12B 2L7UA 4HFUH 4N0UB 4UOW0 2OK0L 3QG6A 1ZLSL 3QDGE 3BPCA 2CXKA 1JHKL 4UU9A 2X4PA 4QYOA 3OXRA 4G8FB 1NDGB 1K85A 1JZ4A 3CGTA 5SX5K 1MRFH 2XA3A 4P9HL 3MOBL 3B6SA 3RWGA 1KYOK 4MXWL 5E99H 4GLRH 4WI3A 5J6HA 1CICC 2AEQH 4PUBL 1YDPB 3NPSB 4YR6B 3UTPD 2YEZB 2F9BT 2UUDK 5HHVH 2G5BA 1FJ1A 4L3EA 3QDJB 5JXEC 4G3YL 3DV4A 3FO0L 5DVOA 4YDIH 1MJ8L 3UYRL 1FDLL 1JHLH 2CO6B 5A43C 5F6IC 3DUSB 1ADQH 1BAFH 2NYYD 3LQAL 4X7DC 1UZ8B 2BNRB 3D39D 2R2EB 4OD2B 1RZGB 1J0HA 4PJEE 2CSPA 3LPGA 3OKDA 4IOFC 1QFUL 2B20A 2E7LC 4M62L 3QP3A 1A0QL 3QEGL 2AEPL 2Y1VA 2BVYA 4EI5A 1PDKA 4OAWA 3WS3B 3U7YH 1FIGL 1CK0H 3SE3A 3F65A 2N7BA 4UB0H 1AI1L 3GSWB 2IH3B 3ZDYF 1A7PH 1JRHL 2EEDA 2UVEA 2NY3B 5HGDA 4ZTOL 4IMLB 2DBJA 4OGXH 4JDVA 3DGGB 2XOTA 4XP9L 5IMOA 5T1KB 1EMTH 2ADIA 2IQ9L 1LE5B 3P4NA 2AJ3A 1P4BL 3HE7D 4P5MA 1AE6H 3ZKXB 1CLYL 4X83A 4YWGL 3HUJF 3U82B 4FNLH 1ED3B 2HJLA 5JUEH 2HWZL 2P8MA 4PP2B 1JGDB 2PO6A 1U8QB 4L8CA 4PJEB 2VDML 4LSSH 1FFNB 5CSZA 4U0QB 2BC4B 1QFHA 3U0TA 1OTSC 1SYVA 2FH6A 3QUZB 5EU3B 5GGVH 4NJAH 2YD5A 4RDQF 1ORSA 1FH5L 4POZD 1SMAA 1EXUA 5C70A 1PLGL 4HXAL 1BJ1J 2X89A 4OZGA 4AG4L 3VXMA 3J7HA 1X5FA 4NZTL 4GW5A 1XEDA 4GKZB 3L1OL 2BCKB 2YR3A 4POYA 2BP3A 1KCSH 2J4WL 1FO0A 4G8EB 1H3UA 1T1XA 5D7LE 3WO4C 1U92A 2HFGH 1RJZA 2W91A 5A3ID 1QKZH 3LPFA 4WV1C 1YEDB 2K1MA 4IIQB 3JV4B 1FSKB 4TSAH 3TFKD 1JWSB 2CH8A 5GGUA 4U33A 1KENH 4XPFL 5BS0D 5IVZB 3CZFA 4K9EC 3LB6C 2HN7B 1T66C 2QSQA 3WD5L 4GAYB 5JOPD 2BNQA 5IW3A 5ALBL 5FO7B 4XXDB 1A9EB 5BVJA 1A8JH 1IEAA 2R23B 1I3RB 2RAMA 1A4JB 1CIDA 3O3BB 3OGCA 1QOKA 5GIRB 4JRYA 3IFPA 5T33H 1ND0B 4E5XA 3QHZL 3VD7A 2AVGA 5DFTA 3OTTA 2XN9B 1MJJB 2BVQB 1OP5K 4MJ4A 4X4YB 2H3NA 2XY2A 4IEFB 1IQDA 3C5JA 4NOFA 4ONFH 4DN4L 5IV2A 2PTTB 5D7LB 5JHLL 4PRPD 2C5DC 1A3RL 4JCMA 1JF1A 2PYEE 3B9AA 4HWBH 2Y9RT 4PJ5E 3VXNA 1Q9OA 5EBGA 3QB7C 5DD1H 1RZKC 5DFVD 4BZ2H 4LU5H 3HAEH 3EDDA 3CFBB 5B4MC 4DN3L 1I3UA 4HH9A 5HI5C 2ZUVA 4MQSB 1VPOL 2FGZA 1ZANH 3O8XD 4ZD3L 3MO1B 4OM0H 1ODAA 2FJGA 1Z2KA 5E2UL 1IGTA 4Y19D 2AXJA 4LEOA 4H5SA 4YXHH 1OSPH 3KPOB 1H3WM 3CFJA 2KKQA 4KI5E 2NW3A 1OAUH 4O58H 3IGAB 3VCLB 1V3MA 1S7VA 1CDGA 1JUFB 4GAJL 3RVUD 1FFOA 3K80A 3OAUH 4JO1L 3LN4A 1FYTE 1ITCA 4MHHG 4MD0B 3IFLL 3I6KB 5T1DH 2PYEB 1ERNA 4TVPD 1WTGT 2YD9A 4M5ZH 2EH7L 3KYKL 2EYRA 3BHBB 5F9AC 3UXFA 4B0MM 4X8JB 5CP3H 3RVTD 4M1GH 4LLVB 2V5SA 1QSFD 4NP4H 3C6LB 5FV1L 3M07A 3RZCC 4O51B 4JM2B 1GC1L 2AJSH 4XTRD 5B21A 2PETA 5CJ5A 3OPZL 3JWNC 4KTEL 5GGRB 2MJWA 3RBSA 3HZKB 5A2LH 2EDEA 5IVXA 2X4RA 2OR9H 5FK9A 4P3WA 4WI2A 5DWUH 3V5KA 4XBGA 1N6VA 3DO7B 2VZOA 1B0GA 4ODHH 3U83A 4NC1E 4PRNB 4P2RA 3EYUH 1A6WL 4I3GA 4X7EC 2J6EA 2EXWD 1FYTB 1VEPA 3PGFH 4BK4A 4X5XA 1NMCB 2WANA 1HNGA 3JWOC 5KS9E 2WQ8A 5BRZE 4RMRA 3QEUA 1HQRB 3G6JE 3LMJL 3T8XB 4PRDB 3MRMA 3RX5A 1V05A 3IU3B 4JFPB 5EU6E 4N8CH 1I7UB 3NCEB 1MFAH 3DBXA 4F7MA 4I0CC 5JXAH 3QWRD 5D1ZC 1KJ2A 2YPKA 3B5TA 4YDVB 3VWKD 3IDXH 5D71L 5FECA 5DD6B 5EO0B 2FJHA 5JMRA 4FQ2L 4YDJA 1TCRB 4FG6C 3WHE1 5F89A 3BKCL 4HK3N 3WFCL 1A6VH 4GUPA 2H32B 3A6BL 4KKLC 4NBYB 5EORH 1TETH 4LFHD 4KXZH 3JV0A 4FTVA 2HJFA 1IGJB 3Q6GH 7FABH 2HTKC 5DO2D 3ZT5A 1QVOB 3PDOA 4L3CA 4NKOB 4PJ9D 3EYVA 2P24A 3RWJA 3TIEA 3PP3H 3B2UD 4KKCC 4ORZC 4IRZH 5MEQB 1JHTB 1KCLA 3UPRA 1BZ7B 3CAFA 1TQBB 5EU6B 1C1EL 3GMQA 3GSQA 5BO1H 4YC2C 5GS0L 1QRKA 2YA2A 2VLRB 5GSRB 3JSSA 3REWB 3TO4A 5C1MB 5IQ9A 3GMRA 3VFNB 3MRNA 4XBEH 3ZHLA 4ERSL 2G9HA 1GGBL 3FT4B 4X7FC 2NZ9C 3NIGE 1CN4A 3W9DA 2W60B 5IF0B 1S5IL 1T20A 4ZFOA 4FMKA 1L6ZA 2ZOKA 1CZ8L 4G9FB 5F8QC 4EDWH 3CVHH 5ISZA 4BJLA 3QH3B 5F7EH 4XXCC 5CLTA 4C56D 4MDJB 4F57L 1U3HD 2JCCE 3ECBB 5E2TL 4BSJA 5F96H 3K3QA 1BQHA 1A22B 1RPQA 2X4OB 4OGYH 4Y5VB 2P5EE 1MEXH 4K3EH 3ARTA 3QISA 4YGAB 1UJ3B 4NNXA 4EQ3A 2FO1A 2LQRA 3BUYB 4O2EB 1UKTA 3QUYD 3H6JA 5IEKA 5INDA 3OB8A 3FCTB 1OTTC 1VB9A 4D3CL 4FP8L 1D9KA 2V2XA 4AK1A 1CQYA 4Z7OE 3L5WA 1ZK9A 3BKML 3MROB 1WBZB 1I1YB 2R15A 4PIRF 5LCVH 3HZMA 3NCYS 4NN6B 4KGLA 5SV4A 1RIHL 2DQCH 4MD5A 4I1NB 2DRUA 1IGYB 3NCMA 1G6RH 5D6CB 2ZUTA 3W0WE 1DQMH 1X5JA 4PJBA 4D8PB 4NN7C 1TZGL 3FONA 4DCQB 4NO5B 3FAXA 3OKNA 4LQFL 3OAZH 2P5EB 4YZFF 5E08L 3GSOB 3N1PC 5TE7L 4WFED 1ZHNB 1TPXB 4RFEA 5L88H 5DF0A 1AGDB 3IJSB 3CJJA 3HS0A 1XAUA 2C7UB 4M8VA 4PRAB 5I76A 1R5VA 5DJZA 5JW4R 4MA1B 3V4VL 2AK4A 4FQHA 4LSDA 5HHXL 4DZ8B 1PG7H 5CGYD 2NQCA 3S96A 4QNPE 3ZE2F 4PTUA 2CLVB 3T2QA 2VZUA 4Z8FH 2OK0H 1DL7L 3EYQC 4TPRL 4H8WC 3Q5TA 5J3HD 1AHWB 2FO4B 1JHKH 2FSEA 2G2RA 1DUZA 4KKAD 3W0WB 4FFZH 3TH4T 1JWUA 2NY7H 2H45A 1UXSB 4Z7VE 5CEXA 1NCAL 4P9HH 4TUJA 4I13B 3KYOA 1MQKH 3MOBH 3SCMC 4MXWH 3L95A 4F15C 1KCKA 5HD8D 1UCTA 4ELMA 1C5BL 4S1QH 4G42A 4NUJA 4PUBH 2W92A 1MELA 3D69A 2VMFA 1D5MA 1Z0NA 1KGCE 4J4PA 4PRHE 3RKDD 3CLFL 3D3VB 4MNGE 3OHXB 4G3YH 1X44A 4NNPL 5HYQA 1MJ8H 4G7YL 1HN1A 3ULVC 2GJ6A 5DD3L 5J89A 4F33A 2VDKL 5FDYA 2X09A 4J3XA 1H3XA 5F88A 4E41B 1K4DA 3TZVD 4X7SL 1A3LL 1P9MC 1NFIB 1ONQA 3F7QA 4KDTA 3CFDB 5DK0B 3KPSD 5K93A 1KPVA 1QFUH 1A7RL 3QO1A 3S35L 3ULSB 4M62H 4D9RD 3NCYP 2B4CC 3QEGH 3G5XA 1BJMA 2AEPH 2OXGA 1FIGH 3G08B 2DQJL 3CVHB 1AI1H 4PD4J 5AYQA 1CE6B 2EEAA 1JRHH 2EH8H 2PXYA 4ONGL 4DGIL 3HE6B 3FQNA 4U1NB 3KDMB 5A2IH 4FHBD 3EO1B 2NY4C 4XP9H 4DFIA 8FABA 2Q20A 1P6AB 4XVTH 1D5ZA 2N7AA 1P4BH 2DQDL 3HA0A 2Y36H 4OZ4A 4XCFL 4DZBB 1W72L 1NEUA 1CLYH 3PHSA 1KNOA 4PRHB 3QPXL 4MNGB 3LVEA 4KPHH 3FMGH 3I85A 4K3JL 4ODVL 3P30H 4Q58C 3ARFB 2H2PD 3RY6C 1P2CA 3BQUC 1FLRH 4DVBA 4K23L 3TYFB 5F1NA 1IARB 5C2UB 2HRLA 5F3BA 2K7PA 4IDJL 1LO2L 5D1XA 1PVHA 1TDQA 4YHML 5HDQL 1IAII 2YPLE 1ZHLA 3H9ZA 5EBLA 4Y4FA 5ACZB 1TXKA 1QYGL 4N0YH 1G7PB 2OX5A 5HHPB 1I7TB 1FL3A 1PLGH 3VGBA 4QRPD 3FQTA 1ZTXL 1T7VA 1RMFL 4GXVH 4NZTH 1X5YA 3L1OH 4KUCD 5CP7A 2E6PA 2QQQA 4P5TC 3UYOD 5I8OH 5B39G 1IM9B 3MV7D 4NQVA 1IAKB 4JFFE 1T2QH 3E3QC 2V5RA 3ZL4L 1ZHKA 5C0IA 1U42A 5D7JD 3RWHA 1FRGH 4X80L 4CW1B 4GJTB 1NGXA 1NAML 4WVRA 1FG9C 5KSVA 2Z92A 2Z8WC 4M6NH 2Z35B 3BD3A 2Y5TA 4N8VB 4F7EA 4GG6E 3C8DA 3T0EC 2YPLB 3SJVA 2DM3A 1OT2A 3MCKB 4HKZB 4JFDB 3QHZH 2W9DH 4LDLB 3S5LA 4P99A 2XY1A 5TF1H 4POUB 3CXHJ 1U8IA 4JN1H 4PJHA 1S7QB 3WN5B 5C08A 4XNZB 4PREB 3F12A 4S1SH 5C92A 1OSZA 4R3SA 1VKXB 1JGEB 3V4PL 1JIBA 3QI9A 2ICCA 5DJ0B 1MHPH 1XF4B 3L7EB 1T1ZB 4QRTB 3ZTJH 3CPLA 5B8CA 1DQQB 1I75A 4HJ0C 5KANG 2WNGA 4WHYH 5E1AB 2H9GB 1FZOB 2ZZUT 2BVPA 1I8MA 4LPXA 1ZGLA 3ZYJA 5EZLB 1DVFA 4WIQA 5JLZA 2EIZB 1VPOH 2Z9TA 4L3ED 2UYLB 2FX8L 1JZ8A 2VIRA 4LLYA 5E5UB 5FB8A 2LU3A 1GPOH 1X5LA 4X9HA 4GG6B 1V3KA 3DV6B 4XVJH 1IM3A 5E2UH 2V6HA 3CMGA 1UB6B 3RWFB 2VTFA 2W0FA 3SGJC 5EULV 2O5XL 4X6DA 1XF1A 3SDXA 5KSAA 3FQXB 1OGAA 5SWSA 1SEBB 3ARBB 4Q0XH 5IMMB 1JPGA 4LRIA 1MLCA 1N8ZB 1V3JA 2O5ZL 4EI5D 3EGSB 3IFLH 2Z8VC 3GBLA 2D4FA 1LD9B 4OF7A 3QWQB 1FORH 5IB2B 2ICEA 1RZ8A 4H20H 2VXSH 4WHDA 1JPSH 3HZYA 2MCG1 1JGLL 1PZ5B 4YXKH 3PWLB 2BOBB 2W0LA 5BCAA 2R4SH 4KJQD 5FYLD 3V0VA 4YK4B 1L0YA 1KJMB 2GTWA 1GC1H 4JPKL 3TH2T 3GDBA 3OPZH 2VC2H 1OTUD 3ARRA 4JFQB 2FZ3A 4AH2B 1KB5A 1FFRA 3S36L 1S5HA 3SQOL 4H25A 2FCBA 3P4OA 3ZDZE 3X14B 4KRLB 5C0NC 1CFTB 1LEKB 3RX7A 2PO6D 3Q3GB 2O5YH 1ZVHA 3QDAA 2V7HB 2CJUL 1JNJA 3QUXA 2FR4B 1QQDA 3VRJB 5DD5H 3RFZC 1K3IA 2UWEE 4RWYL 2X89D 4G6KL 3MRKA 3VXMD 4JG1L 2VLKE 4X8XA 4JO4H 3VJ6B 1AY1L 1F6AA 4CUCA 1ZMYA 5DUML 3PQYE 4QHUA 4CVZA 4O5LH 2L7JA 5KZCD 4NM8H 4UTAH 2YK1H 4W6YB 1U8OA 1CLOH 1DBMH 4G7VL 2FHFA 3OJVC 1Q9LB 5F1SA 1CCZA 3TVMC 3GBNL 3QNZB 3SDDC 3FFDB 3WCYA 3SO3C 5DJ8B 1EO5A 2BNQD 3HRZA 1FYHB 3O9WA 3WFCH 4WI5A 3DECA 3A6BH 2ERJB 2ADFL 2QQNH 4K8RD 5DJCA 5EZOH 1I9IH 1CGSH 1VEMA 3EJYD 4MA7L 4JRYD 3B9KC 2XICA 4K2UH 5JA9A 4UNVA 3FRPA 4G8GA 1MPAL 1T2XA 2LTQC 1P4IH 2DL2A 3WDJA 3U9PH 2IMNA 2VLKB 3TYGH 5T3XE 4JAMA 3QR2A 4PTTB 1C1EH 1E6JL 3IDYC 4NKIL 1WFNA 2UZXB 4F37K 5J1TC 2VXTL 5GS0H 4LPCA 3DUUA 2IAMD 3QFJD 3QUMA 1PKQA 3TJEL 3VFUB 2PCPB 4Y5YB 5BZWA 4GRWF 4DUVA 5C9JA 4RAVB 2SEBB 3TA3A 1YEJL 1TJHH 3LIZL 4NQDA 3RGVB 1FN4A 1IC1A 2CRYA 4B5EA 2EO9A 1S9XA 2AXFB 1CZ8H 1AXTH 1AD9A 2QSCL 4HZAA 4YGVB 5DEZA 2X4QB 3OJMB 5E2TH 4DUXA 5DMYA 1WIOA 3ISWA 4Q74A 4JHWL 3T3PF 2CR3A 1NC2B 2D7QA 5E00B 4EZMA 2W9LA 1F2XK 1X5IA 4YR6A 4Y4KC 1MFNA 3LKNB 1NCDL 4XC1L 5DQ9B 1MCFA 4KRPB 4MQXC 4R4BB 3P0VH 4D3CH 4MMXC 4FP8H 1HYRC 1MLBB 4ENED 1HKFA 1RAMA 1U8PB 3UYPA 2R0WH 3DROB 3DUSA 3BKMH 1FP5A 3R06B 3RWEB 1BZQK 4R26L 4OD2A 1RZGA 4U1IB 5EPMB 1FG2A 1P53A 2ZPKL 2XZQL 4ZUUA 1XGPB 4V1DD 5HYJD 3QDGA 3H2WA 2A83B 3WS3A 2JJWA 4FQPA 3ARVA 4JHBA 4AMKH 4ZNCD 3AREC 2BVTA 3KR3H 1A4KB 2OS7A 1XGYL 5CKAA 2IBGA 5DJAA 3I9GL 3IDMA 1TZGH 5EZJA 4LLMB 1XIWB 4N68A 5HI4C 5IK3A 4PJGB 4LL9A 1UYWL 5L2KB 1J8KA 1HK6A 5IG7A 3DGGA 5CEYA 5DRZB 2UZYB 5J9PA 1MI5D 5TE7H 4DTGL 3LQAC 4P2RD 1L7IL 5F6IB 4LKXA 4G5ZH 5DK2B 3INUL 3QIUB 2A74B 4HK0B 1YJDL 4U3CA 3O6LH 3X17A 1FZMA 1LDSA 3U9UB 3FQRB 5EWIL 5CUSH 1TCMA 1JGDA 3L5XL 3JTSA 3QT2A 1SEQL 3T1FB 4CVXB 3MCG1 3MV9E 4PJEA 4U6XB 1FFNA 4CNIA 3S88L 3SDCC 2WBJB 1K8DB 3QUZA 4HUUA 5EU3A 5I8CB 1I3VA 5AWNH 3STLB 5DD0L 5DMGC 3VFOA 1EPFA 4FXGA 3QQ3B 4ZXBC 1WZKA 3OX8B 1NCAH 1FVCB 3N1FC 5GJSH 5I8EB 1K9TA 2CKBB 4GRMB 2BCKA 1L4IA 5GRXG 4KTYA 1KEGL 1S9WA 1B3JA 2NY6B 4IRSC 4PP1D 2XKNA 1ACZA 4D0BB 1C5BH 1AP2A 1YEDA 4IIQA 4Z7WE 3EDEA 3MUZ1 4TVPL 2X4NB 5C0EA 1DLHB 4NNPH 3UJJL 4G7YH 3LRSB 4HWUA 5E2WL 2MKLC 1FZKB 4XI5C 5FYJH 2VDKH 5DJYB 2XTJB 1A3LH 2DQTL 4IOIA 1OCWH 3MV9B 1PY9A 1E4XI 3TO4D 3S35H 1M7IA 5EUOB 3QAZB 1MCRA 5JOEA 4XWOC 4QRUB 1ND0A 4WW1B 2QADD 4OSUH 5CJQL 5CEZD 1NGPL 2H41A 1AXIB 3AU1A 2ORBL 4GRWH 1YYLL 2BVQA 3TWCH 4CBPA 2I25N 3VD9A 1KJVB 1B0RB 4X4YA 3U0WL 4KGJA 4BZYA 1R5WB 4HQQH 2PTTA 4L8DA 5D7LA 5ISZD 4OZFH 2CDGA 1MCCA 2GYSA 1KCVH 2JJVA 5JIKA 2F8VA 4BM7A 4JY6B 4NO0A 4GRLC 3MBED 3I2CL 2QQLL 2JF1A 5MEPA 2HVKA 5B39A 4ODVH 5I16B 2FNBA 3KS0H 3LKPB 3CFBA 4Y16C 1U41A 3CH1B 3VD4A 2ZUQC 4KVCH 4ALAH 3UO1H 2OP4H 5C2BL 1T1YB 4IDJH 4TQEH 1LO2H 1M7DA 5HDQH 1D9KD 2ICWB 3GK8L 4LVHB 5D93B 3QXAB 3QG7H 4IRJA 4RGND 4YXLH 2HLFC 2I5YL 2Z93B 3UTZA 3ILQD 3E8UL 1RMFH 2HRPL 5IHBA 4OZIF 1OPGH 5SWZE 4YHIA 4LCCB 2YD8A 1JUFA 1I9RL 3BESR 4FABL 1S7UA 5I1JH 5F71A 1BF2A 4NQCE 4MXQC 3DX6A 2FEEI 1NMAL 2PYEA 3BDYL 4R2GC 2PN5A 4Q6IA 4PJ5A 1J0YA 2ZSWB 4DUWA 3DX8A 3GMMB 3QNYA 3ZL4H 1U8HA 1DCLA 1VGEH 5T3ZD 4CDHA 3WHXB 2ARJA 5JPMA 3LEYH 3LAFA 1NAMH 4PJCE 2QEJA 4KZDL 3AGVA 2Z31A 2AS5M 3TN0D 1FNLA 2ZOLB 2CLRB 1JJUA 2AK4D 1L7TH 2F5BL 1KLUB 4ZYKA 3UDWA 3MRHB 5D1QB 4Q9RH 2J7LA 3RDTB 1AGBB 4JKWA 4JFEB 5DEFB 2D31A 5I74C 5SWZB 2M26A 2X9XA 4ZS7H 2OTPA 3NN8A 4HCRL 4NQCB 1NC4D 4XHJD 3V4PH 5E8DL 1R24B 3T8XA 2E8YA 2E5EA 1BVLA 1MFEL 1WICA 1LO5B 3GIZH 3ZE1F 4JFPA 1NGZA 2HMIC 4QWWC 3B2VL 3L7FA 4JGJA 3O81A 4A6YL 3MV8A 5E8OA 1IQWL 1Q1JL 4J4PD 5DD6A 4PJCB 2XZZA 3OR6A 2VLMD 1DQTA 1U2CA 2AJYH 2Z4QA 2YUXA 2CUIA 5HGBB 2GJ6D 4RISL 3LHPH 5I8KL 3O3EA 1WT5C 4YDLC 1HSBA 2OCFD 2B5IC 1HH6B 3HC3L 4AENB 2D0GA 2OXHA 1A1MB 3VFPA 3RVXD 2APWA 4MXVE 2BHUA 3ARYA 2HT3D 1QVOA 2PR4L 1T89C 2O5ZH 1O7SA 4JFOB 4NKOA 2GSIB 1CVRA 3LKSB 5KS9A 4OZFB 5BRZA 1FLTX 1JV5B 4LSQL 1NSNL 12E8H 3G6JA 4Y7MA 4JGMA 2JELH 3KPLA 1JHTA 2CGRH 4U1KB 1OM3L 4DGVH 2VDRL 5CJOH 2M2DA 3BPLC 3BE1L 3V5HA 1B6UA 4LOUD 4X0KB 15C8H 4Y5XB 3KLHC 4IHOA 3REWA 1DE4A 3WDHA 3GHEL 3ORJA 5GGTL 5I30L 3VFVA 4F7CB 1JYNA 4UT6H 5CINH 2R2HB 3N06B 3FT4A 4WEBH 4WO4A 1WEJL 3I84A 3S36H 4I48B 2NPLX 4PJ7F 4HS6A 1G9ML 4RGMC 2YMXH 5MI0B 1HIMH 3IFOB 2DTMH 5D1XD 4NO2B 1WISA 3M8OL 5E5MB 3ZYZA 1UACL 4L9LC 4LF3B 3QH3A 3RWIB 2CJUH 4Y4FD 5C09E 3OZ9L 4NQEA 5TDNB 5KVDL 1F02I 3PWVB 1B4JH 4OZHA 5CZKA 2D4DA 3FN3A 2X4OA 1DLFL 5C6PB 2P8LB 4Y5VA 2VISA 2R1XB 5ICYB 4JG1H 4M8QA 4YX2L 1KN4H 1XH3B 1NLDL 2YC1B 4Q2ZB 4HIXH 3T77B 2VN4A 4J3UA 1A6AB 1BBJA 3WKMH 1NGWB 4O2EA 2HAZA 4HWEH 4WJ5B 5C0BE 1T4KB 1DDHB 2WK2A 4KK6D 1CF8H 4M9OA 4NHUA 1HSAA 4PS4H 4JFZL 1YPZA 4P4KB 3GBNH 1I1YA 1GGUA 5FA3B 3VFSA 1XR9B 4K7PL 4XZUA 5CD3B 3VH8B 2MPAL 1MCWM 2VAAB 3DARA 5GRJL 2ADFH 2IMMA 5TJWK 5IB1B 4LNRA 2BSRB 1UZ6E 2NY1D 1VACA 1HXMA 3SJVD 5C09B 4BFEA 3IVKB 4ZFFB 2FJFA 1SHMA 2JCCA 3V7MA 4ZDHA 5EFIA 2BY2A 1QFOA 3LN5B 5MERB 4QF1B 4Y89A 3GSOA 4XNQB 3RVVD 3BW9B 3PL6B 4ZUVA 4G6AD 5C08D 4IS6B 1MFBH 2VE6B 1JTPA 3V6BR 1S7WB 1AGDA 3IJSA 2DLHA 5FKPA 4N9GA 3CDYA 1FZJB 2NTSP 3QI9D 2C7UA 4AEIL 3OMZA 2F8OA 1I1AB 4Y0GA 3CMOL 1GAFL 3TJEH 4FFWD 1YNLL 4CGTA 5E2JA 1DVFD 2HT2C 3K8LA 4UIMA 3SDAB 1M1SA 1AHWA 3L3HB 3O6MH 3HI1B 1BIIB 3W0WA 1C16A 4Q9QL 1ZV5A 2IANB 1MRCH 5K33A 3PABB 1OGAD 5SWSD 1GGYA 3ULVE 4YO0B 4OGAC 1OWWA 4J12A 4HKBB 4S2SB 2X1QA 4XC1H 3OHXA 2VABB 4KHXH 3LKQB 1M05A 3P9MB 1NUDA 3UJIH 3P73A 4M7LL 3HPJB 3LH2L 2VLJD 5DHYB 3NTCL 1KCRL 1NFKA 4K3GA 4R4FL 4R26H 5HHQB 5HDBF 1NFIA 4PJAE 2ZPKH 3K1DA 1CWVA 2GT9B 2OTUA 1BQLL 5DK0A 3ZTNL 5I19H 4ETYA 2DDQL 1PYWB 3O2WH 3ULSA 5E5RB 1NFDB 3SCMB 5FUOL 5L0QC 4HC1L 4F15B 3AAZA 2EE9A 4MCZA 4EN3D 2DQFA 4Z7VA 1EGJL 2M1KA 4LLDA 1BJ1H 3HE6A 5F21B 4J8RB 1H8OA 4WWID 3VGDA 2W0PA 4JJHA 4U1NA 2WLYA 5I15L 4U6HB 3EO1A 2OJZL 4P57B 3QPQD 1QR1A 4NQSB 1E4KA 3QEHB 2X5PA 3EBAA 2EO1A 2GCYA 2OL3A 2NXYC 3N9GL 3QUXD 4F2MA 4DZBA 1XCTA 3QEQA 1Z0MA 2R2BB 4PRHA 4HX1B 1YJDH 1FGVL 2IWGA 4XHQA 1DEEB 2A6DB 3EOTH 5EWIH 1YYMH 5H2BB 1YEFH 3TYFA 1SEQH 2VZSA 1MFDH 1MCEA 2GITA 1CR9H 3LEXA 2XWJB 4PJAB 2AV7A 5GS1B 4MLIA 5GRZA 2D3VA 3D39B 2JK5A 2X40A 4QHLB 3VXRA 4K71B 1PGRB 3RIAK 2FHBA 3RI5K 3FOLB 4RWHA 4KK5D 3TBYB 1KB9K 2FEDC 1G7PA 3OKKB 1I7TA 4JB9H 1TNMA 3RUGF 4APQA 3ULUD 2DIAA 1I1CA 1N3NA 2D7TL 3RTQC 4XMPL 5AZEL 3MFFB 2V2WB 1BZ9B 2YD7A 1UXWB 3E3QE 4PR5B 3BN9D 1DR9A 1XGQB 5D9SB 3JV6B 2WWKO 4TTDC 5H37H 3CZJA 3BQUB 5DUPL 4C83B 3DVFA 3WUWG 5ANMB 3RL2A 4TVPH 3FQWB 4G8GD 2QHLA 4QO1A 2BMKB 4LCIH 3WSQH 4BFIB 3I6LE 4HIHA 1Z9SA 1U8JA 4AT6A 3QIWA 5E2VL 3T0EE 3BH8B 1GIGL 5FYLL 3DMMC 2DQTH 2P7TA 3B9EA 3W9EA 3ZDYE 5HGHB 4KUZL 4YHNB 2YPLA 4Y1AE 4L1DA 2XKUA 2GW5A 3R8BB 4X4XA 4U0RC 4AM0B 2AEWA 2V17L 4P5TB 5CJQH 5IUSA 1U8MA 2Y4SA 4NQDD 1YYLH 5IWLA 5EBWA 1G7JB 1T6VN 3U0WH 4PREA 4PGBB 5INCA 1IAIL 1VKXA 3FT3B 2BY3A 2OLDA 3AROA 2Q76B 3DVIA 2IEPA 5J13B 1XF4A 1UB5B 1FE8L 2KPNA 1DQQA 4E9LA 4JFFA 2DYPB 3EZ8A 2H9GA 1FZOA 4FQXC 1JVKA 4FZ8H 4U3XA 4Y4HA 2VOTA 3HI5L 2RCSL 1HWGB 5B22A 5DLMH 5EZLA 4L1HA 5I1KL 3AY4A 1YC7A 5C2BH 4O2FB 3QDJD 1OLZA 3CIQA 1BBDH 2CRIA 2NY2B 3RPKA 3GK8H 4GG6A 5IB3A 2NR6D 4Y1AB 1WWCA 3RWFA 1MFCL 5K9JL 2BNRD 3LDBC 4JPWL 3FQXA 4WFGE 3NCCB 2BZDA 2I5YH 1SEBA 2HRPH 3E8UH 4JVWA 4QXTA 2XNAB 4QT5A 4K8RL 3ARXA 1I9RH 5AYUL 5GZND 3OJDB 3GBML 3QDGD 3NACL 2ITDA 3EGSA 4JCLA 1XF5B 4PJ8C 2A6JA 1EZVY 5TGBB 3TO2B 1U93B 3LD8B 3HPLA 4FA8A 5ESQB 1QRNE 1AFVH 5KANI 3RY5A 4DKFH 3HB3C 5T1KD 4P2OB 4Z5RB 1KC5L 4RAUA 2WMPA 4KZDH 3ETBF 3AXLA 4JFQA 1Q0XL 4YDKL 1CFQB 2DIBA 3MUGB 4W4OC 4YFDB 4C57C 1U95B 1CFTA 2FWOB 3VXUA 3HNTH 5I17B 7CGTA 3Q3GA 4C4KT 4FQCL 3O3DA 4I18C 4I77H 1Z5LB 2V9RA 1BWMA 3VFMA 4NRZB 2V7HA 5J6GB 3DSFL 4OLWL 4OQTH 5GRVK 3QUZD 3CCHB 4OZFG 4M7JL 2FR4A 3VRJA 3V6FA 3F7RA 4HCRH 3U7AA 3E2HB 1PBYA 5HVWA 3BT2L 1CE1L 3GHBH 1MFEH 4M3KB 2E27L 4LCYB 1QRNB 4RMVA 4G8IB 3VJ6A 4X98B 3MUY1 3RA7L 4QXGL 1HKLH 1IQWH 4MA8L 1Q1JH 1QSFB 4YEEA 4AEEA 1M7XA 3W11D 3VDBA 4NQXA 5MHSE 1Q9WB 1Q9LA 3E0GA 3QNZA 3CFEB 3FFDA 5E8EA 5ECJE 2OJEA 1OW0C 3CUPB 3C08L 4KUCF 1MJ7L 4JY4B 1NBYA 2MQ3A 5HHOE 1F45A 2DWDA 4PFEA 3I02B 2A0LC 2B2XL 2WWMD 3VE0A 4WU5A 1HNFA 3T4AB 2UWEA 5EC1A 1RJYB 1RUPL 2C26A 5AD0A 4WY7L 4D2NA 1IFHH 4KQ3L 4X99A 1OM3H 1BP3B 4U6YB 1JYXA 4I0PA 4PTTA 2NYYC 3ZSSA 4PGDB 1I85A 1BVZA 2VUOA 5D7LD 5C0CE 1KF9B 3SDDB 3PQYA 3CU7A 3SO3B 2EXYD 3B4NA 4S10A 4MB4A 4NO0D 5EOCJ 5GGTH 5I30H 3VWKB 1GCFA 1LP9E 4XB8A 1CDYA 3VFUA 1LO0L 1WEJH 4XNMB 3VGGA 3ARZA 2QV2A 1G1CA 2CUHA 3VH8G 1VFMA 2ESVE 1ZT4B 3B9KB 2K3TA 3BOVA 3RGVA 4YPGB 3GRWL 4EJ1C 1KJ2L 4RMWA 2F53A 1GL4B 4XWGL 3M8OH 1UACH 3DURA 2P4AB 3HE7C 3NIFE 4TNVF 4YGVA 4Y2DC 2GTZB 4XPBL 3P4MB 3L5HA 5KVDH 3MLYH 4NZUL 1A7QL 4M6OL 3BFOA 4ZO6A 4PJ9B 4D0DB 3O45A 4HUXB 1QHPA 4R7DA 5E00A 1JPTL 3OR7A 5MEOB 5C0CB 4J3SA 3MXWL 5MENE 1UH2A 1AGEA 2PYED 1NCWL 5BV7B 2ZUUA 4PJ5D 4YHLL 2BNUA 1SMOA 3QNXB 1F13A 2MCPL 3K2UH 3DROA 5FUCC 1LP9B 1WK0A 1SJHA 3GIVB 5EPMA 3ARGC 1G7HB 3GMOB 1QUNA 4K7PH 3C6LD 4WFHE 4QXWA 6FABL 3BRGC 4JM2D 5CMAB 4MX7A 2Z31D 3V5DA 1A14H 4L9DA 1UM4L 1CICA 4R0LC 3P0YH 2KQMA 2ARJQ 1DANT 4ZSOE 5CEZL 5DRXA 5IKCB 3MGAA 5I1CH 4KI5D 1U3HB 2C3XA 3CDCA 5JXEA 1R3KB 1CXEA 2EDFA 5ADPH 2IC2A 5FO9A 1MNUH 4R4ND 1FYTD 5IHUL 1K5NB 4HIEA 4I2XA 4HK0A 5JIIA 1PEZA 3ZKQD 5DRWB 4U7KA 1F6LL 3QUYB 1R3JA 2E7LA 3CMOH 4ZMAT 1GAFH 2RJMA 1KPRA 3FN0H 3K4AA 1X7QA 3U1SH 1IC5H 2YD1A 4GS7B 3T1FA 1TVHB 1YN7A 3VGHA 4B7IA 4YJZL 4XCCL 1CLZL 2HFFB 4KFZC 1SY6L 3EYFB 4U1GC 4MS8C 1AGFB 3TNNB 1QFWL 2C1OA 4UILL 2XZAL 4CAGA 3STLA 1F97A 3G9AB 1MF2L 1JI2A 5HGAA 4OIIL 1U58B 3D2UB 1S8DA 1RIUL 1FVCA 4NO3B 2CKBA 3F7VB 3MJ9H 4OT1H 4XMLL 4EUPH 1KPUB 1TVDA 1AC0A 4MNHA 5J1AB 3DRQB 1XGRB 3MLSL 2OI9B 3VRIB 2ENYA 2QR0B 4RIRA 3GJEB 2KUTA 3O8XC 1Z9OA 1ZVSB 2P49B 1DLHA 3R1GL 2YPVL 3AVEA 5BRZD 5EOTB 4GSDL 4QHKJ 4DVRL 3SDCB 4KRNA 5F6HJ 1ZA3B 4M7LH 5T3ZL 5DJYA 5EU6D 3MA7A 2YUWA 1KCRH 1C08A 4R4FH 4JKMA 3L5IA 4PPTA 4I4WB 4NRYB 1A9BB 3VFTA 2IGFL 4YNYA 1A02N 5AG9A 4B41A 1JZ2A 4HC1H 5CIPH 2AJXL 1Y18B 2A6IB 3BZ4B 3P4LA 1IKFH 2I9TA 2ZJSL 1QO3B 4WV1A 4K3HA 4NBXB 4KQ4L 1V7ML 2KQNA 5IW6B 1JNHB 5EO9B 1B6DA 5L6YH 2OJZH 2XYCA 5I71C 3S34L 2DWEA 4M6MH 4LLWB 4Z7WA 2LE9A 3MJ8B 2VLLB 4JY6A 4LCUB 3IDJB 2IFGA 4LQ1A 5F7HA 1FGVH 1CFSA 3WUWA 3ZKMD 2AI0L 3QHTC 3ZE2E 3RWDB 5M95B 4K7FA 3U4EB 4KJYB 4C59B 3MLUH 4CU8A 1RD6A 2HG5A 1DN0B 2ICWA 2XZCH 1L9NA 3CX5J 1R3HB 2X1XR 3P3YA 4XGZB 5TF0A 1K4CA 5CD5D 3QFDB 3T3MF 3TLRA 2IPUG 3KVQA 1W0WB 3MR9B 3QULB 1ZLUH 1VENA 2D7TH 4NWUL 4XH2A 1AXSA 4N0FA 5C3TA 1J05B 3MBXL 5IHZA 4HBCH 1CD9B 4Y16B 5DUPH 3OXSB 1TIUA 2I07A 4MD4A 2ZUXA 2DLFL 2ZSWA 3GMMA 3TT1L 5LQBH 1P1ZA 2P5ED 4PLOB 1KELH 5E2VH 1D6VL 1WZMA 2H8PB 4OV5A 3WHXA 4I3RL 2J5LB 3BZDA 4OD1L 3MCLL 3VMPA 1N26A 2BK8A 1JGUH 5IROC 3SGKC 3ARWA 4YPJA 5DO2C 2CLRA 4KUZH 2YXFA 1G6VK 2JE8A 5KSUB 4L8BA 1BVKB 2KDGA 4FQLL 4PLNC 4HF5L 1IC7L 3MLRH 4M7ZB 1BIHA 3RDTA 4I9WE 1AGBA 5KOMC 5SWZA 2YBRA 3VDAA 3IAGC 3MRDB 3JZ7A 1IAIH 4EUPB 1ZLWK 2AV1B 5LWYL 3W0WD 3RZCA 5DMKB 3PWNB 1RUQH 3WXWL 3LV3A 3MV7B 1FO0H 4WENB 3V0WL 3HI5H 2EEBA 2GJZB 5KVGL 2FX7L 1RUKH 2RCSH 4RDQG 1OAXL 3STZB 5I1KH 3VGAC 4WU7B 1SBSH 3K4ZA 3NCJH 2VR5A 1MCNA 1EAPB 2Q6WA 5DDHB 4LBEA 5FOBA 2PW2B 5TE6L 5CIPB 5I1DB 1EBAA 3PWJA 1F3JB 4IOSD 4B7LA 4EEEA 1T0PB 1YY8B 5AYUH 1KTLB 3GBMH 3DVNA 2X1OA 1UWEH 3BP4A 3NACH 2GSIA 5EOQL 3QG6B 1NCTA 2DLGA 3BPCB 4WUKL 3G6DL 1Y6KR 1MUJA 4UU9B 1JV5A 2X4PB 5D1ZA 5D8JL 4QYOB 5MP6H 3HE6D 1HHIA 3OXRB 3V2AR 4Z78A 1MWAL 2YA0A 4LEXH 2WUBL 3C2AL 5ITFA 1A7BA 1CD1B 3RQ3A 2DM2A 1LO4L 4TNWK 3Q5OA 1KGCD 4PRHD 1JF6A 3B3IA 3NMEA 1Q0XH 2R2HA 2G5BB 1FJ1B 3ARFD 4L3EB 3DV4B 4OF6A 5HXMA 1ZHBA 1A6TA 1QBMH 4NO2A 1A3QA 1UH4A 1GOFA 2KH2B 4LF3A 3OKDB 4NJ9L 4JG0L 1H3GA 1CGXA 4APQD 2P8LA 4OAWB 2E27H 1XH3A 1QNZH 2DI8A 5HGDB 3RA7H 4QXGH 1G9MC 5B3JE 3KYNA 4MA8H 3MRRA 3SN6N 4RGMB 3O41B 5IMOB 2ADIB 1IM9D 3KPQA 2KL6A 3DETC 3P4NB 3U4BH 4IBLT 4XPAL 4D9QE 2P43B 1UT9A 2DB8A 3QIWD 1S7RB 5DI8A 5FA3A 4XXCA 2HJLB 2VR4A 3VH8A 3EO9L 3FT2B 1K2DA 4U6TA 2PO6B 2VZTA 3WV0A 1KB5L 4PJBF 2YPLD 2WBWB 5CSZB 3ZZ1A 4WDIA 2B2XH 5C09A 3EO0A 3IVKA 4ZFFA 3U0TB 4U2YA 5IVOA 1SYVB 3HNSL 1RUPH 5MERA 3OQ3B 1ORSB 4QF1A 4WY7H 1MCQA 3UBXG 2WM0A 4LSPL 1RURL 3UTTE 2FATL 4FFVC 4OZGB 4LKCA 3D25A 3IDUA 3VXMB 4GW5B 1S7WA 2ZCHH 4QEGA 2J6EH 3TZVC 1NGYA 3JUYA 1FZJA 1FO0B 3MMEA 4BH8A 5C0BA 3QXVA 3EHBC 3TCLB 2BJMH 1U92B 1J10A 1RJZB 3WLWC 5KZCB 5I1AA 1N6QH 4JFFD 3D48R 4NGHL 4UQ3A 3OSKA 1LO0H 3LRHA 5TDOB 5GGUB 1OWRM 4Y4HD 1PAMA 3CZFB 5JR1H 1ZWIA 2R0LL 3S6CA 3GRWH 3MZTA 1KJ2H 3SDAA 3ARSA 4YFLI 2BNQB 2YD3A 4UTBL 2YZ1A 4ODUA 1BIIA 2GK0B 5BVJB 2C3WA 1IEAB 2AP2A 4UV4H 3QO0A 3TV3H 5KSBF 3AS0A 2L4OA 3ULUL 3OGCB 4NZUH 4FQJH 3U6RB 4JRYB 1AR1D 3I3BA 5F9WC 3IFPB 4M6OH 4HKJB 2DMBA 4E5XB 3SHSA 3UZVB 3UTTB 4KAQH 3SKJH 4YHYC 3T2OA 4MJ6B 4LAQL 1KIQA 3IFNL 2NY0D 5EBMB 2H3NB 4QRSA 1G9NC 1IQDB 3C5JB 5I9QB 2DJSA 2YRLA 1J1XL 4JRXE 4XPTH 5IV2B 1JF1B 3P9MA 5IVNA 5I0ZA 2MCPH 1Y0LA 5FHBL 2APVA 3VXNB 1Q9OB 1WBXB 4K3DH 3WYRA 5TE4L 2B0SL 5FM5M 5F9JA 5GISL 2GT9A 2X70B 4OB5L 2VDLL 3BMWA 4BKLA 1PYWA 3OB0K 3SCMA 1HYSD 4ODSL 4HH9B 4ZOAA 3PF2A 5DT1H 2A9ML 1E6OH 1IVLA 3MOAL 1G7QA 4GKSB 4KKBD 1R0AL 5GS3A 1GYAA 4XVUD 5C07A 1HDMB 1SJXA 3BGFC 2EDJA 1IGTB 2Z0BA 3T4YA 5JW3L 2Q8BL 4LEOB 4H5SB 2VUYA 4U6HA 4IMKC 4P57A 5IVXE 4NQSA 2NW3B 3QEHA 5D7JC 3I75A 4YBQC 1EH9A 2BFVH 4WTWA 4LLQA 2VWEC 3FQUA 4XP6H 5IHUH 4KRMB 3V8OA 1BF8A 3QCTL 1QBAA 1P9MA 3LN4B 4PB0L 3DI3B 3WLBA 3C09B 3D85A 4Z7QF 1DEEA 4LGRB 1AIFB 4PB9L 3BKJL 4CN6A 1A6UH 4OF0A 4HFWA 5CLWA 2EYRB 4J3OC 4LSTH 2FL5A 4OFIA 4LPWA 4PJAA 2XWJA 4XCCH 3VW3L 3KPRE 5EZIL 1TZHA 3X3FH 3QRGL 3OKEB 4MZ3A 4UILH 2E7HA 2XZAH 2NY5L 3UZEA 3OKKA 3HRPA 4BK5A 3QUKB 4OIIH 1QD0A 1INQB 2NXYB 1KEMH 3KJ4B 3B5GA 1IAIM 1A64A 1BZ9A 4XMLH 1UXWA 1RZ7H 3GSNA 3GJFA 3GGWB 4LHJB 5IOPA 5IVXB 2PTVA 3JV6A 1WFUA 1DBAH 5FK9B 3RY6A 3V5KB 3BQUA 1II4E 3KJ6H 1B0GB 3N1MC 4P2RB 5D7IF 2ADGA 3R1GH 4BFIA 2YPVH 4UAOC 4YQXL 4GSDH 2VLKD 3BH8A 2BVEA 5FCSH 2AJUH 4I0PD 3MRMB 3BMVA 3C60C 3PQYD 4Q97A 3DBXB 3O6FC 3PXJA 3CLEL 5HGHA 4YHNA 4F7MB 5TQ2L 3GSRB 2YPKB 4JJ5B 2AJXH 5FECB 2FJHB 2XPGA 4P5TA 3V95A 4X5WA 2ZJSH 4PJHF 3LZFL 4YAQA 5D7KE 4YDJB 3T0VA 4F9PC 4KQ4H 3RGVD 5DGQA 3TGXA 1G7JA 2R8SH 4DQOL 3KNBB 5F89B 4GUPB 4W6XB 1HHHA 3FT3A 5DSCB 3IETA 4FTVB 2HJFB 3S34H 4XNXL 2KBGA 3DMMB 3FN9A 1V7NL 5KJRH 3PDOB 2DYPA 4L3CB 2EDOA 4NKMA 3ZDXF 1J1PL 2XQYG 3RWJB 1QSEE 3TIEB 3T0EA 4U1JB 1DQDL 5T3XD 4XNYL 1IRAY 2V2TA 4GFTB 3UPRB 2ICWI 4KRPD 1DN2A 3QXDA 3G04A 3QZWA 1J1OH 3TO4B 5JMOC 4S1DC 3SDXF 3SQBA 2HP4A 1WUNT 2W59A 3LS4H 3UC0L 3MRNB 1I3GH 1I9JH 4NWUH 2QADB 3W9DB 1E4XH 1JF5A 4ZFOB 4HFUL 3HUJA 1CT8A 2JJTA 1Q9KA 1CICD 2ZOKB 4PJXF 4NUGH 2RFXB 4N1CA 3S37H 2DLFH 1XIWD 1N64L 3TT1H 1HCFX 5JXED 1MRFL 2FECI 3OG4B 4LNVA 1BQHB 5E99L 1LK2B 4Z5RA 4PLKC 4NFBA 5IESL 5DMIH 3L3OA 1S9KC 4EIGB 3MCLH 3SGJA 1DJSA 4NNXB 3TESA 1CXLA 5HHVL 5I1EL 2W38A 4K8RC 4LVOB 5IEKB 1CGWA 2W07A 3EJYC 3SGEH 1LEIB 4YDIL 4FQLH 3VFGL 1D9KB 5I17A 3UROR 1BFVL 1IC7H 2V2XB 4PBVC 4UBDC 4NCC2 1OF2A 3TBSA 1Z5LA 3L5WB 1T80A 1ADQL 1BAFL 2EYTB 3O2VL 4RGNB 2VDQL 1RZJH 5I0DA 4P3CH 1E4WH 5FYKE 1IGML 4FN0A 2WUCH 3CCHA 3VWJC 5AEAA 1A2YB 2N1KA 1RHFA 1VERA 4MD5B 5LWYH 5B38G 1HHGA 4Z9KB 2IAMC 1CK0L 3STBA 2QLVB 4LCYA 4X98A 3FONB 2NY6D 4Z0BH 3V0WH 4OGXL 1ULVA 3DXAE 1OAXH 2AAVA 5DEGA 1EMTL 3G6AB 2X41A 2DQUL 5EOCL 3EDFA 3ULUF 5F44A 3HS0B 4YUEL 4OZIE 4FNLL 5KN5A 4UT7H 4V2CB 5I76B 2WP3O 3HI6H 5TE6H 3QQ9C 4WRLA 5A2JH 3MV9D 4FQHB 4R97B 2LU7A 1JBJA 3HMXA 2ICWJ 3S96B 2DQIL 4LSSL 5DVMA 4P23C 4PTUB 1J87A 2C3HA 3WXVH 1RJYA 3MLWL 4WUKH 5GGVL 4NJAL 4L29A 1YEIL 2G2RB 3HZVB 1DUZB 4LVNB 4ENEC 3ZE0F 4U6YA 4YFEA 1CL7I 1EIBA 3TVMA 3LB6D 3QDHA 4TUJB 1T66D 3SDDA 3L95B 1GXEA 1IEBA 3MGTB 4ELMB 5T5NG 4G42B 4X9IA 1QKZL 3KXFE 1D5MB 4WWKC 2J3SA 4OCMC 4TSAL 5DVKA 1TJGH 1FNSH 4XNMA 4OF5A 1KENL 3B9KA 2AJZA 25C8L 4YPGA 4Z7UE 4F33B 5HHOA 2W1NA 1F3DH 2A9NL 1AGCA 5F88B 1K4DB 1T04A 1HCVA 5D5ME 3NGBC 4NJ9H 1KPVB 2GTZA 5EIIA 3ZE1E 3QO1B 4JG0H 3RIFK 5C0AE 1CFNA 5CSBA 1N6UA 5IGXH 3UBXA 4ZOEA 5FUCE 2PXYB 1CDHA 1X6LA 1EO8H 3FQNB 1B88A 3FHQA 1RUMH 5B4MD 5HI5D 1D5ZB 5IB5A 5I2IA 4OZ4B 4HWBL 4YE4H 4XPAH 1LP9A 5JA8B 1NCBH 3KPMA 1KNOB 1F90H 3PDDA 4KROC 5DD1L 1G7HA 2ESVA 5FM8A 2XIDA 1XGUB 4LU5L 4Y2DB 1F42A 1BQUA 3FO1A 4P59H 5CMAA 3GI8H 4Z7UB 3L3DA 1P2CB 4DVBB 5F1NB 4PP1C 4CL7A 5F3BB 5D5MB 1MCWW 1KB5H 5D1XB 4Y4KA 2QSTA 4OM0L 5IKCA 3QJHA 5EBLB 1UVQA 1IAMA 4YXHL 1BGXL 1OSPL 4F8TA 2Y06H 5C0AB 4K94H 3RDTD 4LSPH 5SWZD 1JK8A 1RURH 2CUMA 3FQTB 2DKUA 2QQKH 5D70L 3LKRA 4NQCD 3ARGB 3OAUL 5CP7B 5MENA 4QHNA 2ZWLT 3RZCD 1AO7E 5T1DL 5GS2H 2I9LA 4ORGB 4PJEF 4M5ZL 1AD0B 4NQVB 3AREA 3FKUS 1O0VA 2R69H 1WCBA 1N5YL 4M1GL 1ZHKB 5C0IB 1YQVL 2A73B 1AGFA 4CJ0A 3RWHB 1SJEA 1BX2A 1NGXB 4X6EB 5KSVB 3DHMA 3W5MA 1CGTA 2Z92B 3P77A 4BSWA 2Y5TB 5E8NA 4ZSOA 3ULUH 4F7EB 4NO3A 5FCUH 3OKOA 3MBEC 1QPPA 4U1HB 5DRNA 3C5ZC 3GM8A 3V4UL 3DRQA 1XGRA 3S5LB 5DWUL 4HH8A 4IJ3C 3K46A 4ODHL 2FH8A 1ZSDA 5C08B 4WTZG 3EYUL 2Y7QB 4GKNA 4YHKL 1G1YA 1BD2E 3SDCA 2DS4A 1UKSA 3CPLB 5B8CB 5BMFL 2C4XA 2HVJA 1MQ8A 5TE4H 3K74B 2UZIH 4NRYA 3DHJA 4FG6D 5GISH 5IW1A 1MFAL 3ILQC 4OB5H 2BVPB 1I8MB 2EDBA 4BYHA 2DMKA 4KKLD 1ZGLB 4ODSH 3QUMH 4WEUD 1DVFB 5JLZB 1RV6X 4IRSA 1VSCA 5F7MC 2HTKD 2VIRB 4LLYB 4AYFA 4LSRL 4I3SL 3BIBX 3CK0H 1J0KA 1JNHA 5IW6A 1WFOA 4TSCH 4P4RA 2IPUK 1RZIA 3KPPA 3T08A 3OV6A 1YNTA 2W0FB 1A5FH 4KMLB 4X6DB 4KKCD 5KSAB 4A2LA 1FV1A 5ID1B 1OGAB 2OZ4A 2EC8A 1HE7A 7FABL 1JPGB 1VGKA 1MLCB 5IM7A 5HHME 4HKXB 4G80B 1VFAA 4PG2C 2V5TA 2COQA 3TN0C 2CMRL 4LMQE 4PB9H 3D87B 2ICEB 1RZ8B 4IRZL 4BQCA 2NZ9D 3OJ2C 1P7KA 3BXNA 3HZYB 3VW3H 1FNEB 1GGCL 3DX7A 3V52H 5BO1L 3RU8H 4G6FB 3MRFA 3QRGH 4U1SA 3V0VB 2DIJA 5D2NC 2NY5H 4PGCA 4OF3A 4P4KD 3QFDA 4YHZH 2X4SA 3DLQR 3MR9A 4XBEL 5FGCE 1BEYH 3QULA 1KB5B 1S5HB 4H25B 4FQQA 3DSNA 3P4OB 4GRLA 3ROLA 1KXTB 2YZ8A 4C54A 4EQ2A 4Y16A 1X4XA 3WFDL 8CGTA 4EDWL 3OXSA 3WBDA 4L4TE 5C09D 3CVHL 1LO3L 2YRZA 4J4PC 4JREC 3MUJA 5F7EL 4JFXA 2WAHA 3QUXB 3O11A 1B0WA 1AKJB 1IJ9A 2DM7A 4M7LT 5HDBE 4OGYL 3MRKB 4JM2F 1WBYA 1PD6A 4DWHA 2AABH 3TF7C 5C0BD 3WS6C 3NA4A 3JUZA 1I1AD 4XCEB 3FB8A 3M45A 3O6KH 2VSCA 4QHUB 4CVZB 1F6FB 1BVKA 4KI5F 1IKNC 1U8OB 4XT1C 4JPIA 3AMLA 3IKKA 4GBXC 5LCVL 3SDAD 3KYMA 4DQOH 4PJFE 5DA0B 3HRZB 3O9WB 5JIHA 3OAYH 2Y25A 2YXMA 2PW1A 5DJCB 3V8CA 3PWNA 1HQ4A 5E4IA 2IH1A 1DQML 4UQ2A 5HHNA 3SE4C 4S1RL 3NFSL 1E27A 2P5WA 1F3RB 4G8GB 5HVHC 5JDJA 2GJZA 5DJDA 1DQDH 4MB5A 1PZUB 1NMBL 4JAMB 5L88L 3PG2A 4WU7A 3RUGE 1UM6H 4NN5C 2AERT 1ZGLM 3DUUB 2NXZC 4KY1H 5I1HL 4EVNB 1KSRA 3QUMB 4HGMA 2F19L 3UC0H 1PKQB 1GGTA 1RK0A 3MREA 1MREH 2BSTA 3ABZA 4JZJC 3SPVA 5C9JB 2H26A 1PG7L 3TA3B 2GFBB 3W39A 2F54A 3ZT6A 4JO3L 4NQDB 1FN4B 3SCMD 1L6XA 4Z8FL 3PJSB 4H1LG 4HLZG 2BSED 1S9XB 1G0YR 3MRIA 5B38A 1AD9B 4FFZL 4KK6C 1N64H 2NY7L 1RFDL 4OLYH 5EN2A 1JYWA 3ULVD 1MQKL 1RSFA 3T65A 1CD1A 1KG0B 5IESH 4QXUH 2CIKA 5K9OA 1WT5A 4C4KO 3CFKA 5ADOL 4S1QL 2Q3ZA 4ODXA 5I1EH 1DQJB 4O9HL 3DTXA 2XQBH 2NY1C 3WE6A 3VFGH 1T89A 1BFVH 1ZA6A 3AFLA 5BVPL 1KXQE 4UUJB 3O2VH 2VDQH 1P4LA 3RVVC 1FG2B 1IGMH 4G6AC 1E28A 3E6HB 4MMZC 5HVFB 4CMHC 4ZUUB 2CRMA 2NY4D 4OLVH 5K59E 4AEHH 1CDIA 2VITA 3QDGB 1LEGA 4AQ1B 1C5CL 3DO3A 3KLDA 3QI9C 3NOIA 4RX4D 2Y6SD 5F7NC 3SKNB 3BKYL 3G5VA 3BWAA 5DJAB 4FFWC 2EH8L 3IDMB 5EZJB 2J8UE 5IK3B 1NDMA 5IG7B 3BQUD 3T0XA 5CEYB 4NT6A 4DKEL 3O41A 1FGNH 5J9PB 3RVWC 3OG6B 4XVTL 4P48A 1KIPA 1LNUA 1Z3GL 4KU1A 4OUUA 4OLZL 2Y36L 2DQUH 1MCDA 3DRTA 4LKXB 5EOCH 3NIGF 1QBBA 3FB7B 5A16A 4MDIB 1S7RA 4RFOH 4KPHL 4YUEH 4L9LA 3FMGL 4F7TA 3P30L 1FZMB 2VDNL 5J11C 3UTSA 4ONOA 3FT2A 1FLRL 1HWHB 4R8WH 3O4OC 3JTSB 4HZLA 4NCDA 5C6WH 5F97E 2OBGA 2DQIH 4CNIB 4NPYB 4KMQA 4GMSL 4P5TD 5GGQH 4HUUB 3MLWH 3T0AA 2O93L 1INEH 4N0YL 3IAQA 1QP1A 1U0QA 1YEIH 5JHDE 3VFOB 1AC6A 2APXA 4FXGB 4GXVL 4QRRE 5DZOA 5E24E 3RHWK 2J8UB 4TRPL 2NLJA 1S9WB 3JWDC 2Q8AL 1P84K 2XKNB 3TCLA 2IFFH 3DVGA 1AP2B 3QDME 4LSUH 2DYPD 5I8OL 2FGWL 1DTUA 3I6LD 1AQDA 5TDOA 5FHAH 1WTLA 1T2QL 4MNQE 3T0ED 5C0EB 2IPTL 4U7SA 4EN3C 25C8H 1NGQL 5AAWA 3VMOA 1J9CT 3SBWA 1IILE 5E7FA 2WWKT 1I7RA 4WI4A 1FRGL 2A9NH 1QSVA 1D5BB 3SOBL 1TTUA 4HK3J 2NY2D 2GK0A 4IOIB 2CK2A 4M6NL 5FFLA 4ELKB 4Y1AD 4PJDE 3OF6A 1M7IB 4PJIE 1T5WA 1WQVT 3U6RA 2AXHA 2H32H 4HKJA 5JHDB 2ADJB 3UBXI 4OCWH 2W9DL 3UTTA 5TF1L 3AU1B 1Z6JT 1JN6A 4MJ6A 4JN1L 4GQ9H 4QRRB 4FRWA 5D72L 3ZO0A 5EBMA 3TBTA 1JYVA 3MRLA 4S1SL 3FO9A 4L8DB 1H8SA 3TEUA 2CDGB 3ZLQC 1MHPL 1WBXA 5LAXA 4NO0B 4QNPF 2D9CA 4MNQB 4P2OD 2HVKB 5MEPB 5B39B 3VXSE 2X70A 5T5FL 3BPOB 3QA3B 1NUFA 4KZEL 1H5BC 3FFCE 3BN9C 4TUKL 1M7DB 1UWXH 3BJLA 5C9KA 4YHYB 4GKSA 2VWEE 3GSXA 1GPOL 4PJDB 1HDMA 4PJIB 4XVJL 3S5LG 4IRJB 1BGXH 4AL8L 4WFGD 5EA0H 3HKFA 1IAOA 2BXYA 3MFGB 5EO1B 3UTZB 2QTEA 4Q0XL 3BDXA 3S8WA 5D70H 4YHIB 3DX9B 1E0OB 1S7UB 5IMLA 3Q1SH 4JRXA 4WTZA 3DX6B 1AIFA 1FORL 1QRND 3ARDC 4Q6IB 1KYOJ 4PJ5B 4H20L 2VXSL 3DX8B 1JPSL 1N5YH 3BEWA 3QNYB 4N90E 2IBBA 32C2A 3VXSB 5C0ND 1U8HB 1YQVH 4YXKL 4U1MA 3MV8E 1BOYA 2R4SL 2FX9L 3OKEA 4WGVB 2ARJB 3PWUA 5JPMB 3F5WB 3TBVA 4WI6A 2Q7YB 3QUKA 1OAYL 2VC2L 4PV9A 2Z31B 1INQA 5CZXC 5D2LE 3LQMA 3BO8A 3IJYA 1A1NA 4DFHA 5IFHH 4ZYKB 3RNQA 3EOAB 3GGWA 4H0GA 5F70A 3I6GA 3V4UH 2GK2A 4WGWB 3CNKA 2O5YL 1KIUA 2D31B 5FDWA 2ID5A 1WZLA 4XP5H 1JRHI 4RMTA 1CXKA 1HILA 1UH3A 3NN8B 2BRRH 4J3WA 3BSZH 5DD5L 4YHKH 4EXPX 3H3PH 1I8KB 5F7DA 2NY5C 1HZHH 5D96B 3TVMD 1BVLB 3QHFL 5BMFH 3JXAA 3SDDD 4JO4L 2XQYK 1NGZB 1W72A 3O0RL 1WCQA 3KPRA 4GH7B 3L7FB 4XC3L 3RTQA 3MV8B 2YS4A 5E8OB 3GSRA 1T7YA 4O5LL 4NM8L 3Q0HA 4UTAL 4JJ5A 2YK1L 3RHWF 4CADB 5MHSD 5E8PA 1G9EA 1QR4A 3OR6B 4LSRH 1CLOL 2Z4QB 1MVUA 1DBML 3AB0B 3B9KD 3DYPA 4I3SH 5DYOA 4BZ1L 5D2LB 4M48H 2NY3C 5HHOD 3BAEL 2XTLA 3KNBA 3O3EB 2VQ1A 4UAOB 4BH7B 4ISVB 1HSBB 1U6AH 1I1RA 1EEYA 1XFPA 5DSCA 3LSOA 3VFPB 3MJ6A 2QQNL 5FF6B 3ZKXC 3H9YA 3DMMA 5EZOL 4QTHA 3S3JA 1T6WA 1I9IL 1CGSL 3ESVF 3HMWL 2CKBL 3C60B 4KK8D 4NQEE 4K2UL 4MCYB 4OZHE 2CMRH 3TCXA 1P4IL 4KK9D 1HOCA 2EZ0C 5KS9B 4U1JA 3U9PL 5BRZB 1ETZA 3EJZC 3G6JB 1I8LC 3FHAA 3TYGL 4XCNA 3KPLB 1DUYA 1TQCB 5T1LA 5C0CD 1GGCH 3ROOA 2FYYB 4Y8DC 2VL4A 4GG6F 2ITCB 3V5HB 4R96A 4IHOB 1DE4B 4YBLB 3EYSH 3VFVB 2X7LB 1YPZE 2ESVD 2NX5E 4WO4B 2XFXB 1FQ9C 2D0FA 4HS6B 2EIEA 1TJHL 2VN7A 1RU9L 3SKUD 1JZ7A 4ZUSA 1KJ3L 5ELIA 2PYFB 4FQXA 5D7SL 3WFDH 2ED9A 4Y4KD 2RFXA 1FSKC 1LO3H 1AXTL 3HG1A 3FRPG 3AS1A 5F9DC 3K8MA 4OCYL 3ZSTA 3FOMA 4NQEB 3I50L 4MQXD 1UQSA 4OZHB 2X4TA 4K9EL 1QSEA 1LK2A 2VISB 4M8QB 2OL3H 1T0MA 2C3VB 5HI3D 1HINL 5MEND 4M43L 4M93C 1BBJB 1X4ZA 2I60H 1VFUA 5DURB 4WW2C 4O4YH 1LEIA 3P0VL 4LCWE 4PJ8A 4NHUB 1HSAB 1RHHA 2R0WL 3UPAA 1YPZB 3NFNA 2EYTA 2NX5B 2EC9U 1MHEA 4WFHD 2AQ2A 2MMXA 3VFSB 4XZUB 5CWSB 3WFZA 1A2YA 3MYZA 1S78C 4PY7A 1MCPL 3D2UD 4P2QA 4OKVA 1F4WL 2DBLL 4AMKL 4H1LA 3KLAA 3MXVL 4LNRB 2ILLA 3KR3L 1VACB 1HXMB 4S1RH 3NFSH 2BVOA 2FJFB 2JCCB 4OLXH 4ZDHB 5EFIB 1RZKL 3PE9A 1TJIL 4HXBH 2FB4H 2JKXA 4W4OA 1GOHA 1X5HA 4ZUVB 1NMBH 3G6AA 5AZ2L 4I18A 3T3ME 4G5ZL 2YD4A 5FKPB 4N9GB 1JPFB 3SDCD 3O6LL 4AEFA 2OTWA 3QIBC 5I1HH 3VWJB 3PWPE 3B9VA 4MQ7A 5CUSL 2F19H 4JEGB 5DMGD 2YWYA 3ILPA 2GSGA 5HPMA 5C8JB 1QLRA 4ZOBA 2IF7A 1RZFL 4HPOH 4RBPK 4JO3H 2CKNA 2UWEF 4IRSD 4UIMB 1S7SA 1OVZA 5C3LD 2AXGA 5IBUG 5AWNL 5CCKH 5GGSY 3HZVA 1UJTA 1C16B 3BVNA 1RFDH 4CRPA 5C0RL 4ZPVA 5GJSL 4EKXA 3EOBB 1HH9A 4XI5D 1PJ9A 3O3AA 3DXAA 1OW0A 3C6LC 2A77L 3MRJB 4ZS6D 3MGTA 4JM2C 5ADOH 3QEQE 1CBVL 3LKOA 3MACL 4O9HH 1XZ0A 4HUMB 2EE2A 4OZIA 2CR6A 4J3VA 3PWPB 3UTOA 4HWZB 5IT2L 4XWOD 5FYJL 1M05B 2BVUA 3E6FB 3P73B 4KI5C 3S7GA 5BVPH 3BIAX 3B5HA 5IFAH 3WDIA 1MCBA 1OCWL 4PG9B 4L8SC 4HG4K 1ORQB 2OTUB 3VXRE 2CIIA 4R4NC 3H7BB 1NMCC 1T22A 1C5CH 1X5KA 1WLHA 3AAZB 3JWOL 4MCZB