5D93C

Oxidoreductase fragment of mouse qsox1 in complex with a fab fragment from a mouse qsox1-specific antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
207
Chain Sequence
QVQLQQSGPELVKPGASVKISCKASGYSFTSYYIHWVKQRPGQGLEWIGWIYPGSYNTEYSEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYYCARSEDWFAYWGQGTLVTVSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Overcoming a species-specificity barrier in development of an inhibitory antibody targeting a modulator of tumor stroma.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Sulfhydryl oxidase 1
total genus 43
structure length 207
sequence length 214
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d93C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d93C02
5B4MC 3HZMB 3W0WB 5F89A 3ULVH 4WW2B 3DXAD 3FB5A 3OHXA 1VFAB 3G6JB 4PUBL 1N7MH 4XBPB 2VN7A 3Q6FB 3OZ9L 4M7LL 1BQHA 3FB6A 1DVFB 4JE4B 3JUZA 2FCBA 1OB1A 1HQRA 1LD9B 2H32A 3SDCA 2YPKB 1KACB 5DEGA 1IAII 2OMNA 2HA1A 4WFFD 5IJKA 3QDAA 1FN4A 1LD9A 2NTFB 4PBXA 2GK0A 2UWEF 5HHXH 3L3GA 5HYJD 4E5XA 3HHRB 1OM3H 4F7CA 1FC2D 2J6EH 4PB9H 5DXWA 3SE3A 5KVDH 3U30B 2E7LA 2BY1A 2UUDK 3B83A 3MLZL 3O6FC 4HS3B 5SWZE 1NMBH 3RVXD 3UTZB 3ZTNH 2KQNA 4AQ1B 4Q58C 5GS0H 3V2AR 3P4OB 3I2CL 3MV7D 2NPLX 3D0VA 1IC5L 4QRPA 4UT7L 4X6FB 4PJCF 3PGFL 4M02A 1T1XA 1BX2B 2EIBA 5E2WL 4HUWB 1U8LA 2PW1A 5DMIH 3HG1E 1MCFA 1CVSC 4PP1D 3O3DB 5DD3H 5E8DH 4ZNEE 3S34L 5FO8B 2Y06L 3QIWA 4JFEA 3EOYG 1MHPL 4FQLL 3BZ4B 3ARQA 5LGKA 3RVUD 5IJVA 4OZIB 4PJBF 5KSAB 2R2HB 5KSUA 4MJIB 4ELKA 3W2DL 1CU4H 3HG1D 4U1KB 5E8NA 1N2RB 4LCWE 5FDWB 4LCWA 4MA3A 4Q9QH 2BOBA 2EXWC 3IJSA 3E6HA 1SJXA 2EE2A 4IBLT 1IT9L 1T4KA 4HJGB 4D8PA 2EDJA 4R8WH 4M93B 3KNBA 5F9OH 1FG2A 5T1MB 4LDEB 1G7PA 1MRCL 4MHHG 4HS8L 1D5BB 4FQHB 1Q0XL 1DQTA 1PW3A 3OKMB 3P11H 5KW9H 2Z35A 1OAQL 4UT6L 1UM4H 5FUCC 2Y1VA 4GT7A 3VFMB 1I8MA 3WJLC 4KK8C 3MFFA 1QLEL 3FZUD 2VDLH 1MWAA 4P5TA 5GRYA 2ZJSL 5MI0C 2ORBH 1AO7B 4X6CF 2ZKHL 3HE7C 5CJ8A 5EOCH 1SBSL 2QQLL 1HWHB 1GPOH 3TH4T 1ADQA 2VERN 3NFNA 4UV7L 2A74A 1NBYB 3VI3E 3RRQA 5DT1L 5MENB 2GUOA 3OSKA 4HBQA 4NCC1 1B0GA 2YEZB 5CKGA 4D3CH 5L7XH 1B0WA 1FZMA 4H26A 2W9DH 1UGNA 5IFHH 4OLVL 4NQSA 5CINL 4UIKL 2V5MA 5J1AA 1KJMA 3NBNA 3BIKA 1A9BB 2XA8H 5KG9B 1OT1A 4OZHB 2C4FT 5TE4L 1Q1JH 4KRMB 4WHYG 1XR8B 1JTOA 1KB5B 5ENWB 5ETUA 3V52H 3PWPD 3NFSL 3ECBA 1HINH 1T0NA 3JWDL 4OQTH 4KTEH 2AJZA 5TQ2L 3JWOH 5E94B 3PQYD 1SYVB 4MJIE 4N8VG 3X3FH 1IGIL 2Q7NA 2BSTB 1KCVH 3TA3B 3MRHB 1FRGL 2DM3A 4G42B 2EDYA 4ZD3H 5K9JH 2R8SL 1XCQB 1AGBB 2DQIL 1UJ3C 2F54E 3EDJA 4TULL 5CJBA 4GBXC 5L2JB 5D1XA 4ZD3L 4JZJC 3WE6B 3QIBA 2PKDA 4ETYA 4PJEE 5H35B 1YQVH 4MQSB 4JCMA 3VH8A 4NQXB 1IZKA 4JQIH 4KROC 5EN2A 1K9TA 2OZ4L 2HH0L 5EBWB 2KPNA 1R3KA 3RKPA 2A2QT 1M1SA 4UB0H 4CVXB 5I16B 1NCBH 5FOBA 4I3SL 3GIVA 5CIPA 2OI9C 3ES6A 4M9PA 2R0LL 3PF2A 4JY6B 3LEVH 5CHNA 2HTKC 5F3BB 4LRIA 2CGRH 2NW3A 1UB6A 2G9HB 3WBDA 2A0LC 2ADJB 1CZ8L 3EFDH 1MCQA 1QSVA 2A6JB 1A6VH 4LLWA 2EZ0D 1KJ2B 1RZ7L 3IDYB 4EXPX 4XCNB 2LVCA 3VFGH 3P30H 1FSKB 5GRZA 1YPZE 3UX9B 3S4SA 3OAYH 2OL3B 3FTGA 3QH3B 4PJ7B 4YHKH 3RJDA 1U92B 5HXMA 5EU6D 4PJ9D 3IVKB 3QA3A 3QULB 1C5BL 1LO4L 1ZSDB 2I24N 3AREC 3LN5B 3RA7H 5E9DB 2WIMA 2V9RA 1AXTL 3IDGA 4HC1L 2EIEA 2DI9A 3BPOB 4PJ5E 2YK1L 4GG8B 4RX4A 4LLDA 3P9WB 1T04A 1WTLA 3DROA 4RZCA 3T0EB 2R1WB 1KN4H 5JUEL 1MRDH 1KCSH 4MXVF 2YUZA 3C08H 4P2OA 4OQTA 4B0MM 5ICYA 2A73B 1NMAL 1QYGH 4HZLA 1B4RA 2IC2A 1G7MA 4KMQA 1CXIA 2G60L 3KWWB 1JK8B 3BN9C 3CH8A 3MLVL 3WXWH 3VH8B 1HHJB 1S9VA 2VLRB 4DKFL 4K9EH 4MVBD 3KLHC 1RVFH 1KCRH 3WNOA 5M7QA 3L3IB 2XG4A 2ITDA 2AKRB 1TJHL 1YNKL 1R0AH 1F42A 2E5EA 4MQ7A 4RRPA 4JM2C 3M45A 4TSBL 2HFFA 1AP2B 2EH7H 3OXRA 2OXGA 4W68A 3MRBB 3ZDXE 4U4BA 3VCLA 1CFTB 3HNSL 1A7QL 4NRYB 1S7SA 4XP6L 1BECA 2YR3A 5A2KH 1VFAA 3G6JA 1FNSL 2CRMA 1CICB 4M48L 5E24E 4JM2A 1NFIA 3QIWD 4JFED 4PS4L 1NLBH 4M48H 1A9BA 4GBXA 5T33H 4XPFH 1UKTA 2GHWB 1F4YH 3LQAH 1U8HB 1NCAL 4LP5A 4OLWH 3RU8L 2X9XA 1IAKA 2LE9A 3TO4D 2AK4E 3C5ZA 5FO9B 4MD0B 1JGEA 5HHXL 3D87B 4GLRH 2FECI 4HUKB 5GRXG 3WHXB 4YO0B 1IGJA 3K4DA 4EUPH 4ONOA 4UDUA 3LKPB 3UYRH 5JW5B 3GI9H 1CS6A 1L9NA 4N90E 4M6MH 5E2UL 2GYSA 5FUOL 4JO3L 4ELMB 4OV5A 1ZE3C 2P8PB 1AGDA 4R4ND 1VKXA 3VFPB 1CDHA 5EUKB 4ZFOB 2YWYA 1I8MB 1RPQA 4NC2B 4LCUA 4LHUG 2V7HB 1T1ZA 3HUJE 5ICXA 3VRLF 5CJQL 5CBAA 1DEEA 5CJXC 4JY5H 2YC1A 1UZ6E 5CD3B 4PLJD 1ZT1A 4MD4B 4OLUH 5DA0B 3FQRA 5BXFB 1KPUB 2L0DA 5IK3A 4QRUB 1MELA 2DLFL 4OLUL 3BXNB 2BVYA 1GGIL 3FB8A 3GO1L 4DKEH 5IMKA 1D6VL 3JV4A 4U6TA 5TE6L 3DGGB 3MJ6A 3OMZA 5I17A 2PYEB 5D2LA 2N4IA 1WF5A 4J3WA 4UV4H 5C07A 2BX5A 1BFOA 1RJYA 4HCRA 4CADA 1T1XB 4U1MB 5T1DL 4IRSB 2AW2A 3CH1A 1K8IA 1TQCC 2WBKA 1EERB 2AV7A 2B8OT 4LKCB 1MEXL 1P2CA 2QR0A 2V5SA 4F8QA 1LNUB 3ARBC 2JJSC 5F9JB 1TVBB 2J2ZA 3BSZH 4ISVA 5GRUH 1O5DT 4R26H 5FFLA 2LAAA 3U30C 4KJWC 4Z7OE 3DYMA 3IF1B 3OJDB 4RBPH 3S5LA 4YFLF 1GAFH 1T1YB 5D6CB 2AEWA 2X1XR 1J5OH 1ZVHA 1HHGA 5D2NA 3HUJA 2GK0B 1LE9A 4K3HA 3SN6N 1MRFH 3D2UD 4M43L 4FXKA 2Y07L 5L9DH 4YGVA 4JPIA 4TTDD 4AEIL 4HS3A 1DTUA 2XQBH 1FFPB 4XGZB 1LP9B 3NIDF 2KZWA 4AEIH 1LGVA 5I1HH 4LCIH 5IHZA 2DJSA 4UAOB 5HI3C 4W4NA 4HIIB 4WHCA 4J3TA 5HGDB 2HFEA 3VXME 5FB8A 4GRLA 2DJ4A 5IF0B 1FVDA 1TVHB 3DXAB 4WDIB 2IPTL 1KIRA 4R0LC 5FYKU 3QJFB 2R4SL 1XF5B 3QDGA 5IF0A 5BRZD 2F8XC 3PHQB 1NMCB 3QQ3A 2DQCL 4PJCB 5TF1H 3K46A 4GRWF 3O8XD 4XTRC 3X11B 5FYKH 2HG5A 3S37H 2B4CC 2VTFA 1XF5A 3QDGB 2H2SD 3DMMD 1OGAA 3WXWL 3ZDYE 2DOCA 4R0LB 3FT2B 3KPNB 4NZRL 5EIIA 1RVFL 1H3GA 5BMFL 3AC0A 3BD5A 4BZYA 1BQSA 4NRZA 4PRHD 4M8QA 2R15A 2F53A 4G9FE 1KELH 3VWKB 2DRUA 4QWWD 1NGXB 2MWCA 3RX5A 4GMTH 2CR6A 3HR6A 4DKDC 1XH3A 3NH7L 5D1QC 2CDEB 1P84K 3X3GL 4MNGE 5EOQL 4PJGA 3LN4B 3U36A 3RWEA 4OFKA 1YMME 4IRSA 2DKSA 3GSVB 2EYSB 3DMMC 1UCBH 4JFDD 1T2JA 3GRWH 5CD5C 4XPBH 8FABB 3IT8D 3S97C 4X7DC 4X4YB 2Z8WC 4PJXF 4ZFGL 5E2VL 2BNRA 4MNQD 4Y4FD 4M00A 1WC7A 4LKCA 2IADA 2AV7B 4DJMA 1HK6A 1PG7H 2E9WA 1BWWA 4UTBH 1TQCB 4ONGL 5DJYA 3U0WL 3BDYL 5LVEA 4J8RB 4JKWA 1S7TB 5IW6B 3B2UD 2AERT 5D2LB 4CN4A 1MY5A 1OF2B 3ARFB 3NCEB 1NCUA 5C2BH 3BXNA 3MLSH 4IMLA 3SPVA 3S4SG 2ARJQ 1E4XH 4P9ML 1CGSH 4P2RB 3S8WA 4I48B 2ZSVB 3EOAB 4KUZH 3MZGB 4X9BA 4GQ9H 5E8OA 4RGNB 1G7QA 4NM8L 4Q2ZB 4X5LA 1DL7H 1QHPA 4OBRA 5IW1A 1LO3H 5C0AB 1G1YA 2ARJB 1LK2B 1H3UA 3IAPA 5BO1L 2YA2A 1G84A 1KPRB 3MYZA 4MB4A 2APFA 2I60L 4JFQB 3STBA 5CGTA 5LGJA 1BZ7A 1DBML 3MUGA 1X5XA 3X14B 1VFUA 1TTFA 5CKAA 5TQ0L 1R0AL 1NANI 5SWQB 4UV4L 1NBVL 4X7FC 3QRGH 3JTSB 4ZAKA 1I8KB 4NQCD 4Y5YC 4O2CA 3MR9B 3GGWB 4ZOAA 5E4EC 4PRNA 1MWAL 1Q0XH 4K8RC 4HWEH 1HDMB 1M7IA 2AXHA 4BZ1L 2IFFH 2DMCA 3OPZH 5DD0L 4QNPE 2Y25A 1IAIL 4TQEH 2OLDA 1OAKH 4LSTL 2IQAB 3QZWB 3MRLA 4YPJA 1FDLH 1KT2A 4JFXA 5JPMA 4PLJC 4DVBA 3GMMA 4PP2B 1TCRB 2VQ1B 5IV2B 1I9IH 3FN9A 5EU3B 4BH7B 4U1LB 2X2YA 4APQB 4XB8A 5C0CE 1JPST 4ZO9A 5EH1A 2A1WL 3EOTH 1VFOA 1ND0A 3AXLB 3AMKA 5EOCJ 3STLA 1EEZA 3RJQB 2X7LA 3SKMB 1OP9A 4NJAH 3T65B 5L8JB 4OUOA 3RTQC 4XXDA 4NSKA 3FO1B 2Z4QB 1S7QA 2VDKL 4OZFB 1X7QB 3QBTB 2WANA 3TIEA 2AEPL 3DO7A 3ZKXB 5SWSA 1HIMH 4N0CD 2P5WE 1NC2D 4JKPL 1F58H 4JN1H 3T0EA 1TIUA 2V5YA 1WCBA 1V7NL 3CFJB 2CK0H 5DQDH 4KROD 4S2SA 4LMQI 1O0VA 4GRMA 4NRXA 5TE4H 5CP7A 5MEQA 1I8LA 2GK2A 5FYJD 2R1XB 3VRJA 3VU2A 5DD1L 3IAGC 1K8IB 2ICWB 4Z78A 4NWTL 3T0EC 4LPUA 5I2IB 1MHHA 3WDIA 3B9KC 2ERJB 3FL7A 1P1ZA 3V4UH 3IB4A 5EU7C 3NA4A 2YPLB 3IDGB 1SMAA 1HSBB 4N1HB 1QLFB 1AR2A 2ZUSA 3ESUF 2VXUH 3LKOA 4OCSH 4GG6B 4IRJC 4PRDB 4N0FB 4LCCC 3KS0J 5F7EH 5GGRA 1INDH 1MJ8H 3O6MH 3TBTA 4KKLD 2VSCA 4I18C 2W65B 1INDL 2ZNWA 4A2MA 1P53A 4JRYD 5GS1C 4X8XA 5HI5D 2NY6B 2OL3A 4B53A 3C2AH 3VXSD 5GGUA 3FOLA 4R2GC 3UJTL 4ZUVA 4MCZA 4ZO8A 4GKSB 5ICXB 3AM8C 4O4YH 1BFVH 3O2VL 2EKSA 2AXGB 2WQ8A 2CUIA 5D5MF 3T0ED 1N59B 2ICEB 4RGNE 3QPQC 3HTLX 5JNYB 2JELL 1CE6B 1D5MA 3I3DA 1IQDA 1KV3A 1YEJH 3KPSB 1I8IA 4ODXB 4LCYA 4LLUA 3OB8A 1U8MB 4KQ3H 4U2ZA 5J13B 3HRPA 5A2LH 4HX1A 4LHJB 4RGMC 4YDLC 1I3UA 4G42A 1A7NH 4EN3B 1K6QL 2VQUA 3ILPB 5HGGS 4Y89A 3MRNB 4FTVB 3ROLA 4GKZA 4YDVA 1XR9A 3ECBB 3O45A 2R23B 3NN8A 5DRNB 4JZJB 4TRPH 1FAKT 3RGHA 4QCIA 1MIML 1NUDA 1CGVA 4KKCD 3Q2CA 1FGVL 1Q1JL 3B8YA 3CVHL 3VGAC 2YUXA 1QHOA 3GSXB 5BO1H 1MRDL 1SVZA 1NCCH 1QLFA 3HG1B 5IB4A 1WSST 2RFXA 4FS0A 4TOYH 3QJHA 1IGCL 1P1ZB 1UJ3A 4C4KO 4XCFL 1LDSA 1ZLVK 3EUUA 4H26B 4M1DL 2Z91A 2ICCA 4M7JL 4WHTA 4PV9B 1XGYL 2AVGA 4EDWH 1FIEA 4ENED 4MX7B 3NVQA 1K3IA 2F54A 4M61B 3MACH 1MREL 4XH2A 4P2QE 4Z5RA 4RDQG 3MXVH 4BQ9A 5C8JB 2R1WA 3H2WA 3KAAA 4ODSH 3X17A 3MV7B 5DJDA 3CZJA 4U0RB 3GMPB 4FXGA 5CMAB 1U36A 3U1SH 5DJ6B 5DSCA 1ZVSB 2Q86A 3ARZA 3TVMC 4LLMA 5SX5K 1FSKC 5D7IF 2AXGA 7FABH 4JY4B 1M71A 5INCB 3U4EB 4LBEA 2CMRL 4KAQH 4X6DB 4WV1C 3RKDD 3GJEA 2ZOKB 4I18A 3U9PH 5T3ZD 4GRLC 4HFUH 4Z7UF 1N6UA 2JJTA 4KUCF 2FGZA 2UWEB 4PG9A 3KS0H 3W9DA 1DCLA 3DVIA 1RIUL 4GG6F 4FQQA 2W38A 4BFIB 1H0DB 5C2BL 4MJIA 4IRSD 2R2HA 1UZ8B 1U8LB 4JDTH 4ODUA 4L3ED 4CN6A 1JZ5A 4UU9A 5EZIH 5L88H 2QTEA 1U3HA 5E2WH 1DBKL 1S9YA 2OTWB 3FQUA 1EGJH 4NM8H 3DYOA 2VLLA 2Z0BA 3FFCB 3I6GA 4X9IA 1JHKH 2WQRA 3SEPA 2MSPA 3CU1A 4M7KL 5FKPB 1QBAA 3QEQB 3L9RA 1GOHA 5DJ8A 4LSUH 3VFUA 1A3LH 5F6HI 4Q9QL 1Q72H 1S7RA 1P7QD 5H35A 1NBZB 4XP9H 1IT9H 1JGDA 1MCRA 2J88L 3HC4L 3TIEB 3TBVA 3GO1H 4WGWB 5ESQA 3GEWB 3D9AH 3KYAA 4OFPA 2IFFL 4MDJB 3QI9D 2XA3A 2MPAL 1FV1B 3V6OA 3MLWH 4I77L 4Z7QF 4G8IA 4O4YL 3QDME 3A0OA 4NKIL 1T2QH 4UIMB 4FFZL 4Z0XA 5L0QC 2BY3A 1PYWB 3C5ZD 3DRQB 3EBAA 3L5JA 2ADFL 3BKJL 1A7QH 4CU6A 5BVJA 2Y36H 5B8CA 2W59A 1PDKA 5C71A 1GAFL 5IW6A 4U7KA 4QOKB 3MRCB 4GBXD 1H3WM 1DBJH 3K74B 1KT2B 5AYUL 2WIIB 3K2UH 4MAYC 1QLEH 2DI7A 3Q6FA 4WO4C 5F7WC 2BNRB 3ZYIA 4DGIH 3QXDB 2PO6B 2KBGA 1ZS8B 2NY5L 2J6EA 4KVCH 4P59L 3FT4A 1HILA 1QBLL 4FMFA 1UWEH 5DQJA 3JWDC 1F3RB 1K4CB 3HLAB 1F3JB 4U6HB 5TDPB 2D0GA 3RWEB 2A74B 1R24A 2EH8H 3I50L 3UDWA 5JR1L 5B3NA 4OLVH 5AUMA 4LMQE 4ZQKA 1DUZA 2OM5A 5K93A 3WJJC 2YD5A 2HKHH 5HVFB 2W9DL 1R3HA 4LHUB 3IRPX 1YEGL 1H5BB 4JFFA 2DM4A 3NCYP 3DUSB 3DVFA 4U1HA 1FCCA 4ORZC 1R3HB 2UV3A 4ZXBD 5TDOA 4J6RL 3OR7A 3PXHA 3FT3A 4OSUH 4IRJD 4S0SD 3IGAA 4YDIL 2XN9D 4XNMB 3MRPB 3MRGA 1NGPL 4QXTA 4JGUA 4TVSa 5EIIB 3MJ7A 3PIQB 2KUTA 4WY7L 3SPVB 3WNKA 5C0FA 3QAZC 2CUMA 5CP3H 3KLDA 3ROOA 5MEOB 2NY4C 3R06B 1NGWB 5BS0D 4P5KB 5F7NC 5KSAA 1MJ8L 2IPKA 3VXNA 3OB0H 2DLEA 4EEEA 4KZDH 5ISZD 1RQ5A 2Z8RA 3IDMA 1SY6H 4GAJL 3S96A 3QIWB 4JFEB 1MFNA 2CH8A 2VUOA 3MCKB 1NEUA 4EI6A 1A1OB 3HA0A 4MNHA 5CEYB 2XWTB 4K71C 3TCXA 2XTJC 3P73B 4P3DA 3G9AB 2CKNA 4KHTL 4CU7A 3SDAB 1JGLH 1CYGA 4V1DB 3ZKNC 1JI2A 4IIQC 4AEEA 5JDSA 5JHDD 4X9GA 1YJDH 4XRCB 3V0WH 2XFXB 5CJOH 4PJFA 3ZDXF 4ONGH 1V8HA 2CK2A 4PRHE 1MCKA 2OJZH 5E7BA 3M07A 3QEQE 4WI3A 3ZT6A 3BZEA 3EIFA 3HCVB 4FFVD 4OTXH 3OWEA 5D2NE 1Z9OA 2GSIB 4YHYB 4PRIE 3QG7H 2VDPH 3HMXL 4Y2DB 1IC5H 5I1CL 4YZFF 1SJEA 3CH1B 3LV3B 4M6NH 4WRLA 3QEHB 2YPKA 5KTEL 4X7EC 1YDPB 4JPVL 1OGAB 1GIGL 4OCWH 2MCPL 1WIUA 1EO8L 4DGYL 2FX9L 4YDJA 2Y9RT 4JREB 1G7IB 4KKBC 4FQQB 4DGYH 2ZUYA 2AV1B 3U79A 3MLXL 1FIGL 4A6YB 2FL5B 3QFDB 1JMXA 1U58B 3ESVF 1S7WA 1QFWI 2VZUA 2XT1B 4NO0B 3NZHL 2OQJB 4KK6C 1ZT1B 5J12C 4PRPA 1JPGB 1H3PH 4FZEH 3O6KL 1BGXL 4YXLH 1EHNA 2HRLA 4YGAB 3MRPA 2Y5TB 1Z6JT 1SBBA 4RAUA 4YNYB 1LQSR 3FT3B 3LHPL 2ZNXA 2OSLB 4LAJH 4JO1H 1UQSB 4BZ2L 1MI5D 2NNAA 4Z76B 3EDDA 4YR6B 2XXCB 1LEKB 1D9KC 1B9ZA 3HR5B 3DGCR 5CMAA 2L4OA 3LSOA 2FATL 1TTGA 1I3RA 4F7EB 3OKKB 2C4FU 1GZQA 5HGHA 2FATH 4LIQL 3D3VD 4L8DB 1Q0YH 3DI2B 4Z7WB 4W4OA 1J1XH 5GISH 1EX0A 3L5IA 4KQ4L 3TT1L 4PJIE 4TVPH 4H1LH 1LEGA 5I0ZA 2LQRA 2NTSP 4P46A 3DNKA 3RU8H 3FT4B 4PS4H 4HWBL 4HKJA 2XPGA 4PYHA 5T33L 3HUJF 2EXWD 1XGQB 5EU6A 1JUFA 2CO7B 2J1KA 4KGLA 2FH6A 2E8YA 1K2DB 4QRSB 5DHVH 2EE3A 1NANH 1EJOH 1BZQK 3NA9L 5T1LD 5C7XL 2R2BB 2R2EB 5IBLC 4PRPD 4XZUB 4G80A 1HIML 1CTOA 4NRYA 5TPWL 1L0YA 1WFUA 4AEFA 5C0RH 3CD4A 2HTKD 1KPUA 2J8UE 4JHBA 4JKLA 2HFFB 1EVUA 4U7SA 4PJ8B 4L3EB 5E8DL 3NFSH 3V7AE 5DLMH 3TBVB 1EDQA 4KKAD 2C3GA 1A21A 4KTEL 4LVNC 4N1EA 2HJFB 3RNKB 4PJBB 1T7XA 1XGRA 1G7LA 1AO7E 3B9EA 5IB5A 1ED3A 4P4RA 2DD8L 1F6AA 5HD8C 4EI5C 4L8CB 1MAJA 4NWTH 4X83A 4GW5A 4TUOB 3BISA 4JPWL 5I6XC 1VPOL 3VWKD 4YHLL 3AGVA 4LFHD 5CP3A 2J88H 3HC4H 4WO4D 3HI5L 3TPUB 3TV3L 3KPSA 4GS7B 3BDBA 4TNVF 4X99A 1RU9H 1YYML 4M7ZC 2QV2A 2C3VA 2R1YA 1IILE 4ODUB 5J89A 3KPRD 1ZWIA 4X7TA 1CGUA 5FAAA 4NOBA 5EA0L 4QT5A 3I3EA 2IFGA 2ZWLT 1MCJA 3DARA 4HAFA 3W9DB 2YSSB 3MLYH 3VDCA 1FLRL 1JF1B 5D7JA 3MLYL 4R7DA 2YZ8A 3AFLA 1KCUL 3FO0L 3OAZH 3SHSA 3TNNA 3ZL4H 4WHDA 4OD3H 3ZLQC 1HE7A 1C16B 1LHZA 2PCPB 4L29B 2VDLL 5FGCB 1SQ2N 3F58H 2NY4D 5GS0D 4HUUA 3KPPB 4LBEB 4P4KB 1XT5A 1M71B 3PHSA 1JN6A 3O8XB 4JFZH 1XF1A 5I1GH 2ADJA 1OHQA 4G8EA 1OQXA 1M05A 4NQDE 3IU4L 4P3CH 4OCMC 5B4MD 3GMPA 4NQCA 1I7RB 3MA7A 1I85A 2JCCB 5CIPH 5C0CA 4CNIB 4ZTOL 2HKHL 4L4TE 4O51A 1S7UB 4U1JB 5C08B 4J3OC 4HC1H 3ZDZE 4Y2DC 3RBGA 4DCQA 3FQXA 2VDOL 4JPVH 1HNGA 5IFHL 1HOCA 5E56A 3KWWA 1TNMA 3BH9B 4NQED 4RMQA 4D9QE 3E6FB 4OI8A 1YY8A 1FGVH 1FAIH 5IW3A 4PJ5D 3T0BA 5CSGA 2B0SH 1FZJB 2QKIB 2R0ZL 4LGSB 4E9LA 1A6UL 5GGTA 3UBXA 5TQ2H 3EJJX 1G6RH 5I1KH 4WGVB 3X3FL 1IGIH 3WE6A 3MRIA 3FN0H 3EYOB 4R7NA 5AAMA 1JYWA 3S37L 5J7CC 3QJHB 4HKZA 4E41D 3SKNB 3U4AA 4G8FB 3HPJA 1MHCA 5IB2B 4OFVA 3QEUA 1FLTX 3Q5TA 3RIFF 5DJ0A 4NDMA 1CIDA 3S6CA 4YHPA 1JZ8A 1CFSA 4HUUB 3KPPA 3NCFB 2DDQL 1MCBA 2FIKB 3QRFM 2CDFA 3LRHA 1KB5L 1TNNA 5LWYL 3KPRA 4IEFB 3J7HA 3NH7H 3NABL 2WMPA 4ZDHB 2BJMH 1IEAA 2P24A 4YDVB 1BJ1H 3MRDA 2IH3B 4WO4A 5CFHA 2X4NA 3IFOA 1BVKB 1TPXB 2A9ML 1F8TL 4YHZH 2ICWI 3L5HA 4ODSL 4YZFE 4L9LB 2X4TA 2C3VB 2R1YB 1ODAA 1DBAL 3FAWA 5IB1B 3H7BA 1U0QA 3VFGL 4HK0A 3L7EB 1QKZL 3O6LH 1H3XA 4N8CL 5M95B 1HH6A 5FGBA 4L4VA 1CL7H 5JNYA 1VFBB 2AXFB 3SDXE 2VL5B 2K7QA 3MUJA 3UTPD 1A7NL 2ARJA 3RL2B 3MODL 4H25A 4ZFOL 2HVJA 3ZE0F 4PRHA 1HHIA 2AJXH 4CKVX 1E4XL 4P9MH 1CGSL 3RWCB 4KUZL 2ITCA 3DVNA 2FX9H 5T5NG 3MNWA 3E8UL 3K0WA 4LAQL 1OGAD 1WBZA 3DMMA 1NAKH 5E94A 2E9IA 4NN6C 4NBYB 2NXZB 5F7FA 2LU4A 3ARGD 1MY7A 4O2EB 1MJUH 2PO6C 4AYFA 4XX1G 4Z0BH 2AQ2A 3QXTA 3S34H 2JJVA 4DVRH 4C56E 3DTXA 4JZOB 5C0GA 4YIQB 3RTQD 1A3LL 3QWRD 5J1AB 4ZO6A 2X4PA 1W72B 4U6YB 4P9HH 3P4MB 4N8VB 4Y16D 1TZHB 5E70A 2QQQA 4H88L 1RMFL 3RWIB 3P4NB 1SHMA 4H88H 3V5KB 1EMTH 3GBMH 1MCPL 4I8DA 3SDDC 3SQOH 1JIBA 1IM9A 1NLDL 2X10A 4GRWH 1AD0B 4HSQA 3L6FA 3DVGA 1YNTA 4NNPL 3H9SA 4EDWL 4JN2B 1A7PH 1BFTA 1P4LA 3N1QC 4OF5A 3SGJC 4KKNA 3P4OA 4B50A 1A6WL 3I6LD 1T2QL 5ANME 3K80A 1ZA3B 4HXBH 1VSCA 3CDCA 3DX8B 4LSTH 2ADFH 5DHVA 1GGTA 1W8NA 4BSVA 1ORSA 4DK6A 4DQOL 1VA9A 3H9SD 1HN1A 4TUJA 2IAND 5KSBE 3Q48A 4L3CB 4AZ8A 4POUB 3NZ8B 1MCOH 2GITB 4POZC 5ITFB 2RB8A 4FZ8L 1FNAA 1MNUH 2XZAH 3B5TA 5GSVA 3QAZB 1SEBB 1DDHB 1TJIH 3SDCB 4RIRB 4MAYD 4OGYH 3VGBA 4AENA 1T4KB 4HJGA 5E8PB 2Q8BH 3DVNB 4P0DA 2IGFL 1I4FB 4F37K 2Q8BL 4U31A 3C5ZC 1ZLWH 4NQEE 4RFNB 3T4YB 1X5ZA 2Q7YB 1KB9J 2FECL 4YDJB 4I13B 4JO3H 4UIKH 2F19H 5F88B 3GGWA 3BW9A 3MOAH 5HDQL 3BP7B 3EJZC 1RI8A 4OF3A 4JRYE 5T1KD 4JVWA 3FRPG 4GRLB 5KSVB 5I1JH 4RFOH 4NO5B 4NZTL 4X4XA 3TIDB 3DETD 1DANU 5CBEA 4PBWD 2J4WH 3ZYZA 1PQZB 5C3LD 4NZTH 3ZDZF 3F5WB 5LGJB 4QXGL 4NO3A 2QLVB 1FGNL 2UVEA 5D72H 5F9WB 2VXSH 3RDTA 1T5XB 3WFHA 4QGYA 5IIEB 4IHOA 3MRRB 4UILL 3HNTL 1UA6H 1A0QH 3GJFB 1QBMH 4MNGA 4QNPF 1W0YT 3GDBA 1ZLSL 3D39B 1TTUA 2CLRB 3O3AB 4ZSOE 1LO0H 4W4OC 2OP4H 5J57B 3PWPB 5DJCA 4Q9BA 4Z7VF 2WK2A 3RAJL 4J1UB 4R90L 5F1OB 3V6OC 4YEFA 4NNXA 5F8QC 5D7KD 4H5SB 5D1QA 3OAUH 1MEXH 1I8LC 4S1SH 4ZFFA 3C8HA 3WDJA 5I75B 4D0DA 2P8LB 2EIZA 4P2QB 5A16A 5I1LA 5GGSB 1YJDL 2IPKB 3VXNB 4O9HL 4UOW0 2JB5H 1CFNA 4JRYA 2XKUA 1NAMA 1JWUB 4KHTH 1MIEH 1MVUA 1O7VA 1X4XA 3U46A 2YPVH 4JRXB 5F93C 3EO1A 4HGMA 4IRJA 3NIGE 3O41B 2X70A 4O2FA 1P69B 1AR1D 4NN6B 4M43H 5F89B 1ZTXH 1PKQE 2A83A 3HNVL 1FYTD 5ID1A 1YECH 2RCSH 3UTQA 4XAWH 1M6OB 4X6DE 4X98A 2M26A 5BRZE 5IWLC 2AJXL 4OTXL 4A6YH 3HAEA 4QHMB 4H8WC 1XZ0B 4KKAC 4NKOB 3BAEH 3VDAA 3WJJA 3PGCB 5EORL 4CNIA 2GJZB 3TN0A 4RWHA 3MRMB 3VXTB 4UQ3A 2Q76A 3BE1L 4NT6A 1M4KA 1T80A 4XI5C 3BP6A 3ULVC 2R4SH 2D03L 5DVKA 3A67H 4G7YL 4YXHL 4DW2H 3F7VA 4QRQB 1UKQA 4Z9KB 1I9RH 4PJEB 3LKPA 5E9DD 2IMMA 2O61B 1RIVL 3GMOB 4OKDA 2VLRE 3RHWF 1AHWA 3PWUA 3TN0C 4RMSA 3OB0K 3IXAB 3CXHK 3TBYA 1R3JB 4YXLL 5L8KB 2YSSA 5JW3L 3E2HC 1XF2B 4R96B 2XYCA 1NLDH 4D0BA 2QHLA 2YPLD 4YQXL 4I5BA 4PJ9A 3QJFA 3ARXA 1TCMA 3EYSH 1QEWA 2FR4B 2OZ4H 4NQCE 5CZXD 4U0RC 2CSPA 3W9EA 5HI4C 1Q0YL 3K4ZA 4LEOA 4KJYB 4PJCE 4XP6H 3BQUB 3MLUH 4L4TD 1BHGA 3HNSH 4TSAH 5JIHA 5BRZB 4ZUUB 5EFIA 3THMH 4LIQH 3QDMB 1D9KD 2QQNH 4NHUA 5KS9B 1EO7A 4L5FH 4HH9B 3MYJB 4L3EE 4MCYA 3MZTA 2YBRB 2Y72A 1MNUL 5BV7C 1CXLA 1NKOA 2E3VA 3TCLB 4NJAL 1E28A 3RNKA 5E6IC 1ACYL 5I71C 1AIFB 4XPGH 2F15A 4Y7MA 1RJLB 5JOFA 3SE9L 3S88H 3MFGB 4MXVE 1AD9A 2J5LB 5TE7H 4LHUD 4O5LH 5BS0E 3E3QC 2CLZB 7CGTA 3FFCA 3I6GB 2VLLB 3T4AA 3PV7A 4K94L 1DQJA 1WAAE 5DJAB 2PETA 1P7QB 1MCHA 4K94H 2P8MA 3TNMA 4Y5XC 1A22B 5ICZA 3I75A 4YX2H 1JYVA 1AXTH 2IBZY 1RUKL 3ZT5A 3UTOA 2DKUA 3V8CA 5E03A 3CCHB 3RIFK 4XP1H 1ADQL 1ZHNA 4XCCL 2WINB 3WFCL 4QRSA 1EGJL 2NXZD 4QRRA 4WW1B 1FORH 3QQ9D 1IGMH 4P57B 4XC1L 3KLSA 4FABL 3ZHKA 2X4OB 4Y5XA 1CXHA 3QCUL 1F6FB 5HPMB 5ACMA 1EO5A 1DUYA 5D2LE 4OCRL 3BP5A 2UWEA 4ZPTA 1J05B 1I75A 4NCDA 1T1WB 4HUVA 4RGMB 3NAAL 3LRSA 4N5ED 4WEMB 1A6PA 5F7EL 3PWLB 2WLYA 4JQVA 1NCWL 3BH8B 3K8KA 4TPRH 2V7HA 1U91B 1X5AA 3GIZL 3VXPB 5F7LB 1RU9L 2X44D 4MWFB 4L9LC 4YAQB 2APWA 1IM9D 2NW3B 4JAMB 1NL0L 4P46D 1GL4B 4H0GA 1IAIH 4TQEL 1AGCA 3V7AG 2VH5L 4M7ZB 1I7ZB 4JPKH 4QTIH 1ZEAH 3D3VA 4Y16A 3ES6B 2DIJA 3EZJB 3K8MA 2FSEB 6FABH 2F54B 3O4LD 3M1BB 3PP4L 2FJHB 2GJ6E 5EBMB 3ARYA 3BGAA 4EUPB 5E5UB 1KCUH 5ANMB 4XP4L 5FUZL 1II4E 5AYUH 1WT5A 2GSGA 1U58A 2FD6L 2R0WH 2I25N 3CJJA 1LDPH 3ARGA 4PJIA 4ZOEA 4WW1A 5GRVK 2J7LA 2V7NB 3ARDD 2F8OA 3VFVA 5GGSA 4MS8C 2P5EA 3VFSA 2JK5B 3IU3B 3D85B 1HH9B 3WLBB 4LLQB 2VITB 2A6KB 1CFTA 4ZTOH 4OD2B 5FECB 5F6HJ 2IWGA 4G8GD 1BBJB 3AUVA 4ETQA 4L8SB 4OZHA 2XA8L 1YPZF 4Z7VB 4NO0D 3HZKA 2VISA 1NC4A 2V17H 3QUYC 1AFVL 1VADA 5DJCB 4WW2F 5KAQF 3IXTB 4OZ4A 5JHLL 2WM0A 1J0IA 4ODWB 3GSRA 1OSZB 4PGDA 2HMIC 2D0HA 1NH6A 5BMFH 3ZSTA 5F8RC 3ULUL 1QSFE 1T5XA 1UXSB 2E8ZA 3C87A 4HX1B 3WFHB 5E2TL 1P6FA 4AY0A 4G6JL 1QVOA 3P0VH 4ODVH 2VUYA 2DQTL 5EO1A 1IQDB 3UZEA 2X4UA 4ONHB 2P7TB 1OARL 1YYMH 4U1SB 2J8OA 3MLUL 5D5MB 3U6RA 4ZSOB 1B0RA 2VLJD 2OTPA 1A1MA 4D2NA 2DQEL 2PW2B 4R96A 5DFWH 4GMTL 1P4BH 1VGEL 3JWOC 4Y2DD 5D7JC 1FBIL 3QNXB 3AAZB 4N0RA 4RFEA 5T1MA 1AR1C 2CIIB 3BVNA 5ESVB 3RVUC 3GSNB 1PG7W 3TC9A 1FE8H 1B6UA 3SDYL 3IFPB 1N3NA 4LKXB 2MKWA 1P5UA 1A6TA 1A7OL 4XPAH 4OD3L 4NUJB 3SDYH 4YDKL 3F58L 1A14H 3SJVB 1GYAA 1HKLL 1OTUC 3RPIB 1NMCC 3U2SA 5L9DL 3T1FA 2JJTC 4GXUN 3BDYH 3RNQB 4I0PB 3CPLA 1I85C 3MUHL 3WXVL 1YN6A 1CD9B 1ZAGA 4OIAA 3TLRA 1IJ9A 1XGUA 3OKEA 1MCCA 2VE6A 5FM5M 1OCWH 4RGOL 3EKCA 3HAEB 5C0CD 1F4XH 5CEXA 1L6XA 2DM7A 4P23C 4PR5A 1LO5B 1QLRB 4NZJA 1R3KB 4NQDD 4PJ8C 4F58L 4U6HA 5TDPA 2H1PL 4YE4H 5KAQG 2EDWA 4WFGD 5F1NA 1YJDC 3QHFL 1RZGB 1TJGH 5DQJB 3CFCL 1F11B 1DQLL 3EYUL 2EDHA 4WWKC 5GS2H 4IIQA 4NWUL 2WWKT 4L4TA 4G9DB 5I1DA 1XCTA 5DA4A 1D3CA 1UH4A 2RGSA 4XC3L 4NQVB 2FX8H 1EAJA 3W2DH 1G6RA 5IFAH 2R9HC 4Y1AA 3I85A 1EZVY 2FHBA 1JFQH 4K71B 3L3KB 4APQA 4RGND 1XR8A 4G5ZH 5F44A 3CNKA 5T3XH 4MXQD 5FHBL 4BZ2H 1EMTL 5DRXB 1EUTA 4K3JL 3S7GA 3PV6A 1NGYA 2GT9B 3F12B 4GRWB 5D70H 1NAMH 1REIA 3ILQC 3VFRB 3P11L 3X12A 3ULVL 1PJ9A 3B2VL 1WBYB 2EYRA 2VC2H 4TNWF 2E7MA 4HDIB 3IDUA 4XX1E 5JA9A 5JZ7C 1OAUL 5B8CC 3N06B 3EJYD 1CXFA 1VHPA 1D9KB 3QI9A 5CUSL 2GUOB 3MR9A 2F74B 4O2CB 3TN0D 3AY4A 4URTB 5IQ7H 5CEZE 1YEDB 1JHTA 3VWKC 2R0WL 3C6SA 4Z95L 4UTAL 3MUY1 3RZCD 2R9HD 2E6PA 2XZAL 4GKNB 2XKNA 4LVOB 1FFQA 3NPSC 3UTSB 3MX0A 3NCBB 3X14A 3ALPA 5IKCA 2JIXD 2XKNB 4M1CD 1EHLL 1HYSC 5TE7L 2J12B 5IB1A 4LSPH 3DWTA 5TFSL 4WNQB 1FYTA 3AY4C 5KZCD 4WI8A 5GGVY 1FL6A 3ARBD 2P5WA 3MGTB 2BFVH 3RPIA 4H20H 3BO8B 3ZMRA 5GZND 3IDIA 1YUHB 1KPVA 1IEAB 2P24B 5T3ZH 5C0RL 2CKBH 4ZDHA 3E1F1 5E8PA 3RDTC 4PJXB 3BD3A 1AHWC 3V52L 4P46C 3RVVD 4KZEL 4XNZB 4HQQL 1WAAA 4DN3H 3ULUF 4ZO7A 4GQ9L 1HEZB 2CDFB 1GGCH 4Y4FC 5K9OA 4PJ7F 5DD6B 3EYVB 4LPYA 4KHXL 3VXUB 2F5BL 1E4WL 3ZZ1A 2L7JA 1QA9B 5FCUH 5IEKA 5IVXE 3T3PE 5CWSA 2FJFB 4M3JA 4RBPK 3WYRA 4N90D 2LFGA 2GCYA 2X4QB 3MRQA 5F9DC 3S36L 1OW0C 2BHYA 3H7LA 4G9DA 4IS6A 5DURB 3HI5H 4IIQB 4XH2B 1FL3A 1HXMA 1NBVH 4PTUB 1UXSA 2ZCHH 4FA8A 3F7YA 4K3EL 3SKJL 3RDTD 1ZVYA 2DQGL 4KTDL 2X9YA 2DLIA 4HLJA 4OZGF 2F53D 4NNPH 35C8L 3V5DA 3P4NA 4X5XB 2CDEA 4R26L 3UTZA 4WWID 2JCCA 1QSZA 4BUHA 4Q9RL 4F7TB 1FYHB 1LDPL 4FQXB 4HUNB 2R4RH 2BNQE 4UI2A 2ID5A 3CXDL 2VITA 5D96B 1FN4B 3RBSA 4YHMH 4MAUH 4XAWL 4K2UL 4M03A 3B6SB 1WBZB 5L2KE 4ZPVB 4UUJB 4MAYA 1ZTXL 1R5IB 1MSPA 4RAVA 3VXQB 5HYQB 5DJZA 2A38A 4CU8A 3BPLC 5BW7A 2XTJD 4PRHB 3VG0L 4B5EA 5DDHA 1A5FL 5HHPA 4PJDB 3EO9L 1UEYA 1KIPA 2C1OA 1NDGA 3CK0H 1TJGL 1KOAA 4HJ0D 1FL5B 4G7YH 4DW2L 4YXHH 3RL1B 1U6AL 4N1CA 3GM0A 2PYFA 3DUHA 5FYKL 3D2UA 1WQVT 5I76B 3MREB 3U0TA 5B22A 2DQCH 4XVTH 4M5YL 5HVWA 4LCYB 4TUKH 5HGDA 1PX3A 3HI6L 4TULH 4HT1L 1R5VA 1NCDL 4CVZB 1A02N 1NFDA 4LPXA 1LO2L 4G6JH 3MV8D 3MNVA 3HNTH 2GTZA 2ATKA 4IOIA 4ORGA 1HHGB 5D2NB 3RWGA 2H6PA 2X4RA 5GSRB 1DANT 3BH8A 2BOCB 1FZOA 3QWRA 3P9MB 4P5TD 5IOPB 4KVNL 5E99L 1DBBL 3R8QA 3RTQA 1CCZA 1HQ4A 3AMLA 5C07D 5LWYH 4AT6A 5JXAL 4AIOA 3BP5B 5MEPA 5I1EL 4O58L 3N1PC 3BHBB 5I1EH 4YHPB 2W0LA 1J0HA 4JEGB 5GZOC 3MV9A 1ZKAA 2ZOLA 3QEUB 3VXSA 5IB2A 1BFOB 1RV6X 2Z31D 1XFPA 5EPMB 1F90H 3K81A 5IMOA 4KPHL 5J1TC 5IQ9B 3MV01 1Q9LA 4D9RE 1IE5A 4PJIB 4X0KB 3ARGB 3Q1SL 1DQJB 1KTDA 3FQRB 3PGDB 3MQIA 1G0DA 1KC5H 5B39A 3JTTA 5HI5C 5ABDE 3UYRL 4BQCA 4F9LC 2XI9A 5FDYA 2VLJA 3PJSB 3VMNA 4PV8B 2JB6A 5EU7E 5EU5B 1IEBB 1L6ZA 1DEEB 1RUML 5I1AB 4LNVA 1YPZA 1GSMA 2YD3A 4ORGB 4G9FA 3UJIL 3GMNB 3ARTA 3VE0A 5FYLH 4MLIA 5IESL 1J88A 4N0UA 3I6KB 1RUKH 3Q3GA 5HHME 4XNYH 5KANI 2P8PA 2NNAB 3KJ4C 4G6ML 1ND0B 2BVQA 3OAYK 2WUCH 3PWNA 4NKDA 3AREB 4HK3N 3HE7B 4ALAH 5I15L 3P0YH 4DK3A 4YO0A 4QXWA 2VYRE 1HCVA 1BD2D 2LVEA 4NO0A 5C0BB 3NAAH 4BH8B 3SKOB 2AK1H 4YXKH 4HMDA 2H9GB 5GRWA 1KCRL 4EQ2A 4BH8A 1TJHH 5DMJB 2WAHA 4I3RL 4YBHA 4LPCA 4M7JH 1RZKL 1IMHC 5KVGH 1N5YH 4AIZB 2MPAH 2ZUWA 4MS8D 4XMLL 4RMVA 4G8GB 3LEXA 4LCCB 1P7QA 2AI0H 1RK1A 3A6BL 1I1CA 3A6CL 4PJ5A 2VXVL 4PTTA 5JIIA 3A6BH 3C09B 4NQDA 4EJ1C 4FNLL 3GFUA 4LASH 4OM0H 4F2MB 1QFWM 4KXZH 5D96C 2B2XH 2HJKA 2WWMC 1T66D 3QFJD 4LSPL 1JI1A 2NY2B 4FQIL 1CFBA 1EHLH 4H1LG 2DTMH 5DT1H 5DRWB 2MMXA 4XB7A 2H41A 4V2CB 4JJHA 2VDKH 4QGTA 5IROC 4KTYA 4OUUB 1ZV5A 4LVHB 2HN7B 3WUWA 2GCYB 3T0VA 1JPSL 3MCG1 1CFNB 4JRYB 5T3ZL 2B0SL 3LQZA 5B39B 3V6BR 3PGFH 4J3SA 4QKXB 1KTRL 3PGDA 5E1HB 5C0AE 4YDIH 2ZOLB 3INUL 3JV0A 4HK3J 4U05A 1C08B 4J6RH 1XF2A 3BRDA 2W91A 2Q8AH 3C5JA 4WU7B 3WEXB 4APQC 3Q6GL 5JIPA 5F21B 4HJJL 5IMOB 2P48B 4IMKC 1ZT7A 1IL1A 1UA6L 3MSPA 5GS1A 3JBG7 1CFQB 3PIQA 1WLHA 5L2KB 32C2A 1BBDL 1EH9A 2VN4A 4FFYL 4F37F 3L5WA 1D6EB 5D7SL 1NGQL 1T0MB 5AWNH 4YHLH 3QDJA 4PGCA 4U1GB 2AAVA 4FQ1L 5DK2A 3QCTH 4AM0A 4HUMB 3MJ9L 2Z92B 1CU4L 5ILTH 3IGAB 5D4QA 3DX9A 2D3VA 1ITCA 4YPGA 3V6FA 3VXRD 4F7EA 4TPRL 5JOEA 3LKRA 4NT6B 4KI5E 2DMKA 1DN0A 2FYYB 1D5IL 1OQOA 3IYLW 4ZUSA 5EZLA 1PKOA 4S1SL 4C59B 3VA6A 5IKCB 4IOIB 4N0CC 2CGRL 2W60B 3STZA 5IT2H 3EYQD 5KW9L 1FO0A 1HWGB 3LVEA 3SDXA 1IEHA 5HHMB 3BP7A 2ATPA 4LEXL 1KF9B 3QO0B 2ZUXA 3U7YL 4PGEB 3K2UL 2B20A 2X70B 5DTFA 3EO0A 4WUKL 4IDLA 3V0WL 4CDGC 4GXUM 4LCIL 5D1XB 4YDKH 3U46B 1V5JA 3ARFD 2NY0C 1RZJC 4U6VH 2XQBL 5IVXA 2WIIA 5DWUL 1QPPA 4Q9CA 4KK6D 4AH2B 4KXZI 4G43B 3VMPA 4XBGA 3T2NL 1KB5A 5ENWA 4LSDA 5DJZB 3HMXH 1I3GL 3FN3A 5IBTL 2VXTL 1CFVL 2OMBA 1R6VA 5HDBF 3IFLL 5I8KH 1A6UH 5TF1L 3FQTB 2XICA 3BE1H 4OKVA 3SDXF 2BRRH 3KGRA 3KYNA 4D9LH 3GMRA 3BPCA 5C9JB 4X5XA 1OW0A 2XFXA 5IVOA 5C0IB 3V4VH 4XRCA 4OZHE 1XIWB 5IMMB 4HUXB 4Y5VC 3O6KH 3TJHD 3BPNB 1FVCB 3MC0A 5GJSH 4YBQC 1IBGH 5DS8B 4ZTPL 4DOHB 1UYWL 3JV6A 1HXMB 4H8WH 4ISVB 5DYOB 3VRIB 1UXWB 1BFSA 1SJHA 1RZIB 4GOSA 2X4PB 1KIQA 2PNDA 3F7YB 3OPZL 5DD0H 3RNQA 5JMOC 3JVGC 5IEKB 1NBQA 3GUTB 1T89C 1FNSH 3EYVA 5DC4B 3QQNA 1U8OA 5LXGH 5GHWH 1DEDA 1S78C 1P4BL 3CDGA 2B4CL 2CIKA 1DN2A 1I1YB 3LOWA 2AEQL 3VXSE 1T20A 3BKYL 4ZFGH 3K4AA 4JFDB 1I1YA 4YBQD 2VAAA 4N8CH 3VXUD 4C55A 4S1DD 3QNXA 4RFEB 1CL7L 1JNHA 1C5DB 1KXVC 3QWQB 1NPUA 3U7AA 1OP3K 1WZ1H 2QQKH 1HEZA 1QKZH 2OJEB 1PAMA 3BESR 5GIRA 2QBWA 2NX5E 1EJOL 1H5BA 3QUZB 1ZVSA 1ETZB 1S3KH 4LLYB 2Q86B 3DLQR 4K3DL 1QNZH 2AJSL 2P7TA 2CIKB 3MLSL 3MLRL 1ZA3A 3MV7A 1NKRA 4A2LA 1J8HE 3QUZC 4PRBB 4RGNC 3LS4L 1RHHB 5HDQH 1XF4A 3TYGH 5ADOL 4UDUB 4NQTA 4M6NL 1BX2A 1KCLA 3F8UB 1QOKA 4LFHG 2JJWA 1D9KA 3QI9B 1OD9A 1GGCL 3FRPA 3MO1B 1XIWA 5IMMA 4E0RB 2PTVA 5HYJA 1U93A 5FUCE 5DZOA 4MJ4A 5JXEA 3IXTA 2XRAH 2XZQL 3ISWA 1XGPA 1JZ2A 5DJXB 5EZJA 2XRAL 2F74A 3IJYA 3UP1A 1B90A 3MXWL 3FONB 1NCWH 1X9QA 5DHXB 5I66A 1T5WB 3DTXB 1C1EL 1XIWC 4Z7UE 4HLZG 5C0IA 1BGXH 2ZUUA 5FYJE 1T21B 4NDMB 5T3XE 1JFQL 3L3HA 3MMEA 1YNKH 1UB5A 3QO1B 4FTVE 5F1IA 3DMMB 4HS8H 2IJ0C 4HKXA 3QUXA 3G5ZB 1ZEAL 3V6OE 2HT2C 4YBLC 3FB6B 4HWEL 1VERA 2WBWB 1WV7T 4HXBL 2XN9A 1A7PL 1YYLL 3OJMB 3EOBA 5J1SC 3WFDL 2ITDB 1J8HA 2VKWA 4KMTL 4Y5VB 2JB5L 1RZGA 1Y18B 4EN3A 4PD4J 3QUXC 3B9DA 3VXUE 2WLZA 3M1BA 2KDGA 1MF2H 2OTWA 1DE4B 3L3DA 1UWEL 3H9YA 4OGYL 4PY8I 5J6GA 3MV8B 4YHNB 1WVZA 4DOHE 3GB7B 3IJHA 2C4XA 1RZKC 1BD2E 3PWPE 4QRTA 4A6YL 2C1PA 2XNAA 3EFFB 2D31B 3UBXG 3DI3B 5JO5A 3GI9L 4PJHA 2DTSA 3CK0L 1CG9B 4LF3A 4E42A 4JDVB 4L9DA 3CPLB 3PUCA 5J9PA 1JV5A 2AGJH 5C0ND 4X6DF 3H6JA 3WFZA 1JF1A 5D7JB 5ALCH 5ALBL 4D9RD 3O0RH 4Y4FA 3QZWG 3SJVA 2VLKE 3T0EE 4WJ5A 2NMSA 3UMTA 1CE1H 5I1JL 3U4EA 2V2WB 1L0QA 4XP5H 1U9KA 4ERSL 2WZPD 1IGTA 4U1GC 3ARSA 3GBNL 4UAOC 1ZHNB 1MCWM 2I07B 2DD8H 3JV5A 2IPUG 3DUUB 1IL1B 1UACH 5F3BA 4NQEB 4ONFH 5BV7L 5KVFH 2CD0A 3O81A 3EYOA 4R7NB 4FFWD 4JY6A 3Q0HA 5C8JA 3HE6B 1OARH 3UBXB 1IM3A 5KOVC 2W9LA 4K7PH 1LO0L 2D9CA 2ZZUT 1G6VK 3SY0B 2CLZA 4FXLA 2YHGA 2DMBA 1OP5H 3MXVL 3E6FA 1PY4A 3QIUB 4FFWC 2PTTA 1V7ML 1LMKA 5JOPE 5JPNB 1YMHB 3T0AA 3GSRB 2BJML 4OD1H 1QVOB 4G3YH 3IS0X 2YRPA 2ZSWB 2GQHA 3D5OF 4HEME 3QUYB 4HIXH 4OBSA 1FBIH 4PJDF 3BT2L 1BWMA 4NQDB 3EHBD 4KU1A 4PTTB 2R29H 4L3AA 3SCMA 1DQDH 3BIBX 5SWZA 4R3SA 3L1OL 3SJVE 3CSYB 2IBGA 1I9EA 3VXRA 3PWJB 4KK8D 2EYTB 4U1LA 5D7LB 3V5HA 4LDOB 4JFZL 2SEBB 3W9EB 3TZVA 2A9NH 3H9SE 4QCIB 5MERA 4J4PC 2QL1A 4I5BB 1OAZL 1OVZA 3QDJE 4K9EC 4LK4A 2BRQA 3EDKA 5D1ZB 2G2RA 1K3ZA 4D9QD 1S78D 4JDTL 3SKOA 1LK3H 2GSGB 4XNUL 1DZBA 3VFSB 2NY2C 5DR5H 3UO1L 4HKJB 1CLYL 1K5NA 5AZ2L 5CJ5A 4Y1AD 4YUEL 3UO1H 1KULA 5LAXB 5I8CA 3RKDC 1F3DH 1NMAH 1NAKL 1QYGL 4FABH 3BEVB 2XZQH 5KVEH 2FNBA 3C08L 4TVPE 3GSWA 5BZDB 2OZ4A 1I3RB 4ALAL 4CW1B 3Q3GB 1FNEA 1MCIA 3TBWB 3FO9B 5JW3H 1URLA 1A4KB 5K59E 1J1PL 5CEZD 4XWOC 3R1GL 4ZTPH 4G7VH 1T66C 3HB3D 2RJMA 3AS2A 4PJXE 2HLFD 3BUYB 4OAWA 1AQDB 4P3WA 4U0QB 4XMLH 5J8OA 4PJAB 4QHLA 4MZ3A 4GO6B 5E8EA 1N5YL 5GISL 5KZCB 2X4OA 4P2CG 3QDJB 5CUSH 4V1DE 3HPLB 2WINA 4M62H 4PLKD 5BQ7B 1OAUH 5IJVB 1K5NB 2AEIT 4NN5B 1S7TA 1JNLL 5J56B 5HPMA 1OLLA 2BNUA 3GSQB 4QYOB 1F90L 5IVXF 5C92A 1G7JA 4JFOB 4K23H 3ARGC 4BUGA 1KJVB 1NSNL 3NMEA 2A0LD 2ENYA 2PW1B 2J6EL 3ET9F 4HUWA 2VR9A 2EEDA 3U4BH 4AJ0A 3HC3H 4HJ0C 1LEGB 1DE4A 2IANB 2DBLL 3VXRB 1B3JA 1WZLA 5I30H 2AJSH 4WI9A 4R3SB 4I0PD 5FK9A 2DIAA 2KL6A 1F58L 3UROR 1WWBX 5HHOB 3C09C 2NY1D 3SDDA 4Y5VA 1DBKH 3BUYA 1J18A 1NGXA 3LS5H 3QUYA 3VWKA 3JWOL 1ADQH 1JPTH 1A6AB 2H6PB 5GSRA 2VDQH 2XWTA 4Z18A 3SGJA 1MFDH 4OCRH 3UPRA 2HTLD 3TFKC 4PLNC 4G9FD 5MI0B 5DMKB 5KSBB 5DUBB 1UB5B 5DEZA 3N9GH 4CVZA 1NFDF 5LJYH 4DVBB 1U8KB 3UZVB 4FQ1H 3QEQD 4LOUC 1S8DA 1IC4L 3CLFH 5F9WC 1CTNA 4X6EA 2OP4L 2I5YL 1ZHLA 4WUUE 1T5WA 2VAJA 4I3GA 1FC1A 4S10A 3BI9X 1Q9OA 4MDIA 2BVEA 4I77H 4E41A 1W0VB 3HAEH 4FFZH 2ZCHL 4AENB 3D9AL 5J6HB 3K1KC 2HT3D 2Z93A 3RVTD 2Z31A 1T03L 3GMOA 4E0RA 3UJTH 4HV8A 4XVUC 4XNMA 5C08D 2IANE 3FO0H 3N1MC 3PDDA 1R3JA 1T6VN 5EUOE 1RUQL 5M94B 3MV9D 3OR7B 4ENEC 4TSCL 4RAVB 1VESA 2VRAA 2X9WA 2XOTA 4QOKD 3WKNA 1JWSA 3MRMA 3VXTA 3J8F7 1RZ7H 4WENB 2R4RL 5I0DA 4DGIL 2VZSA 1AKJB 3LH2H 3P30L 2GTWB 1YZZA 5K9KA 4P2OD 1A7RH 3MPCA 2IBBA 5SWSD 1JYXA 4QHMA 3BZDA 3LDBB 3AROA 5JDSB 1OY3B 4RX4D 3LEYL 3I6KA 2GI7A 3T2OA 2DN7A 2OJEA 2MQ0A 4EVNA 3DVGB 2PXYD 1I1AA 4U3XA 3GB7A 1X5FA 3HNVH 4P2QD 3WIFA 5JHDE 3WD5L 1F13A 3VG0H 3MV8A 2WBJD 2JIXB 4Z7UA 3MV8E 3OKNA 3V5KA 1YPZB 5HDLA 4OCYL 4R9HA 1U8NB 1G9NL 2MJWA 4JFPB 4OCWL 5CINH 2Y23A 4KY1L 3OTTA 4RMRA 1A5FH 3S96B 1YEHH 4ZG1A 1CBVH 1QFWL 2A83B 1S9WB 2RIKA 1YEGH 3CVHH 1UVQB 4P2RE 4B41A 4PRID 2CJUH 4R97B 2BVPB 4FQXC 1BOGA 3IETA 3OKDA 5IR1B 2X4SA 1JL8A 4KI5F 3BDXA 2BVPA 3HRZA 5HYFA 2XN9B 1MAMH 4JRXA 4M1CC 5IMKB 3DJ9A 2YS4A 2ZG1A 5GGVH 4MSWB 2L7UA 4QRUA 1LO2H 4TN9A 3O4OC 4JFPA 4G6AD 4QHUB 4HT1H 5IG7B 4J1UA 4LSQH 1NUNB 4ODVL 2NR6C 3NIDE 1YUHA 2BXYA 4HFWA 3RGVD 4LSQL 4GW1A 3OQ3B 1CF8H 3MBEA 3QUZD 3G08B 2P5WB 1QZ1A 1VACA 5D70L 4LPVA 1H15A 1DQQB 4WNQA 2JE8A 3GNMH 2F5AH 2BZDA 3KPOB 2CLRA 2A9MH 5J11C 5CS7A 2DWEA 5IWLA 4Q0XH 4ELMA 5KSBF 2XACC 1CXKA 2CDGA 3MBEC 2X05A 2DQHH 5IB3A 1H3VA 3WHE1 5DI8A 5C2UB 2I9TB 3D48R 4QRTB 3QFJB 4UU9B 2I9TA 4K23L 2Q87A 2QADC 1N26A 2Z93B 2IQ9L 2IH3A 3NPSB 3VFNA 4KRPC 1ORQB 1RY7B 2IAMA 2JCCE 1LVEA 3C6SB 5D7LD 1C5BH 5T1LA 1J8KA 2VDPL 2A6IB 1Y18A 2V2XB 3BX7C 4PJIF 4X4ZA 5TPWH 4RIRA 5DRXA 3CSPA 3CAFA 2E27L 4KJQC 4JANB 2GW5A 5B8CB 1AH1A 3DRTA 1ZHKB 2BNRD 3GKWH 4JGMA 5JTWA 2DJUA 5AG8A 2XZZA 2FX7L 2X1OA 1CLCA 1FNLA 1QSFD 1WUNT 5MP6H 2VAAB 3MRFB 5EZIL 1R5IA 5E5MB 4MDJA 4L3CA 1BEYH 2CQVA 3RP1A 3GI8L 3W39B 3GHBL 3VFOA 1MCWW 5F9AC 1FORL 4GH7B 1GOFA 1CD1B 1JYNA 2QHRL 2CLVA 5DJDB 4R4FH 1KFAL 4JFHE 5I15H 2BC4B 1GC1H 4R4FL 4P23A 4BSJA 2VLME 4JN2A 4KRPD 4NO2B 2NXYD 3DV4B 3QNYB 3G08A 1C7SA 3IJYB 4TUJB 1YQ2A 3MJ9A 1IGCH 5DQ9B 4YBLB 4LSUL 3GIZH 3L5WB 1Q72L 3DHMA 4O51B 1S9YB 3QISA 4RMTA 3VWJD 4PRPE 3S5LG 2JIXA 1AXSA 2O5XL 4GSDH 4JO1L 1OGAE 3CC5A 4MSWA 2NY2D 3ULVE 5T3XL 1JP5A 5E1AB 4KKBD 5D7IE 4NO2A 3P0GB 4MHHI 1CLZL 3CSGA 1C08A 3G6AA 4P23B 4LCWD 1MREH 1JN6B 3O8XA 3RWIA 2F53E 1CGTA 1R3LA 4PJAE 3RY4A 3V0VA 3D25A 1ZSDA 4BFGA 5CWSB 4F7MA 5FUZH 1T7VA 2YMXH 2IF7A 3EYFA 2XXMB 2DQJL 4LOUD 4P9HC 1AI1H 3U2SB 3DX6A 1RK0B 4WWKB 1P5VA 1AI1L 5EO9A 3O8XC 3WIFB 4WUUB 4HV8B 1GZPB 4C83B 4P59H 4D3CL 3DX7A 3WD5H 5T1LB 1WGOA 3VD4A 1FNGB 2ZCKH 3L95B 1N6QL 2ADIA 2IGFH 1AKJA 4LSSL 3KJ6L 3S36X 1NQBA 4RQQA 3FAXA 5E2UH 1A3QA 5CCKL 3PHOA 3GUTA 5JXED 3DPBA 3NIGF 3CFEA 4PJ9C 1H3TA 1X6NA 4CVXA 5HHOD 2AJVH 3UTTE 3SGKA 3O11B 3ARDB 2VZVA 3TO2A 1G0YR 4MQXD 1RAMA 5J6HA 3VH8G 3KPOA 1HINL 3DV6B 3RZCB 1KJ3L 4GKSA 1EA9C 2Q6WB 4G6KL 3PABA 3HFMH 4HS6A 3U9UA 2GJ6B 5SV4A 5ISZA 1VADB 5H37G 4MDIB 2YD2A 2PXYC 1YC7A 2HJLB 2HT4C 5EIQA 3RX8A 2RFXB 1CICA 4OLXL 1JNNL 3HE7D 4WFGE 3ZKSD 4FFYH 1PLGL 4OCNC 2AJZB 2DLTA 1S8DB 4OLXH 4OZ4B 1U8KA 4N0FA 4MJID 4LLQA 5E6IA 1T0MA 5FA3B 2Y6SC 3NCYS 3VD7A 5FF6B 5IMLA 3KYKH 3ULVD 3DSFH 1F97A 1L7TH 3OXRB 3HE7A 4NKDB 1RZJL 5DRZA 3SQBA 4GXVL 4MMXC 3O3BB 3E3QE 2ILLA 2X4SB 2DWDA 4Y1AB 4PJAF 2QKIA 3LIZL 3MV11 2Y36L 4JFFD 4G8FA 3LQZB 2ED8A 2HVKB 1YEEH 2V7NA 5HSFA 5I1AA 4JHWL 3G5VA 4XP4H 4Y4HD 5JPNA 4DCQB 1MJ7L 1N0XL 3CVIL 2FD6H 1CD8A 1EXUA 4XNQA 1D5ZB 1DQML 3RVWD 3S35H 4X5WA 4U6VL 5IBUG 2ICEA 1A3RH 1Y0LB 1TLKA 3GSQA 3OKEB 2VDNL 3PDOB 4UDTB 1I7ZA 4F2MA 2MCPH 5D5ME 2GY7B 2NY0B 4FQHA 3MA7B 2Y7QA 5F7YC 3CMGA 4LHQB 4L4JA 4XNYL 1TXKA 4XVSH 4Z8FH 3W0WD 1P4IL 3FTGB 3ZYJA 3P9LA 4F33A 1A47A 1M7XA 2D03H 3QZWA 4F33B 4PJHE 1X5KA 4G8GA 2VXQL 1WAAF 5C0EA 3KPLA 4EQ3A 1G7IA 3GJFH 3HI1A 4X6BA 5FCSH 2FB4H 3EHBC 1YDPA 1JF5A 3TH3T 3MLVH 3C5JB 4ONFL 3CXHJ 5BV7H 4JR9H 5KVFL 3JZ7A 1XGYH 3ARDA 3VRJB 1NFDB 2C1PB 4X6EB 4QRPE 4G7VL 1MLCB 2R0KH 1OAXL 1B2WL 1PKQA 2GSIA 1QUNA 1T7YA 4PBVC 1ZA6B 3WUWB 4XMPH 1WCBB 5C09D 2KZ1B 3D2UB 3AREA 3W11C 1V3KA 5LAXA 1N8ZA 4JFYA 4PJFB 1IAOA 1SY6A 3TEUA 5GGQL 4OZGA 4MA8H 3OGOE 4HWBH 3W5NA 1JNLH 4L3EA 2FHCA 3KHOA 1UENA 2J5LC 4NSKB 4PJ8A 3K1DA 5DVNA 1NGZA 2NY3C 4P2RA 1QRKA 1BF2A 2W9EH 1WZ1L 1QSEA 4G9FB 4KK5D 1DBAH 3ZHDA 4GW4B 4PLOB 5EC2A 1AGFA 5DRZB 5EC1A 3L7FA 1KC5L 4JZNA 5I19L 4HKXB 5HPOA 2ESVB 1ZA6A 5D9SA 5E5RB 3TZVC 1NCNA 4RAHA 2HP4A 4WEBH 2LU3A 5KOMC 2YD4A 3I2CH 1CGXA 1BVLB 1LWRA 1OB1B 3CFBA 2Z9TA 2HT3C 4JO2H 2X1PA 5C08E 2C3WA 4FQJH 1BJ1J 4ZUUA 1V3LA 2HWZH 3VD5A 5C9KA 2F58H 2IQAA 2IAMD 5L8LB 4XBEL 3FONA 5DQDL 3TO4B 5LBSL 3ZO0A 4AIZA 3UTTD 3WO4C 3QYCA 5JW4M 1B0GB 3O6FD 5ADOH 4F9LA 4WFEE 2Q6WA 3HZMA 1KXQE 5FYLL 4JGJA 5GS2D 3T0DA 2HYMA 4GAFB 3ZTJG 5C0EB 3AB0B 3KPMA 5HYJB 1U95B 1YEFL 2OTUB 1IC7L 2JTDA 1KFAH 2D4DA 2YKLH 4HIJA 4CAGA 4FQLH 5C07E 1L9MA 3QCUH 2B1AH 4OAWB 5BJTB 2VSDA 4M7KH 2AK1L 2Y7QB 3UC0L 1N64H 1FQ9C 3RWHB 1DBMH 1Z0MA 3KG5A 2GY5A 2D4FA 4LF3B 4Y16B 5E00A 1WEJH 1CDBA 1CL7I 1QFPA 4UOJA 1GZQB 5HGHB 5HHNB 4R90H 1Y0LA 4HWUA 3TBWA 1KBGL 3AU1B 4H0HB 1DFBH 1TENA 3E2HB 1V05A 3V0AC 1OAKL 4L8BB 1U8IA 1MRCH 4CVUA 5J6GB 2VWEC 2NYYC 4JANA 5L6YH 3W5MA 1BQLL 3BRFA 4NNYA 3UPCA 3O41A 35C8H 4MD5A 5F7HA 4M4RA 5JXEC 3FB7A 4KH2A 1JCKA 4HUVB 1KPVB 5CZXC 3V0VB 3QXVA 1ES0A 2YUWA 4PJHB 1JTPA 5C0DA 3QEHA 1KEML 2D2OA 3JXAA 4WI7A 2ORBL 3KXFE 1WC7B 3PNWB 5FO8A 4HIEB 4M1GL 2W0FA 2Z8VC 4U6XB 4EKXA 2H2SC 1KTKE 4X4YA 1JWUA 5C1MB 2LV4A 4NFCA 3FRUA 4MAYB 3VGGA 2W0KA 1J0YA 3FMGL 5KANG 1ZANL 5I71B 2DWEB 3MCLL 4NC1C 2P8MB 4F9PC 2DQFA 4YGVB 1MH5A 2X1QA 2ADGA 1UM5L 4LSSH 1YMMA 5L0QB 3IFLH 1FVCA 3QNYA 1KG0B 2H3NA 1YY9C 5FYJU 2CKBA 4U3HA 3SDAA 5EU4A 2IPTH 2BDNH 2CKBL 2KQMA 1G6RL 3MA9L 4S1DC 1JGVH 1NGPH 1B4JH 1A1NB 3ALWA 3O3AA 1CD1A 1PQZA 2FJGA 3V5DB 1N6VA 2GTZB 1FG9C 4LRNH 4MNGB 5DF0A 3H3PL 1W0WA 1BAFH 1HKFA 2FEDC 2W1NA 4QXGH 3MRFA 4GJTB 1P9MC 4G6KH 4JY5L 4PJFF 5IIEA 3PE9A 3PXJA 1QRNE 2E7HA 3QR2A 4NOFA 4PTUA 3LKNA 1G9NC 1XF4B 1Y6MR 1BOGB 2VWEE 3IETB 2Q7YA 3OKDB 1OTSC 1F3DJ 3WNNA 1NGWA 1RZFH 1S9WA 1JPFB 5KN5A 1VCAA 3MJ8A 2HKFL 5D2NC 1IVLA 4XVJH 5T5FH 3EO0B 5EOQH 5I1DB 1KIPB 1MPAH 1SEBA 4Q97A 1EBAA 3HZYB 4WUUA 1MCEA 4QY8A 4J3UA 5MEOA 25C8L 3LEVL 4WCYL 3KVQA 1S9XB 1FLRH 1QFOA 4KDTC 3AU1A 4XAKE 1JV5B 4AMKL 3EYFB 4JFFB 5D1QD 1CR9L 1J0ZA 4F7MB 4P5MB 3H42H 2XQYG 1ORSB 4HAGA 4BQBA 3EFDL 5GSVB 3CDGB 1HKLH 3IDIB 3NIFE 1I7UA 4JB9L 4WV1B 1QPXA 3BO8A 3L1OH 1U8OB 1YMMD 1JWSB 3ZSSA 5DWUH 4JB9H 2GITA 3EFFA 1UC6A 4TVPD 4O5LL 1U8QA 4YHML 4K3DH 1QNZL 1F3JA 2VLJE 4HIJB 4MX7A 4RFNC 1EBPA 1OAYL 3T0WA 4HWZB 1RUMH 2MHAA 5I1CH 4KKCC 4YC2B 3ZDYF 5I74B 4NP4L 4AL8H 4HFWB 3WS6C 1TVBA 4WHTB 5KVMC 1EAPB 2BP3A 4PLKC 2H1PH 4YE4L 3CMOH 1AY1L 2YRZA 1MCSA 1J1OL 5DMIL 3NTCH 1QG3A 1YEDA 4IOFD 4ODHH 3SDCD 3VMOA 1AY1H 4XPTL 5D93B 3MRCA 4F58H 4I0KA 3BN9D 4K7FB 3WFEL 5F96H 3P77B 4HHAB 1HNFA 4JZOA 1ZHLB 3SGDI 4DN4H 5C0GB 3FOMB 3B5GA 5JORA 1G1CA 3AB0C 5CILH 2BRRL 5I1KL 2G60H 4G8GE 1EEYA 5DUBA 4DVRL 3RPKA 4TNVK 3W39A 1JPFA 3NZHH 5A3IC 5E5MA 1CK0H 4OFIA 4OUUA 2UZXB 4P49A 2BY2A 4ZFFB 5SWSE 1T22B 4Y19D 2VLKA 4UZGA 4H8WL 3L3KA 1PYWA 5DS8A 4OGAC 1MWAH 3RL2A 3SDDB 1CGYA 4NNXB 1CWVA 2BY0A 1W0WB 2QSTA 4PJ7E 5DUPH 1QP1A 4NN5C 2ADGB 4DEPB 3O4LB 1GRWA 2ED9A 3BQUD 3OKOA 5DUMH 4X80H 3QUKA 4PUBH 3GHEL 5DC9B 2VC2L 2BSSA 2WP3T 4NM4L 1UFUA 1NUGA 3MO1A 2ENSA 3LMJL 1U8JB 2MKLC 4PGEA 4ETQB 3O9WC 4JM4H 2EIDA 5A43C 1GHFL 1VFBA 5IBLD 5JHDA 3G5XB 5IVZB 2CUHA 4FZ8H 1A6ZB 3A6OA 3QHZH 2CDGB 3UTSA 4KPHH 1BOYA 2UZYB 5EZLB 3TM6A 1TZGH 2FGWL 3OGCB 1DN0B 4XWGL 5J3HC 3ZKND 4PFEA 5GGUB 3LPWA 2ARWA 4OIIH 1BVZA 1J0KA 4ZNCD 3KR3H 3S4SB 3T3MF 5C0DB 1MCLA 4MNQA 1GH7A 3QO0A 1WT5C 3MLRH 4AM0B 2ATPB 3NGBC 2Y6SD 4LKXA 4QXUL 4P5TC 4JFDA 1KIUA 4QO1A 1AP2A 3HPJB 1J7VR 2CIIA 5ESVA 1HZHH 3DXAE 2D0FA 1BQHG 3PL6D 4KZEH 5FYKD 2BNQA 4TYUA 4OIBA 5D8JL 3L3IA 5K9JL 4S1QH 2VDQL 3NZ8A 1HYRC 3RGVB 4WY7H 3WLWD 1UKSA 3F7RA 5E2TH 4YPGB 3V6FB 1JK8A 2I27N 1FP5A 1P6AB 5EBWA 2I60H 2RQ8A 3VA2C 4BK5A 1EIBA 2B1AL 5MENE 1UWGH 1WFOA 1RZFL 3EDFA 4HIHB 3BYTA 2ICES 2GEEA 4DKEL 1E4XI 1EFXA 5B21A 3MJ9H 1F11A 1TETL 4M61A 4XCYB 4NZDA 3WEXA 3C60B 2K9UA 4HUXA 5DEFB 4QTIL 3DSFL 4PV9A 1TQBC 1VGEH 4LQFH 5EWIH 1Q9LB 4PGDB 2AJUL 3VGFA 2VE6B 1L7IL 3MROB 1G7HB 3OXSA 3V7MA 4JPKL 2APTA 3WFDH 3ZKXC 1OGTB 4ACPA 3TZVB 3BSZL 1CR9H 3HZKB 2XKSA 4R2GD 5FF6A 2EYTA 4BK4A 2AJ3A 3MLTB 5EC1B 2DL2A 3WIIL 3ALXA 3L3OA 3MRKA 5IGXL 3MRLB 4GW4A 2XWJA 4OD2A 4U2YA 5DFTA 4N0YL 4EXKA 1A7RL 2ESVA 5D9SB 4APQD 5IOPA 4JZNB 3VFVB 4FQIH 4EN3C 3W82A 5CLWA 1IAOB 1UB6B 4KMLB 4R7DB 1U3YA 3BAEL 4NJ9H 3B43A 4Y2OA 2PTTB 1Y6NR 4OLZH 2YOCA 2NZ9D 2R39A 1YEHL 1Z9LA 4DKAA 3SE4C 5F71A 1X4ZA 3VW3H 2B5IC 4ZOCA 1U6AH 3UCRA 4JG0H 1U2HA 3X13B 3BYYA 3RZCC 1KPRA 3UBXI 4RQQB 5LKNA 3VXOA 5I76A 1ED3B 4EDXB 2WUBL 4GS7C 4NQEA 4C58B 1IGYB 1B4JL 3ARDC 4FTVD 4Z7VE 1E0OB 1Y6KR 2M1KA 1BPVA 3HI1B 3C5SA 2FO4B 1NCCL 1IBGL 5E8OB 1A7BA 5FYLE 4Y19A 1JRHH 4Y19E 3MRHA 3TJEH 4WHYH 1I1AC 2G2RB 2EKSB 3T3PF 4IMLB 3MRKB 4MA3B 5FDWA 4PJBA 2ZPKL 5FHBH 4NUGH 1WWCA 1OP3H 2X6MA 4FP8H 3PP3K 3O6ML 3D1MC 3KPLB 5L2KA 3WFBH 2CR3A 2O61A 1OGTA 1CICD 1N7ML 2GAZA 3RVVC 2R0LH 4KJQD 4CDHA 3TBTB 1D7FA 2XG5A 4NM4H 2XNAB 2DQDL 3MLTA 4HKBA 1XGQA 4MXWH 5EU6B 3AVEA 5MEQB 4EI5B 1QACA 2YA1A 1WISA 4RRPG 5ACZA 3CDFA 4UINH 4F3FA 3MROA 2D7TL 3OXSB 3VFTA 3B3IA 2R29L 1RSFA 4F9PA 4X98B 1FJ1A 4Y4KB 2FGWH 5DEFA 1Q8MA 2EICA 2J8UA 3O3EA 3SE9H 2COQA 1XH3B 2KH2B 3KPSD 3GMLA 4S2SB 5CGYD 5I19H 3FO1A 3BRGC 5KBNC 1J8HB 1TVDA 1A64A 4HPYL 4GMSL 4ODTL 4YHOH 4QLRA 2AJYH 4XNUH 1U8PB 2P44B 3RWGB 5C09E 1GJIA 2X40A 1WBXB 4OZFA 4P99A 4XP1L 4UNVA 4JAMA 4OV6F 3CFKA 1LEKA 1NC4D 1NDMA 1BM3L 4MNQB 1IC7H 4UT9H 4G6MH 3PQYA 4JPWH 1IQWH 1HSAB 5IMLB 5IFAL 4GLRI 4FZEL 4E41E 5E4EB 4MA7H 3PWPA 4TOYL 2JKXA 2I5YH 2OXHA 4JFXB 5JPMB 1AJ7H 4Z77A 5FHAH 3SO3C 1FFNB 2B5IB 2HFEB 4UOW1 2FO4A 1Z5LA 3R4DA 3SQOL 3QHTC 1IC1A 1MFAH 4LARL 4X4MA 5IHZB 5IB3B 4JHZA 1B88A 4WIQA 4X99B 1GC1C 3LD8C 3MOQA 4NFBA 3I9GH 3O4LA 1LE9B 4Q9RH 3HUJB 4JM4L 1H15B 4X80L 4C4KT 1MVFA 3HCVA 1MUJA 4N0UB 4RDQF 4IDJL 4JHAL 1PD6A 3BOVA 3MBEB 4OT1H 3P73A 1X5YA 5IB5B 3VXQA 1CN4A 2ICWJ 1KEMH 3G5ZA 4NKOA 1W72H 1KN2H 5JQ6H 2GJJA 5IG7A 3DX7B 4C83A 1NSNH 3O2DA 1EEYB 3BP4B 3SDAC 3FFDB 5TFSH 4NKMA 2F8VA 1OT2A 2XWJB 1SVCP 5DJYB 4JKPH 5A1AA 1RK0A 4WWKA 5JR1H 4I9WD 1INEL 3EYQC 3L3JA 2CXGA 5D2LF 3MOAL 1PZUB 1G9MC 4F7TA 5GGTL 4LEOB 1KTLA 4FQCL 2BERA 3CC5B 4M7LT 4UT7H 2FJFA 4OLYL 2EE6A 3VXSB 3R8BB 1IFHL 4HBCH 5FIEA 1XCTB 5BV7B 3MBXL 1BMGA 2AK4B 3FOMA 3EZ8A 4QXTB 4HQQH 1UXWA 5HVHC 4Z7UB 1U3JA 5DD6A 4CRPA 3V4UL 5CBAB 4H5SA 5D1QB 3ETBF 4EVNB 1A0QL 4ERSH 5TJWK 2A77H 3FFCD 1D6VH 2BC4A 1ZLUK 3ULUH 5ILTL 4KV5E 4LHUA 2OR7A 2HH0H 1N5AA 4MJ6A 1PLGH 4CJ1A 5E99H 2E9BA 1HHHB 3BGMB 3QUMA 3DV4A 4EOWH 3FHQA 3T1FB 1X44A 3HR5A 2Q76B 5EDXA 4XPHL 4ZUWB 1ZHKA 3ELAT 4QY8B 4XNXL 2P42B 1SY6L 4GAJH 2DQDH 3UDWC 2DQHL 25C8H 4P5MA 3VG9C 3H0TA 1QTYT 1XZ0A 1HHKB 4AH2A 3SKUD 4JREC 5IVXB 3MJ8B 1OAQH 1YEEL 4UT6H 4JRWA 1SM3H 5D7IA 3BW9B 1FO0H 2IMNA 1SM3L 2QADB 5C6TL 4MB5A 4Q6IB 3IFNH 5DDHB 4A6YA 3LKNB 1KEGL 5FB8B 1B0RB 2EDEA 1S7SB 5CJOL 2P1YA 1GCFA 5HYQA 1K6QH 1K8DA 3O9WB 3U83A 5DFVD 1PEZA 4KRNA 3WXVH 1FO0B 4K3GA 1IKNC 4HPYH 3HN3A 2Y4SA 5EO1B 5F1IB 2EIZB 4P2QA 5A16B 4P2RD 3U48A 5J11B 4W6WB 5HY9A 5GZOD 3IDNB 3VRIA 3G5XA 5IVZA 5JHDB 4DEPC 1DJSA 3MLPA 3PDGA 1DQQA 2AKRA 4ZAKD 1IGFL 3DURB 3QFJA 3DOSA 3LKRB 1UJTA 3QPQD 3ARED 1GXEA 3VW3L 4KK5C 1GGYA 2WV3A 3MRDB 4WO4B 1O7SA 1XGTA 5DHVB 4ZXBA 3CFCH 3VFRA 3ARBB 3MA9H 3B9VA 1IQWL 3V4VL 5F96L 1XGTB 4DUXA 5FYJH 1AQKL 3O4OB 4GG6E 5DC0A 1S7RB 2G5BB 5A2IH 1CFQA 3KPRB 4WVRA 3PP3H 3JSSA 4KC3B 3DURA 3L6FB 5FGSA 1QLRA 3PNWA 1T22A 2DQFB 1UACL 3PG2A 4DKFH 4G5ZL 3DGGA 1HH9A 4FP8L 2BNUB 4QYOA 5CBEB 4QHUA 1BLNA 1FH5L 1G6RB 2IBZX 5FA4B 2X4QA 3FRUB 1JVKA 3G6DH 5HHQA 1KLFA 1Z3GL 3MACL 1F2QA 2ESVD 3QQ4B 5EULV 1RJYB 2NZIA 5CD5D 1KYOJ 1CDIA 4P5KA 4RWYH 1S9KC 2D7QA 1MFEH 1NLBL 4K94C 4NUJA 4R4BA 4XPFL 4KI5D 1S7XA 3UTTB 4OZFH 2D7TH 1GVIA 5D7LE 3S3PA 1H5BC 1U8NA 2CMRH 2ITCB 3H0TB 3QHZL 3BT2H 2EC9T 4ZUSB 4XPGL 1Z9MA 4Y4KD 2ZG3A 4KI5C 1EK3A 5I1IH 2HFGH 4CW1A 3CFDA 9CGTA 2VL5A 3WLWC 2UYLA 4MJ6B 4M6ML 1N5AB 1X5IA 4H20L 2OTUA 2Z92A 2X4UB 2IPUK 2PUQT 3RWFA 5DK2B 4Q7DA 1DVFD 4FQXD 4ZQKB 4JFHD 2P43B 3M8OH 5I9QB 4JQXA 1RIUH 3T2PA 5BJTA 3GSOA 4OGAD 1U8HA 1J05A 4OFYD 3UEZA 3AAZA 5L2JA 1Q9OB 4YX2L 1DP0A 4K8RD 5HHVL 4QXUH 5HI4D 2OYPA 1FFNA 3HZYA 2ZUTA 1U95A 3V6ZA 1ZLWK 4PY8J 4UT9L 5D1ZA 4QRRB 3DECA 2BNQD 1DQLH 4HJJH 4K55A 4ZSOA 1WBYA 2EYRB 1D5XB 5CJQH 1T0NB 3KYOA 5E6ID 3WDHA 4Z7NE 3CX2A 3GMQB 3GRWA 4DTGH 5JW4Q 4ONHA 2GT9A 4GBXB 1IC4H 1HSAA 1UJ3B 1T3FA 5ICZB 5FCUL 4JG1H 2D7PA 2Q1EA 3S98A 4M6AA 3N9GL 3TPUA 5GS0C 2IH1B 5D1ZC 1N0LA 3F6IA 1UWGL 3GSXA 1RMFH 1ERNA 1T83C 4FTVA 3ROLB 1KNOB 2IG2L 4W6YB 5FK9B 4P4RB 3SKNA 1F4WH 2HRPH 3SGDH 1RZKH 3WSQH 2PF6A 5ESQB 1A1NA 3BKJH 1NBYA 4BQ8A 1UM4L 4IJ3B 2IANA 3UYOD 2FWOB 2VL4A 1XR9B 4BSWB 3ME0A 3GBLA 3WIHH 2DS4A 5A2FA 1DSFL 1XF3A 1I9IL 3I02B 4J3XA 6FABL 2J3SA 1FDLL 4RSVA 1RJCA 4KQ3L 1MH5B 1LO5A 1N8ZB 4X0KA 2NXZC 3WLBA 4K7PY 5CEXB 2W60A 3VFTB 4Z95H 4GAGL 3ZHLA 2NQCA 3BQUA 5I1GL 4OT1L 2BCKA 4CMHC 1XGUB 3QIUC 4P3CL 5AZEL 3QSKB 3OAZK 5E4IA 4X6BB 5EIVA 2NY5H 1T04B 4EI5A 2ZUVA 5BQ7A 4K2UH 4L9LA 4HKBB 4HIEA 4U6XA 4WFHD 2V2WA 4U1NA 1R5WB 1KYOK 5JZ7D 4K07A 2BOBB 3IJSB 1YEKH 1RD6A 1YEKL 2OK0L