5D93C

Oxidoreductase fragment of mouse qsox1 in complex with a fab fragment from a mouse qsox1-specific antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
207
Chain Sequence
QVQLQQSGPELVKPGASVKISCKASGYSFTSYYIHWVKQRPGQGLEWIGWIYPGSYNTEYSEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYYCARSEDWFAYWGQGTLVTVSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Sulfhydryl oxidase 1
publication title Overcoming a species-specificity barrier in development of an inhibitory antibody targeting a modulator of tumor stroma.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 207
sequence length 214
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d93C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d93C02
2QADB 4Z7NE 3VGBA 4ZFZB 2BVPB 5I1LB 3L5WB 3V7AE 3O0RH 1PKQA 4MVBC 1QZ1A 4Z7WF 2KQMA 1MCPL 1T1XB 1YY8B 2HTLC 2ICWB 4N90E 4BM7A 1SBSL 2Z8VC 5FYJD 1S7UB 2CMRH 4MJ5B 2HKHH 4JY5L 5BRZD 1X4ZA 1RJCA 4LIQH 4NBYB 3UTPE 1MHCB 2VXVL 3QXDA 3SBWC 2YBRA 4GRMA 5J12C 3LKRA 5C6TH 4Z7WB 1XMWA 2ZP0T 5C0FA 4U3HA 2P5WA 1C7TA 1XF4B 3BW9A 3RL2B 3TT3H 4D0CA 3IDMB 1XF5A 1S7SA 4TUOA 5F3HB 1A7QL 5B3NA 3ORJA 1I7RA 4XP6H 3K8KA 1TTFA 5L2JA 2HVJB 3L7FA 1NCWH 1C16B 2NX5E 1XIWA 1D5MB 5FKPA 1YMME 5DD5H 5E99L 2WBWB 1IGML 1PZ5B 3QIUB 4P57A 5T1KA 4IHOA 3QQ9D 4Y1AA 1P7QA 5C0CB 3G5XA 2VDML 2CLZB 1FNLA 1F58H 5I2IB 2EDJA 3ARBC 4PJ7E 3VXRA 3QUMH 1YA5A 3WUWB 4ELMA 2YD6A 3INUL 5E5MA 5F8QC 4U2ZA 4W6XB 1MJUH 4PR5A 5E03A 4TULL 1DDHB 1G7PA 4PGZA 5C0JB 5IHBA 3NN8B 2F53B 3KHOA 4M43H 3CLFL 4RMSA 1XR9B 3C5ZB 3QI9A 1RZFH 5I74C 3VXUE 1PD6A 2DLFH 3DECA 1SYVA 3VI4E 3EDJA 3MR9B 3IFNL 5GRJL 4UOJA 2W60B 1LO4H 1BEYL 2NY4C 3VH8A 1MPAH 1HHKB 5IB2B 2WUCL 4YX2L 5IHUL 4GAFB 3OAYH 2K9UA 1LK2B 5DSCB 4ZXBD 1AHWC 5ILTL 4ZUTB 1FFQA 4K7PY 3ARGB 1J5OH 2UV3A 1RIUL 3O9WD 2FEDC 3CJJA 5ESAA 1KIPA 1JGDB 5EA0L 3QWRA 4DOHE 1IZKA 1U3HA 5IQ9B 2IH1A 4XPBL 4O02L 1P7HL 3MOAL 4YHYC 4NPYA 4RFNB 3D0LA 1ODAA 2EC9T 3VFRB 4BH7A 3B5GA 1QBAA 4UI2A 3HC0A 4PJ9D 5FUCE 3FQRB 4UU9A 2Z91A 2NTFA 4H1LB 3RVWC 3MLSH 4LCCA 2YD3A 5T3XD 1INDL 4F37F 3WD5H 4WI3A 5D2NB 3HE6B 4XB8A 43CAB 2IMMA 3ARFA 5HYQA 4WHYH 4AJ0A 3U2SB 3MOQA 5DR5L 5HJ3A 4K23L 3HPJA 3P30L 2IG2H 2Y7QB 5EC1A 3FQUA 2Q7NA 1NMAL 4G8FB 1NGQL 4GAJL 2A73B 3IDYC 4I3RL 3WLBB 1GPOL 3KXFE 5E08L 4UDUA 3H2WA 3UPAA 4HIJA 1OGTB 3L9RA 1S7VB 2ITDA 2OZ4H 3L3KA 3L3OB 1F90L 4M48H 3PWJA 2GJ6B 3T0DA 3N9GH 1CQYA 5D7KE 3P0YL 3TBVA 4OCXH 1JZ6A 3K74B 3TLRA 2GTWB 1Q0XL 5GRXG 3BVNB 4U7SA 1CE6B 2DTML 2MMXA 2X10A 3QISA 5IG7A 4JDVB 2X05A 2PNDA 1S3KH 5D1ZD 3GMMA 4ODVL 2B2XH 4LCWA 2PW2A 4Z7WE 2BCKA 1B4RA 3MRQB 3WFHB 1D6EB 4XVJL 4GAYA 1MCOL 1Q9WB 4HKXB 3RVTD 3F8UB 4EI5C 5FHBL 2FLBT 3U7WL 4D0BA 3MLPA 4C83A 4PJEF 3KLSA 4PP2B 1KCLA 1NCNA 4PRIB 1A7NH 4RWYH 4CGTA 1MIEL 5D6DA 3LKNB 4R4FH 3C6SA 1LGVA 2VLKB 1F2QA 3BPCA 3G9AB 1W0YT 5MI0C 2VXQL 3D39A 5KZCD 1H3XA 2KPNA 5SV4A 1JTPA 5DD1H 5C0CE 4QRPB 3U36B 3S5LB 3ALXA 3SDAA 2BOBB 5JIHA 4OT1L 4LCIH 5HI5D 3TV3L 1S5IL 3QEQA 1WWAX 5CWSA 1KLFA 1KTKE 1J1PH 1P5UA 3FT4B 4JO3H 5DHYB 4DCQB 3BP4B 2H2SC 1G9NC 4F7MB 3K2MC 4RDQG 4X99B 5IMOB 2R56L 3PWVA 1E4KC 1EIBA 3QPXH 5E1HB 4BSJA 5AZ2H 3DVNA 4NN6C 4P59L 4GRLD 4X7SL 1CL7L 3IU4H 4OF8A 5J6HB 3R8QA 4N9GB 4LMQE 3SGJC 1E28B 1LO0H 1ZLWK 3FO0H 1BZ9A 1RUPL 1HHHB 3T0AA 2EEAA 1JP5A 3F12B 4M00A 1MCDA 5IBUB 2E7LC 2FB4H 4J4PD 3D0VA 1FIGL 1FSKC 4OI9A 1UVQB 2COQA 3KS0H 1CGUA 4CVUA 1BM3H 1YUHA 3KYOA 3O6LL 2XWBB 5HHMD 1BQUA 1RK1B 5EIIB 3H7LA 1T0NA 2DICA 2OTWB 2ZNWA 2D31B 2OTUB 1F4XL 4OLZL 2V5SA 1GZQB 2VLJB 3ES6A 5D71H 1WTLA 4NFBA 3X3FL 3RX8A 4N1HB 5F6HI 3FCTA 4LSTL 4Z7VF 2JCCA 4UNTA 3MGAA 5IJKC 4RGNB 1MLBB 1SYSB 3WN5A 5CEZE 1NEZG 5EUOF 4HK0B 3SCMA 4K9EC 1CDJA 2RJMA 2VN7A 3RNQA 2VDLL 4NBXB 4PB9H 4XWGH 4RRPG 1MWAA 3O11A 3UBXI 5MEPA 2VDRH 5ESVB 4U0QB 4Z7VB 2X6MA 1KN2L 1D9KD 4I48A 4NGHL 2NXZC 2QKIB 4LSDA 4KJPC 3VFSA 4JJ5A 2J8HA 3I84A 5DT1H 3QFJB 1NKRA 4JZNA 1V3MA 5D2NE 1BFVL 1MFEH 1QFOA 4IJ3B 1X9QA 3RDTD 2APBA 4KROD 4UINH 3ARYA 4LPTA 4WEBH 4QKXB 3OKMA 4L29A 5EZOL 5DTFA 1LD9B 1QFWH 3VJ6A 4X0KB 3QIBB 3GMPB 5C3TA 3BP7B 3GKWL 3V5KA 1RHFA 2HT2C 2VXUH 3KPSB 1JK8A 5ACLA 1MQKL 1XGYH 5F89A 3RVVC 2YHGA 1EH9A 3DUSB 5IFHL 3JV5A 4XXDA 4V2CB 3G08A 3A6BL 3CX2A 4HS3A 4LVEA 5JOEA 4HUUA 4OV5A 4OZHF 1JGVL 5MHSE 4J23A 3VD5A 5ADPL 2GSIB 5CMAA 1GOHA 2GIYA 4MCZA 4O51B 3GZKA 2D2OA 1YDPB 3T0EC 3ULVH 3VFOB 3RA7H 4I18C 1CGVA 3VFUB 5KN5B 3QDJA 1G9ML 2AI0L 4Q9QL 2H6PB 4L4JA 5HY9A 4AL8H 5B4MD 4AIZB 3L95B 4P4KB 1GGTA 1P4IL 1H8OA 1RQ5A 3D9AH 4YXLH 5DGQA 5J9PA 2WLYA 1FNSH 3QJHB 2E6JA 1N2RA 2MJWA 3MRHB 2DMBA 1J10A 3WS3B 3S35H 4G5ZL 5TF1H 4MDIB 4KMQA 5FF6A 1FAIH 3B6SB 2NYYD 4YDIL 5L9DH 5SWSE 4QOKB 5T33L 4EUPA 5ANMA 4PRIE 1NUNB 4JVUA 4I77H 4TNWF 3BSZL 1UM6H 4NQCE 1DL7L 5DMGD 5ICXA 4EQ3A 3AU1A 1KCKA 4HWBA 4PJXA 4PP1D 4WWKC 4DKEH 1ED3B 4UBDC 3I2CH 4QRPE 2NLJA 4PJEE 3BHBA 1AO7D 5I16A 2VITB 5IROA 1MCEA 4RMTA 1CFNB 2OL3A 2QR0B 2P7TA 3MV8D 2CIIA 3MCLL 6CGTA 3KPRA 1JPTL 4NRXA 5F70A 1GGIH 4DGYL 1M6OA 2X70B 1MF2H 3GEWB 3RFZC 5L7XH 1ORSA 2EDXA 2H32H 1X3DA 4L9LC 5AZEH 5EFIB 5IB3B 5F9WB 2P49B 5K9JH 3UJJH 4XP1L 1F3DJ 2VLLB 2I9LB 1JGUL 2B0SL 5AAWA 1AIFB 1OP5H 1TQBB 2ZUVA 5C0AB 2Y25A 2UZIH 2PUQT 2ITCA 4PGDA 3RY4A 5JW4Q 5IFAL 2B1AL 4L4VA 1WF5A 3VXSE 1YNTA 4PRHA 4Y4HD 4N0UB 4MA3A 5IBLC 5GS2H 3OAUL 4IOFC 1NFKA 4XRCB 1W72B 4QHKI 3SO3C 5CBEB 3L3IA 2QQKH 3D3VE 1B88A 1L9MA 3T4YA 1T3FB 5SWZD 2X89A 3HI5H 2VLJE 4POYA 2PYFB 3VRIA 4GQ9L 1N4XH 4FQHB 5JR1H 2WQRA 3MO1A 1JHTA 1RD6A 4EZMA 4RGNE 3TCXA 2ADJA 2RHEA 5EPMA 2HAZA 1I8KA 2AERT 4CDGC 3H9SD 5HD8D 3JTTA 1T4KA 1QQDA 4KK5D 1MCJA 3MPCA 4N8VG 1XF3B 3QG7L 5C09D 4Z7VE 3TGXA 2ILLA 1G7LB 5JXAH 1BIHA 1RUAH 5C0RH 4AH2A 4MJIE 5E2TL 3TN0C 4UTAH 5EUOE 3RRQA 2EZ0C 1UYWH 1ZANL 1BFTA 1CCZA 1NGZB 4JFDD 2V9QA 4OCWL 5KAQG 1I1YB 1FYHB 4RAVA 2XYCA 1WUNT 2DKUA 1MCBA 3KJ6H 1P84K 4PGBA 1B0RB 1A7RL 5JQ6L 2VDNL 5AEAA 4JM4L 4YPGA 5DUBA 2AEPH 1ZGLM 4JRXB 2NR6D 3WEXA 3KPSE 2OSLB 1ZA6B 3OKEA 5DURD 5DRXB 5I1AA 5IQ7L 1AY1H 4QLRA 1RZKH 4WU5B 3B2UD 4PJAF 1WFNA 2XKNA 4CVZB 4IRZH 4ZPTB 3CGTA 4PGEA 4LBEB 4JM2F 3Q1SH 1JFQH 3RIAK 4PD4J 3DTXB 3N85L 4QTIL 4F3FA 5D7LA 1C08B 3FQNA 1WBYA 3MRDB 4PIRF 3QDGA 3DWTA 1MCLA 5KG9A 5D7JB 4HH9A 1AQKH 1CR9L 4O2EB 4U1SA 2A6DA 3TH4T 4XHJD 1QRNB 3VGAC 1V8HA 4OZHE 4DQOH 1R5VB 3QUXA 2I07A 1ZEAL 4H8WH 5IEKA 4JCLA 1HKLH 1CICA 2MPAH 3VXMB 1YEIH 4OB5L 3U30B 1RZJH 1MFBL 1TVDA 2AJSH 2HFTA 2HKFL 4KTYA 2P48B 2DQGH 3DX8A 1BHGA 4KMTH 4OD2B 4Z77A 3A6OA 2YKLH 3FQTA 3RU8H 3I50H 3QNYB 1DFBL 1NBVH 2NZ9D 4OV6F 4YHPB 1TVHA 5KVDH 3V5DB 2WBJC 2OR8A 3EFDL 4M1CD 4LSPH 3TCLB 1XCQA 3BP5A 3HRZA 2VISA 1JBJA 5DFWH 3ZHDA 1U8OA 1IGJA 1JWSA 5FA4A 2J5LB 4N5ED 3LEVH 4MX7B 5DWUH 3DV4A 4OD3H 5KSUA 3Q5TA 5ISZA 4QT5A 4ZNEA 4KPHH 3OF6D 4NM8L 3S34L 4U1LA 4C57C 1DTUA 2J88L 4UDTB 3TBSB 3G6DL 3LSOA 1QR4A 1YYML 2A83B 3DSFL 5TE6L 2Q6WB 1K6QH 1RAMA 5AWNH 1N5YH 4KRNA 2BSSA 1MH5A 1K3IA 2VL4A 3HG1E 4AT6B 2DD8H 5HGDA 3IF1B 4QXUL 1Q9LA 4N0UE 4GXUM 4OZFG 4YDLC 2BVYA 1KN4H 2BP3A 2NY0D 3F7QA 3OTTA 5BZWB 4MNGE 4Y88A 1FO0A 4K8RD 4KKCC 4OFIA 4LLVB 4NKIH 3RWGB 2APXA 2NY3D 3IDIA 3FOLA 1IAIH 4HMCA 4B7IA 3EO9H 3ZSTA 1MI5E 3GBML 3SDXB 4O2CA 1DVFA 1VDGA 3PXHA 4KDTC 3UZEA 3FHQA 4MS8D 1TNMA 4S1RL 3PGCA 1MJ8H 1QPXA 3VDCA 4KC3B 4CADB 5I1JH 3ALPA 1GH7A 1FNEB 3Q6FA 3VXNA 4NFDA 4Z8FH 2Y36L 1T1YB 4PP1C 3AREB 1ZHBB 1R0AH 2R0KH 2WNGA 5JMRA 4KHTL 5CSZB 3MV9D 4PYHA 4OAWA 5A2IH 5TF0A 1SMOA 1RULL 3UAJC 1AJ7L 2A9NH 4JQXA 3TIDB 5IV2B 1HHGB 2P5WD 3IS1X 1GZPA 5KJRL 5ACZA 2MKLC 5ERWB 5D1XB 5L2KA 2ESVE 3V79C 2VERN 3OGOE 4AG4L 3NAAH 1UXSB 4WO4B 4OCMC 3TA3B 3VA6A 2HYMA 1XIWD 5F7EH 2H8PB 5F7UA 5T1KD 2R2EA 4LGSB 2ATKB 32C2A 2HG5A 2NTSP 4Y1AD 3S37X 3K8LA 2KH2B 4Z76A 3OXRB 2QV2A 5BO1L 3X13B 1N6QH 3OXSA 2XACC 5SX5K 1CF8L 3SKJL 3ZTNH 2DLIA 3VXRD 1NANI 4EDWH 5ID0A 1BJ8A 1VGKB 4K7PL 3CFEB 4KJYA 2V2WB 4L9DA 1KLUB 2Z31B 3ARDB 5DK2B 4PJAE 4G9DB 1EV2E 3BWAB 1IEBA 5BJTA 3V9FA 4DVRL 1EMTL 1T22A 3HUJA 1UXWA 4OIAA 1TIUA 5JPMB 2YD1A 4X4MA 4WW1A 4BFEA 3GMNA 3QI9D 4QRQB 5T5NF 1LK3H 4UMGA 3WLWD 1B9ZA 4Y2OA 4M1DH 3VXME 4WHCA 4APQC 3LQAL 4UIMA 1KC5H 3ARUA 4JPIB 4JO2H 4WUUA 4TOYL 4LK4A 1QLFA 2FJFB 1JHKL 2W9DH 2V17H 4JANB 3PL6B 2AGJL 4LKXA 4U1JA 1AC6A 3FQWA 4H0IA 3KDMA 4ZPVB 5M7QA 4GG8B 4LAJH 4LEOA 4FZ8L 3EBAA 4ZOCA 3QUMA 4XPAL 4F2MB 1LEKA 4Z0XA 3IETB 1CXFA 5EO0B 3LS4L 2VQUA 4ODTH 3GRWL 4P2QB 1BGXH 3QWRD 1B6DA 1WZKA 2IAMC 4BZ2H 4M62H 4ESKA 4LHUA 3GMLA 1VEMA 1SJVA 4UOW0 4MA7L 4LLUB 5TFSL 3MRCA 1A1OA 4PJIA 4R8WL 5HYEA 5EU6A 1C12B 1CLZH 2MOVA 3SGEI 3U6RA 5GS3A 3VFPA 1DUZA 1ZSDA 1KJ2L 2WV3A 3O2WL 4ONHB 3ECBB 5FA3B 2JJSA 5DJ6B 2DIBA 3IFOA 3O3EB 4D0DB 3U46B 2QHRH 3GHEH 2MHAA 3FB6B 1U8NA 4KXZI 5H8DA 1AGEA 3O8XD 3CMGA 3WO3B 2X1PA 1IJ9A 1NMCC 2V2XB 1FBIL 2X9YA 4OGYH 3UTSA 1J0IA 2LVCA 1JRHI 3ARFD 1CD0A 4HV8A 1QA9B 5KVGL 1RURH 1ZWIA 3P11L 5F9OH 3QH3A 2F54B 4O5LH 5ELIA 1ZVSB 5GGTH 5MEOA 4HGKC 3T65A 1G7QB 2OCFD 2DOCA 4M5ZH 4A2MA 1OAXH 3V6ZA 2CSPA 3PNWB 1I8MB 2VDPL 1RMFH 2P8LB 4J6RL 4YWGH 1NLBH 3ROLB 3CZFB 5EO9A 3NA4A 3EO1A 2VKWA 2NMSA 2X41A 1BZ7A 2H45A 5CEZH 1IEHA 2R4SH 2CUHA 2YSSB 4OF5A 3RJDA 3I6KA 3O6ML 4MDJB 4GS7B 4Y4KB 1P7KA 3VWJC 1NCUA 4X6FA 4H1LH 3GIZL 3LD8B 1ITBB 1L6ZA 4AMKH 1ZT1A 5GS1A 4XH2B 3GI8L 5DEFA 1MVFA 2XQBH 2IPKA 3LIZH 1T2QH 1KG0A 4FQ1H 4TSCL 4XPHH 4LCWD 3QUYB 1T5XA 2AJUL 4K3JL 3DX7B 1O7SA 3EYQD 2AKRB 3WDJA 1E4XH 3FOMB 3ZSSA 2JB6A 5FOJA 1JUFB 3PV7A 5HSFA 3IDJA 4L4TB 3RJQB 1JWUA 1C1EH 2CLRB 1H3UA 4G6AD 1VENA 2OZ4A 4UNUA 3MLVL 1V7ML 3MLWL 3TVMC 4K3EL 3C5SA 3BISA 3GBNH 4H25A 4LDLB 4PRAA 5GS0L 1NBZA 1U8KB 3D39D 3ZKND 1MFNA 5DD6A 4P2RA 5I1GH 1BD2A 4R7DA 3SDAD 3LPFA 3L3DA 1C5CH 3QAZC 3QEQD 5ITFB 1R3KB 4PTTA 3IXTB 4EJ1C 3O41B 3JSSA 2X9WA 4ZUWA 4Z0BH 3RWHA 2FX7H 3OQ3B 5D7SH 2VL5B 2NY6B 2VLRB 3L5XL 4JO4L 5IGXL 4NQVA 2VAJA 3GSUB 3GSRA 4UAOB 5D5MF 1JGEB 4HWZA 1AR2A 2PXYC 5DZOA 3MRFB 3UO1L 4LKCA 3B5TA 1SY6L 4I3SH 1NMBL 1U41A 4KUCD 1J8HE 3LRSA 5E2WL 4DFIA 3MRPB 4G6MH 1N59A 4HXBH 5TGBB 1PSKL 2VE6B 2FYYB 3MOBL 5CS7A 5D5MB 4AIOA 3H0TB 4I13B 4J1UA 4XMKL 4ONOA 2QQLL 3CXHK 4FNLL 3WXWH 4CW1A 3MJ9L 4FN0A 1JE6A 3BZEA 3I6LE 5IFJA 2I5YL 1MFCL 4YQXH 3S98A 5D8JH 3GSVA 4HFUL 1YJDC 1RZ8A 2F15A 2FHBA 1FZOA 3BN9C 1NC4D 5CGYC 3HRPA 3BOVA 1PVHA 3PGFH 1DSFL 4RWHA 1IQWH 1GHFH 2VMFA 3CSPA 1MFAH 4D9QD 4AK1A 4U6HA 1EX0A 4JZJC 1R3LA 3ILPA 5HVGB 1OF2B 3C87A 2UUDH 5D7IB 1ZHKA 4S1DD 4NKMA 4X6CA 1JPFA 1WISA 1Y0LA 3SCMD 3ULVC 2GFBA 3CCHA 4I0PA 4NDMA 4Q6IB 4I2XE 3OKLB 4Q9RL 1INEH 2V9RA 2ZUYA 2ED9A 2WWMC 3KPOB 3PIQA 2AABL 1TZIA 1XGQB 5FIEA 1KIRB 3U48A 5F88B 1RK0B 4KJWC 4OFPA 1A22B 2JJWA 4UT7H 5DJ0A 3HMWL 2I26N 5MENB 4NFCA 4W70A 3AAZB 3F5WA 3GIVB 4KAQL 1PYWA 1QEWA 5DEZA 1AI1L 3MA7A 3PJSB 4N0YL 2N4IA 4TRPL 4DJMA 2DQCH 4DW2L 3ZT6A 1AGCB 3LKQA 4YGVB 4P2CG 3WDIA 1MFDH 4D9LH 2J6EL 1FFRA 3W81A 3VXTB 3NFNB 4HAFA 4LGPB 4XHQA 3W0WB 3TM6A 2OJZL 1I1AB 3T4AA 4ODXB 4M7ZB 4PJBA 4JFOA 4M9OA 3FB7A 4QXGH 5EG6C 1UB5B 1ZLVH 2MCG1 3FL7A 3MRRA 1W2KT 2E6PA 4F7CA 1B0GA 3NTCL 4WVRA 4XP9H 1JN6A 1EJOH 4HLZH 1B6UA 1CT8B 1NJ9A 5GRYA 4S11A 2VUOA 3FO1A 5EU5A 3JV4B 2E7MA 3L3JB 2UYLA 5A3ID 3TYFA 1KPUA 1AXSB 4XNXL 5TDNB 1ZLVK 4R4BA 4L4TE 3MNVA 1KCRH 5EN2A 2CRYA 4RMRA 4F7PA 5CD3B 1BREA 1VSCA 3RGVB 1FVDB 2G2RA 5J89A 5CKAA 8FABB 3SE9L 5IB1A 3CIQA 1D5IL 3F58L 3IXAB 4K3GA 3SEPA 3WFBL 3S3PA 2HLAB 1I85C 4KV5F 5FCUL 5HYSG 1DBKL 2GHWB 4NC1E 1GXEA 5C0DB 1G9NL 3O8XC 3QB7C 1A7BA 1IGTA 5J6GB 5I18H 2VABA 1BBJB 1IEAA 3OX8A 2EYRA 2B1HL 3OKDA 1CG9B 5GGRY 2K3TA 5I30H 3KPRD 4IEFB 1FCGA 2Y07L 5C08B 2Q87A 3VU2A 4M7KL 1QSFB 1IGCH 1QLRB 1U2HA 5H94B 4KQ3H 4ISVA 4MCYB 1YNKL 2DN7A 4AEFA 5FYJL 2VOTA 3QWOB 4R2GB 5FCSH 2GJZA 1EAPA 3MCKB 1RJYB 3RWCA 3WIHA 4OUOA 1QFUH 1XCTB 4Y2DB 2IALB 3IAPA 1MQ8A 2XN9A 3QXAB 1I1FB 4QRUA 3IJSA 5KANG 4XBPA 2X7LA 5GSVB 1D5BB 3V5HB 4JB9H 3P9MB 2BXYA 1NDMA 1QKZH 3QUZA 4OFVA 4WDIB 5DHXB 4L4VD 4XBGB 1NCCH 1UT9A 4PRHD 2V2TA 5D5ME 1O0VA 4L8BA 4YBLB 3HLAA 5DQJA 3TESA 1MREL 4PV9B 4G6KL 3SGDH 5SV3A 2E27L 4BFGA 2A74A 4ONGH 2EKSB 5J57B 3EYQC 3C60B 2DWEA 4IOIA 5D2LF 2EXWD 4K9EL 1TVBA 2W9EL 1FNFA 1PDKA 5E8NB 2H32A 2X89D 5T5FH 5DMYA 3D25B 3U1SL 4F9LA 1ETZB 3WYRA 4DK3A 4P46B 2A6IB 3CSYA 4PLKC 5F1IA 5E2VL 4LARH 3HI1A 5D7IE 4U6XB 3I02B 3NMEA 3VRJB 1XH3A 4HAGA 3ZKNC 1M4KA 5FM5M 1C5DB 1KEMH 2XPGA 4E41D 3BQUC 5LWYL 2F8OA 4J3XA 1RV6X 4HKJA 4TTGA 2FX8L 2UZXB 3BZFB 1JYVA 1DCLA 2EDKA 4GT7A 2Y72A 3B2VH 4O9HL 1MNUH 3OZ9L 3UX9B 4U6TA 3RPIA 3FB8A 1W72H 4MJ2A 3WNOA 3U4EA 3EYSL 1F8TL 2YC1A 4JFYB 4OSUL 3PHOB 3QO0A 5MENE 4JFFB 3T0VA 4M6OL 1HWGB 1M71A 3WNLA 2O5YL 4S10A 1ES0B 1S9XB 4GLRI 2H2PC 4LNRB 1XGUB 5L88L 1WAAA 1SBSH 1CVRA 1KJVA 4DN4L 4LHQB 5FV2A 5GQBA 3BPLB 3K1DA 1SJHB 2CIKB 4M6ML 4XZUA 1I9JH 3BWUC 4JY5H 2PTTA 1Z9MA 4HT1H 5D7LD 2D7TL 2OQJA 4NO5A 4K55A 3ZO0A 1FV1A 5HVFB 4D2NA 4KKNA 1F6AB 1TJIL 3QDGD 3CC5B 3BH8A 3OG6B 1OAQL 2M26A 1A7QH 3FTGA 1U8MA 4CRPA 3BDYL 5K9KA 4JHWL 4ELKB 2DL9A 4M4RA 3QUXD 2HLFC 1MAJA 3HS0A 5C8JB 1S7RB 4OF3A 1GC1L 3BEVB 1SVZA 4NRYB 2ZUQC 1CICD 3VWKC 2QSCL 4IIQC 5E99H 1IGMH 3RGHA 3NACH 4G80A 4FA8A 3RTQA 2VWEC 1X4YA 2VDMH 2DQTL 4HFWB 4CMHB 5T1DL 4Z78B 3MRNB 1JZ3A 4NKDB 2XZQL 1ZHLB 2D9CA 5HHNB 2C1PA 2AK4B 3INUH 3PDOA 3WV0A 4L3EA 2XG4A 5F9JA 3IFPA 5EB9A 4TULH 3TBTA 5C0NC 2NPLX 4Y5XC 1XGPB 4M7LL 1Z2KA 4GG6F 1Q94B 2RGSA 3IB4A 4U0RC 5IB5B 3O2DA 3C6LC 1ADQL 2VJXA 3GK8L 2W0FA 4KV5E 5ISZD 3ULUD 5JW5A 1PBYA 1PQZB 1KJ2B 2XT1B 4NN5B 1KIQB 5KS9A 3L3GB 2DJSA 1QSFE 1A1NB 4F33A 3HNTL 2NX5A 4GG6B 3PWNA 1YMMA 2VZ3A 5GRJH 4G42A 2DQEL 2V5YA 5JORB 1VKXB 4MD4B 2Y5TB 1BEYH 4GMTL 4IDLA 4U1MB 2O5XL 2WUCH 4JRYB 4YX2H 3F6IA 2FJHA 4TVPD 3UMTA 3EOTH 3W9DB 3UDWC 5IR1B 5ILTH 1SHMA 3ARPA 5EZIL 1RJLB 1RIUH 3U9UA 3FRPG 1DEDA 3IU3B 3MRLB 3RY5A 5ID1B 4PRBB 3GSOA 4TSBL 4JFPB 4WW2C 2NY7L 3MLXL 2I60L 2R0WL 1U92A 4LDEB 1EO5A 5GXBB 3CK0L 1NBYA 1YEDB 5EBWA 1BF2A 1KSRA 3THML 5JXEC 5F7FA 5F9AC 5J12B 3OKYA 1S7WB 3AXLB 4S0SD 4R26H 5EU3B 4CJ1A 1DVFD 2R1WB 3SPVA 3AGVA 1UCTA 4PJ5E 4GW4A 1II4E 3BZ4B 5D2LE 4MNQE 2BNRB 3MGOB 1YY9C 2FL5B 1CLOH 1FJ1B 5KSAC 2R1YB 3REWA 5GZNC 1OARH 2C1OB 3HAEB 1UB6A 2R39A 2X4RA 5E56A 3WXVL 3ZKXC 1RZIB 3NCEB 3V6FA 2IGFL 1KNOA 4FXGA 4PRDB 4MAYA 4K23H 2YPVH 1JL8A 1G7JB 4M8QA 2FCBA 5D6CA 1NMAH 3DBXA 3O4LE 4GAJH 3G5YB 1R24A 3DMMD 1G1YA 3T04D 4NNPL 1BFOA 4I3RH 4M61A 1BMGA 5L2KD 2C3VA 3PABB 4LEXL 1GPOH 5E08H 3ARBB 1T6VN 5C9KA 3FQXA 3QA3B 3T77A 4WHTB 3QIUC 2OI9C 4EXPX 5CEYB 1BOGA 1M7DA 4ETQA 4XCYA 5FYJU 4JFFE 4GXUN 1BLNA 4UIKH 3P4NB 4W4NA 5DQ9A 1CBVL 4JVWA 1M7XA 1Q0XH 1CWVA 1KELL 3NCFB 3ZYIA 5AAMA 1L9NA 2DTMH 4GH7B 1EEYB 1PKQE 4K3HA 5EOTB 4WV1A 3ZKMC 2LABA 2R9HD 4Z95L 1MVUA 3R06B 4ZAKD 4RISL 3B3IB 1Q1JH 4ODVH 4ZDHA 2XTJD 3QNZB 1UGNA 4XXCA 2CUMA 2ZOKB 1QSEB 2IAND 4CNIB 2Q7YA 2IBZX 5F7LB 4ZO7A 4XVJH 3BKYH 1DBAL 1NUDA 2BNQB 2EDWA 5CBAB 1CXLA 1MCOH 3KPPA 5CHNB 1YEKL 2EXWC 1ZLUH 2VZ1A 4MD0A 5FHBH 1ZTXL 3RWFB 1AHWB 1WITA 1ACYL 1RUML 4I0CC 1F4YL 3KXFA 3VI3F 1MIEH 1SEBA 4NP4L 3OJDA 3L5JA 5JA9A 2F74B 1UKTA 5A2KH 4ZFZA 4JKWA 1FP5A 2BVPA 2VXQH 4WUUD 5I1LA 1ZLUK 4PGCB 1H3VA 1MCIA 1ZVYA 4YHYB 4HMEA 2B4CL 1T1XA 1YY8A 4OT1H 2RFXA 2ICWA 3TV3H 4TNVK 4IBLT 4YXHL 4PPTA 1I3VA 2EYSB 3RHWK 3LEXB 3ET9F 4NZDA 5I75C 2YXMA 4MJ5A 1KCUL 3GJEB 2BRRL 4OKDA 5CJQL 3LEYH 4Z7WA 1FGNH 2W91A 4NZUL 5TPWL 3TT1L 1FE8L 4FTVB 2YPLD 3V8OA 4WNQA 2FHFA 1XF4A 3V7MA 4GW5B 3VFWB 4LLMB 1OPGH 4LHUD 2DYPB 3O3AA 3DRQA 5CIPH 5CCKL 1FG2B 4X7SH 5EU6D 1CL7H 2HVJA 1BQLL 3BKJH 1C16A 5DA4A 2E8ZA 4LSQL 4GG6E 1D5MA 2JIXB 5DD0L 1RUPH 2X1XR 2L0DA 3LHPH 4XWOC 3WKML 1PZ5A 3P4LA 3IDYB 1T5WB 4JRYE 1FN4B 3BGAA 5C0CA 1FIGH 5C07B 5CP7B 4TSAH 2CLZA 5FO8B 3OL2A 4IMKA 4TTDC 5I2IA 3T2NL 2IEPA 4JRWA 5LAXB 5JUEL 5F7KC 5INCB 3O6LH 3UTSD 3VFVB 3WUWA 4XGZB 3UTTB 3HC4L 1SJXA 1HDMB 2JCCF 1F4XH 4XCNB 5M94B 4OLZH 1DDHA 3T1FB 4G8EB 3X3FH 1FGVH 2JJTA 2BNUB 5C0JA 3P0GB 3NN8A 2EXYC 1OTUC 2F53A 4LSTH 2NW2B 1CQKA 4LCUB 4PRPD 4ZFOL 3VE0B 3S8WA 3D85B 5F6IB 1FLRH 4LLDB 3FAWA 8CGTA 4N8VB 1XR9A 2A77L 3C5ZA 4R7NA 2UVFA 2X4NB 2X1QA 3IFLL 3MR9A 1AXTL 2DI8A 1URLA 4EI5B 1KN2H 2W65B 4MHHG 3L5HA 2W60A 3MV7B 4NGHH 4DUVA 5IB2A 1HHKA 3O3DA 4XB7A 2OM5A 2VIRB 1A3QA 1XZ0B 2PF6A 1BFVH 4A6YL 1LK2A 5DSCA 4HF5L 4ZUTA 2O61B 3O6FD 3O81A 3QEGL 3ARGA 2OR9L 5MI0B 5EZOH 4OZIF 1JGDA 5IESH 3H42H 5GGTA 3JXAA 4MB3A 3SE8L 1YQVL 4YIQB 4F58L 3ILQD 5IFHH 3MRGB 3WNPA 3A6BH 4OGXL 1OM3L 2X44D 1G6RH 3DXAD 4PLOB 3V4VH 5C0EB 3MV11 3PWPE 5IW1B 4OZIB 4NQUA 2VZVA 5TE7L 2GUOB 3L3HB 3VFRA 3GMRB 1Q72L 3ESVF 1JGVH 4CKVX 2PETA 4FMFA 3CAFA 2PO6C 5A2JH 1DN2A 4YLQT 3DVGB 2ADFL 4RGMC 4P2RD 3HCVB 4FFVD 1BD2D 1CK0L 4H1LA 1J1OL 1QYGL 4NN6B 1G9MH 2AI0H 2XKUA 4Q9QH 2OBGA 4OIIL 1V5JA 5D2NA 1F11A 1P4IH 2WBKA 3WJJA 3HE6A 4WFFD 3U2SA 4JFHE 1T21B 2BNQE 4HIHB 3HI6L 2NW3B 2Y7QA 4G8FA 1FSKB 1GSMA 4G5ZH 1VEOA 5C2BL 5E4IA 4YDIH 3SE4A 3SDDC 5T33H 3WLBA 4KJQD 2WLZA 1NSNL 4NKOB 2EDHA 4PJXF 1IM3B 1OGTA 1S7VA 1Y6KR 3E6FB 1YN7B 1VADA 3C2SA 4ZYKB 3L3OA 1W0VB 2GK2A 3OB0H 2GJ6A 3W39A 2DL2A 4LQ1A 1A14L 4BA8A 3MLRH 1CVSC 1IRAY 1VFBB 1WFTA 4JY6B 1CE6A 4KKAC 4WI7A 4LVHC 3A67L 3VI3E 2VZTA 4OGAC 3MCLH 3V6OC 3TNNB 1IMHC 3OB0K 1JPTH 3DMMC 5BXFB 3QEQE 4WY7L 4YC2C 4FTVE 4MSWB 4WFGD 3MRQA 2OXGA 3WFHA 1WC7B 2HTKD 2NXZB 1D6EA 4X6EB 4EUPG 1Q9WA 4HKXA 4XP1H 4CDHA 5IP4A 4M9PA 2QSVA 5E8OB 2B0SH 4PP2A 4X6DF 5C1MB 3QQ4B 4PRIA 4HUWB 1EBAA 1KPRB 3LKNA 2HT4D 5TDPB 2EKJA 5DFVD 5IFAH 1BVKB 2VLKA 2IQAB 2B1AH 5T3ZD 2PR4L 3VFNB 2NQCA 3AS0A 5FO9B 4KK9C 4HDIB 4ZAKC 4IJ3C 5KW9L 3OAUH 4QRPA 3U36A 3S5LA 1D5XB 2BOBA 4X6DB 2XTJC 4XVUD 4M7JL 1WJ3A 1I1RA 4NCC2 3T0WA 4JREC 3QIBC 1FDLL 3S35X 2PTVA 5DHYA 3FT4A 3UTTE 4N8CL 1JPGB 3BP4A 2CJUL 5FDWB 4Y89A 3CDCA 4F7MA 3T0EB 3DROB 4GQ9H 3D2UD 3O45B 4I18B 3O9WB 2CRMA 1HXYA 4RX4A 4XPGL 2BRQA 5H37H 5JMOC 4LPCA 2JCCE 5I9QC 2DJ4A 3P77B 5J6HA 3LDBC 4CU7A 3QG7H 3OKNA 4KMLB 1E28A 3IVKA 2I25N 4PJDB 2N7AA 3ZMRA 4AQOA 4J3OC 3MV7E 1G9EA 2VN4A 2XA3A 3P0VH 3VD4A 2EIZB 5E2TH 2A1WL 1MCWW 1LO3L 1OAYL 2ICEB 1ZANH 5D1QD 1UVQA 1V7NL 4OCWH 4CMMA 3D3VA 4P9ML 4RAUB 2AJZB 3DI2B 1FYTD 3QCUH 3QYCA 5IT2L 1I7ZB 2XWBA 1JNHB 2R15A 4WWKB 1A7RH 1MRFL 1RK1A 4MAUL 5EIIA 5JQ6H 2OTWA 4JM4H 4NZRL 2D31A 2OTUA 4KHXL 4U1IB 2VLJA 1U0QA 5FHAH 1NL0L 1AGFB 3QO1B 4P49A 5IQ7H 5DDHB 1I75A 4KKLD 1HZHL 3SJVB 5EOQH 2YS4A 1I7TB 1MLBA 5EBLA 1SYSA 2CKBL 2CRZA 4IRJD 4R9HA 4OZIE 3Q5YA 1K5NB 1TETL 3Q0HA 1RY7B 3N85H 4QTIH 3Q6GL 4L9LB 1CLCA 5ESVA 5CJ5A 1GAFL 2XA8L 4Z7VA 2QKIA 3V95A 1TENA 2EH8L 1OTTD 1TXKA 4MJIA 5EUOA 5IBTH 1DBJL 3MXVL 1E0OB 3NA9H 4MQSB 5IWLA 1ZEAH 3QDJE 3RWDB 4HMDA 2XRAH 4HS6B 5E8EB 1DLFL 1LD9A 4X0KA 2OK0L 2R2BB 3GMPA 3ZT7A 7CGTA 3EW3B 1MFBH 1BP3B 3SO3B 1R5IA 3KPSA 3K81A 2XG5A 4WTZA 3DUSA 1JNNL 1JZ2A 2NY2D 2WIIB 4NQXA 2XN9D 1DFBH 4GBXA 2ZZUT 3QUZD 3AM8A 1DBBL 3BE1L 3BGMB 3EFDH 1RSFA 1YJDL 35C8L 5E5RB 1BBDL 1EHXA 1UWXH 1HIML 2V7HB 4O51A 1T7VA 2F58L 4HJGB 4PJXE 3O6FC 1YDPA 4YHOL 3VFOA 5IW6B 1G1CA 3MV01 5KZCB 3VFUA 2WSKA 3GHBL 5KN5A 2H6PA 4LVNB 5C0BB 4AIZA 3FO2B 4Y5VC 2X1WL 3L95A 4P4KA 2IH3B 3S34H 4CJ0A 2GKIA 5LCVL 2J88H 1UWXK 2E9JA 3QJHA 2YUVA 3QRGH 3MRHA 1X5HA 4N1EA 3G6DH 3TN0B 3WS3A 1YYMH 3V8CA 3ARRA 3DSFH 4U05A 5TE6H 3LN4B 4RFEB 3G6JF 3NOIA 3MJ8A 2YOCA 1G7HB 4KI5D 3QRFM 4FFVC 4CBPA 4BQCA 1R3IL 4QXUH 2K7PA 2P44B 5BV7H 1G7IB 1T7ZA 2C3WA 4B0MM 5IHZB 4KQ4L 3G6JB 4L4VE 4X6DE 3DARA 5HGHB 2VITA 1CFNA 2I9TB 2QR0A 1WZMA 3GUTB 3H9HA 5J56B 1HSAB 2F8XC 3K4ZA 5CSGA 4KRPC 3T0EE 4KJQC 1R3HB 4R0LB 2BJML 2HRLA 5HHMB 5EFIA 5IB3A 5AYQA 5EZLA 2VLLA 4EIGB 5F21B 5GZOD 3VGAB 2I9LA 2HWZH 5B3JE 1CIUA 1N64L 1OVZA 2Y36H 2GAZB 3M8OH 2AAVA 4JGMA 1AIFA 2J8OA 5C0AA 4KZDL 4UB0L 2D0HA 2NY1D 4KHTH 4LP5A 2LVEA 3CZJA 1J18A 1A6ZB 5E00B 5FGBA 5HHQB 5EORL 2ARJQ 4N0UA 1JGLL 3KPNB 5KJRH 4YE4L 2V6HA 1W72A 4NHCH 3JV0A 1JV5A 4QF1B 3V0VB 3VFGL 2WBJB 4H26B 4AG4H 2CPCA 5JIIA 5C7XH 1YEGH 1T3FA 5KSVA 1RFDL 4KROB 4LSUL 3RTQD 2G5RA 5C70A 1F02I 2BMKB 3GFUA 5FB8B 4FQHA 3SJVE 3BXNA 3S37L 5FYKL 1NAKH 1PX3A 4YR6B 5FK9B 5C3LD 4M6AA 3MBEC 2GEEA 2V5RA 4EKXA 5LVEA 1PG7W 4N90D 3SQBA 3P73B 5BO1H 1CF8H 2YN5A 3QBTB 3SKJH 4RZCB 1KB9J 3RP1A 1XF3A 4K7PH 5DFTA 1E6JL 3UTPD 3HUJF 5FGCE 4DKFL 1CFSB 2A38A 1G7LA 2OP4H 4DVBA 1XGTB 4DGIL 4DVRH 1EMTH 4Z7OF 3IDXL 4A2LA 3UPCA 1NGZA 3ZDYF 2NY5L 4ODUB 3R8BB 1MAKA 1I1YA 5AYUL 2JE8A 3P9LA 2EDFA 2G5BB 1B0RA 4PV8B 3LQAH 2FD6L 4TQEH 2CDGB 2NX5D 1N0XH 4M93B 4TOYH 1YMMD 5IVZB 3STBA 3G6AB 5E70A 1ZA6A 4OCYL 4WCYL 5LGHL 5DRXA 5DF0A 1UM4L 2J2ZA 4WU5A 4ZPTA 4FZ8H 4LBEA 1XAUA 1YECL 3BMWA 4XPAH 2RBLA 4ZMAT 2IBZY 2DS4A 3DTXA 2BHUA 2WP3T 1AD0B 1C08A 3B9VA 1S9YB 5D1QC 2ZSWB 5I8OH 3LS4H 2DQFB 3GRWH 3FAXA 4NBZB 1VHPA 4ZFOB 4PJIF 4DZBB 2F5AL 4PJAA 5D7JA 3TBWB 2JLLA 5I0DA 4JM2A 3LB6D 4NJAL 4O2EA 4MA7H 5TFSH 2BVQA 5C0BE 4R8WH 1QRNA 1A3LH 4BYHA 1R5VA 4PY7B 1AO7B 3EDDA 3UTQA 5J11C 2R4RH 4J8RB 3JWOC 4ZNEE 3O2WH 1K8IB 3Q48A 4FFYL 3VXMA 3MJGX 4UV7L 1KPVB 1S7TB 4IRJC 4HPOL 4W68A 3G5ZB 1WWWX 3G5VB 4A6YB 4P9HH 1XGRB 1A5FH 1QUNA 3HC3H 2APVA 2W0KA 1YC7A 3HN3A 2BVTA 4TYUA 4GOSA 3UYRL 3QNYA 1FBIH 4YHPA 5JOFB 1P2CB 3TCLA 5KVGH 3BYYA 4MAYD 3P11H 4LHUG 4Q2ZB 5EBMB 1A9BA 3G6JE 3M45A 3MACL 3DHMA 4MX7A 3TA3C 1HI6B 1D7FA 2Q8AL 4J6RH 3ZKQD 3K3QA 4JKPH 4LVOC 3TBYB 4YDVB 1BFSA 2Z4QB 4G7VH 4OLUL 1EEQA 5I8EB 3QCTL 4UDTA 3O6MH 1FAKT 3R1GL 5B21A 3TBSA 2BY0A 5SWZB 3IRZA 3VW3L 4OM0L 4OTXL 1WSST 4QXWA 2Q6WA 3B5HA 3GIZH 4PFEA 4EDXB 2Z31C 5E9DB 4NIKB 5TE4L 4APQB 1L0XA 2GCYB 3HAEH 1V3KA 3RNKB 3P4OA 4TSCH 5E7FA 5KBNC 3GKZA 4X9IA 3KPMB 3UTOA 1FZMB 5EDXA 4YAQB 3BKCH 2AK1L 5KANI 1ERNA 5DQDH 3RWGA 3MLVH 4P5KB 3KXFD 1V7MH 3M07A 4HZAA 4MXQC 5C86A 5HYSB 4K3EH 5JW4M 2ID5A 3PL6C 4JFDB 4IS6B 3SDXA 2QADD 3TPKA 4JN2B 2XFXB 1VACB 2IAMB 5B8CA 4R96B 2VXTL 5D7KD 4KDWA 5CEXB 4WUKL 1WCQA 4WHYG 4CADA 4OZGB 3RY6C 12E8H 2BC4B 3X11B 2DBLH 5FGRA 5J1SC 4U3CA 5HHXL 1T1YA 1J05B 4HSQA 4NWTL 3EOAB 3AREA 1ULVA 4HJJL 1ZHBA 3MNWB 2P8PB 1ZGLB 5CSZA 4X8JA 4LIQE 3K80A 4YFLI 1ROWA 4PREB 4U1NB 3I75B 1A9EB 5IV2A 2XWTB 1HHGA 3GGWB 1L7TL 3L5XH 4G8IB 4JO4H 4U4BA 3HR6A 5ERWA 5D1XA 1CLYL 4DGVL 3G9VA 1H0DB 3HNSH 3HUJE 2AJXH 1SY6H 1U8HB 3ME0A 1UXSA 3CFCL 4WO4A 4AEIH 4X4ME 4I0KA 4OCSL 5E2WH 3RKDD 5GZOC 4H88H 4XI5C 4Z7OE 2Z92B 3WE6B 2H8PA 5FUOH 3MOBH 5CZXD 1N5AB 3ZDYE 4B7LA 2ATKA 5IF0B 4D8PB 3OG4B 4XMKH 5C0CD 1T03L 5C2UB 1N26A 3OXRA 3EOBB 2QQLH 1BWWA 2P5EB 3AY4C 1Q9OA 3MJ9H 2E7BA 3X13A 1IKNC 4LRIC 3W82A 3A6CH 2I5YH 3HMXL 4U3XA 1Z3GH 3V52H 2FIKB 2X4UB 4LSVL 1VGKA 3SQOL 5B22A 3CFEA 2V2WA 3VXPB 3ARDA 4YGAB 5DK2A 3DO3A 1CDIA 1DSFH 4G9DA 1NCTA 3DIFB 3S7GA 2F53D 5CIPA 3FFCB 3B9AA 2FECI 1RHHB 5CJXC 5JPMA 4HWBL 3C5ZD 5FECB 2H26A 4PJIE 5E2UL 3WHXA 3BN3B 4JPIA 3F7YB 5I1KL 2OL3L 2FJFA 4GQPH 2XNAB 5B39B 1P4BL 1P9MC 4RQQA 3CSBA 4JANA 3ZT5A 4QRRB 1BVLB 1MJ7L 2AABH 4QWWC 4ZPVA 4POUB 3TVMB 3S97C 3KYNB 5GGRB 4F2MA 3O4OC 1U8IB 4CAGA 3ARGD 3F65A 1WBZA 2BFVL 3IETA 3HMWH 3PHSA 3MFFB 2MCPL 2GY7B 5EO0A 4GFTB 4HJ0C 4P2QA 1AI1H 4FQXC 4HWEL 2VR9A 4N0YH 4TRPH 3MQIA 3D69A 4DW2H 2JTDA 3RWIB 2DQIH 3QAZB 2CKBB 4O2FB 2AEQL 1PG7X 4LCYB 1A6WL 3WFEL 1QVOA 2J6EH 2R1XB 4IMLB 5FKAB 1PEWA 1C12A 5CEZD 2NY0B 5DHVH 4FQQB 3CUPA 5L8LB 2OJZH 4ONHA 3X12B 3ECBA 1K2DB 5FA3A 5DJ6A 3X3GL 4V1DB 1QRKA 4D0DA 3CMOH 1P1ZB 1AR1C 3EFFA 4I2XA 4S0TD 4U33A 2PXYB 5BS0E 3FB6A 1J0KA 1FFNA 1A7OH 5E9DE 5HI4D 1AD9B 2V2XA 2ZPKL 1LO2H 2GT9B 3HE6D 1TPXC 2NY6C 4PJHF 3W11D 1QA9A 4YFEA 3E8UH 4XAWL 4UAOC 1Q0YH 3BP6B 2F54A 1ZVSA 3MV9B 1G7QA 4GRMB 1AP2B 4HCRH 3PNWA 1G6RA 5HDBF 2AJVL 5I8CB 3BW9B 3K46A 4HPYL 4TPRL 3ROLA 4PJHB 5MEQB 3CZFA 1U8QB 1XF5B 3F58H 3ULVF 3HR5B 2DQHL 5TDOA 3WFBH 1I7RB 5SX4I 1IL1B 1DBKH 2YSSA 1G9NH 3V6BR 5MHSD 3L7FB 4MDJA 5HGBB 2HT3C 5BOZG 2JKXA 4JZJB 5FKPB 4Y4KA 1QD0A 2B1HH 5A2LH 4U1GC 1FFPB 4XH2A 1MSPA 2Y07H 4C59B 3QUYA 4L8SA 2AVGA 4M7KH 4B50A 4JGJA 2DWDB 4OLXH 4S1SL 3DX7A 2AKRA 2X09A 3FOMA 2QEJA 5FYJH 4P2OC 3FJTA 5L6YL 3VXRB 3PQYE 1JUFA 3MBXH 4Q0XL 2XI9A 4QO1A 1F6LL 4L4TA 2X4PB 4Y4FC 3TH3T 4YBQD 5KVEH 2CLRA 3BGFB 4FZEL 3BD5A 2EIDA 4PRID 5CLWA 2V9TA 5DD3L 4HHAB 4NQCD 1JPSL 2VLKD 3HB3D 2KDGA 4KTEH 5F71A 1U8KA 1I8IB 1WV7T 2XXCB 4ZS6D 4K07A 5L0QB 4QRPD 5DK0A 3L6FB 5SWQB 1MREH 3EO0B 5GGUB 2P5EE 1HQRB 1R3KA 3IXTA 4HEME 4K9EH 2W9EH 3O41A 5BMFL 3EGSB 1UJTA 3E6HB 3U1SH 1K85A 3TEUA 1T66D 2VL5A 4G43A 2ICCA 3VGDA 3FFCE 3GSUA 4ZTPL 3GMQB 1M7IB 1JGEA 4M7ZC 4HC1L 3MRFA 3OPZL 4Z7UF 2IH1B 5E94B 3TO2B 3MZTA 5LWYH 2HA1A 3RZCA 4NPYB 2YWZA 1H3TA 4W4OA 3TJHD 5FFLA 4WTXA 3MRPA 4O9HH 3ULUL 4JAMB 1WFOA 1T0MB 2VE6A 1M1SA 2FYYA 5D5MA 3H0TA 2E6QA 4K94C 4QRRE 1JF5A 4XPTL 1PAMA 3OZ9H 1IARB 4NQSB 3BJLA 2YD4A 4P23D 1GVIA 4LAQL 4HIXL 5CJOH 2VDQL 1U93B 1JJUA 3D3VD 3EYSH 3PWLB 2R0LL 1NGYB 4FQLL 3WFZA 1OCWH 5IVXF 4OSUH 2E9IA 4LCCB 3O8XB 5GGVY 5H2BB 2MFNA 1UA6L 2ZCHL 3WFDH 3BPNC 2VLJD 2O5YH 4JN1L 1ZMYA 3KJ4C 3ARFB 2X4QB 3EJZD 5HJ3B 4UQ2B 5L88H 1EXUB 4PJCB 4RGND 5EC1B 3RKDC 1A6TA 3FQUB 4DN4H 5IVXB 5D7IA 5K59F 4M6MH 1EDQA 3JWDC 4Y16A 4Z18A 1OD7A 5DEGA 2KZ1B 2LU7A 1B0WA 4V1DE 3OJVC 4HIIB 4Q6IA 3WO4C 3OKLA 4BUHA 3SDYH 1OAQH 2M1KA 4HKBB 4XVTL 3RIAF 1I3RB 3KPOA 2A0LC 4MJID 5IVOA 5IMLB 1XGQA 4LF3B 1KIRA 5DJYA 4FXLA 2QQQA 3BDYH 4LPUA 5F88A 1RK0A 1H5BC 1H9VA 1OW0C 2N1KA 5IG7B 2UWEF 4WJ5B 5ITBL 2QSCH 3V2AR 5MENA 3AAZA 2DTSA 3GIVA 2G9HB 5DVLA 4GO6B 4LRNL 3PJSA 4HUVA 2AXGB 3KPSD 5DMIL 3FB5A 2DQTH 1AGCA 4YGVA 5I1HL 5CAYB 4PJHE 2UWEB 1P4LB 2XZQH 3DJ9A 3WNNA 3VXTA 5F1SA 3NFNA 4ALAL 2VNCA 4GBXD 4YBLC 3DVFA 4D0BB 1JIBA 3HPLB 1I1AA 1MCRA 4ODXA 4YDJB 5ACMA 3IAGC 1K4DB 1KBGH 4JQVC 4J3VA 1S9VB 5ABDE 5HDBE 2W92A 3GJFH 1A21A 3F62A 4P3DB 1TTUA 5KS9F 1U91A 3ULVE 1ADQH 3GK8H 2CRIA 3BQUB 4P4KD 1EEUA 3JV4A 3MRIB 3V7AG 3HNTH 1TCMA 4MHHI 5TDNA 2DQEH 3MNZB 1AH1A 5I1DB 3BDBA 4GMTH 5CD3A 1FNAA 3RGVA 1FVDA 2O5XH 2F19L 1OGAB 1TQCC 4HUXA 1TJGL 3QXTA 3TT3L 3TZVC 4X5XB 3IXAA 3VCLB 5EZIH 3JBG7 5F7MC 3PWVB 5AG9A 5B38B 2HLAA 4XP6L 3U83A 5C0DA 4TSBH 4POZD 3V4UL 5EIQA 1BBJA 4L3CB 1OTSC 5T1LB 1ZGLP 3EJYD 3THMH 3VI4F 3NCBB 1CG9A 3P4MB 1I3UA 3DRTB 1QSFA 3I9GH 1QLRA 5DJZA 3MZGB 5H94A 4MCYA 4HWNA 3KYOB 3QWOA 4E42B 2WM0A 5ALBL 2IPTL 43C9A 1NC4B 1XCTA 3QHFL 4ENEC 4Y2DA 1J9CT 3QXAA 5EIVA 3WXVH 3RBSA 2IADB 2ZUQB 5LQBL 5GSVA 1JZ5A 1D5BA 2IGFH 1RU9L 4NYLB 3P9MA 4IIQB 4WDIA 2DM2A 5C0AD 3V5HA 3VWKB 4OIBA 3HG1D 3WN5B 3QXWA 4OGZA 3T09A 3SCMB 4YHLL 2DLFL 1UZ8B 4Z7UE 5AD0B 3QIWA 4NNPH 3O11B 5MEPB 4PV9A 1BJ1H 4LEXH 2HMID 1CZ8L 2EKSA 5E24E 3C60A 1FVCB 3VFSB 4JJ5B 1KEGL 5E8NA 3S36H 2DJUA 4JZNB 4QHLA 1MI5D 4Y5XB 3D25A 1CBVH 5FYKE 1ETZA 2BVOB 4RA0C 1U6AH 3DETC 1KELH 4P46A 2A6IA 3C6LB 4PJ5A 4L29B 2GSGB 5DTFB 2I24N 4YHML 5D2LA 2J4WH 4MNQA 2FATL 5IVXE 4Z95H 4U6XA 3I02A 1WTGT 3VRJA 4RISH 4PG9B 3DO7B 3ZYOA 2LAGB 1C5DA 4LSSL 1H3PH 1S8DB 1GIGL 1HYRC 3BZFA 3QXVA 2P45B 1WCBB 3HE7C 4F7TB 1VB9A 1YEKH 4WW2F 3WMSA 4X4XB 1D6VH 3O4LA 2J8UF 4HUUB 5K59E 5F7DB 2RR3A 3STLA 1ACYH 1RUMH 4MCZB 4OF6A 1F4YH 4U1KB 3DYPA 4NP4H 4MB5A 4JFYA 3JVGA 4UTBL 4JFFA 4WW2B 1X5JA 1YEJH 4ZS7H 3FZUC 1ES0A 1S9XA 2B4CH 4CN1A 4LNRA 3B4NA 2IG2L 4YXHH 2UWEE 1T04A 1SJHA 2CIKA 1D3CA 1F4WH 1KCUH 1MHEB 3KPLB 1I9EA 2ZNXA 2BRRH 2F5BL 4NZUH 5TPWH 3OV6A 3TT1H 5MP6L 4P23C 3RVXD 1F6AA 4L3EE 3CC5A 2VDKL 2YZ1A 4XP5H 1W0WB 5KSAB 4JM2D 4AYFA 3N9GL 1FL3A 3ZKXB 1EFQA 3MLZL 4Z5RB 5CCKH 4G7YL 4KWUA 4NKQB 4ELKA 1BQLH 3UYPA 5C8JA 2N7BA 1S7RA 3BEVA 3NZ8A 4LSQH 5F1KC 4UQ3A 3VXMD 2VSCA 3NCJH 5KS9E 3KPRB 4NRXB 5BQ7B 1OGAE 4YHKL 1YN6B 4HFWA 4BZYA 1ORSB 4YPJA 2H41A 2OI9B 4WFEE 4Z78A 2F9BT 1ZHLA 5GJSL 3RX5A 2ZKHH 1FG9C 3ROOB 5I71C 5HHNA 1DANU 2AK4A 1VGEL 3HZMB 3SDCA 1NEUA 1A7NL 5LXGL 1MOEA 4X8XA 4M1GL 1XGPA 2D7OA 1Q94A 4PGDB 4M3KB 2AQ3A 4DUWA 1T1WA 5IB5A 5GS0C 2HN7B 2BDNL 5DD1L 4ONFL 1PQZA 1KIQA 3L3GA 3IFLH 1A6VL 1AXTH 4NOBA 4GG6A 3EJJX 4IRSC 5JIPA 5JORA 3KYKH 4MD4A 2Y5TA 3L5IA 2DLGA 4U1MA 1OHQA 2E5EA 4JRYA 4BH8B 1OWRM 1WT5A 3HKFA 4J3TA 4A6YH 3MJ7B 3W9DA 5IR1A 1PKOA 1JHTB 1CXEA 4HF5H 4KK6D 5DJAA 3FMGH 3QEGH 1RJLA 3QPXL 5EU4B 2VWEE 1S9WB 3IU3A 3MRLA 3NABL 1FC1A 2X2YA 5ID1A 1X6LA 4PRBA 2AV7A 1HYSC 3JTTB 4G6JL 4E41B 2YUZA 1LE9B 3SE8H 1YQVH 1A4JB 5A16B 4F58H 3FO0L 3MX0A 1YEDA 3TF7C 3MUJA 4OGXH 5I75B 5T3ZL 3QDAA 4Q7DA 5L8KB 4TUKL 3SBWA 4LNVA 1ZT7B 1Q72H 3AXLA 4PB0L 5EU3A 3VMNA 4ZUUA 4EOWL 1TZHA 2R1WA 2YD5A 1NAMH 2EH7L 3H3KA 2AP2A 2ADFH 3TO4D 3HNVL 1KUMA 3BZ4A 1QYGH 3QQ3B 3HA0A 3MGOA 2FL5A 1FJ1A 5DUBB 2R1YA 1OB1B 2BVUA 1IVLA 3WEXB 2C1OA 3HAEA 2OJEB 4OIIH 5F3BB 3QG6A 1RZIA 4XTRD 5J3HD 3ARED 1QBBA 4CN6A 4XVSL 4PRDA 1N0LA 4XCEB 1A7PH 3HI6H 1EFXA 4ZOBA 5I15L 4NSKB 3G5YA 5D7LB 3CX5J 3QSKB 5A40E 5H35B 3WBDA 3PABA 1J1XL 3QDGB 3ARBA 1PLGH 4WHTA 1KCVL 5CEYA 4WO4D 5F7HA 3PWPA 4U1SB 3P40A 5FYLL 2J8UE 4H1LG 1A14H 3P4NA 3RUGB 3G04B 4PJ8C 5IEKB 2FH8A 3CFJB 1PX4A 1CICB 2CK2A 3SKOB 3SKUD 3A67H 1EEYA 2GITB 3QZWB 1QFWL 5IW3A 5F96L 2OMBA 4PTUB 5BW7C 3R06A 2ATPA 5JW4N 3B3IA 3N1FC 1UWEL 3VGHA 5JA8B 3QP3A 3QNZA 4WY7H 3EHBC 3JWOL 4DZ8B 3BUYB 2ZOKA 1QSEA 4O58L 4Z9KB 5F6IC 2BNQA 5CBAA 5CHNA 4YO0B 1BQSA 1S78C 1A0QH 3RWFA 5K9QI 3HRZB 1AHWA 3DHJA 2G60L 1SY6A 2WZPD 4DK6A 1CFQA 4U6VL 3BIAX 2CR3A 1HXMA 4O4YL 2F74A 3B9KC 2MQ3A 4QT5B 2PR4H 1J8HD 4AL8L 1I8LC 3D1MC 3JUZA 4P5MB 4PGCA 5KW9H 3D9AL 1A47A 2AXFB 2WP3O 3STZB 4M7JH 2ARJA 3MJ9A 1FNSL 5BVPL 1INQB 3JTSA 6FABH 4XNZC 4Q6YA 3NCMA 1I7UB 3D6GA 2EYSA 5TF1L 3C9NB 2N56A 3I6LD 5EOCJ 4JQIL 5DJ8B 1JNLH 2PO6B 4NRZB 3NCYS 2CJUH 1IAKB 5EU7C 4I77L 3WIHL 4RGMB 3JUYA 1T83C 3MGTA 5F7NC 1KYOJ 2BSSB 4FTVA 2ZUXA 4H5SA 1UM6L 3VFWA 1F4AA 2DYPA 1ZLWH 4OZ4B 4XPGH 3LS5L 2F53E 3P9WB 4DKEL 1FG2A 5IB4B 1T20B 3O2VL 3LN5B 1HH9B 2JIXA 3HZYB 1ZT4B 4MQ7A 5HPMA 3U7YL 1DQLL 3SDDB 1FN4A 2A1WH 4GKOA 2HFFB 4DTGH 1LO3H 4QTHA 1OAYH 5C07A 5CP7A 5FO8A 5JW3L 1DJSA 3KPQB 4P9MH 5LAXA 2AQ2A 3PP3K 3UJJL 5INCA 3O6KH 2FWOB 3VFVA 5E4EC 4XGZA 1MRFH 4MAUH 3UTTA 4X83A 1HDMA 1QHOA 2ICES 4KHXH 3T1FA 4G8EA 4LVHB 2BNUA 1CN4A 4HX1B 2ZWLT 4R90H 2BVEA 4OAWB 2NW2A 5HHOB 1PW3A 3VE0A 2J6EA 2MWCA 3D85A 1JWMB 4NNXB 4LLDA 2FBJL 4N8VA 5DHVA 3DMMB 5I73C 1UQSB 1O5DT 4YC2B 2XOTA 1T89C 4LFHD 3Q6GH 5GRWA 2QQKL 3S4SA 3S88H 5DJ2B 1XFPA 1EHAA 4EI5A 2W65A 4YNYB 1JYWA 3MV7A 3QQ9C 1KTRL 2C3HA 1M05B 4Y4KD 2VIRA 1XZ0A 2C9AA 1DZBA 3MXVH 1L7IL 5DS8A 2O61A 4PJFF 3QUYD 1CDCA 4FG6D 4ZAKB 1DLFH 2OK0H 2D4DA 2GTZA 2XTJB 5ID0B 1G7MB 1C5BH 4HZLA 4HCRA 1EHLH 4L4TD 2IANB 4YIQA 4JREB 1JNNH 5JZ7D 3MRGA 3MREB 4PJFB 1VPOH 5JXAL 1FH5L 1RUAL 5C0RL 4OZIA 5IW1A 4UTAL 2DB8A 2GUOA 1DBBH 4QCIB 3GMRA 1YJDH 1LNUB 35C8H 4AEHL 4U7KA 1BBDH 3RUGE 3DGCR 3I6GB 4HLZG 4WW1B 5EZJB 1K3ZA 2CLVB 4JPKH 2Y4SA 4KK8D 3LZFL 2ADIB 2GJ6E 3DVGA 4LOUD 1E4KA 3HCVA 3UBXB 3VXOB 4YHOH 5DLML 2YD8A 1HEZB 5I9QB 1NFDB 3OR6B 3GHBH 2AEPL 5HYJB 4ZXBC 5E8PB 3LDBB 4MNHB 4X7EC 3SGJA 1A4KA 3PV6B 3RPKA 3O9WC 4RNRA 4ETYA 5LCVH 4LEOB 3LKPB 1T21A 4WTZG 3OGCA 4HIHA 1YEHL 2E7LA 2NW3A 5GGVL 1JFQL 4S2SA 3FONA 1HSBB 4CVWA 1JRHL 2VZSA 5IKCB 1PZUB 4M4PA 2YPLB 1LMKA 2CH8A 1BECA 4BQ6A 3E6FA 3WSQL 5I6XB 3K4DA 4ZYKA 4YUEH 3SE3C 3TO4C 3RWEB 1W0VA 2AQ1A 1R3IH 3CXDL 3RZCD 3MRCB 1A6AA 1GL4B 3QEHB 3O2DL 4PJ9C 3NPSB 4JEGB 3U6RB 1GGUA 1DUZB 1GC1C 4V2BA 2VLKE 4H8WL 5IJKA 1VFBA 4GAGH 4JY6A 4RAHA 2DKMA 1KB5L 1X7QB 2MPAL 3ARVA 1GCFA 1YEIL 3IFOB 3MROB 2R23B 1RZJL 4FFWD 1VFUA 1I9IL 2DQGL 3TNNA 4ZSOB 1AGDA 4KMTL 3QHZL 5BXFA 3LQZA 4YEEA 4FQ2L 1U36A 5DJXB 2D7PA 2GYSA 1NBVL 2BJMH 3LOWA 4ZFGH 4JFQB 3BFOA 3JZ7A 4HV8B 2W1NA 1I9RL 5E8OA 4PBVC 1N64H 3QQ4A 3OKOB 4XMLL 2Y6SD 4KZDH 4PRNB 4PRPB 5E6ID 4N9OB 5TDPA 2WUBL 5DWUL 4Y16D 2DQUL 2IQAA 3VFNA 5EORH 5FO9A 1JGLH 4HDIA 2Y9RT 1D5XA 2AJ3A 1IGYA 4X6DA 1LE5B 3I6KB 3VFGH 5D1ZC 4MZ3A 4ODHL 3HZVB 2R29H 2LAAA 4L8CB 1K6QL 3NVQA 1JPGA 4L1DA 5FDWA 5MEND 3MRBB 3O6FB 4LSUH 3T0EA 2DAVA 3RVTC 2Z8SA 3FKUS 3JV6A 4I18A 3GSWB 5HHOE 3S37H 4BSVB 5FYKH 5LKNA 1J86A 4Y5VB 2PN5A 3P77A 4BQBA 1E6JH 5IOPB 1I1AD 2PYEB 4PJDA 1Z0NA 4DKFH 3DXAB 4NKIL 5C92A 4J2XA 2OX5A 4DEPB 3BRFA 4LVNC 1HK6A 4DGIH 4X98A 1WGOA 5HI5C 3AB0C 3P2TA 5C9JB 1X5ZA 1BD2B 3QFJE 4RAUA 2AJZA 4R7DB 5EOCL 5AYUH 5HHPA 1TTGA 1UM5H 1I7ZA 1JNHA 4DAGL 3TWCH 4WWKA 2FD6H 4LP4A 3B83A 4U1IA 4P5TD 1E27B 1BAFL 1AGFA 1U58B 4OCYH 1DLHB 3QO1A 4WCYH 5LGHH 3RGVD 5HVWA 5DDHA 3SJVA 4PLJD 1I7TA 1UM4H 4PJFE 1CD8A 2XZAL 2Y5EA 4GRLC 1R3JB 2BZDA 1YECH 4XNMB 2DM3A 1K5NA 5I19L 3QNXB 4KRPB 4L9LA 3EOYG 3GJFA 4OQTL 1CFTB 2F5AH 3K8MA 2ZOLB 4Y7MA 4J4PC 2YD2A 1ADQA 4WI2A 5F7EL 1N59B 1WBXB 4R0LC 3KYMA 3RWDA 4X5WB 4NQEB 4C56B 4CW1B 5GGSY 4EN3D 1QSFD 4LSRL 3TPUB 1N6QL 2WIMA 5IFJB 2HFGL 2R2BA 3E2HC 4HPOH 1SM3L 4R2GD 3GSVB 4K94L 4ERSL 3K4AA 5M95B 4FP8L 1YEEL 2WIIA 4Y2DD 1PJ9A 3UYRH 1ONQB 4QOKE 3ISWA 4PG2C 4J7RA 3OHXB 3BGMA 1R3LB 2Q76B 3CDGB 3ILPB 1HINL 1ZHKB 4X6CB 3ETBF 4C4KT 2V7HA 1D9KC 1IAOB 3NIDF 4UT9L 3MBEB 5E0QA 4HJGA 2XWJB 4NZTL 3QIWD 1IGIL 1ZKAA 2W0LA 3GDBA 2Q8AH 1EEZA 1ZA3A 3C60D 3RDTC 2W9DL 4KROC 2B4CC 5C0BA 3FO2A 2IH3A 4Y5YC 4FS0A 3RIFF 3JWDL 3FT3B 2ZG3A 4BELD 3QCTH 5BCAA 3TN0A 1BQHA 4P46D 4L1HA 4OM0H 3WHE0 4OTXH 4PJ5D 1QFWI 4DKDC 3LN4A 4RFEA 1DQQB 5DMKA 4MNQD 3WIFB 1UWGL 3MA7B 4ZNCD 2R2HB 1LO5B 2JK5B 3D2UB 5IUSA 1G7HA 3W9EB 4BZ2L 5GSRB 3LKQB 3RVUD 2FHCA 1UH2A 2R0ZL 2D0GA 1F97A 5C0AE 1IKFL 4WI6A 5I1EL 1IFHL 1G7IA 1AXIB 1CLZL 3ZYZA 3IKCB 1SMAA 4WI8A 5IHZA 1MRCL 3G6JA 3IKKA 3O4LD 4GUPB 1HKFA 5HGHA 4LLWB 3KNBB 1GGCL 2AK1H 3SDXF 4CN4A 2I9TA 1FCCA 3GHEL 4M93C 4FOMA 5B4MC 3GUTA 1F2XK 1G6VK 4HS8L 1HSAA 5D1QB 2W38A 1DN0B 3EZ8A 4JFFD 2WMPA 4OUUB 5DRNB 3L1OL 2VXTH 1FYTB 4X9FA 2NYYC 4WUKH 1KPUB 1MUJB 2VUYA 3I3DA 5HHXH 2GAZA 3T1WA 5J11B 4NWTH 2F8VA 5ALCH 4M5ZL 5DMGC 2PYEE 4M6NL 4OJFL 4XCFH 5CP3H 2DLTA 1A6ZA 4IRJB 4TNVF 5HHQA 4JDTH 3RHWF 3KPNA 1L7TH 5DRZB 4GW1B 4WGWB 1CLYH 4JCMA 3CLEH 1QNZL 4K7FB 2VAAB 3V0VA 2WBJA 3DYMA 4H26A 1VFAB 1AFVH 3CFCH 3UXFA 4OCSH 3WS6C 3OKDB 3U0TB 4LQFL 5D9SB 5SX5H 1WFUA 3LIZL 1T2QL 4P99A 3K0WA 2B39A 3FO9B 4JJHA 4XPHL 3Q2CA 1CFBA 5E6IC 3SGKC 4YR6A 3FN9A 4JRXE 4LVOB 3KAAA 4PJGB 3P73A 2YEZB 1WIUA 5DJCA 1P7QD 3HMXH 5FOBB 5ECJE 3RWCB 5HYIA 2NY2B 4LSVH 4D9RE 1OP3K 2XN9B 3MRJA 3SDCD 1CFSA 4Y4HC 3REVB 2X7LB 2CXGA 2D7QA 2VZOA 1A6UH 4QY8B 1XGTA 1NQBA 1Y6NR 4XC3H 1NCDH 3OAZK 4N0FB 2VKXA 4ODUA 1YYLL 3J8F7 4NQEE 5DQJB 3IDNB 4C56E 2CQVA 2G5BA 1QRNE 4PV8A 5E2UH 2WQ8A 1C5CL 3UCRA 2HJLB 3CFIC 5IVZA 3G6AA 1S5HB 5JHDB 1P6AB 4JRYD 1IE5A 4Z0BL 3KHQA 2FX7L 3VD7A 2EYTA 1QFPA 5HD8C 5DC0A 3C5JB 4KK5C 5DMJB 2BFVH 4KDTA 2IPUG 1AD0A 4MVBD 3WJLC 1S9YA 2ZSWA 5GRVK 1E4JA 5T1MB 2XPGB 4I3SL 1KIUA 3TBWA 3H8NA 4HBCL 3VRLF 4JVPA 2AEQH 1PG7L 2ZCLL 3WFEH 4AEEA 5ICZB 1U3HD 5DUMH 1KB9K 1QTYT 1LP9B 3VDBA 4U7MA 1A6PA 1IQDA 4P5TC 4PY7A 3NIDE 4J8RA 3RPIB 3MA9H 3FB8B 1K8IA 3U4AA 3X3GH 5TJWK 3MLYL 1KPVA 2NR6C 1S7TA 5T5NG 2EDDA 2EC9U 4JG1H 3QO0B 3ZL4L 1T1ZA 3G5ZA 4A6YA 5HDOA 3B2UC 1XGRA 5AG8A 1M71B 3OSKA 5ICYB 1IM9B 4NO0B 2ZPKH 3R0NA 1MFAL 5JOFA 1P2CA 3I85A 4JO1H 1KJVB 4XAWH 1T6WA 5JQHC 1CD1B 4Q2ZA 5EBMA 4B53A 1EFXD 1ORQB 3GM8A 5I1IL 3BO8B 1HI6A 4XHJC 1FV1B 2AJVH 1UJ3C 3DX6A 3KG5A 4EN3C 4HPYH 4TPRH 4D94A 5FYLE 3ARBD 3BAEH 3JWNC 5I8KL 1TMCB 3QFDB 1TZGL 2Q8BL 3TBYA 1QLEL 4CU8A 4ZODA 4YDVA 2DQHH 1RIHL 3C8KB 1CGSH 4N68A 2IJ0C 2Z4QA 3PWPD 1NAMA 1IT9L 1ZK9A 4P0DA 4PUBL 3SDXE 5SWZA 1DP0A 2OS7A 3ARXA 5BS0A 2X4TA 3RTQB 1AKJB 4EDXA 2NZ9C 5E9DA 3NBNA 4APQA 2DQCL 2GCYA 4LPXA 4M1CC 4D9LL 1RZGA 2GI7A 4S1SH 3TP4A 2FIRT 1DBML 2NY4D 4JFHD 1KJMB 5L6YH 2BNQD 1NC2B 4Q0XH 4ZO9A 3KPMA 1HN1A 4B5EA 4XC1L 4N5EC 5F9JB 4F9PC 1FZMA 5HDLA 3NH7L 1DQJB 4LFHG 3O4OB 1UCBH 2XZCH 3H9YA 4UNVA 5IEHB 1X5YA 4I3GA 2FR4B 4IS6A 4LGRB 4FQXB 4JN2A 5JW5B 2APWA 1KTDB 1VACA 2IAMA 5HGAA 5C6WH 4R96A 1KB5B 1N3NB 5CEXA 5A43C 1FVEA 3AMKA 2LU3A 5DA0B 2NX5B 1B4JL 1ZOXA 4G42B 2BC4A 3H7BA 4XT1C 1RIVH 3S96A 3X11A 3L7EB 1J05A 3EOAA 3MNWA 1UADC 2P8PA 2FJHB 1ZGLA 2DM7A 4UT6L 3K2UH 3SY0B 4PREA 4U1NA 3I75A 1K8DA 4FTVD 2XWTA 5EBGA 3RVWD 4G8IA 4PJ7B 3UP1A 3PQYA 2NY0C 4ZTPH 3KYAA 2AXJA 4K8RC 1MELA 1MEXL 2DYPD 3BH9B 4C54A 4HC1H 3SKMA 1TPXB 2NY3C 3OPZH 1U92B 3QWQB 1U8HA 3GSQB 5E7BA 5D70L 2CK0L 4KGJA 3H9ZA 1KTLB 3WE6A 2FX9L 1IAII 4QNPF 1RPQA 4MS8C 3VD3A 3VXUB 5ENWA 5JHDE 3NFSL 4XPTH 3GSXA 3BZDA 4NC0B 3EOBA 2P5EA 2MQCA 4QHUB 4LAQH 1BZQK 2G75B 4GW4B 4U1HB 5LJYH 4E0RB 2R0LH 4FQLH 2CGRL 2H9GA 4FHBD 1QFUL 2FIKA 2X4UA 3UTTD 2D7NA 3KLAB 4UILH 2IFGA 2KBGA 5ESQA 4JB9L 4S1QL 5D7IF 3VWJA 3DIFA 3NZHH 5DRWB 5GJTH 4R3SB 3FFCA 4P2QE 4U1GB 1NCCL 3D85D 1RHHA 5CKGA 3CPLB 3DBXB 4IDJL 1X5GA 4DOHB 2BX5A 5FECA 1RUKL 1XIWC 2BHZA 2C3VB 4P2OB 3CFDB 3FQXB 2QQNH 3F7YA 3VRLE 3C2AH 2Q3AA 4MA8L 3UROR 3CDFA 4XCYB 4Y4FB 5B39A 1SEQL 2K1MA 3MV7D 4XVTH 5T5FL 3GB7B 4QRRA 1BVLA 5DQ9B 1L4IA 3EAKA 3TVMA 15C8L 5AUMA 3KYNA 2GK0B 5GGRA 5CZKA 1RUQL 1KCSL 1U8IA 5FXCH 2ICWI 3MFFA 1MVUB 3MRMB 3BGFC 3CDYA 5CGMA 4LRNH 4QYOB 3RWIA 2BSTB 2F54E 5I1HH 3GNML 3B2VL 4LCYA 3QI9C 2R1XA 4IMLA 5FKAA 5JDSB 1TCRB 3WLWC 4FQQA 5L0QC 2H2SD 2ZCKL 1K2DA 4V1DA 1X5LA 1EUUA 4IM8A 1P1ZA 4YJZL 2PXYA 2VLME 1EGJH 5F7YC 4JR9L 4P3WA 1AD9A 2C7UB 2GT9A 2RFXB 1VEPA 3QDJD 3VFMB 4OI8A 1XEDA 1A64A 3WFCH 5GISH 2CXKA 1I9JL 1ND0A 1U3HC 3BP6A 1OT2A 1ZHNB 5CJ8A 3EYVA 3CFKB 3MV9A 4HT1L 2F19H 1AP2A 1TJGH 1QPPA 4JFXB 4WNQB 5I8CA 1KFAL 4PJHA 4JGUA 5MEQA 1U8QA 3HR5A 3O3AB 3DRQB 5F1NB 2BHYA 4L8DA 3BPNB 1IL1A 3KJ4B 1FPTH 3V4UH 4XP4H 5HGBA 1UACL 3Q3GB 1E6OL 1KLGA 4JZJA 2P46B 4BKLB 4LCCC 4LMQI 1KENL 3NACL 3HTLX 4NUGL 1FFPA 3TIEB 1WVZA 3ARFC 2L7JA 4NHUB 1OD9A 4JPWL 3DUUB 3WO4B 2DWDA 4D3CL 5CZVH 1RJZB 2FH6A 5K93A 2NXZD 4LU5H 4KJPD 5IJVB 2DBJA 3PE9A 4HK3J 4YEFA 3QHTC 3U9PL 4JZOB 5ALBH 2IPTH 4DUXA 1XT5A 2X4PA 1H5BB 3QHFH 4URTB 2EEBA 2VLRE 3ZE2F 4XMPL 3N1MC 2DLHA 3FRPA 5LQBH 1RU9H 5HDQL 1ZVHA 1U8PB 1QBMH 4XX1E 5JLZB 4HHAA 3H3BC 4YHNB 2NY5C 2HT2D 4R7NB 4YHLH 1I8IA 3RVVD 1FFOA 4FQIH 2X4SB 5GHWL 3L6FA 1OP9A 5SWQA 3EO0A 5GGUA 4ACPA 1CZ8H 4OCNC 5GRZA 1FLTX 1HQRA 2H1PL 3O3DB 4WFHE 9CGTA 1KEGH 4QNPE 3EGSA 4TVSa 2O5ZH 3E6HA 3PP4L 3EOTL 1S7QB 3T0ED 3OWEA 4YHMH 4MQXD 1E4XI 3GMQA 4G6AC 2FATH 3AVEA 1M7IA 1NDGB 1F4HA 2GW5A 2PTUA 5E94A 5D6DC 1QOKA 5FM5O 5GIRB 3TO2A 3EYUH 4LSSH 3OAYK 4U31A 1GIGH 1EHNA 3WL9B 2DQDL 1TQCB 4JAMA 1T0MA 3T0XA 3SDAC 4R26L 4YHIB 4Z7UA 4NQSA 1P69B 3TZVB 4NO3B 4JPVH 5FM8A 3H6JA 3AFLA 1U93A 1I85A 4FABH 3PWLA 1NGYA 4RFOL 5IVNA 4MXWL 4UTBH 1CLOL 2VXSH 4WWKD 2W07A 5F7WC 1LDPH 3O8XA 4UBDD 1OARL 4JY4A 3LCYA 5H2BA 4DN3L 3RL1B 1F11B 1OSPH 2AW2A 3TC9A 2X4QA 4UQ2A 3ZTJH 2YPVL 3SJVD 1EXUA 4PJCA 1WICA 1OL0A 3Q5OA 1JF1B 5IVXA 1C7SA 1MCPH 5KVMC 1CD9B 4GMSL 1F3JA 2F5BH 1V3JA 3NIGF 3RI5K 5I1CL 2J1KA 4HIIA 5MP6H 3W0WE 3H3PL 1VADB 3UJIL 2VDKH 3OB8A 4ZD3L 2AS5M 2VXVH 3M17B 1J87A 4HKBA 3S36X 3W39B 1I3RA 3O3BA 4HKZB 3U0WL 4UIKL 3BUTA 3MLZH 5IMLA 4LF3A 5J8OA 4G7YH 2X4OB 1DE4B 5IK3B 2JF1A 4QHNB 1JNJA 4WJ5A 3VG0L 3MMEB 5CILL 5IBLD 3PWUB 1HH6B 1UKSA 1HCVA 2G9HA 4IOFD 1Q1JL 1CDHA 5CSBA 2X42A 4Y19B 4YHKH 2AXGA 4RBPH 1Z9SA 2YZ8A 5T3XL 3DOSA 3BKYL 4RDQF 4EQ2A 3WN5C 1MRDL 2UWEA 4S1DC 1P4LA 1IBGL 1NKOA 5GJSH 3SCMC 5HTSA 3OMZA 3B9EA 2HJKB 1VGEH 2R2CA 3BJ91 3HPLA 4YDJA 5SWSB 4OCRL 1K4DA 5LXGH 1JCKA 4AQ1B 1S9VA 4M1GH 3PHQA 2EDBA 4RBPK 4NQCB 3T8XB 4OLWL 4P3DA 1OAKL 5KOMC 1F42A 4JE4B 1UEYA 2BDNH 1BWMA 3BQUA 4ONFH 2WW8A 5C0BD 3U7AA 4PJEB 4JFEB 4ZTOL 3CLFH 2NXYD 3MRIA 3HE7B 4MZ2A 2YK1L 1A6VH 3S9DB 4Q9CA 5C08E 1TFHA 3DV6B 3WUZA 3TN0D 3MNZA 3V0WL 5I1DA 1ACZA 2EZ0D 1FZJB 1OGAA 1YMHB 2P8MB 3IFNH 3LEYL 1FGNL 3UZVB 2WINB 4X5XA 1OPGL 3VCLA 3D87B 4YDKL 5IHUH 5A2FA 1NGXB 3BMVA 1HXYB 5B38A 1OOAA 3NABH 4G9FB 4G6JH 3QUKB 5JOPE 1ZS8B 3BKJL 4N0RA 3ZE2E 3OKNB 5J4MA 4K3DL 3IVKB 4NUJB 4AY0A 2CUIA 4L3CA 3VFTB 3DGGB 3LHPL 2YRZA 5EA0H 3D48R 5LGJB 5T3ZH 5T1LA 1ZLSL 3VXSB 3LKOB 4IOSD 4XPBH 4O02H 4TUKH 3P4MA 3MOAH 3RQ3A 5JO5A 1GGYA 1NEZB 4TSAL 3DRTA 5K33A 4PB0H 5A3IC 4P23B 1CI5A 4Q9BA 4CMMB 2PW1B 4F15C 4EBQL 4EOWH 3D3VB 2LFGA 2EH7H 7FABL 4E42A 3HNVH 3VH8G 2LTQC 1NC4A 4I4WB 1FGVL 3MSPA 2FZ3B 2IADA 4NYLA 3VWKA 4IIQA 5EBLB 1U2CA 4XVSH 1KOAA 1FLRL 1INDH 2DI7A 4HG4J 5I15H 1J8KA 5DR5H 1UZ8A 5JPNB 5AD0A 3P30H 5IROC 3E1F1 3PGDB 1J1XH 1NGQH 3CVHL 5I71B 2WBJD 1KCVH 1FVCA 5CFHA 5HVHC 5GGQL 1EVTC 4MJIB 1QHPA 5FYLH 5EUOB 1W8NA 3MYJB 4QXTB 4Y5XA 2ERJB 1Q9KA 4NC2B 2BVOA 1F90H 3MRKB 3LVEA 3C6LA 3HAEG 4XNQB 3TJEL 2GSGA 5E95B 2FRGP 3P0YH 5IESL 1H3GA 2DDQL 3H42L 2EDEA 5F96H 4ORGB 2PKDA 4PG9A 1R5IB 5C6PB 3DO7A 1UWEH 5CP3A 3JWOH 1LEIB 2YR3A 4NQXB 4IRSB 2PCPA 4O58H 1S8DA 1G6RL 1WCBA 4NQDB 3V4VL 4G8GB 4F7TA 1FQ9C 4GBXB 3U4BL 2X40A 1QO3A 4HGWB 4X4XA 3D18B 3QCVL 5F7DA 3UDWA 1UG9A 1FL5B 4MB4A 2G60H 4WI9A 4U1KA 3NIGE 2BSRB 4AENB 4U6VH 5E6YA 4AM0B 3PF2A 4I9WE 3SGDI 2ZUTA 3U7WH 4O4YH 1J0JA 4MQXC 4WW2A 2J8UA 3LPWA 1K4CB 4OZHB 4Y19E 4KKCD 3BEWB 5BZDB 3ZHLA 4NT6B 5F72S 1A1MB 5BVPH 3L5WA 5JXEA 3HMXA 4KU1A 5DYOB 4R97C 1AGBB 3T2PA 4ZUVB 1EA9C 2ENYA 3KPLA 1MHEA 4JQIH 3WNMA 1P53A 1S5IH 4KVCL 3MJ8B 3WIHH 1S7UA 4LLYB 2AK4E 1JF6A 1MHCA 1W0WA 5KSAA 5EO1B 1OAUL 3LS5H 4Z5RA 3MLRL 3RL2A 4TUJB 3IDMA 5DZLA 4KH2A 2IQ9L 4QRSB 4JFEE 3W2DL 2R56H 5F3HA 2A9ML 3IJYB 3O2VH 3WHE1 3UAJD 4P59H 1EO7A 2FEEI 3LH2L 3H9HB 3DURB 3U7YH 4W6YB 1DQLH 4XAKE 5BQ7A 1KF9B 4GSDL 1YN6A 2ED7A 1D5ZB 4M03A 3QIUA 4J12A 2FDBP 4C4KO 5JW3H 5DI8B 2YA2A 5EZLB 2EO1A 3ROOA 3FN0L 4G9FE 4ODWB 4PJ8B 3HZMA 5J1AB 1NANH 2OMNA 4G6FD 3HG1B 2KKQA 2HN7A 4CVXB