5D93C

Oxidoreductase fragment of mouse qsox1 in complex with a fab fragment from a mouse qsox1-specific antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
207
Chain Sequence
QVQLQQSGPELVKPGASVKISCKASGYSFTSYYIHWVKQRPGQGLEWIGWIYPGSYNTEYSEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYYCARSEDWFAYWGQGTLVTVSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfhydryl oxidase 1
publication title Overcoming a species-specificity barrier in development of an inhibitory antibody targeting a modulator of tumor stroma.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 43
structure length 207
sequence length 214
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d93C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d93C02
5EC1B 1NAMB 4HIJA 4RZCA 1MCWW 2JJVA 2Z93B 4HMDA 4E41E 3HMXH 5I1DB 2QSQA 1NUDA 4KROC 3PWLA 4IOIA 3GSOA 4JCMA 2B4CL 3L3IA 1S7XA 1ZGLB 5E8DH 1OP3H 1NANI 3CMOH 1AKJA 3ZYOA 1YN6A 3VFNB 4N0UB 3LKSB 1RZJH 3MRMB 1IC5H 1NC4B 5E7FA 4OZIA 1E4XH 1PYWA 5KSAC 2A9NH 2ENYA 1PAMA 2EYSB 4HMEA 5J9PA 5CCKH 2H2PD 1NEUA 5T1MA 3EIFA 4X5XB 5BRZB 4Z7UA 2KBGA 3I9GH 4NQCA 3KPLA 4R96B 5E2JA 5DJXA 3QPXH 1DVFD 2PNDA 5MEPB 1KJ2L 1P7HL 1P4BL 4F2MB 4B7LA 1Q0XL 2X4UB 1L9MA 3KLAA 4R8WL 3C60A 4PJEB 4FQ2L 4M00A 1ZS8A 1ZVSA 3QIUD 1FIGH 3RWDB 4NKIL 3QIBC 1RZFL 15C8H 3BW9A 1MY5A 4UMGA 1YEIH 1JWMA 4W68A 4Z7UF 1WUNT 1HIML 4OCRL 3GSRA 3EJJX 5I8KH 4OUOA 4XPBH 3IJSA 4I3SL 5ESVA 1SY6L 2ENSA 1G7LB 2VDLL 5HYJB 3VG0H 2Y36L 4POZC 1UENA 2YD7A 1BZ7A 1NC4D 4R3SA 4B50A 5FF6A 2GK0A 4YGAB 5J6HA 1T03L 1QBLL 2VKWA 1TZHA 4L4TD 2UV3A 4LLMB 1G7JA 1Q94B 3ZT5A 4YHML 1MEXL 2ID5A 1W0WA 3ME0A 4MQXC 5CJOH 1JI1A 1YMME 1VFAA 4YBLB 1XAUA 3GSVA 4QOKA 4MXWL 4U2ZA 4UDUA 3U4AA 3NZHL 2ATKB 3ZHKA 1X5LA 4WHYH 5FDWA 1V7ML 1KGCE 4ORGB 1A6WH 1FFOB 1S9WB 3LKRB 1NFDB 4BJLA 3LHPH 3HR5A 4G8FB 1JYXA 5D4QA 3RVXC 4M7LH 4KZEL 4D9QE 5FOBB 5ITBL 5E6ZA 5DQ9A 1I1CA 4DKEH 1LNUB 3VE0B 4NUGL 5GGSY 2FZ3A 3WD5H 2ATPB 3H42L 5DUPH 3DRTA 1ZHLB 3DV6B 1KTLB 5KS9E 4JB9H 3DXAA 3RWGB 4R26H 1ZHKA 2ERJC 4X4MA 5K93A 3MX0A 4PREB 4XVSH 3E0GA 2R23B 3O41A 4P9HL 5HYJD 3M8OH 5CZVL 4RX4D 2QADC 5I1JL 5A2KH 1Q9OA 4I5BB 4NM8H 5F88B 1M7IA 2BVPA 3D5OF 5E5MB 4RISL 4ZUTB 5K9JL 3CLEH 1M05A 4Z7VE 2X09A 5DVKA 2C7UA 1PJ9A 5FA4B 5T5FL 3RGVA 4ODUA 4H26B 1MHEA 3RIAF 1AQDA 2J1KA 3QFJA 1L7IL 2D2OA 5D93B 1DSFL 3L3JB 2QL1A 4YDKH 3QUYC 4ZUSB 4PRPE 4IRZL 1E4WH 1T83A 5SWZE 4FQHA 5HHQB 2FCBA 4D9RD 4LCUA 4PR5A 3S35L 3I2CL 3PUCA 1ACYH 4ZPTA 3W0WA 4LK4A 3VD5A 5FKAB 3MRGA 4X9FA 3RY6C 5KVGL 3FO9A 2AQ2A 4UIKH 1MIEL 4TNWK 3MSPA 4PLKC 3O6FB 4Z8FH 4LCIL 1WBZA 2OL3B 3RIFF 1RU9H 4HLZG 3QO0B 5C6PB 2XZCH 5H8DA 1ZAGA 4JPIA 1YEDA 3WS6C 3T09A 1T0PB 4EDXB 3U9PH 2ZSVA 3S96A 3WNMA 4MAYA 4G5ZL 1HHHB 1VDGA 3O11B 5DMIH 1JN6B 3HLAB 5C0RL 1XF5A 5E08L 1JWSB 1N8ZB 1FV1A 1KCRH 1NEZA 4HS3A 5T3ZH 5EBMA 2ESVE 4LCWB 1NMCB 3QO1A 3QIWC 4YC2B 1HQRA 1RFDH 2DS4A 4NM4H 3KYNB 4LPXA 4M5YL 2WP3T 4PJCA 2QTEA 3DX9B 3KPSB 4JQVC 2F19H 4MCZA 4MD0B 2C4XA 2EH8H 4PJ8C 1IKNC 4FTVE 5EA0H 4OAWB 1K3ZA 4U6XA 2VRAA 2X05A 2AS5M 3W2DL 4FG6D 1MVUA 3PQYE 3W5NA 1LQSR 3I6KB 1KN4H 1RUPH 2CIKB 4LLQA 2DQHL 5D6CA 2LU3A 2N7AA 1B88A 4GG6E 1GOHA 4H5SA 3B9AA 4Y5VC 3FFCE 3E6FB 3RVUD 1JHKL 1Q1JL 2AJYH 1QRNE 1XF3B 4QKXB 3TO4A 5IVNA 4F8QA 2X4OB 5BMFL 4PJCF 3GNML 4FQQB 5GGVL 2OXHA 4LHUB 3L95A 4WFGD 5CJ8A 3BGFC 1Q9LA 1C5CH 3MROA 3QNXB 5J06A 1PBYA 1EAPB 2RHEA 3QEUA 4OD3L 3WFHB 4EKXA 4OLZL 5FO8A 5FYJD 3DX6B 3SO5A 5E95B 3FN9A 1CR9H 1UGNA 5KVMC 1GHFH 3IDXL 3ULVE 2P46B 4KROB 1T1ZA 2Z31C 3ZL4H 4WDIA 5J12B 3CVHB 4S2SB 3KPSD 5LCVL 4FA8A 4XC3L 4XWGL 1JPGB 3I3BA 3QUXA 4G6JH 2DRUA 4JPWH 5BVPH 4XNYL 3QQNA 3HPJB 1DTUA 3OL2A 1QEWB 3MRCB 3NIFF 3MOBL 4KRLB 1WC7B 3KAAA 2P5WD 4QRTB 2G2RB 3TNMB 3E6HA 1M1SA 3LDBC 1YY8B 3O6LL 1J1PL 3V7AG 4MNHA 4M8QB 2Q7YB 1CGUA 4NNYA 1CXKA 4PJIF 4PV8B 1TPXB 3VFRB 3K4AA 1UEMA 4QO1A 1A4JA 1FG2B 1YEJH 3D85A 3PWVA 1VPOH 3VWJA 1Y18A 3KWWA 4UU9A 4XMPH 3G5VB 1PKOA 5GGTA 3MBXL 4LHUD 4MAUH 2CSPA 2V5TA 1U8PB 3MV8A 3QIBB 4OLYH 4OLEA 1EHAA 2FHFA 5IW6A 4X6CB 4QHMA 5CBEA 1FLRL 5AYUL 5J1AB 2EXYC 4BSWB 1JF1A 1MI5E 4LF3A 1S7UA 2MWCA 1S78C 2VXVL 3D87B 5ICXA 1DFBL 3FAXA 4GW4B 3MZTA 2YPLB 1WZ1L 5L2KE 2BHYA 2VDQH 3J8F7 4NNXB 5C2BH 1IGYA 2MJWA 4ZS7H 2E27H 4QF1B 3RQ3A 4ZFGL 2UYLB 5DRWA 2A6DA 2DJUA 4TVPD 4KJQD 3TPUA 4HGKC 5J3HC 4KJPD 3RY5A 1PZ5B 3OR6B 1ZLUH 3PGDB 4FOMA 2ZNXA 4XBPB 5D7LD 2V5MA 2NW2A 2BJMH 1WCBA 1DUYB 4K3DH 4N68A 4ZOAA 1F8TL 2C26A 4PJFB 1OTTC 5KOMC 1CXEA 2FHCA 3OR7A 3W39B 2QHRH 5CUSH 3QUZC 1T04B 3CFJB 4JFFE 5C08E 4W6XB 4HMCA 4YZFF 1A1MA 3GBML 3KPRE 1MNUH 2VITB 4U1GC 4F33B 1WEJL 3EYVA 5HHVL 1Q38A 5FYKE 4O00A 4WW1A 4ODWB 2ITDA 4F7CB 2Z8SA 1XR8B 4QY8B 4YHOL 2Y5TA 1WBYA 2EDJA 1FZJB 3BH9B 4X4XA 1I8IA 2ERJB 4WEBL 2P43B 3BP5B 4CKVX 3GZKA 3G6AB 4LCYA 4L8DB 2YPLD 4KHTH 2R1YA 5E94A 5L9DL 2DBJA 1FZMA 2YN5A 2QADB 3MLYL 4F58L 1OCWL 4WCYH 4WI8A 5BZDB 1KELL 1TQCC 5L6YL 5F6HJ 1RZKL 3N06B 1MRCL 5FKPA 3KJ6L 1AO7A 5BV7B 1TVHB 3L7FA 5E8PB 3ULUE 1HHIA 3B9VA 5JA9A 4WENB 2NR6D 2DM2A 3SKMA 3OKOB 3BGMA 1R5IB 1GPOL 3C8KA 1S7WB 3UJJH 2YD9A 4XVJH 5DUBA 2FD6H 3QUYB 5ILTH 3MOAH 4R0LA 3X14A 2WWMC 1A6AB 3CZJA 3LQAC 4K71B 4NO0B 3SDXE 5CEZL 1NAKL 1DBKH 2RGSA 5B3NA 2ZUQC 1F3JA 4HIEB 2R29H 3VD9A 5L8LB 4KJYB 1T2JA 4WFED 4ZDHB 1WWBX 3V4PH 4R90H 4Y8DC 2WUCH 3ZE1F 1AE6L 2F58L 2NXYC 4UNUA 3TT3H 3WEXB 2HT3C 5JPNA 3FTGA 4EOWL 5F71A 1XGRA 4G9DA 2APWA 5HPMB 3T0WA 4QRQA 3QI9B 3QPQC 2FH6A 1X6NA 1CDBA 4ODTH 1CZ8L 5IHZA 1X5XA 1ZWIA 1S9VA 2VL5B 1IAOB 4P57B 4N0YH 2ZZUT 5E2VL 1LEKB 4A6YB 3DSNA 3QIWB 1K5NB 4MXQD 4WI7A 3OPZL 3HI6H 4ZODA 4CAGA 3RNKB 2N1KA 2F5AH 3DIFB 3UP1A 2FRGP 4M48L 4FFYH 2VB5A 3B5HA 3WUWA 2GSGA 3CLFL 1SJEA 4L8SC 4XNUH 1T0MB 3FQRB 4PB0L 3QG7H 4UT6H 4NO0D 2E6JA 4HWBH 4NWUH 5IB4B 5C70A 4LGPB 3ARFC 3HB3D 4Z7OF 3DBXA 3PJSA 4XCFH 1I8LA 4IM8A 3K8LA 2D7NA 1K4DA 4KV5E 5EFIB 3LN4A 2FB4L 4Y5VB 4B41A 3CD4A 1KB5A 1WIOA 1JYNA 1RJZB 1J8HA 4P59H 1H3UA 3BEWA 3CPLB 1JHTB 4JRYE 1GIGL 4GLRI 2OR7A 2AP2A 2ZWLT 1H5BC 3DUSA 3UAJD 3I6LD 3QI9D 3NFPB 1QBML 2XOTA 1S7RB 2ZUYA 4HWEH 5ACZB 3UPRB 3JV6B 1ND0B 2H6PB 3K8KA 4G6KH 3S36H 2CKBB 3MLSL 3QIWD 3QQ3A 1NDMB 2FHBA 3QHFL 3QJHA 1RQ5A 4ZNEE 1P7QA 5IBLC 4LRIA 5INCA 1UWGL 2V9QA 3O2DH 1UG9A 2J6EA 3SE9H 3VXRB 5JR1L 2ZCKH 1BVLA 3LN5B 1MAKA 5GGRA 2YEZB 3UJIL 2AW2A 4M02A 4O2FB 4XH2A 2P8LA 4JFYA 4GAYA 1J1XH 3FO1A 3PXHA 4X83A 1W0VA 2IQ9L 3JVGC 1R3HB 4LDEB 1T1XB 2OK0L 3O4LB 3P73A 1XGPA 3QB7C 4XP1H 1H3TA 4K9EH 1BJ1J 2IMNA 2OZ4L 4K94L 5B8CC 1MCKA 4BKLB 2NY3C 2PF6A 4ODXA 4TUOA 5KVEH 4FP8H 3RTQC 3L5HA 4YDJA 4QNPE 1T22B 5GSVB 5DJ8A 4CADA 1I3RA 3TVMB 5D1XD 3SKNA 6FABL 4CJ0A 4AEIH 4N8VG 1KJ2A 2DI8A 2HKFH 5I71C 4PJ9A 4LSRL 1QFWM 4PPTA 1NLBL 3VG9B 5IB1A 4Y0GA 3SDDA 2CH8A 1I7TA 1CFNB 5DD6A 1J5OH 4BFGA 1RZJC 4JFPA 3F65A 4KMTL 1FYTA 3TZVA 3T2NL 1NMBH 4JQIH 3D2UD 1NGXA 1E6OL 4NQVB 2P7TB 3BVNB 3V4VH 1J0ZA 4XWOD 3QCUL 5SWQB 1M6OB 1A8JH 3TA3D 4BYHA 2Z8WC 4O2EA 4BQBA 4JN1H 1A2YA 2IANB 3CX2A 3V0VB 4KK5D 3O3BB 5IB3B 3O4LD 2IFFH 1AXTL 3LH2L 3M07A 32C2A 3UCRA 4M9PA 3TN0C 1SY6A 1AGBB 1OAUL 2D0FA 2D03H 2O5YH 1KT2B 2FJGB 2GJ6E 4KFZC 2Q7NA 3MLRH 2IMMA 4KDTA 3UO1L 5JW3L 3VCLA 3CUPB 2AJZB 3RZWA 2XICA 5IHUL 4PGZA 1DUZB 1BF8A 1MFDH 5LQBH 4NQDE 3DLQR 4ZPVB 4V1DB 3GBNH 4GQ9L 4PJBA 4OLXH 3TVMD 2XZQL 1F3DH 2BNUA 4Z7QF 4QRPA 2EIZB 3RVVC 2R0KL 5D7IA 3X11B 1XIWC 1RJYA 4JM4H 3GO1H 2I5YH 1FO0H 3P4NA 2EXYD 4N8VB 4AL8L 4WWKC 1F6FB 3IJHA 2DKMA 1PVHA 2E9WA 3MGAA 4HJ0C 5IFJB 4PRDB 1LE9B 3OAZH 4NGHH 2YK1L 5EBWA 4G9FD 4OD1L 2DLGA 4JHWH 1UM5H 1FZKA 4LGRB 2HAZA 1TQCB 4JFOB 5FM5O 4ERSL 3L1OH 4YE4H 2XRAH 5HGDB 5HYQB 5DJCA 1EEYA 3ARGA 3BKCL 4PJBF 3SJVD 4OF7A 4I2XA 5SWSA 1MCPL 4PS4L 4Y19E 1CK0H 4JZJC 5D7IF 5C09B 4HK3N 3BZEB 3DO3A 3MUY1 4P5TC 3QXUA 1ZE3C 5F7FA 3OAUH 4HWZB 4I0PC 3GSNH 1UZ8B 4JJ5A 4HHAB 1TETL 4QYOB 1EBAA 5E03A 1ZV5A 3UC0L 2EDFA 2ZUQB 3ARRA 3TYFA 1A14H 3VXMB 3P4MB 2C4FT 2PR4H 5GIRB 3MA9L 2NXYB 2VUYA 4G80A 43C9A 3QQ9D 4G8GA 5DVMA 3L3GA 4NHUB 4OIAA 1QSFE 3RY4A 1CFSA 4Y1AE 2DBLH 2IH1B 4E41B 5T1LB 4KGLA 2BP3A 3LKPB 4U1HB 1JGEA 4L4VA 3RWJA 5DURB 1U3ZA 3TF7C 4HDIB 3V9FA 1CF8L 1PX3A 4PJAE 4BH7A 5EUOB 5I75C 4KDWA 5JHDA 5TFSH 4LVHB 1U8NB 4PGEB 5HVHC 4XNXL 3NCBB 4R7NB 4LLAA 1UM4L 2MTPA 2Y7QB 4GAJH 1N4XH 1T3FA 3N1GC 5CIPA 3EO1B 3MV9B 3LEYL 4DVRL 3GJFA 1Z0MA 5EOCL 4NZRH 3SEPA 1MJ7H 2A0LD 4RMSA 4ZFZB 4PRHB 1K4CB 5EBLB 2G9HA 2FJHA 1DLFH 4JY6A 4L8SB 5HJ3B 1WZMA 3TFKC 1BOGB 3EO9L 2DTSA 5H94B 2MKLC 4WUKH 5M7QA 2ARJQ 4YDIH 5I76B 2X5PA 1BIHA 5CSZB 3HG1A 4XXDA 5CEYA 5I19H 4X8JA 3VXMD 4ZS6D 3BIAX 3MUGB 3FQUA 1IEBA 1NL0L 5TQ2L 3DYMA 2EYRB 5D1QA 1P4LB 4P23A 2EDDA 4XPHL 4QXUL 5B38G 1LO5B 1H5BB 4E41D 3SKOA 4FXGB 5T1LD 4HEPG 2IG2L 3U0TA 4AIZA 5MENE 5I1EL 5GJSH 3MRPA 5DD1L 5DURD 1TTUA 4X4ME 1C5BL 3BFOA 1EGJL 3LKQA 3STZA 1NGWB 4M61B 5MERB 1WLHA 1YEKH 3T77B 4N5EC 4M1DH 3SCMA 4JFEA 3MO1A 1AJ7H 5JXAH 2PTTA 4DKFL 3DVGA 1I1YB 3T8XA 3MQIA 3FQTA 4MHHG 3KPOA 3EO0A 4UV7H 3TBTA 2GITA 1S7SB 3ZZ1A 1P6FA 3QISA 1FC1A 1EK3A 2XA3A 5F21B 2OTUB 1GSMA 3D0LA 2YSSB 4KVNH 4P4RA 5CHNB 4URTB 3DV4B 1S5HA 1NCBL 3REWA 3W5MA 3FMGL 4YHIB 2XNAB 3ROLA 3ZKXC 5IJVA 2UZXB 5B8CB 4LNVA 2PETA 3KG5A 2NY3B 4J3TA 4OJFL 3OZ9H 4UOW1 3VH8A 2IAMC 3D69A 4U1MA 1DQDL 3RTQB 1WTGT 5L7XL 4GRWE 4CU7A 3WJJA 4NKOA 2Q20A 5B38B 4UOW0 1YQ2A 3VMOA 3RNQA 4EN3A 5E0QA 1FFRA 4PRNA 1U8HB 2CRZA 4OF3A 5I71B 2W9DH 3MODH 3OX8A 2RAMA 2A74A 2OL3L 3N50A 2D7MA 4NDMB 4F8TA 5K59E 1ACZA 2D0GA 4Q9RH 3LEVH 2Y4SA 3HCVA 1LK3L 2GTWB 3IDGB 2D7TL 1H8SA 9CGTA 1I9JH 5ICYB 1JPTL 4AH2B 4M03A 1YMMD 4QWWC 4X7EC 4X6FB 5F96H 5FYKU 2MFNA 4YHLH 3V8CA 1F4YL 2AJSH 4MHHI 1OPGL 4LSQH 3LOWA 4L3EE 5DJ2B 5K9OB 1KGCD 2B1HH 2J8OA 5DHVH 4FQLH 2ICWA 2A1WL 2CUMA 3LIZH 1XR9B 4WHYG 1BGXH 1E28A 3Q6FB 3IRPX 3V6FA 4PRPB 3TN0B 3SY0B 4RMWA 4D9QD 1KTKE 3IKCA 5SWZB 1R3LA 4J3SA 5DHYB 5I16B 5B4MD 3LKNB 3QWRA 2NY3D 3JSSA 4UUJA 2C3HA 2KH2B 2MKWA 3QDME 4LLYB 4OGXH 2FEEL 3BHBB 5GSRA 5C0EA 3CSGA 4BFEA 5EIIA 1NBZB 1INEL 4Z76B 4YDVA 4XCYA 1CU4H 1U8KA 2XQYG 3CMGA 4JO1L 1RULL 2HRPH 1LD9A 4PG2C 4WWKB 4U1KB 2PXYC 3DVNB 3VA2C 5F9OL 1IM9B 1H3GA 4YFDB 1HH6A 4MLIA 3O8XC 3K8MA 3MBEC 3BEVA 4GBXD 4L8BB 5E99H 4RMRA 3VXUB 5DI8B 2AJVH 1D6EB 2BOBB 4J7RA 1IGJB 1CFTB 5CWSA 1KJMB 4IRJC 1IC1A 4S1DC 1N5AA 4S1SH 1I85C 2XTJB 3MLWH 1ETZA 3S37L 4MQ7A 4O51B 5D2NC 1KCUH 5C0IA 3F12B 3ILQD 4HIXL 2A77L 4OFPA 1KG0B 4PRPD 3FT2B 2V2XA 3PQYB 1DANU 4HFUL 5SWZD 3MRDA 2HJLA 5BXFA 1BEYL 3AAZB 4P5TB 3ZKQD 2AGJL 5JW5B 2JE8A 3CK0H 1QSZA 2O61A 1NDGA 4YPGB 1KC5L 1PY9A 2XQYK 3FKUS 3E2HC 1L0YA 4I0PB 1TVBB 3WFEL 5CKAA 2IFGA 4KC3B 2BVEA 3HE6A 3S34L 1ED3B 1FSKC 2A6IB 3M1BB 2ILLA 3SE3C 2HLFD 2CUIA 1CS6A 4TVPL 4BUGA 4KUZL 4NIKB 3ES6B 4GG8B 2NZIA 5IVXA 3VXNA 5JXED 3Q0HA 4KQ3L 5T33H 1UKTA 4WWKD 4UB0L 5JW4N 1UXWB 1IM9D 4Y16B 3L3HA 4HJ0D 3DSFL 3O3EB 5C0CB 2ESVD 2PYEE 1JV5A 1Q0YL 2EDKA 35C8L 1V5JA 4YWGL 3IDYC 1VA9A 3BKML 4PJXE 2P8PA 4PG9A 3SGDH 3MNWA 1MF2L 1YNTB 4M1CC 2XTJD 1CLYH 4NJ9H 2K7QA 5A3IC 5I75B 4GUPA 5L2JA 3UYPA 5HVHB 1IGIL 1VHPA 5IVXF 2P8MA 1DEEB 2IBGA 3PQYD 2AV1B 4P2YA 4NC2B 4XCCH 1GL4B 3C2AL 1MQKL 4OGAD 3V8OA 4KZDH 4UTBL 3L3DA 3AREC 4I0PD 2YOCA 5ADPH 1U58A 4PJHE 3FFCD 5DVLA 1AC6A 3V4UH 4P3DB 5GRZA 1EIBA 2VC2H 1QSEE 1X7QB 5DGQA 1YPZE 4ZUUA 3K7UA 4JRXA 1HOCB 4XAWL 4TSBH 2X10A 1S5IL 5AUMA 3PWJA 2VLKE 5I66A 5JOPE 4KUCD 3MGOA 2DQGH 1D9KC 4Y16D 5F6HI 1R6VA 1INDL 4PJ5A 1BQUA 2F74A 4P2QA 1IKFH 4WUUA 4P3CH 3OKDB 1A1NA 3ARZA 3VFMA 4JGUA 3ULVD 4C56D 2V17H 1Y6KR 4KMLB 2HH0H 4QRRA 1QFWH 4Z78B 5A1AA 4TN9A 3TJHD 1HILA 4NQSA 3O6MH 4G6AC 5DLML 2NY6D 3GUTB 1UACL 1AQKL 2V7NB 3CDGA 4FMFA 5DO2C 1WAAE 4L9LA 5ERWB 3RVTC 3HUJA 2X70A 5IB5B 5C1MB 2XA8L 1H3VA 4UINL 4PIRF 4YR6A 2X4RB 4HV8B 1FGNL 4IDJL 5BV7L 1JE6A 4KK6C 4GT7A 1ZMYA 1LP9A 3RUGF 4B53A 4OSUH 5I1IH 2IJ0C 5C08B 3MLTB 4P2RB 4XMLH 3KPRB 4WIQA 1X5KA 4OZFH 3ZKXB 4YHZL 3GFUA 1BZ9A 2ZOLA 4KTEL 5EU3B 1B0RB 1FL3B 1VGKB 1D5IH 4CL7A 1CGTA 2IAMB 1AHWA 5I1AA 5AD0B 3HUJF 1MI5D 5HGAA 1NCTA 4EUPH 5DDHB 1QHPA 2BRRL 5CJ5A 5GJTH 3VGAC 4LFHD 1KB9J 2OZ4A 2OX5A 1ZVHA 1WF5A 1SYVB 4FQPA 5TF0A 5JZ7D 5L2KD 3PDDA 1CFQA 1LP9F 1AP2B 1LGVA 4C55A 3MR9B 4N5ED 4CVWA 4R2GC 4ZAKC 4U0QB 3RWFB 2KL6A 4KI1A 1VFBA 1RUMH 1RIUH 4BSJA 1WFUA 3SQBA 3DRQA 4U1IA 1E27B 3MRNB 3X3FH 4IHOA 4NRXB 4P9MH 2HJKB 4A6YL 2RB8A 4EEEA 5F7HA 4K9EC 4MJIA 5C0DA 4JFFD 7FABL 5C08D 1OARH 4KY1L 4P2RD 3KPRD 3U4EB 1DBMH 1BIIA 2UY7A 5E7BA 3SDXB 3UEZA 3MLXH 5KTEL 1A0QH 4HS6B 1IAIM 5FYKD 3BXNB 3RA7H 2HFFA 3TYGH 4L8CA 2CIIA 5IROA 4LPCA 4KI5E 1LDPL 3BSZH 4TUKH 5F97E 3RWHB 4UBDC 1DBAL 3ARDC 3DOSA 1RUAH 1OQXA 1A7BA 3PWNA 3P77A 5HI3C 2VQ1B 1DJSA 5AEAA 1OGAB 2PXYB 4WU7B 3RVWC 4JQXA 2EDOA 2R8SL 3HC4L 2AEPH 1TZGL 3NACH 1ZLUK 2NY1D 4WHTB 1A1OA 1U8IA 3QUML 3ULUD 3TBWA 3BP6A 1CG9A 3WUZA 1IGTB 4O02H 5DD0L 1MFBL 1DVFA 2ADGB 4IRJB 3WFBL 2AABH 3CFKB 2VABA 3IXTB 4J4PD 2CKBL 1KIPA 1DDHB 2FECL 2FDBP 4FFVD 4H25B 4K7FB 4Y5YC 5D2NB 5TGBB 4YBHA 3QRGH 4ETYA 1T1WA 2C1OA 2HRLA 5DZNA 3SDAA 3PHQB 3WNNA 4A2MA 1VCAA 2EZ0C 3QIUA 1I8MB 5LXGL 4YBQC 3O4OC 4NHCH 3E2HB 5GRVL 4RDQG 4DGVL 2Z93A 1ZA3B 3OXRA 5EZLA 2X1XR 1FSKB 1WT5C 4MD4B 4JKPL 4LARH 4XP5H 4OM1L 3BISA 3EHBC 2X6MA 3VFSB 4NFBA 2R1XB 3S36X 3F58L 3GKZA 4N0UA 4PJGE 5AG9A 4D8PA 1OGAD 2PXYD 4MNGE 2XWJB 3BO8B 3EGSA 1CL7L 5KZCB 4L4TA 2VR5A 3EJZC 3LAFA 3EJYD 1WK0A 4TRPL 3TIEB 2H2SC 3BPCB 3IDYB 3GB7A 4U6HB 5MEPA 1J0KA 4S1DD 4WU5A 2R15A 3QCTH 4U6VH 4F2MA 3U36B 1JUFB 1PGRB 2X4UA 2IGFH 3A67L 3HE7D 4CVZB 4TYUA 1XGUB 5C0BE 3DYPA 2DJ4A 5EU4B 2VZ3A 4Z9KB 2B7DT 1EHLH 1CICB 2DN7A 4LCCB 2PYFA 1GGIL 4YQXL 4N90E 1JL8A 1UWEL 4PTUA 4HUUA 3OXSA 3RWDA 1MWAL 5FHAL 2UVFA 1OF2B 1R0AL 4FQXD 5CMAA 4AG4L 2PUQT 1NCAH 1RUQL 2ADJA 2B5IC 3VXSE 3QDJB 1A5FL 1A7QH 4OQ1A 4M43H 1N7ML 2BSSB 3MZGB 2DD8L 1IEAB 2Y6SC 3HI1A 1XGYH 1G7LA 2CGRH 5HYJA 1N5YL 1MREL 3LN9A 4OCXL 4RX4A 2Q6WB 1D9KB 4LIQH 3KHOA 5C0ND 1Q72H 2YXFA 4BFIA 3IS0X 4LLMA 3O45B 2NY7H 5ID1B 4I77H 1NGZA 5C0GA 4JFXB 2AI0H 1AFVH 1V7NL 1DZBA 1KNOA 3OF6D 2XWBB 4G3YH 4P0DA 4Y88A 2Y06L 3WXWH 1SHMA 1F02I 2AERT 3L3KB 1A3RL 1S9WA 2GJZA 3GMQA 3J7HA 4G8FA 5DJ6B 1CICD 4EVNB 2FIKB 3HAEH 5FOBA 4OZGB 5CJXC 3Q2CA 4LSTH 1N6VA 1LNUA 1N59B 3VE0A 5DSCB 4RGOL 1YNKL 3H0TA 2ATPA 4F7TB 5T5NF 1EXUA 3VRLE 3WBDA 2GJ6B 3BH8A 3O3DA 1EGJA 2Y1VA 3UTOA 3RWGA 4H8WH 2BSRB 1RAMA 4Y4HA 4PTTB 1LK2B 2BVQA 3WHXB 4QCIB 3VGHA 4P2OD 5EO0A 2R23A 2V5YA 2FYYA 4XTRD 2VR9A 5FO9A 1IC4H 1YEGH 5BCAA 3CSYB 3T2QA 1QQDB 1LO4L 3QZWA 4XZUB 4I5BA 5F88A 2V2WA 4MNQB 2D3VA 1XGTA 2FGZA 4ZUTA 3V0WH 3DECA 5D70H 5FA4A 3RI5K 5IWLA 1MY7A 1LE5B 3JV5A 1QSVA 3JTTA 3HRPA 1I1AD 4HXAH 4EDWL 3PHOA 4HZLA 2YR3A 3H9YA 3GBLA 3MC0A 1NC2D 1JWUA 2R4SL 3U9UB 3KPPA 2HT4C 2J4WL 2OJEA 4K55A 1F6AA 3IVKB 1YEFH 2QEJA 2EIBA 4K07A 4ELMB 4G8GE 3BJLA 1EEUA 1OTSC 4OV6F 1UVQB 4NP4H 1HINH 4R2GB 1NUFA 3P9LB 1FNSL 1VGEL 4PBXA 3ZDYF 3GRWL 5HHQA 3RVTD 1HH9A 3F7VA 1QR4A 3AS1A 1RMFH 1T0NB 1B3JA 5FKAA 3B2UC 4J3WA 1CCZA 1WWCA 2ICCA 2GJ6D 2D31A 3Q6GL 5C8JB 1U3YA 4KQ4H 2OL3A 5GZOC 3CFEB 1PY4A 2FR4B 1V3LA 3C08L 3IAQA 1QNZH 3D3VB 1OVZA 4NQDD 2WIMA 4I13B 1U3HC 1JN6A 1X5IA 4ZSOB 1IFHH 2DQIL 4L5FH 1XZ0B 4UT9L 2Y07L 4X7SH 5JNYB 2R69L 4GXVH 1ZEAH 4E5XB 4J1UB 4U1SB 2L4OA 4F7MB 3S88H 2GFBA 3V95A 3UMTA 3KPSA 4MD0A 3NFSH 5DD5H 4OAWA 4JG1L 2F5BL 2OQJB 5ALCL 3LS5H 4M6ML 3GM0A 3VI4F 1SEBA 4R2GD 1OLLA 2PO6C 1K8IB 1FAIH 2WQ8A 4K3HA 2P5WA 1AY1L 3AMKA 3VFVA 4U3HA 4LEXH 1T5XB 4Y19D 4TTDD 5EO9A 4I0KA 5KSUA 3KYMA 2WINA 4JO2L 5DT1H 4GS7B 4RGNE 1IMHC 4JFEE 1F4XL 4Y5YB 1HKLL 4G6ML 5TDOB 5IVZB 2CO7B 5D96B 1OLZA 3BKYL 5CGYC 1JNNH 1ZT4B 3WSQL 4LHUA 2XYCA 1X5GA 4GKSA 3ZTNH 1EAPA 3O4OB 2I24N 3DX6A 5DD3L 2GYSA 3OAZK 1A7OL 1TFHA 1U41A 3HI5H 4JFZH 4CMMB 1MVFA 4UBDD 2W38A 1QSFD 3NPSB 4CJ1A 4Y1AD 3S6CA 4NRYB 2BXZA 1JPGA 1N0XL 3F7YB 4GRMA 4IMLB 3IGAB 3F7PC 4XP9L 1U8OA 3R8BB 5EBGA 2J12B 1B0GB 1NJ9B 1KXQE 3MRCA 4ZD3H 1TNNA 1H15B 4H88H 4C58B 2DYPB 1WC7A 1UXSA 4QRTA 3TNMA 2JJTA 4BZ2L 5EIVA 3V6ZB 3H6JA 2JK5B 4M8QA 3TP4A 4U49A 3EOBB 2Q7YA 5ISZB 2J8UB 5C0AE 3MJ9H 2J88H 3VFRA 1IQDA 5IEHA 4H1LA 1UA6H 4C56A 5D7LA 5I74C 3HZVB 1FG2A 4A2LA 2GAZB 1U8MB 3IDUA 3IFNL 5DXWA 1TJIL 1HKFA 1IGFL 1RK0B 1UJ3B 5AZEL 5HY9A 4AMKL 1GGBL 4CVXB 1VKXB 1JIBA 1WICA 2X4PB 4QTIH 1GZQB 3GSNB 4B7IA 2A9ML 5DJDB 2E7CA 3NIDF 1R3KB 3QBTB 5ICZB 1WJ3A 5ANME 5DJZA 4YXKL 2B5IB 5LVEA 2F8VA 2GTZB 1W8OA 3L9RB 4M62L 1J0IA 5J1AA 4FXLA 4BSWA 2X4SB 1N3NB 2MQCA 1EHNA 4X7DC 2W0LA 1OAQL 2YPLA 4D0CB 4DGIL 4ONFH 5E2UH 2NMSA 2VYRE 5KAQG 4XHJD 1CLOH 1T1YB 4P3WA 2FLRT 2DYPD 2JF1A 3GMMA 4QF1A 5IJKA 2YPKB 2VO5A 3PXJA 4ODVH 2KKQA 2IPKB 2H2SD 1HXYB 2ICES 5JIHA 15C8L 3SKJH 5CBAB 4RFOH 2VZUA 1CQKA 5BZWB 1HYSD 4NQEE 1BAFL 4NNPH 3OR6A 3PGDA 1EUUA 4XBPA 4HBQA 3MJ7B 4PJFA 3PWPB 4KMQA 2VXUH 2JELH 3IYLW 4XMKL 2IALB 3SE8H 1S7QB 1FVCB 5GISL 3RBSA 1S8DA 3FT3B 1QLEH 3D39E 1A7RL 1O7SA 5F7EL 2HKHL 3AS3A 2BSTB 2VITA 2ZPKH 2BX5A 4XC1L 4F33A 4Z0XA 4M6AA 1LMKA 3TT1L 5B39A 1TJGH 4H0IA 1XR8A 4F7CA 1BOYA 4NSKB 2XIDA 2HVJB 3ZKSD 1UCBL 5HYEA 1WGOA 3QNZA 3BH9A 1P5UA 2XZAH 3BP5A 3OKNA 4U6TA 2P47B 2O5ZH 3G6AA 1G6RH 4L8DA 4F7PA 2R2HB 3DNKA 4PJFF 3RI5F 1IAIH 4EXPX 3ARTA 3MPCA 1T66D 1H8OA 4Q97A 2ARJA 5C07B 4NFDA 1FBIL 1F3RB 4GQPH 4KVCH 5LWYL 1UYWL 2JCCA 1TVHA 4HIIB 4FQ1H 5E8PA 3SDYH 4U6YB 5DUPL 5FM8A 4F9LC 5D6DC 3V5HB 3TEUA 1NKRA 1FN4A 1UM6H 3CXDL 5DUML 4I18A 3AU1B 3D18B 1DBBL 5F89B 1G7HB 3H9SB 1S7WA 2YXMA 4XVUC 5F3BB 5JQ6H 5CEZE 4FQJH 2BC4B 1FL5B 3TH2T 3RL2A 1A6AA 1H8NA 2VWEC 1BF2A 4S1RL 5GHWH 4E0RB 1T7ZA 4YHKH 5DEZA 4NO0A 1EVUA 1CE1H 3ULVL 4YO0B 1S7TB 5GS1C 4UTAH 3KLDA 4HIEA 2JJSC 2C3GA 2FJFA 3UTPE 2JCCF 4ZDHA 4QTHB 2KUTA 1YJDH 1JFQH 1QP1A 4UAOC 2OBGA 4JO3L 1MCSA 1P4IH 3FOLB 2NY4D 3WEXA 1I9IL 2FEDD 5FAAA 4ZUWA 1X5ZA 3QDMD 3TBYB 1T89A 5EC2B 4GH7B 1IQWL 3QI9A 2F53E 1U3HB 4K3JH 3B9KD 3ZKNC 4DZBA 3HTLX 5C07D 2OTWB 2VL5A 4WVRA 3BP7B 1J86A 3PHSA 3NAAH 4IMKA 4P57A 5FUZL 5ITFB 1NUGA 3BD5A 4D2NA 3ZTJH 1LEKA 4A6YA 2E5EA 1RVFL 3QIWA 2DI9A 1QYGH 3JZ7A 1E4KC 1D6VL 3B3IB 5CD5C 3F5WB 4JFQB 4FXKB 4HW6A 5HYIA 5CJQH 2PYEB 2DQEH 2VDRL 1AR2A 5CP3A 1EX0A 4PV9A 1T21B 1J05A 1I7ZB 3V52L 1UH4A 1OTSD 4IOFD 4R4ND 2P5EB 2LVEA 4JG0L 2QKIB 1FG9C 5HHPA 1A3QA 1T0MA 2KZWA 3MLUH 4CNIB 1BVZA 5ACMA 3WXVL 5IB4A 4WY7H 1OW0C 1RFDL 2ICEB 4Y5VA 1P7KB 5GZOD 4LHJB 1E4JA 1NCWL 4ZUVA 1MRFH 1RJZA 3U0WH 1XT5A 2F19L 4LMQE 4PJHB 1IL1B 1Z5LB 4BZ1H 4LSDA 3MRBA 3QUMA 1FNGA 3NFPA 5F1NA 1QSEB 1S7RA 4RRPA 5D1XA 3WIHL 5ACZA 1YPZB 3JV6A 3VRIB 3LRSA 4OF6A 2CKBA 3U46B 4NCC1 1SEQL 1X5HA 4NN6C 4Z7NE 1N6QL 3BN9D 5EU6E 4U1LB 2PYED 4ZO7A 3HZMB 1QLFA 4JZNB 3CX5K 2NLJB 2VJXA 3D2UA 5J1SC 2EECA 1U8QB 4CGTA 5IR1B 4N0CD 3LN5A 5MEQB 1IC7H 4YFEA 3C6LB 3O3AA 4WW2C 1J7VR 4X6BA 4Z0BH 5FYKL 4O2FA 5IGXL 5F9WC 3QA3B 4Y5XA 5GRUL 3TA3A 2ZCLH 2F9BT 2DQFA 3VFUA 3W9EB 4NPYB 2GK2A 2AV7B 4EI5C 1R3HA 1T1XA 3O4LA 4KDVA 3C9NA 2VXTL 1R3IH 4FZ8H 1YDPB 3OAYH 4GMTH 4K23L 2VZTA 3A6BH 4M7LT 5D7JC 4K8RD 4EQ2A 1M4KA 5E1AB 4BKLA 2RR3A 1KEML 3MRRB 3WIIH 3V7MA 1OAXL 5ESAB 1RI8A 4TQEH 3KPNB 3C8HA 3ULUL 3HNVL 1ZLWH 1XEDA 3TVMA 1KOAA 1B6UA 1QSED 4FFZH 1XGQB 5FUOL 5KSBE 5I1GH 4P46D 3BD3A 1G9MH 3BDBA 2GUOB 4KK8C 5HDQL 1FGVH 2BCKB 4IIQB 4F9PC 4XPFH 2VLKD 5JOPD 1UKSA 5E6IC 1ZANL 4JVPA 3GHEH 3T3PF 5DGRA 3BP4B 1XH3A 2IADB 4GSDL 4DN3H 2GW5A 4G9FA 5K33A 2D7QA 1MWAA 5HYFA 4NQVA 1DQQB 3TWCH 2P7TA 3BVNA 3C6LD 2GJJA 4IS6A 2N4IA 5IMLB 2DDQL 3RPIA 1GAFH 3CIQA 3UTQA 5SWQA 2XZZA 4JANB 1PEZA 3SJVA 2ZJSL 2FL5A 1J0YA 3RDTC 2W65B 5DRZB 3WL9A 1AGBA 3OB0K 3U2SB 2FJGA 1KTDA 2ZG3A 3BKJL 4M5ZL 3QQ4B 3O2VH 1TCMA 1T4KB 3MREB 4XVTL 4LNRB 5I17B 5DMGD 3X3GH 4LVOC 4UV4H 4RFNB 5GS0H 4FS0A 2PCPB 1EFXD 2YRZA 5HHOE 4ZPVA 4KH2A 4OQTL 1ZXQA 3IXAB 3I3EA 2EIZA 3DVIA 3RBGA 3X11A 1CD8A 5FCUH 2Z0BA 3MOQA 4OZHE 1BFVH 4Y4KC 4ODSL 1JCKA 2YRPA 4OZFG 5C9KA 2HA1A 1PKQA 5GGTH 1QKZL 4HF5L 4PRIE 3BE1H 1MPAH 5EZOL 3T0EE 4PRDA 4R4BA 1OSPH 4Y2DC 4F3FB 2FBJH 4LU5H 5EU5B 4RGMC 4OLUH 4JFOA 4G7VL 4EUPG 3MV11 1OAKL 1ZTXL 3CH8A 5HYQA 1TLKA 4ODHH 3N1PC 2Q8BL 4JM2C 4RFEB 3UYRL 4MQSB 1M71B 1X4YA 2R0LL 3TJEL 4N0UE 5A16B 1VFUA 1B2WL 3H7BB 1DL7H 3RWEA 2YS4A 3H9HB 1J1OL 1I7UA 3VFWB 4HPOL 5F7KC 4HWZA 3UTZB 5BRZE 1FRGH 4YHPA 4O5LL 12E8H 5D71L 3VW3L 4HHAA 4LBEB 1RZIB 1TJHH 4QYOA 2UVEA 3WMSA 4PB9H 3EOAB 1R3JA 1RK1A 3VFGH 3VFTA 1NLDH 4ZTOH 1L7TH 5GS1B 1A7NL 1MFCH 3ECBB 4H8WC 4HUXB 1F4HA 4OUUB 3VXMA 4L3CA 4Q58C 2E9BA 4PJEE 3BWAB 1GVIA 4YXHH 4UAOB 4HX1B 5TJWK 2OMNA 1K6QH 4OZFB 5IT2L 1JYVA 4OM0H 4NHUA 3VGDA 4KI5D 3NIFE 2CMRH 4OB5L 3P11L 4XHQA 4XNMB 3GRWA 4P4KB 4YUEH 4E41A 1ZSDB 2DQDH 3NOIA 3QULA 4RMVA 3CDFA 1R5VA 2FD6L 3G6JB 1A6UH 1RZ7H 3F6LA 2X9XA 4HDIA 4PJIE 4XNZC 4XBEH 4OT1H 5F70A 3UTTB 4EUPB 1ZK9A 4CW1B 3CDYA 5H2BA 4OCSH 1BFSA 4QHKJ 4DGYL 4MNGB 1JGDA 5F7LB 3FZUC 1U8NA 1KPUA 3N85H 4OGYL 3CNKA 3KDMA 3TCLB 3VJ6A 3PGCB 1A9BB 2OR9H 43CAA 4JPVH 3EO1A 3MLZH 1DP0A 4N0FA 5E9DB 3GI8L 3INUH 2WW8A 1K4CA 3MUJA 5EZIL 3DWTA 2DICA 1BOGA 3SBWA 1DQML 3HPLB 4NZTL 5H94A 5D1ZB 4LPWA 1KUMA 4JLRB 4DUVA 5C0BB 3DI3B 5EU7E 1R24B 1X4ZA 5I76A 3O9WB 4L29A 3LS4L 1P1ZB 3OKKB 4CDHA 3MJ8B 2MMXA 4ZXBD 1NFDE 1CLZL 2Z35B 2H3NB 4P5KB 3HMWH 4Q9CA 2EYRA 4K7PL 1JNLL 3DMMC 5CZKA 1P4LA 1KJ3L 2ZCHH 4GW1B 4MJ6A 4P4KD 4WI3A 4APQB 1DQJB 4D0BA 3G5YA 1MHHA 1AXSB 3BQUC 3P4OA 3QUKA 1NGPL 3P4LA 4NBZB 1EBPA 2WUBH 3UTTD 1LO3H 1FVEB 3RZCC 1PQZB 4Z7WF 3I75B 1QFUH 4NN6B 1J9CT 4K3EL 1G0DA 3C09C 4HK0B 1IEHA 1AGCA 2ADFL 4ETQA 3PWUA 2ZUUA 1FPTL 1I1FB 5BO1H 1CGVA 3BUYB 2OP4L 1YMMA 3WN5C 3PP4L 2COQA 2DB8A 2CKNA 3C6SA 4NOFA 1QR1A 1JZ5A 5F9WB 1JF5A 4YIQB 4DQOL 2OTUA 4XPAL 5D1ZD 2YSSA 4NZUH 4H0HB 1KCSH 5C0BD 4EI5B 2DWDB 3O9WD 2AK1L 1H3WM 4LQ1A 3DV4A 1UWXH 2IBBA 3ZKMC 1VERA 2VOTA 1MCQA 3GGWB 5D7JB 1A9EA 3JWDL 3CSBA 3ZSTA 4I4WB 4YAQA 5KSVB 1KENH 1RJCA 2AK4B 3IFPA 4U2YA 1YYLL 1JPSL 4Q9QH 1KPVB 5KS9A 1WWWX 1KN2L 4APQD 4ZYKB 2NXZC 3RU8L 1NMAH 1KB5H 3KVQA 4HCRL 1ONQB 25C8H 3VMNA 1VADB 2FX8H 2Y25A 5F44A 5E6IB 4OI8A 2XN9B 1NCCL 3AM8C 3BIKB 3C5SA 1KPRB 4TVSa 4WFGE 2V6HA 2ZUVA 2VZ1A 4LPUA 3TNNB 2GTWA 4QXTB 2OJZL 4GBXA 1JNHB 5FYJE 5ICYA 1D5MB 4AH2A 5I1KL 5F3HB 2HN7B 4LSUH 4LCWE 3GK8L 4X6FA 4XNQA 4XCNB 4G8IB 1JGLH 5KS9F 5HDLA 3SOBH 5FECB 4GAGH 3SGJC 2DQCL 2I9LA 1CGSH 4EI5D 1XR9A 2J6EH 3RDTB 2DKSA 3Q6FA 2EYTA 4PRPA 1E6JL 2E9IA 3U7WL 5SWZA 5I16A 5J56B 3MNZB 1UADC 3HAEG 1VEOA 3G5ZA 5AAMA 3KS0J 1FZOB 2M26A 4LLYA 4Z7VF 4LVOB 3BHBA 1NBYB 2B4CH 5HYSG 3ZDXE 1NBZA 5F7YC 3PNWB 4Z76A 1MFAL 4ALAL 4L1HA 5JXEA 1CE6B 1KCVL 4Y4KB 3UBXG 2K3TA 4U1KA 3V6OC 5E6ID 1U91A 4QHLB 2CPCA 1IM9A 3AC0A 1RHHA 5T1KB 3L3OB 4LKCB 2ESVA 4Y2DB 1EFQA 4D9LL 4L8BA 2W07A 5TE7L 3M17B 2NY5L 1KJ2H 1P4BH 1IGJA 1Q0XH 2W0FA 3HN3A 4HKXB 2EDLA 4X6EB 5JHLL 2OI9C 4R8WH 3RWIB 4XI5C 3WS3B 2FSEB 4X6DF 4FQ2H 2MHAB 4O51A 3F12A 1PSKL 3U4BL 3RDTD 2W60B 1KG0A 4DZ8B 5JORB 5EOTB 4MX7B 2FGWL 4NKIH 3SE4A 5FO7B 1WV7T 1RZFH 3PQYA 4KJWD 1EEZA 3AAZA 5JW5A 5E4EB 3W11C 1LEIB 4KKBC 3CFIC 3HAEB 4OCMC 5TE4L 4GG6A 1TVBA 5B22A 1HIMH 4OCRH 1SM3L 3FFCA 4TVPE 1MLCB 4Y2OA 3BRFA 2H9GA 2A6IA 2BZDA 4I3SH 1WQVT 5DMKB 3D0VB 1DE4A 5KANI 1SY6H 1QOKA 2VDLH 4HIHA 3C60C 3ARVA 1MLBA 2Y36H 5KG9B 4GG8A 1T03H 4O4YL 1QBLH 4Q7DA 2F8OA 4Y4KD 3TBSB 3FN3A 2C1PA 3CGTA 4HUVB 1RJLB 4YHMH 1MEXH 4BQ8A 4Y16A 5T1KD 3V2AR 1JBJA 1TTFA 5I2IB 4Y2DD 5MEOA 5F8RC 4MXWH 4X6CE 3BDYL 2CDEB 3RKDC 4JO4L 4GG6F 1AGDB 1V7MH 3PL6D 4XNZB 4J8RA 3CC5B 1QO3B 3GIZL 1L6XA 4KZEH 3AFLA 5ITBH 1F97A 1IBGL 4NUGH 3H42H 3FOMA 4DTGL 5BVJB 4KUCF 1YMHB 2MPAH 3MXWL 5A2IH 1QG3A 4I0CC 4E42B 3ZYIA 3BPNC 4P3DA 3V7AE 4NKMB 3DX7B 1BMGA 4P9HH 2W9EL 4X9BA 2QQLL 1X7QA 3BZFA 5CZVH 1YJDC 3GMRA 2C4FU 5I1JH 3T0AA 4AENB 5FB8B 1HOCA 3PGFL 4RISH 1G84A 5K9JH 1QFPA 5IF0B 5T5FH 3DMMB 5ANMB 3RJDA 4GJTB 4WW2F 1BQSA 5FYLE 2EIDA 5LAXB 3OKDA 1MI5A 5KVDL 3T4AA 4WFEE 2FX9L 3CXHK 2X41A 2HJFB 1MCJA 3EYSL 2QR0B 4HT1L 4XP6L 5E8NA 3CFDA 4LLWB 1L7IH 1DSFH 5IB2B 1I7RB 4OCYL 3RZCB 5L2KA 5TDPB 3BZ4B 3TH4T 3C09B 4IRZH 2AJ3B 4LVNC 3FB5B 3GUTA 3S35H 3I2CH 4DCQB 2R4RL 5KVGH 1MIEH 4BK4A 5IB5A 2IPTL 4LCIH 5GGRY 3WIHA 3WN5B 5BS0B 4LDLB 1RIHL 4NQEB 1J18A 1PLGL 5C0AD 3LV3A 4HJJL 3ILPB 5EPMB 3RGVC 3GMNA 2X4RA 4HV8A 4G6FB 5A40E 1IGCL 1HHGB 1RZGB 4U3CA 3PF2A 4XXCA 4G5ZH 4HUNB 4NO2A 1UZ6E 5DFTA 4JFFA 5CIPH 5DYOA 5C08A 5C0RH 3GJFH 3KPRA 5E08H 1T83C 1T20A 3NMEA 3MJGX 3W81A 1AJ7L 2A6JB 4LLDB 5EU3A 3DMMD 5T3XE 1B0RA 5JW4M 1FL3A 3GSXA 4M93C 1VGKA 4NN7C 3U1SL 1K8DA 5EG6C 4PY7B 4M5YH 5FM4A 3MRJA 3U30C 3VRJA 5AD0A 2BNRB 1HQ4A 5E5RB 1ZGLM 4WWID 3D9AL 3VD4A 4BSVB 1B90A 3MMEB 1RUKL 4X0KB 4MAYC 1SYVA 3RZCD 3IU3B 3T65B 3WIFB 5AAWA 1AP2A 3W2DH 4NRZB 3MR9A 3I6LE 4MDIB 2DQHH 5F9AC 2NYYC 2R0ZL 1T2QL 4NQED 1JHKH 1E27A 1Q1JH 3CSPA 3MRNA 4NRXA 1PFCA 2NZ9D 5BMFH 4J4PA 2HJKA 3GNMH 3V5DA 1S9YB 5GGVH 2NTFA 2XPGB 4MB5A 3N9GL 1ZLVH 1U6AL 4TOYL 4OD3H 3D39D 3U4EA 4OLZH 4XRCB 5IQ9B 1ODAA 5SX4I 3SDXA 5AWNL 4KRPC 2WANA 3IETB 3BXNA 2OM5A 1FVDB 2AXGB 3IDXH 4FQIL 4YGVA 4MA8L 1G7IB 3SGKA 4KPHL 5DVNA 3LPGA 4YHLL 5LCVH 4XC3H 1G9MC 4XWGH 3TO4C 5IKCB 1V3MA 4RAUB 1KIRA 1IT9L 1ZT7B 3EFFA 2V9TA 4JM2F 1A21A 2R2EB 2AXFA 2VQ1A 3N1FC 4FQLL 2F53B 3TV3L 3MOBH 2HTKD 4KRNA 4K8RL 4ELKA 3C5ZD 3QP3A 5F7MC 3VRJB 4WHDA 3O6LH 1J1PH 4FQCL 4EZMA 1YY9D 4NJAL 4LAQL 2SEBA 4I9WE 3CH1B 3SDCD 4OQTA 5DC9B 1EJOL 2NY0B 1IGTA 4IOIB 2VXSL 2OI9B 1S7XB 3L3IB 4B0MM 3CFKA 1F4WL 1AKJB 1DDHA 3QUXC 1YN6B 3HE7A 5TGBA 2J7LA 3H2WA 3MBXH 3MRFB 4OLWL 3VXRE 1P9MA 2FO4B 3JTSB 3B8SA 4DAGL 2OLDA 2J3SA 4R97C 1FLRH 4TPRL 5AYUH 2B8OT 1L0XA 2X9WA 4NQCB 1I8MA 5GS0C 3KPLB 4FQXA 5DJXB 1N64H 3LQZB 3UTPD 1FH5L 3U7YL 1SYSA 3OKLB 1T5WB 2VLJE 2VXVH 3O2WL 4NQXA 4MD4A 1DFBH 3KLAB 3VWJC 1WZ1H 1JZ6A 4JRYA 2VLRE 4ORZC 1F11A 1CYGA 1VENA 3BPLC 3QHTC 2AJXL 2R1XA 1ZS8B 5AZ2L 2F53D 1ZVSB 1G6RB 5DWUL 5HXMA 4ZFGH 5H37H 3CCHB 3BW9B 3TH3T 2LTQB 3TIEA 1TNMA 1JWMB 3ZTJG 4ZNEA 1SMAA 1L0QA 3LKOA 3QEGL 2NY0D 4U6HA 5HGHA 4Q2ZB 5EU6B 1PEWA 1F8TH 4OF0A 3SPVA 4HXBL 1T7VA 4KV5F 5HVGB 3IJSB 4HKZB 3AB0B 2G75A 1H3PL 5HHME 3OF6A 1FIEA 3U36A 1JUFA 3IJYA 3QEHB 3GBMH 1BZ7B 2CJUL 2XY2A 4R3SB 4RA0C 5FF6B 2HYMA 4M7KL 1HHKB 4U1NB 1CICA 4LCCA 3WNLA 1WEJH 1G7JB 4OLVL 4L4JA 1W0WB 4NQCD 3IT8D 1BFOB 5IV2A 4YHOH 3MXVL 2BOCB 2IANE 4QOKB 3WYRA 1OAYL 3B9EA 4P2CG 4WEBH 3VA6A 5FDWB 4OFYD 2BSSA 3PDOA 1IAKB 5L9DH 2YWZA 4F58H 3MLYH 1OCWH 3K2MC 3K74B 4P2OA 1KELH 5L6YH 1RZKH 4FFWD 1R5WA 1MRCH 2AEQL 3KJ6H 1QLRB 3QT2A 5F72S 4V1DE 1DLHA 5HD8C 3GIVA 3LCYA 3DRTB 3EAKA 3F6IA 3MRQA 4HUWA 2X7LB 3NH7H 3DXAB 2CDFA 1ZHKB 1I1AA 3L5XL 4JFXA 1IRAY 5EU6D 5IMOA 1NC2A 1GPOH 3RIFK 4HUMB 5IIEA 4G8EB 5EH1A 1G7MA 4DUWA 1Q9OB 1JZ4A 4LVNB 4OBSA 1M7IB 5GGVY 5DJ6A 3TO2B 5CEZH 1NAKH 4QNPF 4EVNA 2FIKA 1AGFA 1G9NL 5FA3A 5GS3A 2EC9T 5IM7B 2C7UB 4J3OC 1PG7W 2BFVL 3QHZL 1N59A 2LVCA 1C1EL 1AE6H 2F58H 3RGVB 4MGXA 2GJ6A 5C7XL 1FNEB 1MHEB 2QQKL 3VGGA 4EOWH 1AQDB 5C09E 2BSRA 1KF9B 4GKZB 2X2YA 4NYLB 3ZHLA 4DK6A 4PTTA 5TE6L 1LK2A 1CZ8H 5BJTA 3KPMA 4R0LC 4U7MA 4NQDA 3GMLA 2W9LA 5E2VH 5IG7A 4JN2A 4ZPTB 4GMSL 3W0WB 4XZUA 4LP4A 5DR5L 1AD0B 3OPZH 4IBLT 2UWEF 2H1PL 4NN7B 1C12A 2QHLA 1WBZB 4QHKI 2J5LB 8FABA 3CU1A 1GGUA 4UOJA 1KCLA 4M48H 3U9UA 3ARUA 2F15A 2R9HC 1H0DB 3IVKA 2ZUTA 3VDAA 3FQXB 3S96B 4XGZA 3CLFH 1WBXA 4QXWA 1A6VL 4PB0H 1J0JA 3OAYK 5GGQL 4HS3B 3P9LA 5EBMB 2WSKA 2X1PA 4X98B 2FB4H 1T0NA 1FFNA 1KIUA 4Y19A 1MJJA 5GRJL 4BQ9A 5JLZA 3KYOA 4HBCL 4HCRA 4PJCB 5EUOE 5C8JA 1A4KB 1ZLWK 3L5WA 1GIGH 3CFEA 4BELD 3OGCA 3JBG7 3MV9E 1L9NA 1XMWA 4N9OB 3OBAA 3T4YB 1QBMH 4HC1L 1MVUB 5HHOD 2NY2C 4FNLL 4PRHE 4LLQB 5D6CB 4JFHE 3MLSH 1XZ0A 2H45A 3QHFH 1I8LC 1UB5A 4KWUA 4H5SB 5JNYA 2D9CA 2NPLX 5CGTA 4PRID 4U1SA 1GZPB 1FC2D 3TO4B 5JR1H 3O0RL 4JE4B 3T0ED 4OZIF 1QSFA 1VESA 2ICWJ 5E5UB 3UJIH 4Y1AA 1Q9LB 4MVBD 1G1YA 4EIZC 2XKSA 1AD9A 2IQ9H 5FO8B 4PJIB 1XF4B 2OK0H 4XP4L 4PJAA 2ADIA 3TYGL 5I9QC 2OZ4H 4GXUN 1J10A 2EO9A 4K94H 2YZ1A 4LRIC 4U1JA 1IE5A 3HNTL 3QUXB 4N1EA 4KAQL 5DK0B 1MHCA 4M7JL 3KXFE 5BRZD 2A73A 3G08B 6FABH 3BAEL 4R97B 2DI7A 2CO6B 5I1HL 1YQVL 4LSRH 1NGQL 2B4CC 3IRZA 4NNYB 1XF2A 1NLBH 4MXVE 2W0KA 2HLAB 3JV4A 4PJAF 4JVWA 4PGBB 4YLQT 5CSBA 3SKUD 3D85B 1B0WA 4CMMA 4KMTH 3PWVB 3TO4D 3T2NH 3VWJB 1Y18B 5JA8B 1KACB 1LEGA 4IRSA 3BPLB 3L7EB 1E6OH 4KKCD 1F58L 3WDJA 3F7YA 3MV8B 5MENA 3QCUH 3UYOD 2VDKL 1B0GA 2KZ1B 5IW6B 3T2OA 2NW3A 1UH2A 5CBEB 3AROA 2P44B 1AXTH 5LGKA 3LH2H 4PJ9C 1MCEA 2CLVB 3V6ZA 4WV1A 3VFPA 2OMBA 1JF1B 1OAUH 4AY0A 4LF3B 4MZ2A 1S7UB 3SDDC 3EOBA 3G04A 3UO1H 3S4SA 4DVBA 5JW3H 5HGBA 1AI1L 5ESQA 5IHUH 3TZVC 3QUXD 3T0DA 3LEXB 1U8MA 3DI2B 3I3DA 1UJ3A 1TQBC 4GQ9H 2R56H 4CVXA 3LB6D 1EO8L 2XZQH 5D2LE 1EH9A 4LSSL 4Z95L 3Q5YA 2R0KH 4NN5C 4MJ5A 4KHXL 1GZQA 5DRWB 2DIAA 3ETBF 4BH8A 2BMKB 3TPUB 3T1FA 4AL8H 1XCTB 1BWWA 4PLJC 3EKCA 3H9ZA 1LO0L 3LRHA 3L9RA 5LGJA 2PW1B 3UPCA 1RZ8B 4KDTC 2YK1H 1KSRA 2AQ1A 2EDHA 1N3NA 3OR7B 4OD1H 3VWJD 4G42A 1MUJA 3NCYS 2MQ0A 1A1MB 3ZE0E 4S10A 3BN3B 4ERSH 4D0CA 1TITA 1T7XA 3ARBB 5BOZG 2WBJA 2A2QT 1T1YA 3BKCH 2VAAA 3EYVB 3WKML 1RPQA 4ISVB 3KLHC 1M7DB 1MCPH 4PS4H 3Q3GB 4MJ4A 4B5EA 4XPTL 2IEPA 2IPKA 1NANH 2Y5TB 1WBYB 2VDOL 4X4XB 1S3KL 5CBAA 1MAML 5BZWA 4TUJB 5E2TL 5J6GB 4LCYB 2B2XL 1FQ9C 4N8CL 1YUHB 2XQBL 1TETH 4R7DA 2W1NA 1FVCA 3VXUE 5J4MA 4NFCA 3UC0H 1W72B 4GRWF 5FKPB 4L3EA 3L7FB 2R2BB 3ARGC 4JHAL 5B3JE 2XTJE 4TULL 4S1QH 1HDMA 3MA9H 1MQ8A 4I77L 1FDLL 1T80A 3ZE2E 4P9HC 3NZ8A 3WUWG 3BGMB 2HVJA 3R1GL 3C8KB 1CN4A 1ZGLP 1NFIB 4UT7L 3QDMA 5DUBB 3PIQB 4R0LB 2R2HA 3ARBD 3B9KA 1CF8H 1JF6A 3FO0L 3O6FD 4NOBA 1BWMA 1ZHNA 2E3VA 1NCNA 1I3GL 2UZIL 1F3JB 2EXWD 1ADQL 2CK2A 4L1DA 5C6TL 4LSTL 1ERNA 4XNXH 1ZA6A 1UM4H 4HIIA 4OV5B 1T7WA 4NT6B 4LGSB 3FTGB 3LEYH 2JTDA 4DVRH 3V5HA 5EOCH 1S7VB 4MCYB 5C0CE 4LCWD 3AU1A 3D18A 4W4OA 5IHZB 4ENEC 1GYAA 3FO2A 2Q1EA 3EO9H 1G7HA 5F89A 1UWXK 4Z77B 5F3BA 2VXQL 3MUZ1 5DRXB 1MCNA 1A64A 3X12B 2DQTL 1YEHL 5IQ7L 1NL0H 1I3UA 5TQ2H 1QA9B 4R9HA 5T1DL 2AEWA 4MD5B 4QTHA 4ZFOL 5KSAB 1EZVY 5E8OA 4XPHH 2YUXA 1MCOL 1YA5A 4QXUH 3H3BC 3FOLA 2IG2H 5I1EH 3TBYA 1SJEB 1KXVC 4CMHC 2BVUA 5DD1H 3O3UN 3BYYA 1C5BH 1MFEL 2EDTA 1JPFA 1EGJH 2OTWA 3DBXB 3BP7A 4D3CL 3NCMA 4J3XA 5ITFA 3LN4B 1NCUA 1KB5B 3B3IA 4DKFH 5D1QC 1J8HB 3F5WA 4JFQA 2ZSWB 4P23C 2PYEA 4QT5A 1UEYA 4PJXA 2I9TA 4Y4FC 2AJUL 5ELIA 5T3ZE 1PW3A 4JGJA 4KROD 3MTRA 2CUHA 1KLUA 4RCAA 1NCBH 3WLBB 3QJHB 5I9QB 2VQTA 2B1AL 2DLHA 2FWOB 3FMGH 4LLVA 5JOFA 2H8PB 3SCMC 5C0FB 4I1NB 4OJFH 3C5JB 1F6LL 3JWOL 2ICEA 5KSAD 3RL1A 1P7KA 4FN0A 2YZ8A 1DQDH 1BP3B 5L7XH 1FFPB 3NFSL 4PJHA 4XH2B 1Z5LA 2P8LB 4JFDE 4JFYB 1J12A 3MACL 4PJXF 5DJ0B 1B9ZA 1W0VB 1OSZB 5JW4Q 2K9UA 3GI9L 1QSEA 3IFOB 2OL3H 1XGPB 1YPZA 3VRIA 3D48R 4P46A 3U46A 2VLKA 8CGTA 1LK3H 2E7MA 4P2RE 5HHNB 2D7TH 5HHXL 4YX2L 1HI6A 5CINL 2JB6A 1JPTH 1SVZA 4ODXB 5GGUB 4ACPA 3QIBD 3CZFB 2ED9A 3HRZB 4O9HL 3EZ8A 2NLJA 3WJJC 5DJ8B 1F4YH 4WO4C 1I3RB 1CFVL 1MCIA 1EPFA 4LSPL 1OPGH 4CADB 5L8KB 3C6LA 1MCFA 4RWYL 4OFIA 4EN3C 5IUSA 4PJHF 3E1F1 3S35X 1CBVL 2A1WH 3AUVA 2RFXB 2BHZA 4PJ9B 5CD3A 4RAVA 3W9EA 1TCRB 2AV7A 2D0HA 2WK2A 3SDDB 1YPZF 5DD6B 5CLWA 4POZD 2HMIC 2V7HB 3GJEB 5TQ0L 3RX7A 2GEEA 1GRWA 1WAAA 5GZNC 4AM0A 3TZVB 2B0SL 1KFAL 4MQXD 5AG8A 4POUB 3HZYB 1EFXA 3EYUL 1INEH 4O2EB 1A2YB 1MCDA 2CRIA 1O7VA 5KZCD 4JO1H 1RULH 1XGQA 2BERA 3NABL 3L6FA 4IIQA 2BCKA 5F9OH 1JGVL 3IKKA 5MHSD 1N0LA 1U8LA 3RVXD 3GKWL 1RV6X 2J88L 4ZOCA 2ZG1A 2EDBA 2VN7A 5SV4A 3IAPA 5FOJA 3BP4A 5FYLD 2IADA 1PG7L 3ROOA 1WAAF 4JDTL 1WVZA 4PJBB 2BNUB 3S37H 2QSVA 2MOVA 4QRPB 1CDYA 1AIFA 4HIXH 1RJYB 2A77H 4JANA 2JLLA 4F37F 1U0QA 4HFUH 4KRMB 3SDDD 1BEYH 2AGJH 2XTLA 3OMZA 1KIQA 3MCKA 2QADD 1OGAE 1KC5H 3WFCL 5EBWB 4MSWB 3WFEH 5HI4C 3EUUA 4LPVA 3GSQB 2I07B 3S34H 1FZKB 3DO7A 3MREA 3DURA 5EOCJ 1YECL 4TVPH 5A43C 4KUZH 3SHSA 5E2UL 1A7PL 2EDYA 2KQNA 1C7SA 1EEYB 3ARGB 4WTZA 4C54A 3X13A 4KQ3H 4I2XB 4H1LH 4PJ8B 5SWSB 4R4FL 4UB0H 4LASL 1ZHBA 5CP7A 5D2NE 1RURL 2OTPA 2WWKO 2L7UA 3DSFH 1Z0NA 2Q87A 5I1CL 1Q0YH 3QUYD 35C8H 4YWGH 5T3XD 1IVLA 3BKMH 4PD4K 3VI4E 2FBOJ 3VMPA 2XWTB 3HE6C 3OKMB 4X7CC 1MF2H 4PLKD 4Z5RB 2HT2C 4YHYC 1T6VN 5J1TC 3TYFB 2H32B 3EW3B 1IGIH 4RFEA 4FMKA 2YD1A 2EKSA 3OHXA 1M71A 3C2AH 1MQKH 43C9B 1FORL 1CDCA 3BGFB 5KVFL 5A16A 3L3GB 1G6VK 4UTBH 2Q76A 6CGTA 1OM3L 1UB6B 1CFSB 4X5WB 3MUHL 2XKNA 1G6RL 5F7NC 3UTZA 1JGEB 3CVIL 3E8UL 3GJFK 4L4VB 3RWJB 5F9JB 1RZIA 2Z31B 1BQHG 4ONOA 3LZFL 3ARGD 3STLB 3EOAA 4XAWH 4PJ8D 2YA1A 1S5IH 1UKQA 3T3ME 3ECBA 1WITA 4HUXA 4ZXBA 1INDH 1T3FB 4AK1A 5ABDE 5CIPB 2EE2A 4PGCA 3LDBB 2G9HB 4Q74A 3NTCL 2C9AA 4CMHB 4XNMA 4JY6B 4JEGB 4P4KA 2VLJB 4CDGC 1RIVL 2D4DA 3QDJE 3OKEB 2VDPL 2VLRB 3HG1B 4XXDB 5DK3A 5CEYB 5I18L 4X8JB 5DLMH 1UACH 1AQKH 2O5XL 4PJGA 3NVQA 3FQUB 5I1LB 1S9XA 1H3XA 2YPVL 1IEBB 4MNGA 2FIRT 5DK2B 3VH8G 3VFOA 2O93L 1CGYA 3KYAA 3K1DA 4P23B 1D5ZA 3TCLA 2XA8H 4HC1A 4DW2L 4KK9C 4I9WD 4K2UL 1DN0A 1A9BA 3PGCA 4KTDL 3SKOB 4HFWA 4MS8C 4OTXL 4UINH 3VI3E 4Y4FB 1ZLVK 1CDHA 1FGNH 4IDJH 5BV7H 3R0NA 4MYWB 5HHMB 4ZMAT 1ITBB 2Z31D 3RX5A 5D1ZA 4JLRA 5C0BA 1BQHB 1R24A 3VXRD 3O9WA 2PW2B 5KW9L 4YHZH 4WI4A 4I3GA 3SCMB 5FHBL 1X4XA 3EYFA 1P1ZA 3OKKA 3MO1B 4JDZB 2HVKA 3P9WB 4GRLA 4KTEH 4PJGF 5MP6L 4L9LC 2Z35A 4KKLC 4OKVA 3FQTB 2H3NA 3T8XB 1JMXA 3KPOB 3EO0B 4AEHL 5DS8B 2GITB 3TBTB 4OZGE 3VXSA 3KGRA 3MRKA 5EN2B 4GW1A 2BRRH 2VLJD 1CQYA 3D0LB 4Y89A 3WJLA 5IW1B 4APQA 1DQJA 4WNQA 3VDCA 5HVFB 5HVWA 2C3VB 7CGTA 2VLRD 3G6DL 1AXSA 1BVKB 1S5HB 5DF0A 3REWB 3F7RA 3QUZB 1PQZA 3GMPB 5DEFB 4HK0A 5KJRL 1MCCA 2VZOA 1MH5A 3DETC 3DPBA 3UTSB 2Z91B 4P23D 5JMOC 5H37G 4YNYA 1KYOK 4J12A 4U1GB 3D69B 5EWIL 1I1FA 4U1MB 1AHWC 4NKOB 1B4RA 4JY5L 4MNQE 4WO4B 4Y4FD 5E00B 2XXCB 4A6YH 3RNQB 4JAMB 1XF1A 4WI5A 1CT8A 5HHMD 1Z3GL 7FABH 1S78D 3U0PB 4K94C 3MLPA 3OX8B 4KY1H 1OL0A 5CP3H 5FUCC 2DWDA 4ELME 5KTEH 3HCVB 2ZUSA 1A3LL 5I30L 4KKAC 4HS8L 1HWHB 1NAML 1UQSA 1ZVYA 1LDPH 2IAND 4JKMA 4JKWA 2EKJA 2QQQA 3ZHDA 2P24A 5J3HD 1DBAH 4M1GL 4WTXA 2QSTA 3W9DA 4ZYKA 1FP5A 1OWWA 3NPZB 2ICWB 1GC1L 1H9VA 5IK3A 1OTTD 2ICWI 3V6FB 4YFLF 2R8SH 5I8CB 3HC4H 3IKCB 3P3YA 3QUZD 1TZGH 1VADA 2EDNA 1R3LB 4GLRH 1OB1B 3D3VE 3SQOL 4YK4C 4NCC2 5EO1A 5JUEL 3BIKA 3QUMH 4UUJB 1KPRA 4V1DD 1HEZA 2HFEA 3HC0A 3UTSD 3IDJB 1RSFA 4ZSOE 4RBPH 5IROC 5DD0H 1JRHI 4J3VA 2C3WA 1MFBH 5GSRB 3WFBH 5C0EB 1D5MA 3P9MB 4WO4D 1U92A 2OCFD 1ZKAA 2CKBH 4XCNA 4G8IA 4XB8A 3VRLF 1JZ2A 3PV6A 4M9OA 4YDVB 4JVUA 1U8KB 1MIML 4M6OL 1BM3L 1KBGH 5FECA 1LD9B 4GO6B 1OD7A 2Q86A 5IFHL 1AGEA 4GKNA 5LXGH 2M1KA 3KNBB 3BEVB 5GZND 3RX8A 5GS2D 5SV3A 4DGVH 2GT9A 1DVFC 2HFGL 4JKPH 4RNRA 4OM1H 1ETZB 4ZO6A 2YHGA 1NBYA 5C09D 4MQ7B 3LD8C 4NBXB 3L5JA 5C0IB 5E1HB 3F58H 5TDNA 3PNWA 3SDAC 2Q3ZA 5D7SL 1C5DA 3ET9F 2V2XB 1CL7H 1CE6A 3MRDB 5DQDL 3QIUC 3O81A 3QWRD 4TRPH 3QAZC 2WWMD 2O61B 4QHLA 5T1KA 3QH3B 4TSAL 3ARFB 4BFBD 3HE6B 1GGTA 3V5KB 3OG6B 4HGWB 4X6EA 3A67H 1O0VA 2CD0A 4YHYB 3DTXA 2NXYD 3AY4A 2FSEA 2WIIA 2X4TA 3PL6A 2HT3D 3VXNB 5IVXB 5GGSB 4X4YB 4LKXA 2MHAA 1NCDL 4OD2B 3AXLB 2XV6B 1OGTA 3MYZA 1GGIH 4YQXH 3QPQD 2W60A 1UWEH 4DZ8A 5JORA 3ESVF 4MX7A 1MWAH 5FHAH 1R0AH 5FO7A 3N1QC 4WJ5B 4AG4H 3THML 4O2CB 1UC6A 1RUQH 1P2CA 2VISB 4XPGL 4OIIL 2LAAA 4NWTL 5K9KB 1HSBA 2X40A 1JJUA 1A5FH 1FNFA 2P8PB 1EV2E 3RWCA 4UQ3A 5DMYA 3NIGE 3S3JA 1ADQA 3FN0L 1N7MH 5F7DA 1MLCA 5ISZE 5ALBL 2DD8H 2J8UE 5DMKA 3D0VA 1A6ZB 1Z9LA 2HWZL 2CR6A 5L2JB 3KXFB 3L5IA 1N5YH 1MREH 3MV9D 1EZVX 4OCXH 5KG9A 5I15L 4HKJB 5HPOA 1FAKT 4PRHD 4HULB 3A0OA 2IQAA 4JFHD 2RCSL 2ZP0T 1C08B 3L3DB 1BBDL 4LRNL 2JB5L 1U58B 3ARFD 3QJFB 3HE6D 1EMTL 1V7NH 1X5YA 3P0GB 2IWGA 2Y06H 3S9DB 1AR1C 1A3RH 3WHE0 1TVDA 3FCTA 4ZFOA 2P45B 4JRXB 2EE6A 5AUMB 3PWJB 1X3DA 1QFOA 1HXMB 4HWUA 2GKIA 1I8KB 3KR3L 4HPYL 4PJ5B 4RGOH 1F4AA 1S9KC 1N2RB 1YNKH 4P2QB 1YYML 4P49A 5BVJA 3BRDA 3IDMB 3IFLL 3FB8A 3RUGB 3RHWF 1F3DJ 4QRRB 4UZGA 5C0AA 4J6RL 4PLOB 4HEME 4E42A 5IBLD 3FRUB 4HQQL 5JO5A 4MB4A 3FRPA 4POYA 4XCEB 3KXFD 4XBEL 5D2LB 1E4XI 3PWPE 1LO4H 4AENA 3QXAB 3CDGB 1NH6A 5FYJL 4L9LB 5E2WL 3HFML 2X70B 5ANMA 1VFMA 4P48A 4DKAA 4EDWH 1U42A 1W72L 1C7TA 3F8UB 4Q0XL 2R4SH 2J4WH 1YNLL 3VWKA 5D72L 5ID0B 5GRWA 4Y4HC 1P84K 4O58L 2QR0A 3S3PA 2OYPA 3IDNA 1IJ9A 4PRAB 3B6SA 1LDSA 4JRXD 5IB2A 1I7RA 3BZ4A 1FNSH 1XFPA 1VGEH 3ULSB 1BZ9B 3RTQD 4HD9A 3GRWH 2AJ3A 2ZOLB 3FB5A 5FM5M 3I84A 3E3QC 1TDQA 5E8EB 1I9RL 5C07E 1AHWB 1X5JA 2CQVA 4OZ4B 5IWLC 1XIWB 2VH5L 3Q6GH 4NQEA 4QRRD 2VZVA 4D0DB 3NFNA 1ZLSL 4FABL 4Q6IA 1RZGA 1CFQB 4LAJH 2QSCL 2NX5E 2EDQA 2VL4A 5D93C 4AYFA 2DQIH 3D39A 1HHJB 4UT9H 3H9SE 1VFBB 2X1WL 2Y07H 2EH7L 1NPUA 5H35B 3QXDA 4NCDA 3DRQB 4U1IB 2R69H 4LLDA 2A38A 4YEEA 1NGYB 1V8HA 4PY7A 4IHOB 4TSCL 3QNYB 4JZJB 2ORBL 4L9DA 3RVUC 3TN0D 3T0XA 2HTLC 3CVHL 4TTGA 1JTOA 3BESR 5C0DB 2VLLB 1N6UA 4JG1H 2F5BH 3MMEA 5ALCH 2ED8A 2F54E 4M6MH 1U93A 3Q1SL 1YC8A 2G60L 1DEDA 3C5ZA 5FGBA 4NRZA 3DETD 2HFFB 1AY1H 4MA7L 4MDIA 5JPMA 5LKNA 2MNUA 3ARXA 3UDWA 2CIIB 1NMCC 4YC2C 3RVVD 4JO2H 3SDCA 4AEFA 1XIWD 3MRHB 1KLGA 1IZJA 1F4XH 1HKLH 4G6MH 2GQHA 3P77B 2CK0L 3FQWA 2DTML 3JWNC 2XPGA 3WSQH 1BZQK 4PJDE 5C92A 2VIRB 3VXUD 2WLYA 3K3QA 4XRCA 4YHNA 5EUKA 3MNVA 5DD3H 4UDTA 2P5EE 2AXJA 1A7OH 4JPKL 3TBWB 1CI5A 3BP6B 5IBTL 3IETA 1FVDA 1DVFB 1I9EA 4NO5A 2BY0A 3LD8B 5IKCA 1WFNA 4RAUA 1N0XH 4P5TD 1K3IA 4X9HA 3MRLB 4XP9H 3EOTL 3SDAB 4X9GA 3FFDB 2F53A 5INDA 4XX1G 1VFOA 2RJMA 1GGCL 3DUUA 3OB0H 3QG6A 4BZ2H 3QAZB 3NCJL 1V3KA 1RD6A 5J89A 5EZLB 3OXRB 3OKYA 1MJ8L 3CH1A 4U3XA 3ZT7A 2VE6B 2DQJL 2CLZA 3I50L 3IFNH 5J12C 1TJIH 1IGFH 3R06A 5AZEH 4AMKH 1GGBH 3BRGC 5D5ME 5C0CD 4D8PB 3MRFA 5T5NG 3EGSB 4HZAA 5IESL 2FO4A 3JTSA 4L4TB 2A9MH 4EI6A 5FYLL 2JJTC 1IAMA 4YXKH 3GB7B 4M62H 5LGHL 4WI9A 4KJQC 5DJYB 4KJPC 1TPXC 3LQZA 1IGML 4WU5B 3OKLA 4JKKA 1T5WA 3FL7A 1ROWA 4Z7WE 1OAQH 4OFYA 3G5XA 4WHCA 3GSWA 4DGIH 3P40A 1MHPL 5EZJB 3SDAD 2K1MA 4JFDB 1G7QA 3P0VL 1U95B 3LPFA 3R0MA 5L88L 2PYFB 4PTUB 4HUUB 3OXSB 4DOHB 1G6RA 3JXAA 4P5MA 3TFKD 5CMAB 3WFZA 3CCHA 1FE8L 2LAGB 2ADJB 5LBSL 1BAFH 2CXGA 1Y0LB 4RQQB 3LQMA 5JDSA 2XACC 4Q2ZA 5EU6A 1CD1B 3PDGA 1EVTC 3HI1B 4XMKH 4HKZA 5GISH 1ZT1A 3QEHA 3QZWG 1E0OB 4LEOA 1A7RH 5F7EH 1ORSB 2HKHH 3KPQB 5T3XL 2Z4QB 5T3ZD 1HHKA 4MWFA 2OR8A 4HJGA 4U1NA 4XC1H 2YKLL 4BFIB 3A6OA 5IJKC 3TT1H 3GHBL 1D5BA 3K0WA 1NGZB 3P0YL 5C0GB 5CGMA 1BFOA 2FX7L 2NR6C 3FB7A 2BOCA 1UCBH 3MLVL 3EDFA 3TIDA 5TF1L 1KNOB 3VXTB 4Z7NF 2AQ3A 5GPRA 2YMXL 5F8QC 1IAKA 2R1WA 5ENWA 2GJZB 3GMQB 4JFDD 1FBIH 4CN4A 2PTVA 3BGAA 5LWYH 5EDXA 1QLRA 1UYWH 1INQA 4W81A 3H0TB 5KSBA 1EXUB 1K2DA 2MPAL 1CXHA 3A6CL 3UJTL 1HK6A 3BH8B 3O3DB 3IDIA 2IH3A 3UXFA 2X7LA 2A83B 3K4DA 2ZKHL 3QDGE 4JGMA 2IC2A 3CXDH 1KCKA 4Y4HB 3CX5J 5DUMH 3S37X 3B2VL 2BVQB 1BD2E 3HZKA 1AR1D 1DBBH 5BQ7A 5EO0B 4M6NL 2FYYB 4G8EA 2DLFL 2GSIA 4OCWL 5JIKA 5FO9B 3QWQB 2XI9A 3NN8B 2IAMD 4S1RH 3QZWB 2V2WB 4NUJA 3TO2A 3ULVH 1XGTB 5BV7C 5IM7A 4F7EB 1GCFA 1OHQA 4MXQC 4LLUA 3JTTB 2RIKA 2D7PA 3PHOB 4HZLB 5KSBF 2UZYB 4OF8A 1JWUB 4JO3H 5IOPB 3KPPB 1KJVA 2OJEB 1F6AB 1I9IH 1FNEA 4UQ2A 3O8XB 1NBVL 1Q9WA 4I18C 3MBEB 4U4BA 1PD6A 2V5SA 1OT1A 4GKZA 4NYLA 1IQWH 4JY4B 4PUBL 5DTFA 3KYKL 2P49B 4QWWD 1CDUA 4NKDB 5D7KE 5J11C 5HHOA 4W6WB 4K71C 5FUZH 5DRNA 2Y5EA 1HH9B 3F7VB 1YN7B 1SBSL 1RVFH 3HB3C 2VWEE 3QEQE 5ADOL 1OQOA 1AD0A 1D6VH 5CEXA 4OZHA 4UNVA 3FT4B 1F2QA 1HCFX 2D31B 3HNSL 2VDRH 4X6DE 2ED7A 4PRIA 4Y4HD 3V52H 1A6TB 1CDJA 3T0EA 1H0DA 4LHUG 1T89C 3LMJL 3FQXA 1EERB 5DHXB 3UAJC 5EC1A 3QI9C 2A6KB 1NAMA 4JG0H 5F7WC 4RIRB 3O6KL 4IMKC 5I1DA 3WXVH 2X4NB 2WBWB 2FLBT 2XY1A 2NCMA 3G6JE 1JMZA 1ZGLA 4X98A 3UTTE 4OIBA 3VFNA 2YN3A 3LKSA 4OZHF 3MRMA 4YXLL 1NC4A 1NCWH 2GFBB 2P48B 2EDEA 5HDBF 1A4KA 2EYSA 3O8XD 5TPWL 4DN4L 1KEGL 3MBED 1A02N 1G7PB 4JR9L 5D8JL 4X5XA 1MRDL 5BRZA 1SEBB 5E9DE 3T4YA 3WIHH 4R96A 2QQNL 2P5WB 2APXA 2FEEI 4IRJD 3S5LG 2MCPL 3VFVB 5EO9B 1SEQH 1BLNB 5KSUB 4H1LG 3KYMB 5HTSA 1N6QH 2WINB 1KULA 3V79C 4PJEA 2ITCB 3ESUF 3H8NA 2HTLD 1GZPA 3T1WA 1YEEL 2W59A 4AIOA 4X80L 1DR9A 3DX8B 2YBRB 5FYKH 3AREB 5FV1L 3GSUB 5IGXH 4GKSB 3FQNB 5GRUH 5D1XC 1MCBA 1L6ZA 1BQLL 2E8YA 5DEGB 4PJIA 4X5LA 5EOQL 1XF4A 2E9JA 2CR3A 2VXTH 1U2HA 4Q6YA 4K23H 1U9KA 1KEMH 1MJUL 3T0VA 4PJEF 4HWNA 3QSKB 3MV7E 4GRMB 2FATL 1OAXH 1FFQA 5DK0A 4YH6A 1Q94A 2EIEA 1U8OB 3ULUH 3HNVH 4ZTPL 4XWOC 3QCVL 4Y5XC 3TA3C 1UXSB 3G08A 2P42B 5FUOH 5HDQH 4M1CD 4KK5C 3S5LB 2ATKA 5EORL 1CXLA 5A3ID 4ORGA 1FFOA 5GXBB 1ZANH 2HLAA 1IQDB 3LKRA 1NFDA 4H1LB 5IEHB 3K2UL 4C56B 4PGBA 5D7LB 5K9QG 1BX2B 4GSDH 1GOGA 3EYOB 5HY9B 3NCCB 3L7EA 1B4JL 2DDQH 3ARED 2AK4E 1JHLL 3QDJD 5B39G 4OCNC 3TVMC 1ZHLA 3DV6A 2DQUL 1KTLA 2ZJSH 5DJZB 1IM3B 4PREA 5C86A 2CLVA 3P30L 4J2XA 1N64L 2BY2A 4J23A 5BW7A 3VG9C 2VDNL 3BKJH 4M5ZH 3ARQA 3N0PB 4EIGB 4EBQL 1DQLL 1NFDF 2XN9E 1D9KD 2JKXA 3GEWB 5E5MA 4XVTH 4LPTA 1JGUL 3LEXA 5FEBA 3LQAL 1F2XK 5E70A 4OQTH 1KV3A 3BZDA 1JRHL 2YRLA 3GMMB 4RA3A 2Y9RT 1BJ1H 2YWYA 3VGAB 2BMKA 4H26A 4M4RA 3I6GB 4ODSH 3CAFA 1XCTA 1QKZH 2BDNL 4HF5H 3HKFA 4G6AD 2PW1A 5EZOH 3CFCL 3L3JA 3MCLL 4FZEL 4ZAKB 1F90L 4ZUSA 1RZ8A 4XT1C 4X99B 4LOUC 5DO2D 5K9QI 1S8DB 4WFFE 3IU4L 1HZHH 4G7VH 2W91A 3H3PL 4GOSA 3ARBA 1OAKH 1ZTXH 3O6FA 4Z0XB 4KK6D 5B39B 4ISVA 2Q8BH 1M7DA 3UYRH 3QO0A 3Q3GA 5CJBA 2R0LH 5B21A 3TJEH 5F7UA 4QRSB 3EFDL 1B2WH 4EDXA 3QNZB 2H26B 2OXGA 4JHBA 1HHHA 3O11A 1OAZL 3NA9L 3QQ9C 4TUJA 1J1OH 3HLAA 3OKNB 3OSKA 4GXUM 2DIBA 5J6GA 2VDML