5D94A

Crystal structure of lc3-lir peptide complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
KTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title FYCO1 Contains a C-terminally Extended, LC3A/B-preferring LC3-interacting Region (LIR) Motif Required for Efficient Maturation of Autophagosomes during Basal Autophagy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/peptide
total genus 36
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5d94A00
1WM3A 2MSED 2MBHA 3VXWA 4URKA 4NY0A 5L95C 1Q5WB 1WR6E 4ZRIA 5C23A 3UQBA 1Q0WB 3ZDMC 3ML9A 1S1QB 5LXIB 2KC1A 1OGWA 3IG3A 2ZPYA 3M95A 4EFOA 4XX5A 1WGRA 1WGDA 4BOZB 5CTRC 4HPLB 4RMAA 5G55A 4EOYA 1GJZA 2NBVB 1XQQA 4E74A 2HE7A 1WE7A 2CR5A 2PEAA 5E6OA 3VQIA 4FLHA 2GOWA 3WAOA 1OQYA 2A5UA 2FCSA 1V49A 4GDLA 4NJ7A 4MGYE 2LJ5A 1E8ZA 1E8WA 1F9JA 4I6LB 2FNJB 2K8HA 3DBRI 4TUUA 4FN2A 2LVPA 2AEHA 4PYZA 3APCA 3PHXB 2G4SA 2KJ6A 3PVLA 1WR1A 1FXTB 1V5OA 1SE9A 4K81A 1WX7A 2M0XA 4EZJA 1LXDA 1I35A 3QC8B 4G0NB 3PT2B 4K7WA 1YD8U 5AEKB 1H8CA 3DVNU 2R2QA 2LD9A 1OEYA 3WAMA 3NY5A 2JXXA 2NS5A 3DPDA 3ZNGC 2L05A 3RZFA 2NBUA 2LVQA 4JL9A 5DPWA 3TCAA 1HE8A 2NPTB 2PPHA 4WJOA 3V62A 3PRMB 3Q3FA 4HXDA 1I42A 2G4DB 3APDA 3OJ3A 2BWFA 4DXAB 5HKHA 5CHVC 2KD0A 3CSTA 3TJPA 2KMCA 2EKEC 2NVUI 3L08A 2LXCA 2J0KA 2ZJDA 4ICVA 1IP9A 3TBLD 3ZTCA 2V4LA 1R4NI 4LCDE 2MBQA 4DHJB 4W9FA 1K8RB 2CHZA 1UELA 1E7UA 2C7NB 2CKHB 2N9XA 3KW5B 3VTWA 2JPHA 2B3AA 3EFUA 4NQKE 2WX0A 2UWQA 4X57B 3MTNB 3N30A 3X0WA 2L7RA 4WJPA 2LRWA 2ZNVB 2C9WB 3ZUNA 2NPTA 3B08A 4MGKE 1ZGUB 4KV2A 1WGYA 3KUCB 2ZCCA 3X23A 3DVGX 3ZNID 1NBFC 1OTRB 2KN5A 4WJQA 2C7HA 1YJ1A 1KOTA 2UYZB 2LVOA 2OOBB 5J17A 2FIFA 3QHTA 2KNBA 2MCNB 4FHJA 2LGDA 3ZRCA 1UBIA 4IWQA 4DHZE 2GBNA 4HJKA 3UGBB 1YX6B 2REXA 3VAWA 4FJZA 3UF8A 4GSWA 4BKSA 2JY6A 3MHSD 3SU8X 1A5RA 2ZNVC 3WIMA 4LJOB 3ONSA 4BVUC 2DZJA 1V86A 4KIKB 4F7ZA 4DBGA 2EMSA 2W9NA 2BYEA 3ZVVA 5KHQA 1WX8A 3B0AA 4N9F4 2L76A 4JGHB 3APFA 4BBNF 4FULA 1BT0A 2LI5A 2ZVOA 3H7PB 2VRRB 4LDTD 4A3PA 2NBWB 3DVGY 5D94A 2IY1B 1KJTA 3T8MA 3HHMA 4NQLB 2KLCA 2XK5B 4TQ0A 3KVFB 4I6NB 3TL5A 4DK5A 2LXAA 1ZW7A 1M94A 2D11A 3RYTA 4PS3A 4DDID 4OVUA 4GU2A 2LWPA 1IPGA 2DZKA 4GMVA 2L0FA 1MG8A 4KIKA 1VCBA 4WWPA 2BWES 3V6CB 5EDSA 3N32A 4ZYNA 2KDBA 2XEWA 3O65B 3U7DA 2AL6A 2KDFB 4GGQA 2MBOA 5L83A 3H7PA 4IM3A 3ML8A 3ZKJC 1WXAA 1EF5A 4ZRKA 4EUTA 3R3MA 3SD5A 4KSLC 2J0JA 2XK5A 2GBMA 2CU1A 3DBSA 3PHWB 4NJ6A 2LGXA 5GMVA 3DOWA 3RCZA 3VFKA 2L00B 2K39A 1YQBA 1GUAB 2MRPA 4FADA 5IA7A 2ASQA 3H6NA 4MM3A 2Y5BB 4A3OA 1LQBA 2MWSB 5E6PA 1IYFA 4IWPA 4BKTA 3ZNHB 5DPTA 2MX2A 3IFWB 3KYDD 4PYUA 4CO7A 3AU5A 3K9OB 4W9HA 1V81A 3WANA 3M62B 2M17A 5D6JB 3W1SC 4F1SA 3VUWA 2RSUA 4F8CB 1UD7A 5IAAC 3W1SA 4K7UA 1WXMA 4ANXA 2ZEQA 1V80A 2KHWB 2GBJA 4KVGB 3PRZA 4MGIE 2KOXA 4AJYB 4IWOA 2DENB 3DVNV 5J2RA 2KXJA 2KMAA 2BGFA 3PS6A 4ZDVA 3NZUA 1WZ3A 1TBEA 1WGHA 2DYOA 1RFAA 1V6EA 1WF9A 2J0MA 2K1FA 3LJ3A 3QAQA 4NAWB 2D10A 1EF1A 2BYVE 5JZEB 4MH0E 3HK0A 3ZO5B 1ZKHA 2ZVNA 4II3B 4MGZE 3KUDB 2LZ6A 5D7GA 4EKUA 1WIAA 2N9EB 2Z0EB 2JWZA 1ISNA 2DZIA 2Z59B 4WQOB 1T0YA 3JYUA 3VH3B 5DPSA 2JUOA 3PPAA 3Q3JA 3OLMD 2IO3B 4IG7B 3VTVA 3L10B 4K7SA 2AWTA 1E8XA 3N3KB 4FJYA 3BINA 3PRPB 2K25A 1P9DU 2MBEA 3PLUA 2V3SA 3UQAA 4M0WB 4MSMB 1TZ1A 4DHZB 1LFDA 1TGZB 2PE9A 2RPQA 2IBIB 2V1YA 3QIJA 4NAWA 5G2NA 2KWUB 2M4NA 1WMHB 1VD2A 2R2OA 1H4RA 2WDTB 4B9KA 4HVBA 1Q1OA 3RULA 4AOFA 4ANVA 3M3JA 3QCAA 2MQJA 2N7EA 4HPMB 4MELA 1GC7A 1WRDB 4JLCA 1QZEA 4EZKA 2LASA 2BKFA 4DWFA 1XD3B 2KDIA 2O6VB 2JZZA 3H9DA 3EECA 1S3SG 1WJ6A 3QA8A 2K6QA 4NPNA 2IO1B 1EUVB 2G3QB 1UZXB 5JHAA 3GOEA 3L16A 5KHOA 4BOSC 4FA6A 4TKNA 5AZFA 1WM2A 3CMMB 4HK2A 4CHKA 5JHBA 1WMHA 3S2AA 2HJ8A 3R7RA 1YX5B 1J8CA 2KWCA 4J6IA 1WYWB 2WWZA 3SDLC 3PGEA 1G6JA 3R7QA 2C5LC 5CHWA 2DAJA 2MP2B 3IHPC 1WXSA 4G50A 1NI2A 1UBQA 4AP4C 1EO6A 2BPSA 4BBNC 4EEWA 2O6VA 5DCNA 3SHQA 2MBBB 2JRIB 5J18A 1WJUA 1P3QU 3A9KB 3K9PB 4FHKA 3UIPB 3W1YA 4A20A 3OJ4B 2D07B 3M63B 2KX3A 3QARA 4G3XB 2A4ZA 1J19A 2KK8A 3IVFA 1KLVA 3A4SC 1U4AA 2BKRB 4HCPB 3NOBA 1E90A 1X1MA 2IYDB 5AZGA 2WX1A 3RZWC 3CF6E 2C60A 5LLIA 4TQ1A 2BYFA 4CYEA 5CHFA 1L7YA 1C1YB 2GMIC 3VUYA 4AJWA 2DZMA 3C0RB 1XT9B 4W9IA 4KSKC 2GBKA 2MP2A 3GZNI 2DYMA 2QHOA 5AZHA 4E3CA 1UH6A 1Z5SB 2ZZPB 1WY8A 2RGFA 4PS8A 3PLVA 1P98A 2JVCA 4IM0A 2M8SA 3ZNZB 3A9KA 2RR9A 3QX1A 3AULA 3RUIB 3AI5A 2KFKB 3AXCA 3TMPB 1P1AA 1WH3A 2M1MA 3PREA 4IC7B 4K1RB 3L17A 2KJHB 2L0TA 4OVVA 4W9CA 3HIZA 4GN1A 3T9LA 4ASWC 2N9PC 4DHJD 1GG3A 3MJWA 1WE6A 3PZDA 1WGGA 4BKSD 5FR6A 1L2NA 2HTHA 2O2VB 4II2B 3VHTC 4FJVB 3ECIA 2C7MB 3EC8A 4GOCA 2OJRA 3PV1A 2BF8B 2ZPNA 2L8JA 4TV3A 1E5WA 3H1UA 3QQ8B 4LDTB 1WZ0A 3VDZA 2JRHA 3NZSA 1WFYA 3KH0A 4LJPB 5E6NA 2L3ZA 1LM8B 3R66C 4HLEA 1R4MI 2DYBA 2LUEA 2IO2B 3KYCD 5BO4B 3ZTDA 2KFKA 4KZCA 1GNUA 2FCQA 1WX9A 4RM8A 1GC6A 3WA0A 2G45B 2N7DA 4W9KA 2EMTA 5LXHA 2I1JA 1WI0A 2D3GA 2O6VD 3A1QB 2IZVB 1Z2MA 2PE6B 2CHWA 3ZLZA 3NS8A 2KTRB 3V61A 3ALBA 2GBRA 4HDOA 2O2VA 1TTNA 1KM7A 4G11A 1Y8RC 2RD0A 3A33B 1WJ4A 2FCNA 2KDEB 3JVZX 3L0WB 3QWZB 2KQ7A 3RT3B 4PS7A 2KZRA 1UGMA 1WJNA 3KUZA 2MW5A 3H7SA 1E7VA 3VVWB 4W9DA 4AUQC 4W9LA 3V6EB 2DX5B 2WYQA 1RAXA 2N1WA 3JW0X 2KVRA 4KDIC 1V2YA 3VH4B 4E71A 4WAAA 4EZLA 2YVCA 3L13A 2KQSA 2Z0DB 4KDLB 3D32A 5DPRA 2J7QB 2JT4B 4RM9A 4MJSB 3A1QA 2KO3A 4IW0A 2KC2A 1WXVA 2I1KA 4W9EA 3I3TB 4GDKB 3UINB 2ZCBA 1P0RA 2KTRA 2K8BA 2FIDA 2AL3A 3DCGA 3IBEA 3ZRFA 2YLMA 2LGYA 4ZRJA 2MA9B 3V60A 4M8MA 4HWIB 2KFJA 2KX0A 4GXBA 4P7IA 4M8NA 2KTFA 3NHEB 2CS4A 3ENEA 3A9JB 3AU4A 4JIOU 4NNJB 4WWNA 4WWOA 1SIFA 2IY0B 3JSVB 3QK0A 3WAPA 1RRBA 2K6DB 2XBBC 4ANWA 2LRUA 1J0GA 3P2BA 2FAZA 4ANUA 4GB9A 4DDGD 5D2MB 4IUMB 3DQVA 1C3TA 3DDCB 1V9JA 3EHVA 4MJSA 4B95A 3ZDTA 2DHZA 3UIOB 3VTUA 2KLGA 4GDKA 3CSFA 3U8ZA 5JH5C 5TR5A 3TIXA 4BKGA 3HM3A 3ZW3A 2KWVB 4W9JA 4YL8A 4ICUA 4B6WA 1YIWA 3B1LX 3OAWA 4MSQB 2N4FA 4BFRA 2CHXA 2KANA 1JRUA 3WALA 2AYOB 2FUHB 2KKCA 4MDKE 3A4RA 2D2QA 3VUXA 2NR2A 4GIVA 3A9JA 3RD2A 3JSVA 1OEYJ 1NDDA 3DBHI 5C1ZA 2FCMA 3HM6X 2DAFA 1AARA 4XZ4A 4JQWC 3QJZA 4IM2A 2MLBA 4FBJB 2NCNA 1CMXB 1D3ZA 3PTFC 1V5TA 4KZ0A 4HCNB 2IO0B 4W9GA 2JZ3B 4HDQA 2N1VA 1SGHA 1E8YA 2K8CA 4WJNA 2HD5B 2PJHA 4MEMA 3ZIMA 2KJRA 3U30A 2JF5A 3L54A 4XC2A 5CX3A 1RLFA 3DBLI 4I6PA 4AWJA 3BY4B 3PSEB 4GDLB 3LDZE 1PQSA
chains in the Genus database with same CATH superfamily
2MSED 3VXWA 4URKA 2ZW0A 5L95C 1Q5WB 1FNVA 4ZRIA 2DLBA 3UQBA 3ML9A 1S1QB 4YTMB 3RFZB 3M95A 2ZPYA 2VZKB 2DNFA 1MPEA 5CTRC 1DYQA 4EOYA 3E56A 2HE7A 1WE7A 1SE2A 4FLHA 4KGSA 1VR9A 2WXPA 4NJ7A 1E8ZA 4TUUA 4JWUC 4PYZA 3APCA 3PHXB 1HTQA 1J7BA 1R4NB 1WR1A 2WXGA 3Q2AC 1FXTB 3MC9A 1FNUA 1WX7A 1HTOA 2BT6A 2BS4B 3PO0A 3GE8C 1I35A 4G0NB 2AQ3B 3DVNU 2LD9A 1OEYA 2L05A 4AS1A 1I4GA 1T5XD 1EU3A 4JL9A 2WXFA 2NPTB 2G4DB 2OJWA 3MFGA 3OJ3A 5CHVC 5TSSA 2KD0A 1TZOA 2EKEC 2N9KA 3Q6BA 1GAQB 2NVUI 1KFYB 2H88B 2ZJDA 1SJED 5I4DA 1IP9A 3ZTCA 1CK1A 4LCDE 1K8RB 1I4XA 2CHZA 1E7UA 3ZJVA 1C77A 3KW5B 4NQKE 2WX0A 2M19A 1QKZA 3MTNB 4WJPA 2INDC 4PT5A 2NPTA 3TEWA 3B08A 4MGKE 1ZGUB 1WGYA 2MHJA 2IGDA 2ZCCA 3X23A 2KN5A 2SAKA 4WJQA 2C7HA 3N20C 3I9V1 4OW0A 2LVOA 1L5PA 3AEAB 5BYRA 3AEEB 2N7JA 2KNBA 4IWQA 2GBNA 1YX6B 4JPSA 2D5GA 4ACFA 2ZNVC 1IGDA 4LJOB 3P4SB 3ONSA 4BVUC 4KIKB 2VZKD 1XLNA 2KDMA 2Y5PA 5KHQA 2M56B 2V3PA 3B0AA 4N9F4 3UI3A 4BBNF 4FULA 4YWGG 3AEBB 3FILB 3GZNB 3LYYA 3E9SA 3GS2A 3RNBC 4LNNA 2L32A 1M94A 2D11A 4PS3A 4OVUA 4MM3B 4KIKA 4LNKA 3V6CB 1FCLA 3R2TA 1TYGB 1PGAA 5EDSA 3N32A 2XEWA 1DOXA 4GGQA 5L83A 3FILA 4ZRKA 2IPKD 1ZDXA 5H8YE 1NI3A 3SD5A 1C76A 3PHWB 5GMVA 3VFKA 3DOWA 1YQBA 1GUAB 2ASQA 4MM3A 2B76B 2Y5BB 2MWSB 5E6PA 1SEBD 1HQRD 1MJDA 2MX2A 2ON8A 3EA6A 4CO7A 1ENFA 3W1SC 4F1SA 2RSUA 3Q3NC 1V80A 2VH2A 4KVGB 1FPYA 1ACCA 2DENB 2KXJA 1FD6A 1WZ3A 1FFUA 1EWYC 1WGHA 3B2FA 1V6EA 1WF9A 2J0MA 2K1FA 3QAQA 2BYVE 4YSYB 4II3B 2N9EB 1JRPA 1ISNA 3VH3B 2JUOA 3Q3JA 4IG7B 3VTVA 5C3JB 1E8XA 1YN5A 1JWBD 2V3SA 3UQAA 2PE9A 2IBIB 5G2NA 4HVBA 2WDTB 5LNK1 3ZYYX 4DXGA 1SF0A 2OHFA 1WRDB 1QZEA 2JYTA 4EZKA 2BKFA 4DWFA 1XD3B 2O6VB 4P1CC 3EECA 1S3SG 4NPNA 5H92C 3DBHB 3SR6A 1C4CA 4ITKA 3BYTB 3L16A 1Q10A 2JU6X 4TKNA 1WM2A 1RWSA 4HK2A 5FK9C 4CHKA 2KWCA 1JWMD 2LHEA 2GI9A 2I2YA 5CHWA 1TS2A 2MP2B 3IT4B 4G50A 1NI2A 2CJNA 3EUB2 2BPSA 2O6VA 2JRIB 5J18A 4WH4A 1P3QU 4FHKA 3K9PB 3UIPB 3W1YA 4A20A 2D07B 4BZAA 3M63B 2KX3A 3VRBB 2A4ZA 1UWMA 3IVFA 4ARIA 2QCZA 3R2IA 2LMCA 3CF6E 1L4ZB 2C60A 1VZ6A 4S0RA 1XLQA 2DZMA 1JWUD 3P1MA 2MP2A 1T6BX 1UH6A 1Z5SB 4E3CA 1HEZE 2KN4A 2G1EA 2MJEA 2RGFA 2JVCA 3ZNZB 2M8SA 2RR9A 3RUIB 3AI5A 3AXCA 1P1AA 2H89B 1YJJA 4OVVA 1FRRA 3T9LA 4DHJD 1E9MA 1WE6A 3ZXRA 2OJRA 3PV1A 4TV3A 3H1UA 3QQ8B 4LDTB 1WFYA 4LJPB 2L3ZA 4HLEA 3KYCD 3ZTDA 1SE3A 2FCQA 1BMLC 2WNMA 4RM8A 3WA0A 5IKCM 2G45B 2N7DA 2EMTA 1JROA 5LXHA 2O6VD 3A1QB 4K3BA 1EWCA 2PE6B 2CHWA 1TS3A 3ALBA 4C4VB 4HDOA 1Y8RC 3L0WB 2FCNA 1FCCC 2KQ7A 3RT3B 4PS7A 1NVID 1UGMA 4TSSA 3KUZA 2MW5A 1E7VA 3RNCC 1RAXA 2KVRA 1V2YA 2QMTA 4IDIA 4C00A 4E71A 4EZLA 2YVCA 3L13A 2Z0DB 1LGRA 2J7QB 4LLGM 4RM9A 4MJSB 3A1QA 2KC2A 5T8IA 3UINB 2ZCBA 2K8BA 2FIDA 4C4VA 3TUOA 4C7ZA 2LGYA 2KFJA 4P7IA 4NAMA 2KTFA 3NHEB 4MH8A 1FIQA 3AU4A 5G5HA 3NVZA 1SIFA 4WWOA 3ZGZA 1FFVA 3P2BA 2FAZA 3SEBA 5D2MB 3DQVA 4B95A 4MJSA 5BMIA 3ZDTA 3UIOB 1T3QA 1A70A 3CSFA 3LB8C 3U8ZA 2RDHA 4W9JA 4ICUA 4HKZE 3FKYA 3OAWA 1MFWA 3Q14C 4RH6A 3A4RA 3I57A 2TSSA 3ZXVA 2R61A 1NDDA 4JWSC 3VRAB 2J42A 3HM6X 4XZ4A 4JQWC 4XYCA 4IM2A 1CMXB 2Y5CA 1XXGA 3PTFC 1D3ZA 2N1VA 3GP7A 1E8YA 2HD5B 3N1ZC 1TY2A 4C56C 1L6VA 4KGTA 4XDDA 3BY4B 1SBBB 1WM3A 1I4HA 1Q0WB 5LXIB 1ZXHA 1OGWA 2KC1A 2MH7A 4EFOA 1K51A 4HPLB 5G55A 1AW7A 3V3XA 1XQQA 4E74A 1MHXA 3VQIA 2GOWA 1OQYA 4RGOS 3RI7C 3O13A 4MGYE 2LJ5A 1E8WA 4I6LB 2FNJB 3ZJTA 5FKAC 2JXTA 1MI0A 2KJ6A 2PVGC 1V5OA 2HDEA 4B0MA 2MJDA 1LXDA 3QC8B 5AEKB 1NYQA 2NS5A 2WDQB 3DPDA 2LVQA 1R7SA 3PRMB 1I42A 3TJPA 2NTSA 3ZQ4A 2LXCA 2UU7A 3TBLD 2PW9A 4HJGE 1MG4A 1L4DB 1UELA 2N9XA 3VTWA 4A8XC 1ZDVA 1V97A 3X0WA 2L7RA 1VZ7A 1M4VA 2C9WB 3ZUNA 3KUCB 3ZNID 1NBFC 2L52A 2UYZB 2OOBB 1TY0A 4HPPA 3R8BA 5G5GA 2QILA 2MCNB 4CQNA 2REXA 3VAWA 4FJZA 3UF8A 2JY6A 3MHSD 1I4QA 3WIMA 1V86A 1F2RI 1CJEA 1WX8A 3HVDA 3N1YC 4WWMA 5AUKA 1BT0A 3KWVA 4KGRA 3AE7B 3DVGY 2WGSA 4XDCA 3T8MA 1GB1A 3KVFB 4I6NB 3TL5A 5MPOA 1ZW7A 2WLBA 1F0ZA 2LWPA 1IPGA 1Y56A 4S17A 1SE4A 2L0FA 2INNE 4ZYNA 2KDBA 1SSNA 2MBOA 4IM3A 2IDYA 4XGAB 4WQMA 1WXAA 1EF5A 4EUTA 2J0JA 2GBMA 2CU1A 3DBSA 4NJ6A 3RCZA 2LGXA 2L00B 2K39A 5IA7A 3EGRA 4A3OA 1IYFA 2OEDA 4IWPA 4BKTA 2WU2B 5DPTA 3IFWB 1YJIA 4B0EA 1V81A 3WANA 5D6JB 3FC4A 1FXAA 5IAAC 1MHHE 1YQ3B 3ABVB 1WXMA 4ANXA 2KVZA 3PRZA 2KOXA 1MVKA 5EE0A 2KMAA 3PS6A 3NZUA 1I7HA 5BMHA 3MJ5A 4HEA1 1E0ZA 3ZO5B 1ZKHA 2ZVNA 3KUDB 2LZ6A 4EKUA 1WIAA 5AUIA 2Z0EB 2DZIA 2Z59B 4WQOB 2JX5A 2IO3B 2INCC 3L10B 3N3KB 2VH1A 3BINA 3PRPB 4XE0A 5EE9A 1P9DU 2MBEA 4NJCA 4MSMB 4DHZB 2LGSA 1L0YB 3EFCA 1LFDA 2RPQA 1UNSA 2V1YA 3QIJA 3AE4B 2KWUB 2M4NA 3NVWA 5EE3A 1C4PA 3M3JA 1UWXA 1PGBA 1QQRA 3BZDB 4HPMB 4MELA 2BYTA 1D5MC 3P4QB 1KH0A 2KDIA 2K6QA 4FXCA 4LTUA 1EUVB 3TSSA 3GOEA 5KHOA 4FA6A 5AZFA 4YSXB 3CMMB 3KLSX 5JHBA 3S2AA 2JYEA 2LJIA 1WYGA 4J6IA 1WYWB 1BUIC 3PGEA 1OFFA 1TKYA 2C5LC 3TEZA 5BYQA 4AP4C 1DGJA 2MBBB 4A55A 4RF0A 2J52A 1SIJA 2X38A 4G3XB 4LNIA 1J19A 4A9AA 1HXYD 1X1MA 2EELA 2WX1A 3RZWC 1J7AA 2BYFA 4CYEA 5CHFA 1C1YB 3VUYA 4AJWA 2K0PA 3C0RB 1XT9B 2DYMA 4PS8A 1P98A 4IM0A 3QX1A 2WXHA 3TMPB 2M1MA 1WH3A 2AX5A 3L17A 5HG2A 2L0TA 5C2TB 3AEDB 3PZ8A 3MHZA 1JQ4A 2JSVX 3IAS1 2M0AA 5GXGB 2O2VB 3ECIA 2C7MB 2ZPNA 2L8JA 5HI1A 2JRHA 5E6NA 3KH0A 1E6EB 3R66C 2CU3A 1D6EC 1GNUA 2N9LA 2YEPF 4GLSC 1WX9A 1F77A 1WI0A 1Z2MA 3BIID 1WRIA 3NS8A 3V61A 2GBRA 2O2VA 1TTNA 1KM7A 2RD0A 1WJ4A 3JVZX 2KDEB 1DOYA 3QWZB 2WXRA 1WJNA 4HKQA 4W9DA 4W9LA 3V6EB 2K22A 5IN7A 3NVVA 1XCQL 2FUG1 3NJTA 5DPRA 3NRZA 2HJ1A 4H2AA 2KO3A 2WHIA 2JQRB 4W9EA 3W9CB 3DCGA 2DBYA 1GOZA 4MACA 1I4RA 2JWUA 2MA9B 4QAYA 4PK1A 2QDFA 3C8YA 2WU5B 4GXBA 3WAPA 2IY0B 1RRBA 2LRUA 1J0GA 4GB9A 4DDGD 3DDCB 1QOAA 5TR5A 2BS2B 3RPFC 2KWVB 4YL8A 4B6WA 1YIWA 3DBLB 4MSQB 1JRUA 1NEKB 2AQ1B 2KANA 2NR2A 1OEYJ 1F52A 1N62A 5C1ZA 3MP9A 3T3OA 1AARA 1YNTE 2V4IB 4M02A 2BTEA 2NCNA 2IO0B 3MC8A 1FEHA 4XWTA 1PDXA 2K8CA 1B1ZA 1C79A 2PMVA 1ZXIA 2D3BA 2PJHA 4MEMA 3AE1B 4Q2JA 2KAJA 1TT5B 3U30A 3L54A 5CX3A 2K5PA 3Q69A 4I6PA 4DQOC 3PSEB 2W82A 3LDZE 2MBHA 4NY0A 4YTPB 1ZOYB 1WR6E 3L4PA 1VLBA 2BB6A 2QSDA 1WGRA 1WGDA 3BVZA 4RMAA 3U7ZA 4A90A 1V1OA 2CR5A 5E6OA 1LO5D 3WAOA 1YMHE 2RDGA 1V49A 4ZOHC 1OQRA 1F9JA 1FRDA 4RFBA 4FN2A 3RNEC 5D3DA 3PVLA 2MEKA 2K9XA 4K81A 4EZJA 4MT5A 4L2YA 1BXTA 3PT2B 3B9JA 1L6UA 1CQVA 3WAMA 3NY5A 2NBUA 4RGTA 3TCAA 1HE8A 4WJOA 3V62A 3Q3FA 4YXDB 4DXAB 1XO3A 3L08A 3LXFA 5E6JA 2J0KA 4M01A 2WXKA 4LNOA 2V4LA 1R4NI 4W9FA 4YT0B 3NZ3A 2LHDA 2B3AA 3EFUA 1FNWA 2UWQA 3N30A 3AM9A 2LRWA 3GB1A 2IGGA 1TS5A 4KV2A 2IGHA 1STEA 1OTRB 3NS1A 1UF0A 3DWGC 4TMAB 5J17A 2ZW1A 3QHTA 3ZRCA 4FHJA 1YN4A 3UGBB 2IJ0A 1XEEA 1T0QC 4GSWA 4BKSA 3SU8X 1A5RA 4OHJA 2DZJA 3KQ4A 1P7EA 4REZA 4N58A 2BYEA 4J3OD 4JGHB 1ET6A 2JZPA 3RNGC 2WXLA 4C80A 2ZVOA 3H7PB 4LDTD 4A3PA 2IY1B 2Z8LA 3NUHB 3HHMA 2PTLA 4IOIE 3DHHC 3W2DA 4GMVA 1MG8A 1V1PB 1VCBA 3O65B 3U7DA 4HRSA 3AE9B 1NENB 3H7PA 4C7YA 2ACZB 3ML8A 3R3MA 4KSLC 1TS4A 3W5VB 1KRHA 4ZHPA 2PIAA 2MRPA 3H6NA 2WDVB 3AE2B 3ZNHB 2BS3B 4UDUC 4PYUA 3AU5A 3K9OB 2QJLA 3M62B 3VUWA 4ARCA 3CIRB 1XLPA 1UD7A 4K7UA 2WXJA 2ZEQA 1FM0D 2KWDA 4P16A 3ZJUA 3U52E 4AJYB 4ZDVA 2DYOA 1RFAA 3LJ3A 4NAWB 3HK0A 5D7GA 3HRDD 1T0YA 3JYUA 5DPSA 3SFDB 3OLMD 2PVOD 2AWTA 3HVZA 3H8HA 4M0WB 1TZ1A 1QOGA 4NAWA 1JALA 3BVGA 1VD2A 2R2OA 1H4RA 3RULA 4AOFA 2J4XA 4ANVA 1WGKA 1N5WA 1CZPA 1AWDA 1GC7A 5IP4D 2LASA 1QOBA 1WJ6A 2LEKA 3QA8A 4ZYSA 4M0WA 4P6VF 4BOSC 1KLUD 3KWLA 4RGMA 2HJ8A 3R7RA 3N9YC 2WWZA 1E7PB 3R7QA 1VJKA 3AE8B 1UBQA 4KKIA 4USAA 1EO6A 4BBNC 4EEWA 3VR8B 3A9KB 4WIPA 3OJ4B 2GLSA 3QARA 2BW2A 2KK8A 1KLVA 3A4SC 1K50A 1U4AA 1SXTA 2BKRB 1KLGD 1E90A 3AE5B 3BK1A 1RM6C 5LLIA 1ZUD2 3AEFB 4TQ1A 1L7YA 2GMIC 3AMZA 4W9IA 5IOIA 1WY8A 2QEJC 1C9FA 3PLVA 3A9KA 1YOVB 2AQ2B 3PREA 4IC7B 2QC8A 4GN1A 2N9PC 1GG3A 3MJWA 2X8XX 3PZDA 2WXMA 2KYWA 1C4AA 1F1HA 3N1XC 3IXSA 4RCOA 4FJVB 1D4BA 5EE1A 1E5WA 1LM8B 1R4MI 2DYBA 2LUEA 2IO2B 3BWUD 2D3AA 5BO4B 1ESFA 4KZCA 4W9KA 2I1JA 3Q8CA 2IZVB 1I4PA 3ZLZA 3I5JC 3IT6B 3J9CA 4L23A 1WWTA 3H7SA 2Q5WD 2WYQA 2N1WA 4US8A 3JW0X 1TIFA 3U2SC 3P63A 2KQSA 4KDLB 1EM7A 2DWQA 3D32A 4IW0A 2I1KA 3I3TB 2EKIA 2GB1A 3ZRFA 3AE3B 3IBEA 4D2KA 1D5XC 4L1BA 4RF1A 4M8MA 4HWIB 1WXQA 4O1NA 2CS4A 4NNJB 3VR9B 3QK0A 3Q8FA 1IBXB 4OZBA 4IUMB 2V0GA 1V9JA 2FE8A 2PKOA 1TKGA 4BKGA 3HM3A 3ZW3A 1T0RC 1F2RC 3WALA 3BK2A 2INPE 2AYOB 2FUHB 2KKCA 4MDKE 3VUXA 2V3NA 4HROA 3RD2A 1UGJA 1IBXA 2NMQA 3AV8A 2FCMA 2DAFA 2MLBA 3I63C 5HHDG 4KZ0A 1V5TA 4HDQA 4YSZB 1SGHA 4WJNA 1ZE3D 3FAHA 5JXVA 1RYJA 2KT7A 4WURA 2JF5A 1RLFA 1XCTL 1YN3A 4AWJA 4GDLB 2WDRB 2K3UA 5C23A 3ZDMC 3IG3A 2D3CA 2YEPB 4XX5A 4BOZB 1GJZA 2NBVB 1GPXA 1KF6B 3DHIC 2PEAA 2RPVA 2A5UA 2FCSA 3IAM1 4GDLA 2E3TA 3NG0A 1SJHD 2K8HA 3DBRI 2LVPA 3HUIA 2AEHA 2G4SA 2L83A 4KX6B 3MC0B 1SE9A 2M0XA 4IKGA 4K7WA 2WXIA 1YD8U 2N0SB 1H8CA 2R2QA 2LFIA 3OG5A 2JXXA 3ZNGC 4M00A 3RZFA 5DPWA 2PPHA 4HXDA 2KMMA 3APDA 3RNFC 5HKHA 2BWFA 1HZ5A 2RMMA 4US9A 3T3NA 3CSTA 4LK0M 3AN1A 1N60A 2KMCA 1PGXA 5BYSA 1N61A 4ICVA 1FXIA 1JW9D 2WP9B 2WXOA 2MBQA 4DHJB 3SFEB 2PLPA 1ZPSA 2C7NB 2CKHB 2JPHA 1N5XA 2NTTA 1UUPA 1AYFA 4X57B 3P4PB 1P7FA 2ZNVB 2W55A 2W54A 3DVGX 2ONQA 4K3CA 1YJ1A 3DWMA 1KOTA 2FIFA 4WAFA 3DHGC 2LGDA 1UBIA 4DHZE 3AECB 4HJKA 1PUTA 2L1AA 3CWIA 2W3RA 3Q8AA 4F7ZA 4DBGA 2EMSA 2HTME 2Y3AA 2XNAC 2W9NA 3ZVVA 1B9RA 2L76A 3APFA 4OZCA 2LI5A 2VRRB 5FR3A 2NBWB 5D94A 1KJTA 2BVCA 3GE3C 4NQLB 4NZLB 2KLCA 2XK5B 1XF5L 4TQ0A 2CJOA 3V05A 4DK5A 2LXAA 1V8CA 3RYTA 4DDID 1HA5A 4RNAA 4GU2A 2DZKA 4WWPA 2BWES 1HZ6A 2AL6A 2KDFB 3ZKJC 2XK5A 1R4MB 4N59A 3TEXA 2QIEB 2WQYB 4FADA 2V9HA 1LQBA 1SB3C 1JCKB 4KKJA 1PYWD 3KYDD 3RMKC 1VDVA 1VZ8A 4W9HA 5D3IB 2M17A 4F8CB 3P42A 3W1SA 2KHWB 2GBJA 4MGIE 4IWOA 3DVNV 5J2RA 2BGFA 3OWEB 1TBEA 3Q8EA 4BAXA 2I38A 2D10A 1EF1A 5JZEB 1K52A 4MH0E 4ZRQA 4MGZE 2JWZA 4YTNB 1TKEA 3PPAA 3URYA 4K7SA 5HFYA 4FJYA 1FO4A 2K25A 2BB5A 2KACA 2WS3B 3PLUA 2MJ3A 1N6ZA 1TGZB 1D5ZC 1WMHB 4B9KA 1Q1OA 1QLBB 3QCAA 2MQJA 2N7EA 1C78A 3Q3MC 2FBWB 4JLCA 1L0VB 3H9DA 2JZZA 3TEYA 2IO1B 1FMAD 4RGNA 2G3QB 1UZXB 5JHAA 1WSPA 1RFKA 1WMHA 3WCQA 1YX5B 1J8CA 3SDLC 1G6JA 1QILA 3Q3OC 3NVYA 2DAJA 3BVMA 3IHPC 1WXSA 3C19A 3SHQA 2LUMA 5DCNA 1WJUA 2ICIA 1IGCA 1OQQA 1VRAB 4HCPB 3NOBA 2IYDB 5AZGA 3AH7A 1NYRA 1XLOA 4OVZA 4KSKC 2GBKA 3GZNI 2QHOA 5AZHA 2ZZPB 2RDBC 4P1BC 3AULA 2KFKB 1QT9A 3ETRA 3DBRB 1J7CA 3AE6B 1V1PA 3P4RB 4K1RB 1YQ4B 2KJHB 4W9CA 3HIZA 3RN9C 4ZHOA 4ASWC 1WGGA 4BKSD 1QF6A 1EU4A 3PZ7A 5FR6A 1L2NA 2HTHA 4II2B 1L0XB 3VHTC 4GOCA 3EC8A 4XWWA 2BF8B 3VDZA 1WZ0A 3NZSA 2KFKA 3AB5A 4EE2A 4DXFA 1GC6A 3AEGB 1K53A 2D3GA 1JMLA 1DOIA 1ROEA 2KTRB 4G11A 3A33B 1JWSD 3U4EG 1AN8A 2KZRA 3VVWB 4AUQC 2DX5B 4R3DA 4KDIC 4A6QA 3VH4B 4WAAA 2SEBD 2GRIA 3RNAC 1QOFA 1IUEA 4AQ7A 2WXNA 2WXQA 2JT4B 2BBCA 2LGIA 1WXVA 4GDKB 1P0RA 2KTRA 5BMGA 3BYYB 2AL3A 2YLMA 4LNFA 4ZRJA 3Q8BA 3V60A 2KX0A 4M8NA 4JIOU 3ENEA 3A9JB 4WWNA 3JSVB 2K6DB 2XBBC 4ANWA 2G9HD 4ANUA 3B2GA 1KTKA 1C3TA 2KQ4X 1T0SC 3EHVA 2DHZA 3VTUA 2KLGA 4GDKA 5JH5C 3TIXA 2W3SA 4N6EB 3B1LX 2N4FA 4BFRA 2CHXA 2XN9C 4JX1C 2D2QA 4GIVA 1ET9A 3A9JA 1GB4A 3JSVA 4ZRPA 1TJEA 3DBHI 1N63A 3QJZA 1PFDA 5IO9A 4FBJB 1E10A 2E6XA 4HCNB 4W9GA 3W5UB 2JZ3B 4JE3B 1JWAD 2BQQA 3ZIMA 2KJRA 1ZP0B 4OZAA 4XC2A 3DBLI 2J53A 1PQSA
chains in the Genus database with same CATH topology
1WM3A 2MSED 2MBHA 3VXWA 4URKA 4NY0A 5L95C 1Q5WB 1WR6E 4ZRIA 5C23A 3UQBA 1Q0WB 3ZDMC 3ML9A 1S1QB 5LXIB 2KC1A 1OGWA 3IG3A 2ZPYA 3M95A 4EFOA 4XX5A 1WGRA 1WGDA 4BOZB 5CTRC 4HPLB 4RMAA 5G55A 4EOYA 1GJZA 2NBVB 1XQQA 4E74A 2HE7A 1WE7A 2CR5A 2PEAA 5E6OA 3VQIA 4FLHA 2GOWA 3WAOA 1OQYA 2A5UA 2FCSA 1V49A 4GDLA 4NJ7A 4MGYE 2LJ5A 1E8ZA 1E8WA 1F9JA 4I6LB 2FNJB 2K8HA 3DBRI 4TUUA 4FN2A 2LVPA 2AEHA 4PYZA 3APCA 3PHXB 2G4SA 2KJ6A 3PVLA 1WR1A 1FXTB 1V5OA 1SE9A 4K81A 1WX7A 2M0XA 4EZJA 1LXDA 1I35A 3QC8B 4G0NB 3PT2B 4K7WA 1YD8U 5AEKB 1H8CA 3DVNU 2R2QA 2LD9A 1OEYA 3WAMA 3NY5A 2JXXA 2NS5A 3DPDA 3ZNGC 2L05A 3RZFA 2NBUA 2LVQA 4JL9A 5DPWA 3TCAA 1HE8A 2NPTB 2PPHA 4WJOA 3V62A 3PRMB 3Q3FA 4HXDA 1I42A 2G4DB 3APDA 3OJ3A 2BWFA 4DXAB 5HKHA 5CHVC 2KD0A 3CSTA 3TJPA 2KMCA 2EKEC 2NVUI 3L08A 2LXCA 2J0KA 2ZJDA 4ICVA 1IP9A 3TBLD 3ZTCA 2V4LA 1R4NI 4LCDE 2MBQA 4DHJB 4W9FA 1K8RB 2CHZA 1UELA 1E7UA 2C7NB 2CKHB 2N9XA 3KW5B 3VTWA 2JPHA 2B3AA 3EFUA 4NQKE 2WX0A 2UWQA 4X57B 3MTNB 3N30A 3X0WA 2L7RA 4WJPA 2LRWA 2ZNVB 2C9WB 3ZUNA 2NPTA 3B08A 4MGKE 1ZGUB 4KV2A 1WGYA 3KUCB 2ZCCA 3X23A 3DVGX 3ZNID 1NBFC 1OTRB 2KN5A 4WJQA 2C7HA 1YJ1A 1KOTA 2UYZB 2LVOA 2OOBB 5J17A 2FIFA 3QHTA 2KNBA 2MCNB 4FHJA 2LGDA 3ZRCA 1UBIA 4IWQA 4DHZE 2GBNA 4HJKA 3UGBB 1YX6B 2REXA 3VAWA 4FJZA 3UF8A 4GSWA 4BKSA 2JY6A 3MHSD 3SU8X 1A5RA 2ZNVC 3WIMA 4LJOB 3ONSA 4BVUC 2DZJA 1V86A 4KIKB 4F7ZA 4DBGA 2EMSA 2W9NA 2BYEA 3ZVVA 5KHQA 1WX8A 3B0AA 4N9F4 2L76A 4JGHB 3APFA 4BBNF 4FULA 1BT0A 2LI5A 2ZVOA 3H7PB 2VRRB 4LDTD 4A3PA 2NBWB 3DVGY 5D94A 2IY1B 1KJTA 3T8MA 3HHMA 4NQLB 2KLCA 2XK5B 4TQ0A 3KVFB 4I6NB 3TL5A 4DK5A 2LXAA 1ZW7A 1M94A 2D11A 3RYTA 4PS3A 4DDID 4OVUA 4GU2A 2LWPA 1IPGA 2DZKA 4GMVA 2L0FA 1MG8A 4KIKA 1VCBA 4WWPA 2BWES 3V6CB 5EDSA 3N32A 4ZYNA 2KDBA 2XEWA 3O65B 3U7DA 2AL6A 2KDFB 4GGQA 2MBOA 5L83A 3H7PA 4IM3A 3ML8A 3ZKJC 1WXAA 1EF5A 4ZRKA 4EUTA 3R3MA 3SD5A 4KSLC 2J0JA 2XK5A 2GBMA 2CU1A 3DBSA 3PHWB 4NJ6A 2LGXA 5GMVA 3DOWA 3RCZA 3VFKA 2L00B 2K39A 1YQBA 1GUAB 2MRPA 4FADA 5IA7A 2ASQA 3H6NA 4MM3A 2Y5BB 4A3OA 1LQBA 2MWSB 5E6PA 1IYFA 4IWPA 4BKTA 3ZNHB 5DPTA 2MX2A 3IFWB 3KYDD 4PYUA 4CO7A 3AU5A 3K9OB 4W9HA 1V81A 3WANA 3M62B 2M17A 5D6JB 3W1SC 4F1SA 3VUWA 2RSUA 4F8CB 1UD7A 5IAAC 3W1SA 4K7UA 1WXMA 4ANXA 2ZEQA 1V80A 2KHWB 2GBJA 4KVGB 3PRZA 4MGIE 2KOXA 4AJYB 4IWOA 2DENB 3DVNV 5J2RA 2KXJA 2KMAA 2BGFA 3PS6A 4ZDVA 3NZUA 1WZ3A 1TBEA 1WGHA 2DYOA 1RFAA 1V6EA 1WF9A 2J0MA 2K1FA 3LJ3A 3QAQA 4NAWB 2D10A 1EF1A 2BYVE 5JZEB 4MH0E 3HK0A 3ZO5B 1ZKHA 2ZVNA 4II3B 4MGZE 3KUDB 2LZ6A 5D7GA 4EKUA 1WIAA 2N9EB 2Z0EB 2JWZA 1ISNA 2DZIA 2Z59B 4WQOB 1T0YA 3JYUA 3VH3B 5DPSA 2JUOA 3PPAA 3Q3JA 3OLMD 2IO3B 4IG7B 3VTVA 3L10B 4K7SA 2AWTA 1E8XA 3N3KB 4FJYA 3BINA 3PRPB 2K25A 1P9DU 2MBEA 3PLUA 2V3SA 3UQAA 4M0WB 4MSMB 1TZ1A 4DHZB 1LFDA 1TGZB 2PE9A 2RPQA 2IBIB 2V1YA 3QIJA 4NAWA 5G2NA 2KWUB 2M4NA 1WMHB 1VD2A 2R2OA 1H4RA 2WDTB 4B9KA 4HVBA 1Q1OA 3RULA 4AOFA 4ANVA 3M3JA 3QCAA 2MQJA 2N7EA 4HPMB 4MELA 1GC7A 1WRDB 4JLCA 1QZEA 4EZKA 2LASA 2BKFA 4DWFA 1XD3B 2KDIA 2O6VB 2JZZA 3H9DA 3EECA 1S3SG 1WJ6A 3QA8A 2K6QA 4NPNA 2IO1B 1EUVB 2G3QB 1UZXB 5JHAA 3GOEA 3L16A 5KHOA 4BOSC 4FA6A 4TKNA 5AZFA 1WM2A 3CMMB 4HK2A 4CHKA 5JHBA 1WMHA 3S2AA 2HJ8A 3R7RA 1YX5B 1J8CA 2KWCA 4J6IA 1WYWB 2WWZA 3SDLC 3PGEA 1G6JA 3R7QA 2C5LC 5CHWA 2DAJA 2MP2B 3IHPC 1WXSA 4G50A 1NI2A 1UBQA 4AP4C 1EO6A 2BPSA 4BBNC 4EEWA 2O6VA 5DCNA 3SHQA 2MBBB 2JRIB 5J18A 1WJUA 1P3QU 3A9KB 3K9PB 4FHKA 3UIPB 3W1YA 4A20A 3OJ4B 2D07B 3M63B 2KX3A 3QARA 4G3XB 2A4ZA 1J19A 2KK8A 3IVFA 1KLVA 3A4SC 1U4AA 2BKRB 4HCPB 3NOBA 1E90A 1X1MA 2IYDB 5AZGA 2WX1A 3RZWC 3CF6E 2C60A 5LLIA 4TQ1A 2BYFA 4CYEA 5CHFA 1L7YA 1C1YB 2GMIC 3VUYA 4AJWA 2DZMA 3C0RB 1XT9B 4W9IA 4KSKC 2GBKA 2MP2A 3GZNI 2DYMA 2QHOA 5AZHA 4E3CA 1UH6A 1Z5SB 2ZZPB 1WY8A 2RGFA 4PS8A 3PLVA 1P98A 2JVCA 4IM0A 2M8SA 3ZNZB 3A9KA 2RR9A 3QX1A 3AULA 3RUIB 3AI5A 2KFKB 3AXCA 3TMPB 1P1AA 1WH3A 2M1MA 3PREA 4IC7B 4K1RB 3L17A 2KJHB 2L0TA 4OVVA 4W9CA 3HIZA 4GN1A 3T9LA 4ASWC 2N9PC 4DHJD 1GG3A 3MJWA 1WE6A 3PZDA 1WGGA 4BKSD 5FR6A 1L2NA 2HTHA 2O2VB 4II2B 3VHTC 4FJVB 3ECIA 2C7MB 3EC8A 4GOCA 2OJRA 3PV1A 2BF8B 2ZPNA 2L8JA 4TV3A 1E5WA 3H1UA 3QQ8B 4LDTB 1WZ0A 3VDZA 2JRHA 3NZSA 1WFYA 3KH0A 4LJPB 5E6NA 2L3ZA 1LM8B 3R66C 4HLEA 1R4MI 2DYBA 2LUEA 2IO2B 3KYCD 5BO4B 3ZTDA 2KFKA 4KZCA 1GNUA 2FCQA 1WX9A 4RM8A 1GC6A 3WA0A 2G45B 2N7DA 4W9KA 2EMTA 5LXHA 2I1JA 1WI0A 2D3GA 2O6VD 3A1QB 2IZVB 1Z2MA 2PE6B 2CHWA 3ZLZA 3NS8A 2KTRB 3V61A 3ALBA 2GBRA 4HDOA 2O2VA 1TTNA 1KM7A 4G11A 1Y8RC 2RD0A 3A33B 1WJ4A 2FCNA 2KDEB 3JVZX 3L0WB 3QWZB 2KQ7A 3RT3B 4PS7A 2KZRA 1UGMA 1WJNA 3KUZA 2MW5A 3H7SA 1E7VA 3VVWB 4W9DA 4AUQC 4W9LA 3V6EB 2DX5B 2WYQA 1RAXA 2N1WA 3JW0X 2KVRA 4KDIC 1V2YA 3VH4B 4E71A 4WAAA 4EZLA 2YVCA 3L13A 2KQSA 2Z0DB 4KDLB 3D32A 5DPRA 2J7QB 2JT4B 4RM9A 4MJSB 3A1QA 2KO3A 4IW0A 2KC2A 1WXVA 2I1KA 4W9EA 3I3TB 4GDKB 3UINB 2ZCBA 1P0RA 2KTRA 2K8BA 2FIDA 2AL3A 3DCGA 3IBEA 3ZRFA 2YLMA 2LGYA 4ZRJA 2MA9B 3V60A 4M8MA 4HWIB 2KFJA 2KX0A 4GXBA 4P7IA 4M8NA 2KTFA 3NHEB 2CS4A 3ENEA 3A9JB 3AU4A 4JIOU 4NNJB 4WWNA 4WWOA 1SIFA 2IY0B 3JSVB 3QK0A 3WAPA 1RRBA 2K6DB 2XBBC 4ANWA 2LRUA 1J0GA 3P2BA 2FAZA 4ANUA 4GB9A 4DDGD 5D2MB 4IUMB 3DQVA 1C3TA 3DDCB 1V9JA 3EHVA 4MJSA 4B95A 3ZDTA 2DHZA 3UIOB 3VTUA 2KLGA 4GDKA 3CSFA 3U8ZA 5JH5C 5TR5A 3TIXA 4BKGA 3HM3A 3ZW3A 2KWVB 4W9JA 4YL8A 4ICUA 4B6WA 1YIWA 3B1LX 3OAWA 4MSQB 2N4FA 4BFRA 2CHXA 2KANA 1JRUA 3WALA 2AYOB 2FUHB 2KKCA 4MDKE 3A4RA 2D2QA 3VUXA 2NR2A 4GIVA 3A9JA 3RD2A 3JSVA 1OEYJ 1NDDA 3DBHI 5C1ZA 2FCMA 3HM6X 2DAFA 1AARA 4XZ4A 4JQWC 3QJZA 4IM2A 2MLBA 4FBJB 2NCNA 1CMXB 1D3ZA 3PTFC 1V5TA 4KZ0A 4HCNB 2IO0B 4W9GA 2JZ3B 4HDQA 2N1VA 1SGHA 1E8YA 2K8CA 4WJNA 2HD5B 2PJHA 4MEMA 3ZIMA 2KJRA 3U30A 2JF5A 3L54A 4XC2A 5CX3A 1RLFA 3DBLI 4I6PA 4AWJA 3BY4B 3PSEB 4GDLB 3LDZE 1PQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WM3 A;  2MSE D;  2MBH A;  3VXW A;  4URK A;  4NY0 A;  5L95 C;  1Q5W B;  1WR6 E;  4ZRI A;  5C23 A;  3UQB A;  1Q0W B;  3ZDM C;  3ML9 A;  1S1Q B;  5LXI B;  2KC1 A;  1OGW A;  3IG3 A;  2ZPY A;  3M95 A;  4EFO A;  4XX5 A;  1WGR A;  1WGD A;  4BOZ B;  5CTR C;  4HPL B;  4RMA A;  5G55 A;  4EOY A;  1GJZ A;  2NBV B;  1XQQ A;  4E74 A;  2HE7 A;  1WE7 A;  2CR5 A;  2PEA A;  5E6O A;  3VQI A;  4FLH A;  2GOW A;  3WAO A;  1OQY A;  2A5U A;  2FCS A;  1V49 A;  4GDL A;  4NJ7 A;  4MGY E;  2LJ5 A;  1E8Z A;  1E8W A;  1F9J A;  4I6L B;  2FNJ B;  2K8H A;  3DBR I;  4TUU A;  4FN2 A;  2LVP A;  2AEH A;  4PYZ A;  3APC A;  3PHX B;  2G4S A;  2KJ6 A;  3PVL A;  1WR1 A;  1FXT B;  1V5O A;  1SE9 A;  4K81 A;  1WX7 A;  2M0X A;  4EZJ A;  1LXD A;  1I35 A;  3QC8 B;  4G0N B;  3PT2 B;  4K7W A;  1YD8 U;  5AEK B;  1H8C A;  3DVN U;  2R2Q A;  2LD9 A;  1OEY A;  3WAM A;  3NY5 A;  2JXX A;  2NS5 A;  3DPD A;  3ZNG C;  2L05 A;  3RZF A;  2NBU A;  2LVQ A;  4JL9 A;  5DPW A;  3TCA A;  1HE8 A;  2NPT B;  2PPH A;  4WJO A;  3V62 A;  3PRM B;  3Q3F A;  4HXD A;  1I42 A;  2G4D B;  3APD A;  3OJ3 A;  2BWF A;  4DXA B;  5HKH A;  5CHV C;  2KD0 A;  3CST A;  3TJP A;  2KMC A;  2EKE C;  2NVU I;  3L08 A;  2LXC A;  2J0K A;  2ZJD A;  4ICV A;  1IP9 A;  3TBL D;  3ZTC A;  2V4L A;  1R4N I;  4LCD E;  2MBQ A;  4DHJ B;  4W9F A;  1K8R B;  2CHZ A;  1UEL A;  1E7U A;  2C7N B;  2CKH B;  2N9X A;  3KW5 B;  3VTW A;  2JPH A;  2B3A A;  3EFU A;  4NQK E;  2WX0 A;  2UWQ A;  4X57 B;  3MTN B;  3N30 A;  3X0W A;  2L7R A;  4WJP A;  2LRW A;  2ZNV B;  2C9W B;  3ZUN A;  2NPT A;  3B08 A;  4MGK E;  1ZGU B;  4KV2 A;  1WGY A;  3KUC B;  2ZCC A;  3X23 A;  3DVG X;  3ZNI D;  1NBF C;  1OTR B;  2KN5 A;  4WJQ A;  2C7H A;  1YJ1 A;  1KOT A;  2UYZ B;  2LVO A;  2OOB B;  5J17 A;  2FIF A;  3QHT A;  2KNB A;  2MCN B;  4FHJ A;  2LGD A;  3ZRC A;  1UBI A;  4IWQ A;  4DHZ E;  2GBN A;  4HJK A;  3UGB B;  1YX6 B;  2REX A;  3VAW A;  4FJZ A;  3UF8 A;  4GSW A;  4BKS A;  2JY6 A;  3MHS D;  3SU8 X;  1A5R A;  2ZNV C;  3WIM A;  4LJO B;  3ONS A;  4BVU C;  2DZJ A;  1V86 A;  4KIK B;  4F7Z A;  4DBG A;  2EMS A;  2W9N A;  2BYE A;  3ZVV A;  5KHQ A;  1WX8 A;  3B0A A;  4N9F 4;  2L76 A;  4JGH B;  3APF A;  4BBN F;  4FUL A;  1BT0 A;  2LI5 A;  2ZVO A;  3H7P B;  2VRR B;  4LDT D;  4A3P A;  2NBW B;  3DVG Y;  5D94 A;  2IY1 B;  1KJT A;  3T8M A;  3HHM A;  4NQL B;  2KLC A;  2XK5 B;  4TQ0 A;  3KVF B;  4I6N B;  3TL5 A;  4DK5 A;  2LXA A;  1ZW7 A;  1M94 A;  2D11 A;  3RYT A;  4PS3 A;  4DDI D;  4OVU A;  4GU2 A;  2LWP A;  1IPG A;  2DZK A;  4GMV A;  2L0F A;  1MG8 A;  4KIK A;  1VCB A;  4WWP A;  2BWE S;  3V6C B;  5EDS A;  3N32 A;  4ZYN A;  2KDB A;  2XEW A;  3O65 B;  3U7D A;  2AL6 A;  2KDF B;  4GGQ A;  2MBO A;  5L83 A;  3H7P A;  4IM3 A;  3ML8 A;  3ZKJ C;  1WXA A;  1EF5 A;  4ZRK A;  4EUT A;  3R3M A;  3SD5 A;  4KSL C;  2J0J A;  2XK5 A;  2GBM A;  2CU1 A;  3DBS A;  3PHW B;  4NJ6 A;  2LGX A;  5GMV A;  3DOW A;  3RCZ A;  3VFK A;  2L00 B;  2K39 A;  1YQB A;  1GUA B;  2MRP A;  4FAD A;  5IA7 A;  2ASQ A;  3H6N A;  4MM3 A;  2Y5B B;  4A3O A;  1LQB A;  2MWS B;  5E6P A;  1IYF A;  4IWP A;  4BKT A;  3ZNH B;  5DPT A;  2MX2 A;  3IFW B;  3KYD D;  4PYU A;  4CO7 A;  3AU5 A;  3K9O B;  4W9H A;  1V81 A;  3WAN A;  3M62 B;  2M17 A;  5D6J B;  3W1S C;  4F1S A;  3VUW A;  2RSU A;  4F8C B;  1UD7 A;  5IAA C;  3W1S A;  4K7U A;  1WXM A;  4ANX A;  2ZEQ A;  1V80 A;  2KHW B;  2GBJ A;  4KVG B;  3PRZ A;  4MGI E;  2KOX A;  4AJY B;  4IWO A;  2DEN B;  3DVN V;  5J2R A;  2KXJ A;  2KMA A;  2BGF A;  3PS6 A;  4ZDV A;  3NZU A;  1WZ3 A;  1TBE A;  1WGH A;  2DYO A;  1RFA A;  1V6E A;  1WF9 A;  2J0M A;  2K1F A;  3LJ3 A;  3QAQ A;  4NAW B;  2D10 A;  1EF1 A;  2BYV E;  5JZE B;  4MH0 E;  3HK0 A;  3ZO5 B;  1ZKH A;  2ZVN A;  4II3 B;  4MGZ E;  3KUD B;  2LZ6 A;  5D7G A;  4EKU A;  1WIA A;  2N9E B;  2Z0E B;  2JWZ A;  1ISN A;  2DZI A;  2Z59 B;  4WQO B;  1T0Y A;  3JYU A;  3VH3 B;  5DPS A;  2JUO A;  3PPA A;  3Q3J A;  3OLM D;  2IO3 B;  4IG7 B;  3VTV A;  3L10 B;  4K7S A;  2AWT A;  1E8X A;  3N3K B;  4FJY A;  3BIN A;  3PRP B;  2K25 A;  1P9D U;  2MBE A;  3PLU A;  2V3S A;  3UQA A;  4M0W B;  4MSM B;  1TZ1 A;  4DHZ B;  1LFD A;  1TGZ B;  2PE9 A;  2RPQ A;  2IBI B;  2V1Y A;  3QIJ A;  4NAW A;  5G2N A;  2KWU B;  2M4N A;  1WMH B;  1VD2 A;  2R2O A;  1H4R A;  2WDT B;  4B9K A;  4HVB A;  1Q1O A;  3RUL A;  4AOF A;  4ANV A;  3M3J A;  3QCA A;  2MQJ A;  2N7E A;  4HPM B;  4MEL A;  1GC7 A;  1WRD B;  4JLC A;  1QZE A;  4EZK A;  2LAS A;  2BKF A;  4DWF A;  1XD3 B;  2KDI A;  2O6V B;  2JZZ A;  3H9D A;  3EEC A;  1S3S G;  1WJ6 A;  3QA8 A;  2K6Q A;  4NPN A;  2IO1 B;  1EUV B;  2G3Q B;  1UZX B;  5JHA A;  3GOE A;  3L16 A;  5KHO A;  4BOS C;  4FA6 A;  4TKN A;  5AZF A;  1WM2 A;  3CMM B;  4HK2 A;  4CHK A;  5JHB A;  1WMH A;  3S2A A;  2HJ8 A;  3R7R A;  1YX5 B;  1J8C A;  2KWC A;  4J6I A;  1WYW B;  2WWZ A;  3SDL C;  3PGE A;  1G6J A;  3R7Q A;  2C5L C;  5CHW A;  2DAJ A;  2MP2 B;  3IHP C;  1WXS A;  4G50 A;  1NI2 A;  1UBQ A;  4AP4 C;  1EO6 A;  2BPS A;  4BBN C;  4EEW A;  2O6V A;  5DCN A;  3SHQ A;  2MBB B;  2JRI B;  5J18 A;  1WJU A;  1P3Q U;  3A9K B;  3K9P B;  4FHK A;  3UIP B;  3W1Y A;  4A20 A;  3OJ4 B;  2D07 B;  3M63 B;  2KX3 A;  3QAR A;  4G3X B;  2A4Z A;  1J19 A;  2KK8 A;  3IVF A;  1KLV A;  3A4S C;  1U4A A;  2BKR B;  4HCP B;  3NOB A;  1E90 A;  1X1M A;  2IYD B;  5AZG A;  2WX1 A;  3RZW C;  3CF6 E;  2C60 A;  5LLI A;  4TQ1 A;  2BYF A;  4CYE A;  5CHF A;  1L7Y A;  1C1Y B;  2GMI C;  3VUY A;  4AJW A;  2DZM A;  3C0R B;  1XT9 B;  4W9I A;  4KSK C;  2GBK A;  2MP2 A;  3GZN I;  2DYM A;  2QHO A;  5AZH A;  4E3C A;  1UH6 A;  1Z5S B;  2ZZP B;  1WY8 A;  2RGF A;  4PS8 A;  3PLV A;  1P98 A;  2JVC A;  4IM0 A;  2M8S A;  3ZNZ B;  3A9K A;  2RR9 A;  3QX1 A;  3AUL A;  3RUI B;  3AI5 A;  2KFK B;  3AXC A;  3TMP B;  1P1A A;  1WH3 A;  2M1M A;  3PRE A;  4IC7 B;  4K1R B;  3L17 A;  2KJH B;  2L0T A;  4OVV A;  4W9C A;  3HIZ A;  4GN1 A;  3T9L A;  4ASW C;  2N9P C;  4DHJ D;  1GG3 A;  3MJW A;  1WE6 A;  3PZD A;  1WGG A;  4BKS D;  5FR6 A;  1L2N A;  2HTH A;  2O2V B;  4II2 B;  3VHT C;  4FJV B;  3ECI A;  2C7M B;  3EC8 A;  4GOC A;  2OJR A;  3PV1 A;  2BF8 B;  2ZPN A;  2L8J A;  4TV3 A;  1E5W A;  3H1U A;  3QQ8 B;  4LDT B;  1WZ0 A;  3VDZ A;  2JRH A;  3NZS A;  1WFY A;  3KH0 A;  4LJP B;  5E6N A;  2L3Z A;  1LM8 B;  3R66 C;  4HLE A;  1R4M I;  2DYB A;  2LUE A;  2IO2 B;  3KYC D;  5BO4 B;  3ZTD A;  2KFK A;  4KZC A;  1GNU A;  2FCQ A;  1WX9 A;  4RM8 A;  1GC6 A;  3WA0 A;  2G45 B;  2N7D A;  4W9K A;  2EMT A;  5LXH A;  2I1J A;  1WI0 A;  2D3G A;  2O6V D;  3A1Q B;  2IZV B;  1Z2M A;  2PE6 B;  2CHW A;  3ZLZ A;  3NS8 A;  2KTR B;  3V61 A;  3ALB A;  2GBR A;  4HDO A;  2O2V A;  1TTN A;  1KM7 A;  4G11 A;  1Y8R C;  2RD0 A;  3A33 B;  1WJ4 A;  2FCN A;  2KDE B;  3JVZ X;  3L0W B;  3QWZ B;  2KQ7 A;  3RT3 B;  4PS7 A;  2KZR A;  1UGM A;  1WJN A;  3KUZ A;  2MW5 A;  3H7S A;  1E7V A;  3VVW B;  4W9D A;  4AUQ C;  4W9L A;  3V6E B;  2DX5 B;  2WYQ A;  1RAX A;  2N1W A;  3JW0 X;  2KVR A;  4KDI C;  1V2Y A;  3VH4 B;  4E71 A;  4WAA A;  4EZL A;  2YVC A;  3L13 A;  2KQS A;  2Z0D B;  4KDL B;  3D32 A;  5DPR A;  2J7Q B;  2JT4 B;  4RM9 A;  4MJS B;  3A1Q A;  2KO3 A;  4IW0 A;  2KC2 A;  1WXV A;  2I1K A;  4W9E A;  3I3T B;  4GDK B;  3UIN B;  2ZCB A;  1P0R A;  2KTR A;  2K8B A;  2FID A;  2AL3 A;  3DCG A;  3IBE A;  3ZRF A;  2YLM A;  2LGY A;  4ZRJ A;  2MA9 B;  3V60 A;  4M8M A;  4HWI B;  2KFJ A;  2KX0 A;  4GXB A;  4P7I A;  4M8N A;  2KTF A;  3NHE B;  2CS4 A;  3ENE A;  3A9J B;  3AU4 A;  4JIO U;  4NNJ B;  4WWN A;  4WWO A;  1SIF A;  2IY0 B;  3JSV B;  3QK0 A;  3WAP A;  1RRB A;  2K6D B;  2XBB C;  4ANW A;  2LRU A;  1J0G A;  3P2B A;  2FAZ A;  4ANU A;  4GB9 A;  4DDG D;  5D2M B;  4IUM B;  3DQV A;  1C3T A;  3DDC B;  1V9J A;  3EHV A;  4MJS A;  4B95 A;  3ZDT A;  2DHZ A;  3UIO B;  3VTU A;  2KLG A;  4GDK A;  3CSF A;  3U8Z A;  5JH5 C;  5TR5 A;  3TIX A;  4BKG A;  3HM3 A;  3ZW3 A;  2KWV B;  4W9J A;  4YL8 A;  4ICU A;  4B6W A;  1YIW A;  3B1L X;  3OAW A;  4MSQ B;  2N4F A;  4BFR A;  2CHX A;  2KAN A;  1JRU A;  3WAL A;  2AYO B;  2FUH B;  2KKC A;  4MDK E;  3A4R A;  2D2Q A;  3VUX A;  2NR2 A;  4GIV A;  3A9J A;  3RD2 A;  3JSV A;  1OEY J;  1NDD A;  3DBH I;  5C1Z A;  2FCM A;  3HM6 X;  2DAF A;  1AAR A;  4XZ4 A;  4JQW C;  3QJZ A;  4IM2 A;  2MLB A;  4FBJ B;  2NCN A;  1CMX B;  1D3Z A;  3PTF C;  1V5T A;  4KZ0 A;  4HCN B;  2IO0 B;  4W9G A;  2JZ3 B;  4HDQ A;  2N1V A;  1SGH A;  1E8Y A;  2K8C A;  4WJN A;  2HD5 B;  2PJH A;  4MEM A;  3ZIM A;  2KJR A;  3U30 A;  2JF5 A;  3L54 A;  4XC2 A;  5CX3 A;  1RLF A;  3DBL I;  4I6P A;  4AWJ A;  3BY4 B;  3PSE B;  4GDL B;  3LDZ E;  1PQS A; 
#chains in the Genus database with same CATH topology
 2MSE D;  3VXW A;  4URK A;  2ZW0 A;  5L95 C;  1Q5W B;  1FNV A;  4ZRI A;  2DLB A;  3UQB A;  3ML9 A;  1S1Q B;  4YTM B;  3RFZ B;  3M95 A;  2ZPY A;  2VZK B;  2DNF A;  1MPE A;  5CTR C;  1DYQ A;  4EOY A;  3E56 A;  2HE7 A;  1WE7 A;  1SE2 A;  4FLH A;  4KGS A;  1VR9 A;  2WXP A;  4NJ7 A;  1E8Z A;  4TUU A;  4JWU C;  4PYZ A;  3APC A;  3PHX B;  1HTQ A;  1J7B A;  1R4N B;  1WR1 A;  2WXG A;  3Q2A C;  1FXT B;  3MC9 A;  1FNU A;  1WX7 A;  1HTO A;  2BT6 A;  2BS4 B;  3PO0 A;  3GE8 C;  1I35 A;  4G0N B;  2AQ3 B;  3DVN U;  2LD9 A;  1OEY A;  2L05 A;  4AS1 A;  1I4G A;  1T5X D;  1EU3 A;  4JL9 A;  2WXF A;  2NPT B;  2G4D B;  2OJW A;  3MFG A;  3OJ3 A;  5CHV C;  5TSS A;  2KD0 A;  1TZO A;  2EKE C;  2N9K A;  3Q6B A;  1GAQ B;  2NVU I;  1KFY B;  2H88 B;  2ZJD A;  1SJE D;  5I4D A;  1IP9 A;  3ZTC A;  1CK1 A;  4LCD E;  1K8R B;  1I4X A;  2CHZ A;  1E7U A;  3ZJV A;  1C77 A;  3KW5 B;  4NQK E;  2WX0 A;  2M19 A;  1QKZ A;  3MTN B;  4WJP A;  2IND C;  4PT5 A;  2NPT A;  3TEW A;  3B08 A;  4MGK E;  1ZGU B;  1WGY A;  2MHJ A;  2IGD A;  2ZCC A;  3X23 A;  2KN5 A;  2SAK A;  4WJQ A;  2C7H A;  3N20 C;  3I9V 1;  4OW0 A;  2LVO A;  1L5P A;  3AEA B;  5BYR A;  3AEE B;  2N7J A;  2KNB A;  4IWQ A;  2GBN A;  1YX6 B;  4JPS A;  2D5G A;  4ACF A;  2ZNV C;  1IGD A;  4LJO B;  3P4S B;  3ONS A;  4BVU C;  4KIK B;  2VZK D;  1XLN A;  2KDM A;  2Y5P A;  5KHQ A;  2M56 B;  2V3P A;  3B0A A;  4N9F 4;  3UI3 A;  4BBN F;  4FUL A;  4YWG G;  3AEB B;  3FIL B;  3GZN B;  3LYY A;  3E9S A;  3GS2 A;  3RNB C;  4LNN A;  2L32 A;  1M94 A;  2D11 A;  4PS3 A;  4OVU A;  4MM3 B;  4KIK A;  4LNK A;  3V6C B;  1FCL A;  3R2T A;  1TYG B;  1PGA A;  5EDS A;  3N32 A;  2XEW A;  1DOX A;  4GGQ A;  5L83 A;  3FIL A;  4ZRK A;  2IPK D;  1ZDX A;  5H8Y E;  1NI3 A;  3SD5 A;  1C76 A;  3PHW B;  5GMV A;  3VFK A;  3DOW A;  1YQB A;  1GUA B;  2ASQ A;  4MM3 A;  2B76 B;  2Y5B B;  2MWS B;  5E6P A;  1SEB D;  1HQR D;  1MJD A;  2MX2 A;  2ON8 A;  3EA6 A;  4CO7 A;  1ENF A;  3W1S C;  4F1S A;  2RSU A;  3Q3N C;  1V80 A;  2VH2 A;  4KVG B;  1FPY A;  1ACC A;  2DEN B;  2KXJ A;  1FD6 A;  1WZ3 A;  1FFU A;  1EWY C;  1WGH A;  3B2F A;  1V6E A;  1WF9 A;  2J0M A;  2K1F A;  3QAQ A;  2BYV E;  4YSY B;  4II3 B;  2N9E B;  1JRP A;  1ISN A;  3VH3 B;  2JUO A;  3Q3J A;  4IG7 B;  3VTV A;  5C3J B;  1E8X A;  1YN5 A;  1JWB D;  2V3S A;  3UQA A;  2PE9 A;  2IBI B;  5G2N A;  4HVB A;  2WDT B;  5LNK 1;  3ZYY X;  4DXG A;  1SF0 A;  2OHF A;  1WRD B;  1QZE A;  2JYT A;  4EZK A;  2BKF A;  4DWF A;  1XD3 B;  2O6V B;  4P1C C;  3EEC A;  1S3S G;  4NPN A;  5H92 C;  3DBH B;  3SR6 A;  1C4C A;  4ITK A;  3BYT B;  3L16 A;  1Q10 A;  2JU6 X;  4TKN A;  1WM2 A;  1RWS A;  4HK2 A;  5FK9 C;  4CHK A;  2KWC A;  1JWM D;  2LHE A;  2GI9 A;  2I2Y A;  5CHW A;  1TS2 A;  2MP2 B;  3IT4 B;  4G50 A;  1NI2 A;  2CJN A;  3EUB 2;  2BPS A;  2O6V A;  2JRI B;  5J18 A;  4WH4 A;  1P3Q U;  4FHK A;  3K9P B;  3UIP B;  3W1Y A;  4A20 A;  2D07 B;  4BZA A;  3M63 B;  2KX3 A;  3VRB B;  2A4Z A;  1UWM A;  3IVF A;  4ARI A;  2QCZ A;  3R2I A;  2LMC A;  3CF6 E;  1L4Z B;  2C60 A;  1VZ6 A;  4S0R A;  1XLQ A;  2DZM A;  1JWU D;  3P1M A;  2MP2 A;  1T6B X;  1UH6 A;  1Z5S B;  4E3C A;  1HEZ E;  2KN4 A;  2G1E A;  2MJE A;  2RGF A;  2JVC A;  3ZNZ B;  2M8S A;  2RR9 A;  3RUI B;  3AI5 A;  3AXC A;  1P1A A;  2H89 B;  1YJJ A;  4OVV A;  1FRR A;  3T9L A;  4DHJ D;  1E9M A;  1WE6 A;  3ZXR A;  2OJR A;  3PV1 A;  4TV3 A;  3H1U A;  3QQ8 B;  4LDT B;  1WFY A;  4LJP B;  2L3Z A;  4HLE A;  3KYC D;  3ZTD A;  1SE3 A;  2FCQ A;  1BML C;  2WNM A;  4RM8 A;  3WA0 A;  5IKC M;  2G45 B;  2N7D A;  2EMT A;  1JRO A;  5LXH A;  2O6V D;  3A1Q B;  4K3B A;  1EWC A;  2PE6 B;  2CHW A;  1TS3 A;  3ALB A;  4C4V B;  4HDO A;  1Y8R C;  3L0W B;  2FCN A;  1FCC C;  2KQ7 A;  3RT3 B;  4PS7 A;  1NVI D;  1UGM A;  4TSS A;  3KUZ A;  2MW5 A;  1E7V A;  3RNC C;  1RAX A;  2KVR A;  1V2Y A;  2QMT A;  4IDI A;  4C00 A;  4E71 A;  4EZL A;  2YVC A;  3L13 A;  2Z0D B;  1LGR A;  2J7Q B;  4LLG M;  4RM9 A;  4MJS B;  3A1Q A;  2KC2 A;  5T8I A;  3UIN B;  2ZCB A;  2K8B A;  2FID A;  4C4V A;  3TUO A;  4C7Z A;  2LGY A;  2KFJ A;  4P7I A;  4NAM A;  2KTF A;  3NHE B;  4MH8 A;  1FIQ A;  3AU4 A;  5G5H A;  3NVZ A;  1SIF A;  4WWO A;  3ZGZ A;  1FFV A;  3P2B A;  2FAZ A;  3SEB A;  5D2M B;  3DQV A;  4B95 A;  4MJS A;  5BMI A;  3ZDT A;  3UIO B;  1T3Q A;  1A70 A;  3CSF A;  3LB8 C;  3U8Z A;  2RDH A;  4W9J A;  4ICU A;  4HKZ E;  3FKY A;  3OAW A;  1MFW A;  3Q14 C;  4RH6 A;  3A4R A;  3I57 A;  2TSS A;  3ZXV A;  2R61 A;  1NDD A;  4JWS C;  3VRA B;  2J42 A;  3HM6 X;  4XZ4 A;  4JQW C;  4XYC A;  4IM2 A;  1CMX B;  2Y5C A;  1XXG A;  3PTF C;  1D3Z A;  2N1V A;  3GP7 A;  1E8Y A;  2HD5 B;  3N1Z C;  1TY2 A;  4C56 C;  1L6V A;  4KGT A;  4XDD A;  3BY4 B;  1SBB B;  1WM3 A;  1I4H A;  1Q0W B;  5LXI B;  1ZXH A;  1OGW A;  2KC1 A;  2MH7 A;  4EFO A;  1K51 A;  4HPL B;  5G55 A;  1AW7 A;  3V3X A;  1XQQ A;  4E74 A;  1MHX A;  3VQI A;  2GOW A;  1OQY A;  4RGO S;  3RI7 C;  3O13 A;  4MGY E;  2LJ5 A;  1E8W A;  4I6L B;  2FNJ B;  3ZJT A;  5FKA C;  2JXT A;  1MI0 A;  2KJ6 A;  2PVG C;  1V5O A;  2HDE A;  4B0M A;  2MJD A;  1LXD A;  3QC8 B;  5AEK B;  1NYQ A;  2NS5 A;  2WDQ B;  3DPD A;  2LVQ A;  1R7S A;  3PRM B;  1I42 A;  3TJP A;  2NTS A;  3ZQ4 A;  2LXC A;  2UU7 A;  3TBL D;  2PW9 A;  4HJG E;  1MG4 A;  1L4D B;  1UEL A;  2N9X A;  3VTW A;  4A8X C;  1ZDV A;  1V97 A;  3X0W A;  2L7R A;  1VZ7 A;  1M4V A;  2C9W B;  3ZUN A;  3KUC B;  3ZNI D;  1NBF C;  2L52 A;  2UYZ B;  2OOB B;  1TY0 A;  4HPP A;  3R8B A;  5G5G A;  2QIL A;  2MCN B;  4CQN A;  2REX A;  3VAW A;  4FJZ A;  3UF8 A;  2JY6 A;  3MHS D;  1I4Q A;  3WIM A;  1V86 A;  1F2R I;  1CJE A;  1WX8 A;  3HVD A;  3N1Y C;  4WWM A;  5AUK A;  1BT0 A;  3KWV A;  4KGR A;  3AE7 B;  3DVG Y;  2WGS A;  4XDC A;  3T8M A;  1GB1 A;  3KVF B;  4I6N B;  3TL5 A;  5MPO A;  1ZW7 A;  2WLB A;  1F0Z A;  2LWP A;  1IPG A;  1Y56 A;  4S17 A;  1SE4 A;  2L0F A;  2INN E;  4ZYN A;  2KDB A;  1SSN A;  2MBO A;  4IM3 A;  2IDY A;  4XGA B;  4WQM A;  1WXA A;  1EF5 A;  4EUT A;  2J0J A;  2GBM A;  2CU1 A;  3DBS A;  4NJ6 A;  3RCZ A;  2LGX A;  2L00 B;  2K39 A;  5IA7 A;  3EGR A;  4A3O A;  1IYF A;  2OED A;  4IWP A;  4BKT A;  2WU2 B;  5DPT A;  3IFW B;  1YJI A;  4B0E A;  1V81 A;  3WAN A;  5D6J B;  3FC4 A;  1FXA A;  5IAA C;  1MHH E;  1YQ3 B;  3ABV B;  1WXM A;  4ANX A;  2KVZ A;  3PRZ A;  2KOX A;  1MVK A;  5EE0 A;  2KMA A;  3PS6 A;  3NZU A;  1I7H A;  5BMH A;  3MJ5 A;  4HEA 1;  1E0Z A;  3ZO5 B;  1ZKH A;  2ZVN A;  3KUD B;  2LZ6 A;  4EKU A;  1WIA A;  5AUI A;  2Z0E B;  2DZI A;  2Z59 B;  4WQO B;  2JX5 A;  2IO3 B;  2INC C;  3L10 B;  3N3K B;  2VH1 A;  3BIN A;  3PRP B;  4XE0 A;  5EE9 A;  1P9D U;  2MBE A;  4NJC A;  4MSM B;  4DHZ B;  2LGS A;  1L0Y B;  3EFC A;  1LFD A;  2RPQ A;  1UNS A;  2V1Y A;  3QIJ A;  3AE4 B;  2KWU B;  2M4N A;  3NVW A;  5EE3 A;  1C4P A;  3M3J A;  1UWX A;  1PGB A;  1QQR A;  3BZD B;  4HPM B;  4MEL A;  2BYT A;  1D5M C;  3P4Q B;  1KH0 A;  2KDI A;  2K6Q A;  4FXC A;  4LTU A;  1EUV B;  3TSS A;  3GOE A;  5KHO A;  4FA6 A;  5AZF A;  4YSX B;  3CMM B;  3KLS X;  5JHB A;  3S2A A;  2JYE A;  2LJI A;  1WYG A;  4J6I A;  1WYW B;  1BUI C;  3PGE A;  1OFF A;  1TKY A;  2C5L C;  3TEZ A;  5BYQ A;  4AP4 C;  1DGJ A;  2MBB B;  4A55 A;  4RF0 A;  2J52 A;  1SIJ A;  2X38 A;  4G3X B;  4LNI A;  1J19 A;  4A9A A;  1HXY D;  1X1M A;  2EEL A;  2WX1 A;  3RZW C;  1J7A A;  2BYF A;  4CYE A;  5CHF A;  1C1Y B;  3VUY A;  4AJW A;  2K0P A;  3C0R B;  1XT9 B;  2DYM A;  4PS8 A;  1P98 A;  4IM0 A;  3QX1 A;  2WXH A;  3TMP B;  2M1M A;  1WH3 A;  2AX5 A;  3L17 A;  5HG2 A;  2L0T A;  5C2T B;  3AED B;  3PZ8 A;  3MHZ A;  1JQ4 A;  2JSV X;  3IAS 1;  2M0A A;  5GXG B;  2O2V B;  3ECI A;  2C7M B;  2ZPN A;  2L8J A;  5HI1 A;  2JRH A;  5E6N A;  3KH0 A;  1E6E B;  3R66 C;  2CU3 A;  1D6E C;  1GNU A;  2N9L A;  2YEP F;  4GLS C;  1WX9 A;  1F77 A;  1WI0 A;  1Z2M A;  3BII D;  1WRI A;  3NS8 A;  3V61 A;  2GBR A;  2O2V A;  1TTN A;  1KM7 A;  2RD0 A;  1WJ4 A;  3JVZ X;  2KDE B;  1DOY A;  3QWZ B;  2WXR A;  1WJN A;  4HKQ A;  4W9D A;  4W9L A;  3V6E B;  2K22 A;  5IN7 A;  3NVV A;  1XCQ L;  2FUG 1;  3NJT A;  5DPR A;  3NRZ A;  2HJ1 A;  4H2A A;  2KO3 A;  2WHI A;  2JQR B;  4W9E A;  3W9C B;  3DCG A;  2DBY A;  1GOZ A;  4MAC A;  1I4R A;  2JWU A;  2MA9 B;  4QAY A;  4PK1 A;  2QDF A;  3C8Y A;  2WU5 B;  4GXB A;  3WAP A;  2IY0 B;  1RRB A;  2LRU A;  1J0G A;  4GB9 A;  4DDG D;  3DDC B;  1QOA A;  5TR5 A;  2BS2 B;  3RPF C;  2KWV B;  4YL8 A;  4B6W A;  1YIW A;  3DBL B;  4MSQ B;  1JRU A;  1NEK B;  2AQ1 B;  2KAN A;  2NR2 A;  1OEY J;  1F52 A;  1N62 A;  5C1Z A;  3MP9 A;  3T3O A;  1AAR A;  1YNT E;  2V4I B;  4M02 A;  2BTE A;  2NCN A;  2IO0 B;  3MC8 A;  1FEH A;  4XWT A;  1PDX A;  2K8C A;  1B1Z A;  1C79 A;  2PMV A;  1ZXI A;  2D3B A;  2PJH A;  4MEM A;  3AE1 B;  4Q2J A;  2KAJ A;  1TT5 B;  3U30 A;  3L54 A;  5CX3 A;  2K5P A;  3Q69 A;  4I6P A;  4DQO C;  3PSE B;  2W82 A;  3LDZ E;  2MBH A;  4NY0 A;  4YTP B;  1ZOY B;  1WR6 E;  3L4P A;  1VLB A;  2BB6 A;  2QSD A;  1WGR A;  1WGD A;  3BVZ A;  4RMA A;  3U7Z A;  4A90 A;  1V1O A;  2CR5 A;  5E6O A;  1LO5 D;  3WAO A;  1YMH E;  2RDG A;  1V49 A;  4ZOH C;  1OQR A;  1F9J A;  1FRD A;  4RFB A;  4FN2 A;  3RNE C;  5D3D A;  3PVL A;  2MEK A;  2K9X A;  4K81 A;  4EZJ A;  4MT5 A;  4L2Y A;  1BXT A;  3PT2 B;  3B9J A;  1L6U A;  1CQV A;  3WAM A;  3NY5 A;  2NBU A;  4RGT A;  3TCA A;  1HE8 A;  4WJO A;  3V62 A;  3Q3F A;  4YXD B;  4DXA B;  1XO3 A;  3L08 A;  3LXF A;  5E6J A;  2J0K A;  4M01 A;  2WXK A;  4LNO A;  2V4L A;  1R4N I;  4W9F A;  4YT0 B;  3NZ3 A;  2LHD A;  2B3A A;  3EFU A;  1FNW A;  2UWQ A;  3N30 A;  3AM9 A;  2LRW A;  3GB1 A;  2IGG A;  1TS5 A;  4KV2 A;  2IGH A;  1STE A;  1OTR B;  3NS1 A;  1UF0 A;  3DWG C;  4TMA B;  5J17 A;  2ZW1 A;  3QHT A;  3ZRC A;  4FHJ A;  1YN4 A;  3UGB B;  2IJ0 A;  1XEE A;  1T0Q C;  4GSW A;  4BKS A;  3SU8 X;  1A5R A;  4OHJ A;  2DZJ A;  3KQ4 A;  1P7E A;  4REZ A;  4N58 A;  2BYE A;  4J3O D;  4JGH B;  1ET6 A;  2JZP A;  3RNG C;  2WXL A;  4C80 A;  2ZVO A;  3H7P B;  4LDT D;  4A3P A;  2IY1 B;  2Z8L A;  3NUH B;  3HHM A;  2PTL A;  4IOI E;  3DHH C;  3W2D A;  4GMV A;  1MG8 A;  1V1P B;  1VCB A;  3O65 B;  3U7D A;  4HRS A;  3AE9 B;  1NEN B;  3H7P A;  4C7Y A;  2ACZ B;  3ML8 A;  3R3M A;  4KSL C;  1TS4 A;  3W5V B;  1KRH A;  4ZHP A;  2PIA A;  2MRP A;  3H6N A;  2WDV B;  3AE2 B;  3ZNH B;  2BS3 B;  4UDU C;  4PYU A;  3AU5 A;  3K9O B;  2QJL A;  3M62 B;  3VUW A;  4ARC A;  3CIR B;  1XLP A;  1UD7 A;  4K7U A;  2WXJ A;  2ZEQ A;  1FM0 D;  2KWD A;  4P16 A;  3ZJU A;  3U52 E;  4AJY B;  4ZDV A;  2DYO A;  1RFA A;  3LJ3 A;  4NAW B;  3HK0 A;  5D7G A;  3HRD D;  1T0Y A;  3JYU A;  5DPS A;  3SFD B;  3OLM D;  2PVO D;  2AWT A;  3HVZ A;  3H8H A;  4M0W B;  1TZ1 A;  1QOG A;  4NAW A;  1JAL A;  3BVG A;  1VD2 A;  2R2O A;  1H4R A;  3RUL A;  4AOF A;  2J4X A;  4ANV A;  1WGK A;  1N5W A;  1CZP A;  1AWD A;  1GC7 A;  5IP4 D;  2LAS A;  1QOB A;  1WJ6 A;  2LEK A;  3QA8 A;  4ZYS A;  4M0W A;  4P6V F;  4BOS C;  1KLU D;  3KWL A;  4RGM A;  2HJ8 A;  3R7R A;  3N9Y C;  2WWZ A;  1E7P B;  3R7Q A;  1VJK A;  3AE8 B;  1UBQ A;  4KKI A;  4USA A;  1EO6 A;  4BBN C;  4EEW A;  3VR8 B;  3A9K B;  4WIP A;  3OJ4 B;  2GLS A;  3QAR A;  2BW2 A;  2KK8 A;  1KLV A;  3A4S C;  1K50 A;  1U4A A;  1SXT A;  2BKR B;  1KLG D;  1E90 A;  3AE5 B;  3BK1 A;  1RM6 C;  5LLI A;  1ZUD 2;  3AEF B;  4TQ1 A;  1L7Y A;  2GMI C;  3AMZ A;  4W9I A;  5IOI A;  1WY8 A;  2QEJ C;  1C9F A;  3PLV A;  3A9K A;  1YOV B;  2AQ2 B;  3PRE A;  4IC7 B;  2QC8 A;  4GN1 A;  2N9P C;  1GG3 A;  3MJW A;  2X8X X;  3PZD A;  2WXM A;  2KYW A;  1C4A A;  1F1H A;  3N1X C;  3IXS A;  4RCO A;  4FJV B;  1D4B A;  5EE1 A;  1E5W A;  1LM8 B;  1R4M I;  2DYB A;  2LUE A;  2IO2 B;  3BWU D;  2D3A A;  5BO4 B;  1ESF A;  4KZC A;  4W9K A;  2I1J A;  3Q8C A;  2IZV B;  1I4P A;  3ZLZ A;  3I5J C;  3IT6 B;  3J9C A;  4L23 A;  1WWT A;  3H7S A;  2Q5W D;  2WYQ A;  2N1W A;  4US8 A;  3JW0 X;  1TIF A;  3U2S C;  3P63 A;  2KQS A;  4KDL B;  1EM7 A;  2DWQ A;  3D32 A;  4IW0 A;  2I1K A;  3I3T B;  2EKI A;  2GB1 A;  3ZRF A;  3AE3 B;  3IBE A;  4D2K A;  1D5X C;  4L1B A;  4RF1 A;  4M8M A;  4HWI B;  1WXQ A;  4O1N A;  2CS4 A;  4NNJ B;  3VR9 B;  3QK0 A;  3Q8F A;  1IBX B;  4OZB A;  4IUM B;  2V0G A;  1V9J A;  2FE8 A;  2PKO A;  1TKG A;  4BKG A;  3HM3 A;  3ZW3 A;  1T0R C;  1F2R C;  3WAL A;  3BK2 A;  2INP E;  2AYO B;  2FUH B;  2KKC A;  4MDK E;  3VUX A;  2V3N A;  4HRO A;  3RD2 A;  1UGJ A;  1IBX A;  2NMQ A;  3AV8 A;  2FCM A;  2DAF A;  2MLB A;  3I63 C;  5HHD G;  4KZ0 A;  1V5T A;  4HDQ A;  4YSZ B;  1SGH A;  4WJN A;  1ZE3 D;  3FAH A;  5JXV A;  1RYJ A;  2KT7 A;  4WUR A;  2JF5 A;  1RLF A;  1XCT L;  1YN3 A;  4AWJ A;  4GDL B;  2WDR B;  2K3U A;  5C23 A;  3ZDM C;  3IG3 A;  2D3C A;  2YEP B;  4XX5 A;  4BOZ B;  1GJZ A;  2NBV B;  1GPX A;  1KF6 B;  3DHI C;  2PEA A;  2RPV A;  2A5U A;  2FCS A;  3IAM 1;  4GDL A;  2E3T A;  3NG0 A;  1SJH D;  2K8H A;  3DBR I;  2LVP A;  3HUI A;  2AEH A;  2G4S A;  2L83 A;  4KX6 B;  3MC0 B;  1SE9 A;  2M0X A;  4IKG A;  4K7W A;  2WXI A;  1YD8 U;  2N0S B;  1H8C A;  2R2Q A;  2LFI A;  3OG5 A;  2JXX A;  3ZNG C;  4M00 A;  3RZF A;  5DPW A;  2PPH A;  4HXD A;  2KMM A;  3APD A;  3RNF C;  5HKH A;  2BWF A;  1HZ5 A;  2RMM A;  4US9 A;  3T3N A;  3CST A;  4LK0 M;  3AN1 A;  1N60 A;  2KMC A;  1PGX A;  5BYS A;  1N61 A;  4ICV A;  1FXI A;  1JW9 D;  2WP9 B;  2WXO A;  2MBQ A;  4DHJ B;  3SFE B;  2PLP A;  1ZPS A;  2C7N B;  2CKH B;  2JPH A;  1N5X A;  2NTT A;  1UUP A;  1AYF A;  4X57 B;  3P4P B;  1P7F A;  2ZNV B;  2W55 A;  2W54 A;  3DVG X;  2ONQ A;  4K3C A;  1YJ1 A;  3DWM A;  1KOT A;  2FIF A;  4WAF A;  3DHG C;  2LGD A;  1UBI A;  4DHZ E;  3AEC B;  4HJK A;  1PUT A;  2L1A A;  3CWI A;  2W3R A;  3Q8A A;  4F7Z A;  4DBG A;  2EMS A;  2HTM E;  2Y3A A;  2XNA C;  2W9N A;  3ZVV A;  1B9R A;  2L76 A;  3APF A;  4OZC A;  2LI5 A;  2VRR B;  5FR3 A;  2NBW B;  5D94 A;  1KJT A;  2BVC A;  3GE3 C;  4NQL B;  4NZL B;  2KLC A;  2XK5 B;  1XF5 L;  4TQ0 A;  2CJO A;  3V05 A;  4DK5 A;  2LXA A;  1V8C A;  3RYT A;  4DDI D;  1HA5 A;  4RNA A;  4GU2 A;  2DZK A;  4WWP A;  2BWE S;  1HZ6 A;  2AL6 A;  2KDF B;  3ZKJ C;  2XK5 A;  1R4M B;  4N59 A;  3TEX A;  2QIE B;  2WQY B;  4FAD A;  2V9H A;  1LQB A;  1SB3 C;  1JCK B;  4KKJ A;  1PYW D;  3KYD D;  3RMK C;  1VDV A;  1VZ8 A;  4W9H A;  5D3I B;  2M17 A;  4F8C B;  3P42 A;  3W1S A;  2KHW B;  2GBJ A;  4MGI E;  4IWO A;  3DVN V;  5J2R A;  2BGF A;  3OWE B;  1TBE A;  3Q8E A;  4BAX A;  2I38 A;  2D10 A;  1EF1 A;  5JZE B;  1K52 A;  4MH0 E;  4ZRQ A;  4MGZ E;  2JWZ A;  4YTN B;  1TKE A;  3PPA A;  3URY A;  4K7S A;  5HFY A;  4FJY A;  1FO4 A;  2K25 A;  2BB5 A;  2KAC A;  2WS3 B;  3PLU A;  2MJ3 A;  1N6Z A;  1TGZ B;  1D5Z C;  1WMH B;  4B9K A;  1Q1O A;  1QLB B;  3QCA A;  2MQJ A;  2N7E A;  1C78 A;  3Q3M C;  2FBW B;  4JLC A;  1L0V B;  3H9D A;  2JZZ A;  3TEY A;  2IO1 B;  1FMA D;  4RGN A;  2G3Q B;  1UZX B;  5JHA A;  1WSP A;  1RFK A;  1WMH A;  3WCQ A;  1YX5 B;  1J8C A;  3SDL C;  1G6J A;  1QIL A;  3Q3O C;  3NVY A;  2DAJ A;  3BVM A;  3IHP C;  1WXS A;  3C19 A;  3SHQ A;  2LUM A;  5DCN A;  1WJU A;  2ICI A;  1IGC A;  1OQQ A;  1VRA B;  4HCP B;  3NOB A;  2IYD B;  5AZG A;  3AH7 A;  1NYR A;  1XLO A;  4OVZ A;  4KSK C;  2GBK A;  3GZN I;  2QHO A;  5AZH A;  2ZZP B;  2RDB C;  4P1B C;  3AUL A;  2KFK B;  1QT9 A;  3ETR A;  3DBR B;  1J7C A;  3AE6 B;  1V1P A;  3P4R B;  4K1R B;  1YQ4 B;  2KJH B;  4W9C A;  3HIZ A;  3RN9 C;  4ZHO A;  4ASW C;  1WGG A;  4BKS D;  1QF6 A;  1EU4 A;  3PZ7 A;  5FR6 A;  1L2N A;  2HTH A;  4II2 B;  1L0X B;  3VHT C;  4GOC A;  3EC8 A;  4XWW A;  2BF8 B;  3VDZ A;  1WZ0 A;  3NZS A;  2KFK A;  3AB5 A;  4EE2 A;  4DXF A;  1GC6 A;  3AEG B;  1K53 A;  2D3G A;  1JML A;  1DOI A;  1ROE A;  2KTR B;  4G11 A;  3A33 B;  1JWS D;  3U4E G;  1AN8 A;  2KZR A;  3VVW B;  4AUQ C;  2DX5 B;  4R3D A;  4KDI C;  4A6Q A;  3VH4 B;  4WAA A;  2SEB D;  2GRI A;  3RNA C;  1QOF A;  1IUE A;  4AQ7 A;  2WXN A;  2WXQ A;  2JT4 B;  2BBC A;  2LGI A;  1WXV A;  4GDK B;  1P0R A;  2KTR A;  5BMG A;  3BYY B;  2AL3 A;  2YLM A;  4LNF A;  4ZRJ A;  3Q8B A;  3V60 A;  2KX0 A;  4M8N A;  4JIO U;  3ENE A;  3A9J B;  4WWN A;  3JSV B;  2K6D B;  2XBB C;  4ANW A;  2G9H D;  4ANU A;  3B2G A;  1KTK A;  1C3T A;  2KQ4 X;  1T0S C;  3EHV A;  2DHZ A;  3VTU A;  2KLG A;  4GDK A;  5JH5 C;  3TIX A;  2W3S A;  4N6E B;  3B1L X;  2N4F A;  4BFR A;  2CHX A;  2XN9 C;  4JX1 C;  2D2Q A;  4GIV A;  1ET9 A;  3A9J A;  1GB4 A;  3JSV A;  4ZRP A;  1TJE A;  3DBH I;  1N63 A;  3QJZ A;  1PFD A;  5IO9 A;  4FBJ B;  1E10 A;  2E6X A;  4HCN B;  4W9G A;  3W5U B;  2JZ3 B;  4JE3 B;  1JWA D;  2BQQ A;  3ZIM A;  2KJR A;  1ZP0 B;  4OZA A;  4XC2 A;  3DBL I;  2J53 A;  1PQS A; 
#chains in the Genus database with same CATH homology
 1WM3 A;  2MSE D;  2MBH A;  3VXW A;  4URK A;  4NY0 A;  5L95 C;  1Q5W B;  1WR6 E;  4ZRI A;  5C23 A;  3UQB A;  1Q0W B;  3ZDM C;  3ML9 A;  1S1Q B;  5LXI B;  2KC1 A;  1OGW A;  3IG3 A;  2ZPY A;  3M95 A;  4EFO A;  4XX5 A;  1WGR A;  1WGD A;  4BOZ B;  5CTR C;  4HPL B;  4RMA A;  5G55 A;  4EOY A;  1GJZ A;  2NBV B;  1XQQ A;  4E74 A;  2HE7 A;  1WE7 A;  2CR5 A;  2PEA A;  5E6O A;  3VQI A;  4FLH A;  2GOW A;  3WAO A;  1OQY A;  2A5U A;  2FCS A;  1V49 A;  4GDL A;  4NJ7 A;  4MGY E;  2LJ5 A;  1E8Z A;  1E8W A;  1F9J A;  4I6L B;  2FNJ B;  2K8H A;  3DBR I;  4TUU A;  4FN2 A;  2LVP A;  2AEH A;  4PYZ A;  3APC A;  3PHX B;  2G4S A;  2KJ6 A;  3PVL A;  1WR1 A;  1FXT B;  1V5O A;  1SE9 A;  4K81 A;  1WX7 A;  2M0X A;  4EZJ A;  1LXD A;  1I35 A;  3QC8 B;  4G0N B;  3PT2 B;  4K7W A;  1YD8 U;  5AEK B;  1H8C A;  3DVN U;  2R2Q A;  2LD9 A;  1OEY A;  3WAM A;  3NY5 A;  2JXX A;  2NS5 A;  3DPD A;  3ZNG C;  2L05 A;  3RZF A;  2NBU A;  2LVQ A;  4JL9 A;  5DPW A;  3TCA A;  1HE8 A;  2NPT B;  2PPH A;  4WJO A;  3V62 A;  3PRM B;  3Q3F A;  4HXD A;  1I42 A;  2G4D B;  3APD A;  3OJ3 A;  2BWF A;  4DXA B;  5HKH A;  5CHV C;  2KD0 A;  3CST A;  3TJP A;  2KMC A;  2EKE C;  2NVU I;  3L08 A;  2LXC A;  2J0K A;  2ZJD A;  4ICV A;  1IP9 A;  3TBL D;  3ZTC A;  2V4L A;  1R4N I;  4LCD E;  2MBQ A;  4DHJ B;  4W9F A;  1K8R B;  2CHZ A;  1UEL A;  1E7U A;  2C7N B;  2CKH B;  2N9X A;  3KW5 B;  3VTW A;  2JPH A;  2B3A A;  3EFU A;  4NQK E;  2WX0 A;  2UWQ A;  4X57 B;  3MTN B;  3N30 A;  3X0W A;  2L7R A;  4WJP A;  2LRW A;  2ZNV B;  2C9W B;  3ZUN A;  2NPT A;  3B08 A;  4MGK E;  1ZGU B;  4KV2 A;  1WGY A;  3KUC B;  2ZCC A;  3X23 A;  3DVG X;  3ZNI D;  1NBF C;  1OTR B;  2KN5 A;  4WJQ A;  2C7H A;  1YJ1 A;  1KOT A;  2UYZ B;  2LVO A;  2OOB B;  5J17 A;  2FIF A;  3QHT A;  2KNB A;  2MCN B;  4FHJ A;  2LGD A;  3ZRC A;  1UBI A;  4IWQ A;  4DHZ E;  2GBN A;  4HJK A;  3UGB B;  1YX6 B;  2REX A;  3VAW A;  4FJZ A;  3UF8 A;  4GSW A;  4BKS A;  2JY6 A;  3MHS D;  3SU8 X;  1A5R A;  2ZNV C;  3WIM A;  4LJO B;  3ONS A;  4BVU C;  2DZJ A;  1V86 A;  4KIK B;  4F7Z A;  4DBG A;  2EMS A;  2W9N A;  2BYE A;  3ZVV A;  5KHQ A;  1WX8 A;  3B0A A;  4N9F 4;  2L76 A;  4JGH B;  3APF A;  4BBN F;  4FUL A;  1BT0 A;  2LI5 A;  2ZVO A;  3H7P B;  2VRR B;  4LDT D;  4A3P A;  2NBW B;  3DVG Y;  5D94 A;  2IY1 B;  1KJT A;  3T8M A;  3HHM A;  4NQL B;  2KLC A;  2XK5 B;  4TQ0 A;  3KVF B;  4I6N B;  3TL5 A;  4DK5 A;  2LXA A;  1ZW7 A;  1M94 A;  2D11 A;  3RYT A;  4PS3 A;  4DDI D;  4OVU A;  4GU2 A;  2LWP A;  1IPG A;  2DZK A;  4GMV A;  2L0F A;  1MG8 A;  4KIK A;  1VCB A;  4WWP A;  2BWE S;  3V6C B;  5EDS A;  3N32 A;  4ZYN A;  2KDB A;  2XEW A;  3O65 B;  3U7D A;  2AL6 A;  2KDF B;  4GGQ A;  2MBO A;  5L83 A;  3H7P A;  4IM3 A;  3ML8 A;  3ZKJ C;  1WXA A;  1EF5 A;  4ZRK A;  4EUT A;  3R3M A;  3SD5 A;  4KSL C;  2J0J A;  2XK5 A;  2GBM A;  2CU1 A;  3DBS A;  3PHW B;  4NJ6 A;  2LGX A;  5GMV A;  3DOW A;  3RCZ A;  3VFK A;  2L00 B;  2K39 A;  1YQB A;  1GUA B;  2MRP A;  4FAD A;  5IA7 A;  2ASQ A;  3H6N A;  4MM3 A;  2Y5B B;  4A3O A;  1LQB A;  2MWS B;  5E6P A;  1IYF A;  4IWP A;  4BKT A;  3ZNH B;  5DPT A;  2MX2 A;  3IFW B;  3KYD D;  4PYU A;  4CO7 A;  3AU5 A;  3K9O B;  4W9H A;  1V81 A;  3WAN A;  3M62 B;  2M17 A;  5D6J B;  3W1S C;  4F1S A;  3VUW A;  2RSU A;  4F8C B;  1UD7 A;  5IAA C;  3W1S A;  4K7U A;  1WXM A;  4ANX A;  2ZEQ A;  1V80 A;  2KHW B;  2GBJ A;  4KVG B;  3PRZ A;  4MGI E;  2KOX A;  4AJY B;  4IWO A;  2DEN B;  3DVN V;  5J2R A;  2KXJ A;  2KMA A;  2BGF A;  3PS6 A;  4ZDV A;  3NZU A;  1WZ3 A;  1TBE A;  1WGH A;  2DYO A;  1RFA A;  1V6E A;  1WF9 A;  2J0M A;  2K1F A;  3LJ3 A;  3QAQ A;  4NAW B;  2D10 A;  1EF1 A;  2BYV E;  5JZE B;  4MH0 E;  3HK0 A;  3ZO5 B;  1ZKH A;  2ZVN A;  4II3 B;  4MGZ E;  3KUD B;  2LZ6 A;  5D7G A;  4EKU A;  1WIA A;  2N9E B;  2Z0E B;  2JWZ A;  1ISN A;  2DZI A;  2Z59 B;  4WQO B;  1T0Y A;  3JYU A;  3VH3 B;  5DPS A;  2JUO A;  3PPA A;  3Q3J A;  3OLM D;  2IO3 B;  4IG7 B;  3VTV A;  3L10 B;  4K7S A;  2AWT A;  1E8X A;  3N3K B;  4FJY A;  3BIN A;  3PRP B;  2K25 A;  1P9D U;  2MBE A;  3PLU A;  2V3S A;  3UQA A;  4M0W B;  4MSM B;  1TZ1 A;  4DHZ B;  1LFD A;  1TGZ B;  2PE9 A;  2RPQ A;  2IBI B;  2V1Y A;  3QIJ A;  4NAW A;  5G2N A;  2KWU B;  2M4N A;  1WMH B;  1VD2 A;  2R2O A;  1H4R A;  2WDT B;  4B9K A;  4HVB A;  1Q1O A;  3RUL A;  4AOF A;  4ANV A;  3M3J A;  3QCA A;  2MQJ A;  2N7E A;  4HPM B;  4MEL A;  1GC7 A;  1WRD B;  4JLC A;  1QZE A;  4EZK A;  2LAS A;  2BKF A;  4DWF A;  1XD3 B;  2KDI A;  2O6V B;  2JZZ A;  3H9D A;  3EEC A;  1S3S G;  1WJ6 A;  3QA8 A;  2K6Q A;  4NPN A;  2IO1 B;  1EUV B;  2G3Q B;  1UZX B;  5JHA A;  3GOE A;  3L16 A;  5KHO A;  4BOS C;  4FA6 A;  4TKN A;  5AZF A;  1WM2 A;  3CMM B;  4HK2 A;  4CHK A;  5JHB A;  1WMH A;  3S2A A;  2HJ8 A;  3R7R A;  1YX5 B;  1J8C A;  2KWC A;  4J6I A;  1WYW B;  2WWZ A;  3SDL C;  3PGE A;  1G6J A;  3R7Q A;  2C5L C;  5CHW A;  2DAJ A;  2MP2 B;  3IHP C;  1WXS A;  4G50 A;  1NI2 A;  1UBQ A;  4AP4 C;  1EO6 A;  2BPS A;  4BBN C;  4EEW A;  2O6V A;  5DCN A;  3SHQ A;  2MBB B;  2JRI B;  5J18 A;  1WJU A;  1P3Q U;  3A9K B;  3K9P B;  4FHK A;  3UIP B;  3W1Y A;  4A20 A;  3OJ4 B;  2D07 B;  3M63 B;  2KX3 A;  3QAR A;  4G3X B;  2A4Z A;  1J19 A;  2KK8 A;  3IVF A;  1KLV A;  3A4S C;  1U4A A;  2BKR B;  4HCP B;  3NOB A;  1E90 A;  1X1M A;  2IYD B;  5AZG A;  2WX1 A;  3RZW C;  3CF6 E;  2C60 A;  5LLI A;  4TQ1 A;  2BYF A;  4CYE A;  5CHF A;  1L7Y A;  1C1Y B;  2GMI C;  3VUY A;  4AJW A;  2DZM A;  3C0R B;  1XT9 B;  4W9I A;  4KSK C;  2GBK A;  2MP2 A;  3GZN I;  2DYM A;  2QHO A;  5AZH A;  4E3C A;  1UH6 A;  1Z5S B;  2ZZP B;  1WY8 A;  2RGF A;  4PS8 A;  3PLV A;  1P98 A;  2JVC A;  4IM0 A;  2M8S A;  3ZNZ B;  3A9K A;  2RR9 A;  3QX1 A;  3AUL A;  3RUI B;  3AI5 A;  2KFK B;  3AXC A;  3TMP B;  1P1A A;  1WH3 A;  2M1M A;  3PRE A;  4IC7 B;  4K1R B;  3L17 A;  2KJH B;  2L0T A;  4OVV A;  4W9C A;  3HIZ A;  4GN1 A;  3T9L A;  4ASW C;  2N9P C;  4DHJ D;  1GG3 A;  3MJW A;  1WE6 A;  3PZD A;  1WGG A;  4BKS D;  5FR6 A;  1L2N A;  2HTH A;  2O2V B;  4II2 B;  3VHT C;  4FJV B;  3ECI A;  2C7M B;  3EC8 A;  4GOC A;  2OJR A;  3PV1 A;  2BF8 B;  2ZPN A;  2L8J A;  4TV3 A;  1E5W A;  3H1U A;  3QQ8 B;  4LDT B;  1WZ0 A;  3VDZ A;  2JRH A;  3NZS A;  1WFY A;  3KH0 A;  4LJP B;  5E6N A;  2L3Z A;  1LM8 B;  3R66 C;  4HLE A;  1R4M I;  2DYB A;  2LUE A;  2IO2 B;  3KYC D;  5BO4 B;  3ZTD A;  2KFK A;  4KZC A;  1GNU A;  2FCQ A;  1WX9 A;  4RM8 A;  1GC6 A;  3WA0 A;  2G45 B;  2N7D A;  4W9K A;  2EMT A;  5LXH A;  2I1J A;  1WI0 A;  2D3G A;  2O6V D;  3A1Q B;  2IZV B;  1Z2M A;  2PE6 B;  2CHW A;  3ZLZ A;  3NS8 A;  2KTR B;  3V61 A;  3ALB A;  2GBR A;  4HDO A;  2O2V A;  1TTN A;  1KM7 A;  4G11 A;  1Y8R C;  2RD0 A;  3A33 B;  1WJ4 A;  2FCN A;  2KDE B;  3JVZ X;  3L0W B;  3QWZ B;  2KQ7 A;  3RT3 B;  4PS7 A;  2KZR A;  1UGM A;  1WJN A;  3KUZ A;  2MW5 A;  3H7S A;  1E7V A;  3VVW B;  4W9D A;  4AUQ C;  4W9L A;  3V6E B;  2DX5 B;  2WYQ A;  1RAX A;  2N1W A;  3JW0 X;  2KVR A;  4KDI C;  1V2Y A;  3VH4 B;  4E71 A;  4WAA A;  4EZL A;  2YVC A;  3L13 A;  2KQS A;  2Z0D B;  4KDL B;  3D32 A;  5DPR A;  2J7Q B;  2JT4 B;  4RM9 A;  4MJS B;  3A1Q A;  2KO3 A;  4IW0 A;  2KC2 A;  1WXV A;  2I1K A;  4W9E A;  3I3T B;  4GDK B;  3UIN B;  2ZCB A;  1P0R A;  2KTR A;  2K8B A;  2FID A;  2AL3 A;  3DCG A;  3IBE A;  3ZRF A;  2YLM A;  2LGY A;  4ZRJ A;  2MA9 B;  3V60 A;  4M8M A;  4HWI B;  2KFJ A;  2KX0 A;  4GXB A;  4P7I A;  4M8N A;  2KTF A;  3NHE B;  2CS4 A;  3ENE A;  3A9J B;  3AU4 A;  4JIO U;  4NNJ B;  4WWN A;  4WWO A;  1SIF A;  2IY0 B;  3JSV B;  3QK0 A;  3WAP A;  1RRB A;  2K6D B;  2XBB C;  4ANW A;  2LRU A;  1J0G A;  3P2B A;  2FAZ A;  4ANU A;  4GB9 A;  4DDG D;  5D2M B;  4IUM B;  3DQV A;  1C3T A;  3DDC B;  1V9J A;  3EHV A;  4MJS A;  4B95 A;  3ZDT A;  2DHZ A;  3UIO B;  3VTU A;  2KLG A;  4GDK A;  3CSF A;  3U8Z A;  5JH5 C;  5TR5 A;  3TIX A;  4BKG A;  3HM3 A;  3ZW3 A;  2KWV B;  4W9J A;  4YL8 A;  4ICU A;  4B6W A;  1YIW A;  3B1L X;  3OAW A;  4MSQ B;  2N4F A;  4BFR A;  2CHX A;  2KAN A;  1JRU A;  3WAL A;  2AYO B;  2FUH B;  2KKC A;  4MDK E;  3A4R A;  2D2Q A;  3VUX A;  2NR2 A;  4GIV A;  3A9J A;  3RD2 A;  3JSV A;  1OEY J;  1NDD A;  3DBH I;  5C1Z A;  2FCM A;  3HM6 X;  2DAF A;  1AAR A;  4XZ4 A;  4JQW C;  3QJZ A;  4IM2 A;  2MLB A;  4FBJ B;  2NCN A;  1CMX B;  1D3Z A;  3PTF C;  1V5T A;  4KZ0 A;  4HCN B;  2IO0 B;  4W9G A;  2JZ3 B;  4HDQ A;  2N1V A;  1SGH A;  1E8Y A;  2K8C A;  4WJN A;  2HD5 B;  2PJH A;  4MEM A;  3ZIM A;  2KJR A;  3U30 A;  2JF5 A;  3L54 A;  4XC2 A;  5CX3 A;  1RLF A;  3DBL I;  4I6P A;  4AWJ A;  3BY4 B;  3PSE B;  4GDL B;  3LDZ E;  1PQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...