5D94A

Crystal structure of lc3-lir peptide complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
KTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title FYCO1 Contains a C-terminally Extended, LC3A/B-preferring LC3-interacting Region (LIR) Motif Required for Efficient Maturation of Autophagosomes during Basal Autophagy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/peptide
total genus 36
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5d94A00
2EMSA 2ZJDA 3APDA 3VQIA 1WGRA 2CS4A 2KNBA 3PRPB 3WAMA 2LVPA 1WXAA 3L08A 4II3B 1P1AA 3DVNV 5IAAC 2O2VA 1KM7A 1WYWB 2ZPYA 4HLEA 2N9XA 2LUEA 1NBFC 1E8WA 2UYZB 4TKNA 2LZ6A 2YVCA 4DHZE 2KWCA 2ZEQA 2LVOA 2FNJB 1V6EA 4HWIB 4WWNA 4ICUA 2JPHA 2BYEA 2N7EA 2GBJA 2WX0A 4ZYNA 1P0RA 2DHZA 1WE6A 2HE7A 2JY6A 3PZDA 3TJPA 4DHZB 4J6IA 3IBEA 3TL5A 3SHQA 2KMCA 4DBGA 1S3SG 3JYUA 2PPHA 3CF6E 2LJ5A 3IVFA 4YL8A 5GMVA 4B6WA 2KDEB 4BKTA 4N9F4 4JLCA 4MGYE 1SGHA 4ANUA 4PYZA 3D32A 2DX5B 2KZRA 1TTNA 1U4AA 4LJOB 4TQ0A 4JIOU 4HJKA 5D7GA 4K81A 2C7NB 4LCDE 3DVNU 4NAWB 3S2AA 4ZRKA 1RLFA 4M8MA 2WYQA 3NS8A 3RT3B 4PS7A 2HTHA 3QA8A 3ZDMC 3KUZA 4KZCA 3UIOB 4AJWA 5AEKB 2AL3A 3R7QA 3WAOA 2MP2B 4KIKA 2KC2A 3U8ZA 1ZKHA 2G4SA 3JVZX 4W9CA 3PVLA 4DXAB 2LXCA 5LXIB 2ZNVC 4F1SA 2GBRA 3UINB 4B9KA 1MG8A 4MGKE 4G3XB 1WJ4A 4W9DA 1E90A 3L17A 4PS8A 3CSTA 2RD0A 2KFKA 4FHKA 5LXHA 3ZW3A 2KQSA 1R4NI 3AU4A 3PRZA 4HVBA 5E6OA 2M0XA 1WM2A 4RMAA 5JH5C 2NS5A 1M94A 2A4ZA 2NVUI 2K1FA 4BBNF 4KVGB 3AI5A 3ZNGC 1C3TA 2JUOA 1E5WA 1WGGA 4A3OA 4W9JA 1WH3A 2EKEC 4AP4C 4MSMB 4K1RB 1WMHA 3IG3A 1E8YA 1YD8U 2Y5BB 2L0FA 1YX6B 2L0TA 5JHBA 4XZ4A 4PS3A 1SE9A 3PGEA 2KX0A 2DAFA 4I6LB 2N1VA 3QC8B 5D94A 4IWQA 2JWZA 3DBRI 4MEMA 2KDIA 3C0RB 4FADA 3PREA 5KHQA 4HCPB 3B1LX 2A5UA 2JXXA 4FJZA 5G55A 2NPTB 3N3KB 3CMMB 3L0WB 3ZNID 2L05A 4E74A 2DENB 5DPSA 1H4RA 3NY5A 3ZVVA 1F9JA 1QZEA 3PV1A 2AWTA 2KDFB 2KDBA 2KQ7A 4IWOA 2FIDA 3PLVA 3NZSA 5CHFA 2PEAA 4MSQB 3V6CB 1V5TA 5CTRC 2KLCA 4JQWC 4E3CA 5IA7A 2MQJA 1GC7A 3VUWA 1JRUA 1LM8B 2LGYA 2C5LC 2G3QB 1TGZB 2YLMA 4ANXA 1OQYA 4I6PA 3TIXA 3DBLI 4BBNC 2C7MB 3H1UA 3H6NA 1EF1A 2IO1B 4TUUA 4W9KA 2RPQA 4FLHA 2KFJA 3VTWA 2KN5A 3DDCB 2RSUA 2MLBA 4BOSC 3N32A 2BKRB 5CHWA 4W9FA 3EECA 2M1MA 4DHJB 1ZGUB 3WIMA 2ZVOA 3HM3A 2KTRA 3AULA 2CU1A 5DPWA 3L54A 4W9LA 5JHAA 2KK8A 4IM3A 4ZRIA 4KDLB 1V9JA 1WY8A 2GOWA 1S1QB 5J18A 3OJ4B 2HJ8A 4NJ6A 2J0JA 4HDQA 4F7ZA 1UZXB 2MA9B 3SDLC 3UQAA 3T9LA 2G4DB 3DBSA 3H7PA 3TBLD 4ZDVA 1IYFA 1P9DU 2UWQA 1BT0A 4EFOA 3PHWB 2KMAA 4BVUC 1Z5SB 1E8XA 1WR6E 2D2QA 3RZWC 4EZKA 3TCAA 2JF5A 2XK5A 3VHTC 1IP9A 3UF8A 5KHOA 2K8CA 1UELA 2L00B 1TZ1A 4WJPA 2KLGA 3QARA 4FA6A 5C1ZA 2L3ZA 3RZFA 1G6JA 3A9JA 3LJ3A 4LJPB 2NR2A 1ISNA 1XQQA 3GZNI 4CO7A 5E6NA 2BYFA 1L2NA 3IFWB 2NBWB 2MBEA 1AARA 4IWPA 3HM6X 3ONSA 4KV2A 4K7WA 4BKSA 4GDLB 2BKFA 4HCNB 2MW5A 3VXWA 3DVGY 2WX1A 3WAPA 5D6JB 3M95A 2KFKB 4HXDA 2MBOA 1R4MI 3RD2A 1WR1A 1WX9A 4WJNA 5FR6A 2GMIC 3Q3FA 2DYMA 3VUYA 4MJSA 5JZEB 3V62A 3MTNB 1EO6A 4FJVB 2N9EB 4EUTA 3TMPB 2IZVB 5AZFA 1E8ZA 4OVVA 2ZPNA 1UBIA 3RULA 5DPRA 3PSEB 4GGQA 4JGHB 4ZRJA 4AOFA 2MBQA 4WJQA 3SD5A 1Y8RC 2O6VD 2MBHA 4MGZE 1VD2A 2ZCCA 1RFAA 4FN2A 2LASA 2AYOB 4NAWA 1WF9A 2I1KA 1V81A 3ML8A 1V49A 1LFDA 4GDKA 2DYOA 2O6VB 4RM8A 3QCAA 5DPTA 5AZGA 3M3JA 1XT9B 2BPSA 3BINA 1EUVB 2KTFA 1YIWA 4BFRA 4EOYA 3A1QA 3PHXB 4DDGD 4F8CB 3AXCA 3Q3JA 2CR5A 1UGMA 2MRPA 2MBBB 2Z0EB 2JRIB 3APFA 3ZLZA 4NY0A 3VVWB 4TV3A 5J2RA 4OVUA 2LI5A 3NZUA 2DAJA 2JZ3B 4I6NB 1WXVA 3PLUA 3ZRCA 2GBMA 3KH0A 1Q1OA 4GOCA 3R7RA 3V61A 2N4FA 5DCNA 3OLMD 1WX7A 3CSFA 2N7DA 1I42A 2MX2A 3A9KA 1K8RB 2KD0A 4IG7B 4JL9A 3R66C 3DQVA 1D3ZA 2MCNB 2V4LA 3ZUNA 2FCNA 2HD5B 3L10B 1J19A 1L7YA 1WJ6A 2CHXA 3JSVA 2KVRA 2R2OA 3ML9A 2G45B 1YQBA 4GIVA 2MWSB 4ASWC 1WXMA 5J17A 3GOEA 2KJ6A 2KANA 4MH0E 4W9GA 2CKHB 2K6QA 3NHEB 3V60A 3PTFC 4CHKA 4W9IA 4EZLA 3RCZA 2R2QA 2C7HA 2M17A 3VFKA 4GSWA 1KOTA 1WJNA 1ZW7A 2KWVB 2KTRB 3W1YA 1GUAB 3ZRFA 2K39A 2FIFA 5G2NA 3ZNHB 2IO2B 1FXTB 1RAXA 1PQSA 2QHOA 2OOBB 1NDDA 4KDIC 2D10A 1UH6A 3B08A 3UGBB 2V3SA 3VDZA 1GJZA 3U7DA 1J0GA 2IO3B 3PRMB 3HIZA 1P98A 4URKA 3ECIA 2WWZA 4II2B 2O2VB 3KVFB 4CYEA 2BWES 4HPLB 4MDKE 5C23A 2D07B 4GMVA 4G50A 3KUDB 3MJWA 2LGDA 4GXBA 4M8NA 2D3GA 2DZMA 3EHVA 3H7PB 3O65B 4FJYA 5E6PA 1E7UA 5EDSA 3QX1A 2BYVE 1NI2A 2CHZA 1GG3A 2XEWA 2LD9A 2ZCBA 3H9DA 4HPMB 5L95C 2XK5B 4K7UA 2LRWA 1WX8A 4BKSD 4WJOA 4GN1A 2CHWA 2IYDB 2DZKA 3AU5A 2DZIA 4MGIE 4EZJA 3PPAA 1V5OA 5TR5A 4DK5A 2M4NA 3WA0A 1V2YA 2JVCA 3DPDA 4BOZB 2V1YA 3QJZA 4NNJB 3HK0A 1KJTA 2WDTB 2LWPA 4TQ1A 2IBIB 3VTUA 3QWZB 3UIPB 4FHJA 3OJ3A 1A5RA 3K9OB 4DWFA 4EKUA 4EEWA 2L8JA 1VCBA 4KIKB 4M0WB 2KX3A 4ANWA 4FBJB 4G0NB 2N1WA 2BF8B 2C9WB 3NOBA 4KSKC 4MJSB 3T8MA 3W1SA 4DDID 2GBKA 1WGYA 4G11A 2W9NA 2KXJA 5CHVC 3ZTDA 4IUMB 4RM9A 2KJRA 2K8BA 2NCNA 1E7VA 3QK0A 2K8HA 4WWPA 4WQOB 5CX3A 5AZHA 3LDZE 2ZVNA 2KJHB 2KHWB 4MM3A 3DCGA 3ZO5B 2KOXA 4KZ0A 2OJRA 2VRRB 3B0AA 3I3TB 4IW0A 3RYTA 3KYCD 1V86A 1WGDA 1WMHB 3ZIMA 2I1JA 3QAQA 2REXA 4K7SA 5HKHA 1OEYA 4XX5A 3EC8A 2IY1B 3H7SA 4GDKB 4ANVA 1WE7A 3EFUA 1WZ3A 4WWOA 2L76A 3KW5B 2FCSA 3WANA 3ZDTA 1YJ1A 2RR9A 3A1QB 4AWJA 4KSLC 1LXDA 1WFYA 4GB9A 3VTVA 1RRBA 1GC6A 4B95A 3ENEA 3OAWA 2BWFA 4GDLA 3VUXA 2ASQA 3L16A 4IC7B 4HDOA 4X57B 2DYBA 3KUCB 2IO0B 1WIAA 3DOWA 4XC2A 3A4RA 4E71A 3SU8X 2MP2A 1J8CA 3PS6A 5D2MB 1V80A 2J0MA 3R3MA 5BO4B 3A9KB 1C1YB 3DVGX 2L7RA 3U30A 2ZZPB 2Z0DB 2DZJA 1WGHA 1LQBA 4IM2A 1EF5A 3JSVB 4IM0A 2KO3A 3RUIB 1GNUA 2ZNVB 3VH3B 1WXSA 2LRUA 3MHSD 3A4SC 1YX5B 3ZKJC 2Z59B 4W9HA 3DBHI 1WRDB 2BGFA 4W9EA 1WI0A 4HK2A 1TBEA 1P3QU 1WJUA 2IY0B 4PYUA 4LDTD 1Q0WB 3P2BA 1XD3B 3L13A 3HHMA 2FUHB 3QIJA 1OTRB 3PT2B 2O6VA 2J7QB 2LVQA 5LLIA 3UQBA 1WM3A 4A3PA 2B3AA 2D11A 1CMXB 2J0KA 2K6DB 3K9PB 4LDTB 4NJ7A 2FCMA 2KKCA 2M8SA 1I35A 1T0YA 4WAAA 2RGFA 2NPTA 3IHPC 2XBBC 3VAWA 2EMTA 4BKGA 1Z2MA 2MSED 2AEHA 2PE9A 2JT4B 2C60A 1H8CA 3X23A 2KWUB 2LXAA 1KLVA 4A20A 1X1MA 2NBVB 4AUQC 4DHJD 4FULA 3BY4B 2JRHA 2AL6A 2PE6B 4GU2A 4P7IA 2N9PC 1HE8A 3ZTCA 1WZ0A 3ALBA 4ICVA 4NPNA 2LGXA 3W1SC 3QQ8B 3N30A 3WALA 3KYDD 1OEYJ 1OGWA 2FCQA 3VH4B 1UD7A 1IPGA 2K25A 3QHTA 4MELA 3M63B 2NBUA 3JW0X 5L83A 2FAZA 3X0WA 3A9JB 4AJYB 1SIFA 3V6EB 1UBQA 2GBNA 2KC1A 3A33B 3APCA 3ZNZB 2JZZA 4NQKE 3M62B 4NQLB 1Q5WB 2PJHA
chains in the Genus database with same CATH superfamily
2CS4A 2KNBA 1VRAB 3WAMA 3DVNV 5IAAC 1WYWB 2HDEA 1FCCC 1J7CA 1YQ4B 4HKQA 1I4RA 1V1PA 2JPHA 3RNCC 2GBJA 1TS2A 2HE7A 4DHZB 2KQ4X 3TL5A 3SHQA 3PO0A 1S3SG 2PPHA 3CF6E 1K50A 3IVFA 4N9F4 4ANUA 2DX5B 2KWDA 1MJDA 4ZRQA 3R2IA 3S2AA 4ZRKA 4M8MA 4PS7A 2BTEA 3ZDMC 3UIOB 2OEDA 2MP2B 2G4SA 4W9CA 4DXAB 2Y5PA 3UINB 1MG8A 2K3UA 4JPSA 1E90A 1GPXA 1ENFA 5IP4D 5LXHA 1R4NI 3PRZA 2K22A 5H92C 1WM2A 2NS5A 1M94A 2NVUI 2JUOA 1E5WA 1WGKA 4A3OA 2ZW0A 3IG3A 1E8YA 4A6QA 2JU6X 4CQNA 2L0FA 4RGTA 2DAFA 1BXTA 2IJ0A 3I57A 4I6LB 2N1VA 5D94A 4O1NA 4HROA 3C0RB 4FADA 3PREA 3AEAB 4FJZA 2IGHA 3ZNID 2WXKA 3FC4A 2DENB 2AWTA 2KDBA 2FIDA 2KT7A 3NZSA 2PEAA 1D4BA 3V6CB 1V5TA 5IA7A 3W5UB 1JRUA 1J7AA 1LM8B 2LHEA 2YLMA 1N5WA 1A70A 1OQYA 3TIXA 4BBNC 2C7MB 1EF1A 2IO1B 3VTWA 2KN5A 3DDCB 1GOZA 3N32A 4W9FA 4DHJB 3WIMA 2W82A 3L54A 4IM3A 3KLSX 3EFCA 2GOWA 1K52A 4Q2JA 4HDQA 1FFUA 1UZXB 2RPVA 2MA9B 3SDLC 3P63A 3MC0B 3T9LA 2G4DB 3TBLD 1SE3A 4ZDVA 3B2GA 1P9DU 1M4VA 2KMAA 1Z5SB 4REZA 2MJ3A 3VHTC 4HJGE 3UF8A 2N7JA 1OFFA 2KLGA 5C1ZA 4YXDB 3RZFA 2RDBC 1G6JA 3DBLB 4XWWA 3RPFC 1ISNA 1XQQA 3GZNI 4CO7A 2BYFA 4IWPA 4KV2A 2OHFA 5EE0A 4DXFA 2MBOA 1R4MI 1WR1A 4WJNA 3VUYA 1DYQA 4MJSA 1YOVB 3V62A 4S17A 3MTNB 1FNUA 3Q69A 4A90A 5AZFA 3V3XA 3TSSA 3PSEB 3IAM1 4GGQA 4ZRJA 2MBQA 3C19A 2MHJA 4A55A 2MBHA 1MHHE 1VD2A 3IT4B 1RFAA 4FN2A 2LASA 4TSSA 1PUTA 3PZ7A 3NVVA 3ZXVA 2GB1A 1NENB 2ONQA 2KYWA 2O6VB 3QCAA 1AN8A 3M3JA 5AUIA 4EOYA 1EUVB 1UGMA 1HQRD 2MBBB 5G5GA 3R2TA 4RGNA 3NZUA 4KKJA 3KH0A 1Q1OA 2N4FA 5DCNA 3KWVA 5G5HA 5C3JB 3GE3C 1F1HA 3P1MA 5BMHA 4RCOA 3ZUNA 1L7YA 3JSVA 3ML9A 5HKHA 2KVRA 2G45B 3Q8AA 3UI3A 4ASWC 5J17A 2KJ6A 2KANA 4W9GA 2R61A 4HKZE 3PTFC 2BT6A 1JALA 3W5VB 3RCZA 5BMIA 2M17A 1ROEA 1GUAB 2K39A 5G2NA 3ZNHB 4IOIE 1T3QA 4QAYA 1C9FA 4KDIC 2D10A 3VDZA 2V3SA 3U7DA 4URKA 4II2B 4CYEA 2VH2A 4G50A 4GXBA 2LGDA 2D3GA 4JWUC 3O65B 3RNFC 2ACZB 4K3CA 2BYVE 2XEWA 3ETRA 4BKSD 2CHWA 2N9LA 2QJLA 3AU5A 1NEKB 3N1ZC 2G9HD 3PPAA 4DK5A 2MJEA 2JVCA 2XNAC 3DPDA 2FUG1 2V1YA 3HUIA 5I4DA 3P4SB 2N0SB 2WDTB 2LWPA 3VTUA 3QWZB 3UIPB 1JWBD 4FHJA 1A5RA 3BK1A 4DWFA 1XCQL 3I63C 1CK1A 4M0WB 4ANWA 4G0NB 4KSKC 3T8MA 4DDID 4KGRA 2WLBA 3U4EG 1LO5D 3ZTDA 2KJRA 1Y56A 2J4XA 3QK0A 5AZHA 1L5PA 4WQOB 2JWUA 2AQ3B 2KJHB 2Y3AA 3DCGA 4KZ0A 4IW0A 3RYTA 3KYCD 1WMHB 1I4GA 1MI0A 1F0ZA 4ANVA 3ZDTA 3WANA 3KW5B 3DHIC 1YJ1A 3A1QB 2V9HA 2WXQA 4KSLC 1WFYA 2WU2B 4GDLA 4IC7B 3E56A 3DOWA 3PS6A 1T0RC 3W2DA 1XLQA 5D2MB 3Q3OC 2J0MA 3R3MA 5BO4B 1C1YB 3DVGX 2L7RA 3N9YC 2Z0DB 1LQBA 4IM2A 4PK1A 1ZUD2 3RUIB 2LRUA 1QOAA 4HK2A 2IY0B 4OZAA 3L13A 3WCQA 3QIJA 4M01A 2J7QB 4RGOS 3UQBA 4A3PA 2B3AA 2J0KA 2KKCA 5GXGB 2M8SA 2CJNA 2NPTA 1IBXA 3BZDB 3RNGC 3IAS1 2JT4B 2FBWB 5FKAC 1CZPA 2MJDA 1KLVA 4AUQC 1C4AA 1SB3C 3BY4B 2JRHA 4P7IA 2LHDA 1HE8A 2N9PC 2LGXA 2BB6A 1RYJA 4MELA 3NZ3A 1E6EB 4XDDA 3FAHA 5L83A 2VZKB 3V6EB 3DBRB 1UBQA 2KC1A 2PVGC 4NQLB 5H8YE 1Q5WB 4II3B 4JX1C 2O2VA 2Z8LA 1NBFC 2LZ6A 2YVCA 3MFGA 2RDGA 2KWCA 2INPE 2LVOA 1V6EA 2WNMA 4ZYNA 2DHZA 2MH7A 2JQRB 3JYUA 2KAJA 4BKTA 5GMVA 2KDEB 4JLCA 4C4VB 3D32A 1E9MA 3I9V1 4XGAB 3QA8A 4KZCA 2AL3A 1L4ZB 4KIKA 3JVZX 1JQ4A 4JWSC 5LXIB 3DHGC 1TKGA 4MGKE 4G3XB 1WJ4A 1WRIA 3L17A 2KFKA 3ZW3A 2KQSA 3ZXRA 3AU4A 4HVBA 4RMAA 1YMHE 5JH5C 2A4ZA 2NTSA 3AI5A 5D3IB 3VRBB 1PGXA 1RFKA 3AE1B 4MSMB 1C4CA 3ZYYX 5JHBA 2KX0A 1Q10A 4YSZB 2KACA 3DBRI 4MEMA 1FD6A 5KHQA 2A5UA 2JXXA 5G55A 3AH7A 3AE8B 5C2TB 4K3BA 5DPSA 3NY5A 3ZVVA 1XXGA 1SSNA 1HTQA 1F9JA 1QOFA 1QZEA 3Q3NC 2LGSA 3PLVA 3FILB 4GLSC 4OW0A 5CHFA 4IKGA 1FMAD 1EWCA 2W55A 2LGYA 4L2YA 3V05A 3BWUD 1T6BX 3H1UA 3NVWA 4TUUA 1DOYA 1IGCA 3MJ5A 1TYGB 1DGJA 3N1YC 2E3TA 2M1MA 2B76B 2V3NA 1TKEA 3AULA 1SBBB 5DPWA 3Q8FA 5JHAA 1V9JA 2JSVX 1S1QB 5J18A 2HJ8A 4NJ6A 3L4PA 2J0JA 1V1PB 5T8IA 4DXGA 1IYFA 3PHWB 4MM3B 1E8XA 2D2QA 2M0AA 4EZKA 2GLSA 3AE4B 3TCAA 1GB4A 2JF5A 1FO4A 2K9XA 1UELA 2L00B 1TZ1A 4WJPA 2L3ZA 2I38A 3A9JA 4N59A 2NR2A 2WXPA 3RI7C 5E6NA 2WXOA 1K53A 3IFWB 2NBWB 2L83A 4K7WA 2NTTA 3TEYA 2MW5A 3VXWA 2WX1A 3WAPA 5D6JB 1B1ZA 2JXTA 3RD2A 4HXDA 3Q3FA 2WHIA 4M02A 1EO6A 1EU4A 3CWIA 2IZVB 1YN3A 4OVVA 2ZPNA 1UBIA 4JE3B 5DPRA 2Y5CA 2WXNA 4WJQA 3SD5A 2O6VD 1I4PA 2AYOB 4C00A 1KRHA 1D5MC 3B2FA 1WF9A 2ZW1A 2I1KA 2JYEA 1LFDA 4GDKA 1V8CA 1YIWA 3BK2A 3GZNB 2CR5A 2Z0EB 4USAA 3APFA 1XF5L 1ET9A 2LI5A 4I6NB 2DAJA 1T5XD 1WXVA 2KDMA 2BYTA 4GOCA 1WX7A 4WURA 1R4MB 1K8RB 2KD0A 2WDVB 1CQVA 2QSDA 4US9A 3R66C 1FPYA 2HD5B 3L10B 2CHXA 2R2OA 3AE5B 1YQBA 4GIVA 1I4HA 2HJ1A 2CKHB 3NHEB 4RF0A 4CHKA 4W9IA 4EZLA 2W54A 1WJNA 1JWSD 3AMZA 3ZRFA 2IO2B 2QHOA 4M00A 4EE2A 1EM7A 3UGBB 1GJZA 3P4PB 2IO3B 1P98A 3ECIA 2WWZA 1YN4A 3LYYA 4FJYA 3QX1A 5IOIA 5EE3A 3H9DA 4WJOA 2IYDB 1NI3A 2DZKA 1D5XC 2DZIA 4EZJA 2QC8A 2M4NA 4KGSA 1V2YA 2GRIA 1MVKA 3QJZA 3IT6B 1KJTA 2WDQB 4TQ1A 1WSPA 2IBIB 4TMAB 4EKUA 4EEWA 1XO3A 1XEEA 2KX3A 4FBJB 1T0SC 3W1SA 2BF8B 3NOBA 4MJSB 2BQQA 2GBKA 1WGYA 2W9NA 1TS5A 5HG2A 4IUMB 4RM9A 1VZ6A 2NCNA 1E7VA 1FXIA 4WWPA 4WAFA 5CX3A 1QQRA 3LDZE 2ZVNA 2KOXA 2OJRA 3I3TB 3NUHB 4ZHPA 1WGDA 3QAQA 1LGRA 2IY1B 3H7SA 3EFUA 1WZ3A 4AWJA 3NRZA 3AECB 4GB9A 3TEXA 1ZDVA 3OAWA 2BWFA 3VUXA 5JXVA 4E71A 1QF6A 4ITKA 5FR3A 3JSVB 2KO3A 1P7EA 3VRAB 1GNUA 3VH3B 1F2RI 3MHSD 1PGBA 1YX5B 2Z59B 5AUKA 4W9HA 1WRDB 2INCC 1BMLC 2BGFA 4YSXB 4RGMA 1WJUA 1OQRA 3RNEC 1Q0WB 1MFWA 2FUHB 3IXSA 2O6VA 4S0RA 1N5XA 2LVQA 1TY0A 3AV8A 2IDYA 2QIEB 3K9PB 2FCMA 3ZJTA 1T0YA 2INDC 2XBBC 4BKGA 2AEHA 2BB5A 1GAQB 2LXAA 3SFEB 2WDRB 1X1MA 3RNBC 4YSYB 2LMCA 1N61A 2WXGA 1ZP0B 3ZTCA 3DWMA 4ICVA 2VZKD 1KLUD 1JROA 3KYDD 1OGWA 2QDFA 2K25A 3QHTA 2RMMA 3M63B 2NBUA 2SEBD 2FAZA 3X0WA 1TJEA 3Q8BA 1L6VA 2EKIA 4NQKE 1JCKB 3EUB2 3NJTA 4YTNB 1FIQA 3X23A 1SE2A 2JYTA 2CU3A 3VQIA 1WGRA 3DHHC 3PRPB 1FM0D 1WXAA 2QEJC 1P1AA 3C8YA 4MT5A 2ZPYA 2LUEA 1E8WA 4TKNA 2DWQA 2ZEQA 2FNJB 4HWIB 4WWNA 3I5JC 2IGDA 2BYEA 2N7EA 2WX0A 1P0RA 3PZDA 2JY6A 5TSSA 4J6IA 1QT9A 3LB8C 1B9RA 2KMCA 4DBGA 3GP7A 1T0QC 3MC8A 2LJ5A 3U7ZA 4YL8A 4MGYE 1SGHA 4YT0B 3BVMA 2KZRA 1FNVA 3GS2A 4JIOU 4HJKA 5D7GA 4K81A 5LNK1 2C7NB 4LCDE 4NAWB 1PDXA 3RT3B 2HTHA 4XWTA 3KUZA 4AJWA 2WXHA 3U8ZA 2KC2A 1ZKHA 1SEBD 3PVLA 4C7ZA 3HVDA 2ZNVC 4B9KA 2L32A 1V97A 2L52A 4W9DA 4PS8A 3CSTA 4FHKA 3P4RB 2PKOA 2E6XA 5E6OA 1I4XA 2M0XA 1R7SA 2BVCA 3MHZA 4W9JA 2EKEC 4AP4C 1WMHA 1D6EC 2D3CA 2QMTA 1YX6B 4OVZA 2L0TA 3U2SC 4XZ4A 4WQMA 2WU5B 3PGEA 4PS3A 3QC8B 4L1BA 4IWQA 2JWZA 1UNSA 2KDIA 2M19A 4HCPB 3B1LX 2NPTB 1IBXB 2AQ2B 3CMMB 4E74A 3RN9C 1H4RA 1KLGD 2BBCA 1IGDA 1STEA 2KDFB 3P4QB 2KQ7A 4IWOA 4MSQB 3EGRA 5CTRC 3Q2AC 4JQWC 1ZXHA 4E3CA 1FCLA 3AEFB 2PTLA 4ANXA 4I6PA 2MEKA 4FLHA 2KFJA 2DLBA 1MG4A 3NG0A 2MLBA 4BOSC 2BKRB 2WS3B 4ZHOA 4D2KA 4MH8A 1VZ7A 3HM3A 2KTRA 2WXLA 2CU1A 2LJIA 2KK8A 4ZRIA 4KDLB 1WY8A 2K0PA 5IKCM 3DBSA 1GB1A 1JMLA 3H7PA 4P6VF 1UGJA 2JZPA 2UWQA 4EFOA 1BT0A 2D3BA 1SJHD 1JWMD 1HA5A 3FKYA 3RZWC 4C56C 2XK5A 3J9CA 2W3SA 5KHOA 2K8CA 4LNKA 3LJ3A 2N9KA 2W3RA 1L2NA 1YJIA 3R8BA 1AARA 3LXFA 3ONSA 4BKSA 1ESFA 4HCNB 1DOIA 3DVGY 3M95A 2KFKB 1N62A 1ET6A 1ZDXA 1WX9A 4OZBA 1WXQA 2GMIC 2DYMA 3ABVB 5JZEB 4FJVB 3ZJVA 3TMPB 1SJED 1E8ZA 2OJWA 1TIFA 1AYFA 1Y8RC 2D3AA 4C4VA 2ZCCA 1EWYC 4LNFA 3SEBA 5EE1A 1HZ6A 3AE6B 5DPTA 4BFRA 2AX5A 1FEHA 2KTFA 3PHXB 3TUOA 3AXCA 3Q3JA 2MRPA 1PFDA 2JRIB 4LK0M 4NY0A 3VVWB 4TV3A 5J2RA 3Q14C 2JZ3B 3GB1A 3PLUA 3V61A 3R7RA 3CSFA 2N7DA 3AE3B 3A9KA 4IG7B 3DQVA 1D3ZA 1HXYD 4H2AA 1J19A 1WJ6A 2BS3B 4MH0E 5BYQA 2IPKD 1WWTA 2K6QA 3ZJUA 2J42A 2DNFA 2C7HA 3VFKA 1NYRA 1FNWA 1KOTA 2KWVB 1VR9A 2FIFA 1FXTB 1UH6A 3B08A 4BZAA 3SFDB 1ACCA 1J0GA 3PRMB 2BWES 4MDKE 4KGTA 2D07B 2D5GA 4GMVA 4M8NA 4OHJA 1C78A 5E6PA 1NI2A 2CHZA 1J7BA 2ZCBA 4HPMB 5L95C 1SF0A 4GN1A 1JW9D 2QILA 2TSSA 2RDHA 2INNE 2QCZA 4MGIE 1E10A 4N6EB 5TR5A 1HTOA 3WA0A 4HEA1 4NNJB 4XE0A 2ON8A 4A9AA 4AS1A 1MHXA 2L8JA 1VCBA 3NVYA 2N1WA 4G11A 1XLPA 1TZOA 3CIRB 2K8BA 4C7YA 2K8HA 2V0GA 2KHWB 1C4PA 4MM3A 3ZO5B 1YJJA 1DOXA 1VZ8A 4YWGG 3PZ8A 4ARIA 2REXA 4K7SA 1OEYA 4XX5A 1QOBA 4GDKB 1WE7A 2L76A 2RR9A 1LXDA 1YQ3B 3VTVA 3ENEA 3L16A 4X57B 4HDOA 3BYTB 3AN1A 1F52A 3KUCB 1WYGA 1WIAA 2YEPF 2V4IB 3A4RA 2MP2A 1J8CA 3AE2B 2PVOD 1V80A 4XYCA 1KH0A 4N58A 3N20C 2ZZPB 1MPEA 2DZJA 1EF5A 3BYYB 4IM0A 4P16A 3O13A 3ZKJC 3DBHI 4KKIA 1P3QU 3P2BA 4YTPB 1XD3B 3HHMA 1D5ZC 1SE4A 2L1AA 1TY2A 4LDTB 4NJ7A 4RNAA 3W9CB 4ARCA 4WAAA 4FXCA 4XDCA 3IHPC 4HPPA 3NS1A 4KX6B 2KWUB 4A8XC 2BS2B 1WZ0A 3ALBA 4NPNA 1L0XB 3QQ8B 3WALA 1OEYJ 3Q8CA 1TS3A 2FCQA 1UD7A 1IPGA 3RMKC 3VR8B 2UU7A 2GI9A 2KVZA 2WXMA 2YEPB 3JW0X 1SIFA 3AB5A 2GBNA 5IN7A 2PJHA 2EMSA 2ZJDA 3APDA 1OQQA 1XLNA 2LVPA 3L08A 2WP9B 1QOGA 2WXIA 1KM7A 1NVID 4ACFA 4HLEA 2N9XA 2UYZB 3AEEB 4DHZE 3GE8C 3SR6A 1VJKA 1I7HA 3Q6BA 3T3OA 4ICUA 1I42A 3TJPA 1WE6A 3IBEA 3BVZA 4B6WA 4ZRPA 4C80A 4PYZA 4LJOB 1TTNA 1U4AA 4TQ0A 4NZLB 3DVNU 1RLFA 2ICIA 2WYQA 3NS8A 2J52A 5AEKB 3R7QA 3WAOA 3Q8EA 1BUIC 4HRSA 3RNAC 1F77A 3ZGZA 5IO9A 2LXCA 4F1SA 2GBRA 2FE8A 2RD0A 2H89B 1C79A 1ZE3D 3BIID 4BBNF 2K1FA 4DQOC 4KVGB 3AEGB 3ZNGC 1C3TA 1WGGA 1WH3A 4K1RB 4P1BC 3TEZA 1YD8U 2Y5BB 1VLBA 1SE9A 1ZXIA 3KWLA 5BMGA 4WWMA 3N3KB 4ZYSA 1RM6C 3L0WB 2L05A 3BVGA 1KTKA 3PV1A 2H88B 1N63A 5HHDG 2V3PA 2KLCA 2MQJA 1GC7A 3VUWA 2C5LC 2G3QB 1TGZB 4L23A 3DBLI 4LTUA 3H6NA 3N1XC 4W9KA 2RPQA 1RWSA 2M56B 2RSUA 5CHWA 1TS4A 5HI1A 2LGIA 3EECA 3U52E 2HTME 3DWGC 1ZGUB 1TKYA 2ZVOA 2WXRA 4W9LA 1XLOA 2Q5WD 3OJ4B 4WH4A 4F7ZA 1L0YB 3AM9A 4LNNA 3UQAA 3KQ4A 3Q3MC 4RFBA 4BVUC 1WR6E 1IP9A 4FA6A 3QARA 4NAMA 1PYWD 4LJPB 4MACA 2MBEA 1AWDA 3HM6X 1E7PB 4GDLB 2BKFA 2PLPA 2WXFA 4IDIA 4LLGM 1KFYB 5FR6A 4M0WA 4YTMB 1SXTA 2CJOA 3E9SA 2N9EB 4EUTA 4B0EA 1FRDA 4RH6A 3RULA 1N60A 4JGHB 4AOFA 1QLBB 4MGZE 4B0MA 1YNTE 3T3NA 1L4DB 3H8HA 4NAWA 3OG5A 5EE9A 4LNOA 1V81A 2X38A 1UF0A 2X8XX 1V49A 3ML8A 2DYOA 4RM8A 2WXJA 5AZGA 1XT9B 2BPSA 3BINA 4F8CB 1I4QA 3A1QA 4DDGD 2BS4B 1JWAD 3ZLZA 4US8A 5MPOA 4OVUA 2BW2A 3ZQ4A 3ZRCA 5E6JA 2GBMA 4R3DA 3OLMD 1L6UA 2SAKA 2PW9A 1FFVA 2MX2A 4JL9A 2MCNB 2V4LA 2FCNA 1UWMA 3AE7B 1C77A 1K51A 2PMVA 2MWSB 1WXMA 3GOEA 4LNIA 3V60A 4BAXA 2R2QA 4GSWA 1ZW7A 2KTRB 3W1YA 1IUEA 1UUPA 1E0ZA 3MC9A 1RAXA 1PQSA 2OOBB 1NDDA 5D3DA 1FRRA 1ZOYB 3HIZA 2DBYA 2O2VB 3KVFB 4HPLB 5C23A 3MP9A 3KUDB 3MJWA 2DZMA 3EHVA 3H7PB 3RFZB 1E7UA 5EDSA 1GG3A 2LD9A 5BYRA 1VDVA 1AW7A 2XK5B 4K7UA 2LRWA 1WX8A 3EA6A 4NJCA 1V5OA 4BOZB 1EU3A 1L0VB 3HK0A 4OZCA 3OJ3A 3K9OB 4KIKB 2WGSA 1PGAA 1CJEA 2C9WB 4ZOHC 1C76A 2KXJA 5CHVC 1JRPA 2KN4A 2VRRB 3B0AA 1HEZE 1V86A 3ZIMA 2I2YA 2K5PA 2I1JA 4J3OD 2G1EA 2LFIA 3P42A 3B9JA 3NVZA 3EC8A 3AEDB 2IGGA 4WWOA 1ZPSA 2FCSA 2LUMA 2PIAA 2KMMA 1RRBA 1GC6A 4B95A 4RF1A 2ASQA 2DYBA 2IO0B 4XC2A 3SU8X 3AEBB 1NYQA 1V1OA 2LEKA 2XN9C 3A9KB 3U30A 2J53A 1WGHA 1QILA 2ZNVB 1WXSA 3A4SC 1UWXA 1N6ZA 4W9EA 1WI0A 5FK9C 3HVZA 1TBEA 4PYUA 2JX5A 4LDTD 3AE9B 3URYA 3HRDD 1OTRB 1SIJA 3PT2B 4PT5A 2NMQA 5LLIA 1WM3A 2D11A 1CMXB 2K6DB 5BYSA 1I35A 1FXAA 2RGFA 2WQYB 1F2RC 3VAWA 2VH1A 2EMTA 1Z2MA 2MSED 2PE9A 2C60A 2AQ1B 1H8CA 1R4NB 3VR9B 4AQ7A 1HZ5A 4A20A 1QKZA 2NBVB 4DHJD 4FULA 3FILA 2AL6A 2PE6B 4GU2A 3OWEB 1KF6B 1TT5B 3W1SC 3N30A 3VH4B 1XCTL 1YN5A 2EELA 3DBHB 1JWUD 1P7FA 5HFYA 4P1CC 3A9JB 4AJYB 4UDUC 4WIPA 3A33B 3APCA 3ZNZB 2JZZA 3TEWA 3M62B
chains in the Genus database with same CATH topology
2EMSA 2ZJDA 3APDA 3VQIA 1WGRA 2CS4A 2KNBA 3PRPB 3WAMA 2LVPA 1WXAA 3L08A 4II3B 1P1AA 3DVNV 5IAAC 2O2VA 1KM7A 1WYWB 2ZPYA 4HLEA 2N9XA 2LUEA 1NBFC 1E8WA 2UYZB 4TKNA 2LZ6A 2YVCA 4DHZE 2KWCA 2ZEQA 2LVOA 2FNJB 1V6EA 4HWIB 4WWNA 4ICUA 2JPHA 2BYEA 2N7EA 2GBJA 2WX0A 4ZYNA 1P0RA 2DHZA 1WE6A 2HE7A 2JY6A 3PZDA 3TJPA 4DHZB 4J6IA 3IBEA 3TL5A 3SHQA 2KMCA 4DBGA 1S3SG 3JYUA 2PPHA 3CF6E 2LJ5A 3IVFA 4YL8A 5GMVA 4B6WA 2KDEB 4BKTA 4N9F4 4JLCA 4MGYE 1SGHA 4ANUA 4PYZA 3D32A 2DX5B 2KZRA 1TTNA 1U4AA 4LJOB 4TQ0A 4JIOU 4HJKA 5D7GA 4K81A 2C7NB 4LCDE 3DVNU 4NAWB 3S2AA 4ZRKA 1RLFA 4M8MA 2WYQA 3NS8A 3RT3B 4PS7A 2HTHA 3QA8A 3ZDMC 3KUZA 4KZCA 3UIOB 4AJWA 5AEKB 2AL3A 3R7QA 3WAOA 2MP2B 4KIKA 2KC2A 3U8ZA 1ZKHA 2G4SA 3JVZX 4W9CA 3PVLA 4DXAB 2LXCA 5LXIB 2ZNVC 4F1SA 2GBRA 3UINB 4B9KA 1MG8A 4MGKE 4G3XB 1WJ4A 4W9DA 1E90A 3L17A 4PS8A 3CSTA 2RD0A 2KFKA 4FHKA 5LXHA 3ZW3A 2KQSA 1R4NI 3AU4A 3PRZA 4HVBA 5E6OA 2M0XA 1WM2A 4RMAA 5JH5C 2NS5A 1M94A 2A4ZA 2NVUI 2K1FA 4BBNF 4KVGB 3AI5A 3ZNGC 1C3TA 2JUOA 1E5WA 1WGGA 4A3OA 4W9JA 1WH3A 2EKEC 4AP4C 4MSMB 4K1RB 1WMHA 3IG3A 1E8YA 1YD8U 2Y5BB 2L0FA 1YX6B 2L0TA 5JHBA 4XZ4A 4PS3A 1SE9A 3PGEA 2KX0A 2DAFA 4I6LB 2N1VA 3QC8B 5D94A 4IWQA 2JWZA 3DBRI 4MEMA 2KDIA 3C0RB 4FADA 3PREA 5KHQA 4HCPB 3B1LX 2A5UA 2JXXA 4FJZA 5G55A 2NPTB 3N3KB 3CMMB 3L0WB 3ZNID 2L05A 4E74A 2DENB 5DPSA 1H4RA 3NY5A 3ZVVA 1F9JA 1QZEA 3PV1A 2AWTA 2KDFB 2KDBA 2KQ7A 4IWOA 2FIDA 3PLVA 3NZSA 5CHFA 2PEAA 4MSQB 3V6CB 1V5TA 5CTRC 2KLCA 4JQWC 4E3CA 5IA7A 2MQJA 1GC7A 3VUWA 1JRUA 1LM8B 2LGYA 2C5LC 2G3QB 1TGZB 2YLMA 4ANXA 1OQYA 4I6PA 3TIXA 3DBLI 4BBNC 2C7MB 3H1UA 3H6NA 1EF1A 2IO1B 4TUUA 4W9KA 2RPQA 4FLHA 2KFJA 3VTWA 2KN5A 3DDCB 2RSUA 2MLBA 4BOSC 3N32A 2BKRB 5CHWA 4W9FA 3EECA 2M1MA 4DHJB 1ZGUB 3WIMA 2ZVOA 3HM3A 2KTRA 3AULA 2CU1A 5DPWA 3L54A 4W9LA 5JHAA 2KK8A 4IM3A 4ZRIA 4KDLB 1V9JA 1WY8A 2GOWA 1S1QB 5J18A 3OJ4B 2HJ8A 4NJ6A 2J0JA 4HDQA 4F7ZA 1UZXB 2MA9B 3SDLC 3UQAA 3T9LA 2G4DB 3DBSA 3H7PA 3TBLD 4ZDVA 1IYFA 1P9DU 2UWQA 1BT0A 4EFOA 3PHWB 2KMAA 4BVUC 1Z5SB 1E8XA 1WR6E 2D2QA 3RZWC 4EZKA 3TCAA 2JF5A 2XK5A 3VHTC 1IP9A 3UF8A 5KHOA 2K8CA 1UELA 2L00B 1TZ1A 4WJPA 2KLGA 3QARA 4FA6A 5C1ZA 2L3ZA 3RZFA 1G6JA 3A9JA 3LJ3A 4LJPB 2NR2A 1ISNA 1XQQA 3GZNI 4CO7A 5E6NA 2BYFA 1L2NA 3IFWB 2NBWB 2MBEA 1AARA 4IWPA 3HM6X 3ONSA 4KV2A 4K7WA 4BKSA 4GDLB 2BKFA 4HCNB 2MW5A 3VXWA 3DVGY 2WX1A 3WAPA 5D6JB 3M95A 2KFKB 4HXDA 2MBOA 1R4MI 3RD2A 1WR1A 1WX9A 4WJNA 5FR6A 2GMIC 3Q3FA 2DYMA 3VUYA 4MJSA 5JZEB 3V62A 3MTNB 1EO6A 4FJVB 2N9EB 4EUTA 3TMPB 2IZVB 5AZFA 1E8ZA 4OVVA 2ZPNA 1UBIA 3RULA 5DPRA 3PSEB 4GGQA 4JGHB 4ZRJA 4AOFA 2MBQA 4WJQA 3SD5A 1Y8RC 2O6VD 2MBHA 4MGZE 1VD2A 2ZCCA 1RFAA 4FN2A 2LASA 2AYOB 4NAWA 1WF9A 2I1KA 1V81A 3ML8A 1V49A 1LFDA 4GDKA 2DYOA 2O6VB 4RM8A 3QCAA 5DPTA 5AZGA 3M3JA 1XT9B 2BPSA 3BINA 1EUVB 2KTFA 1YIWA 4BFRA 4EOYA 3A1QA 3PHXB 4DDGD 4F8CB 3AXCA 3Q3JA 2CR5A 1UGMA 2MRPA 2MBBB 2Z0EB 2JRIB 3APFA 3ZLZA 4NY0A 3VVWB 4TV3A 5J2RA 4OVUA 2LI5A 3NZUA 2DAJA 2JZ3B 4I6NB 1WXVA 3PLUA 3ZRCA 2GBMA 3KH0A 1Q1OA 4GOCA 3R7RA 3V61A 2N4FA 5DCNA 3OLMD 1WX7A 3CSFA 2N7DA 1I42A 2MX2A 3A9KA 1K8RB 2KD0A 4IG7B 4JL9A 3R66C 3DQVA 1D3ZA 2MCNB 2V4LA 3ZUNA 2FCNA 2HD5B 3L10B 1J19A 1L7YA 1WJ6A 2CHXA 3JSVA 2KVRA 2R2OA 3ML9A 2G45B 1YQBA 4GIVA 2MWSB 4ASWC 1WXMA 5J17A 3GOEA 2KJ6A 2KANA 4MH0E 4W9GA 2CKHB 2K6QA 3NHEB 3V60A 3PTFC 4CHKA 4W9IA 4EZLA 3RCZA 2R2QA 2C7HA 2M17A 3VFKA 4GSWA 1KOTA 1WJNA 1ZW7A 2KWVB 2KTRB 3W1YA 1GUAB 3ZRFA 2K39A 2FIFA 5G2NA 3ZNHB 2IO2B 1FXTB 1RAXA 1PQSA 2QHOA 2OOBB 1NDDA 4KDIC 2D10A 1UH6A 3B08A 3UGBB 2V3SA 3VDZA 1GJZA 3U7DA 1J0GA 2IO3B 3PRMB 3HIZA 1P98A 4URKA 3ECIA 2WWZA 4II2B 2O2VB 3KVFB 4CYEA 2BWES 4HPLB 4MDKE 5C23A 2D07B 4GMVA 4G50A 3KUDB 3MJWA 2LGDA 4GXBA 4M8NA 2D3GA 2DZMA 3EHVA 3H7PB 3O65B 4FJYA 5E6PA 1E7UA 5EDSA 3QX1A 2BYVE 1NI2A 2CHZA 1GG3A 2XEWA 2LD9A 2ZCBA 3H9DA 4HPMB 5L95C 2XK5B 4K7UA 2LRWA 1WX8A 4BKSD 4WJOA 4GN1A 2CHWA 2IYDB 2DZKA 3AU5A 2DZIA 4MGIE 4EZJA 3PPAA 1V5OA 5TR5A 4DK5A 2M4NA 3WA0A 1V2YA 2JVCA 3DPDA 4BOZB 2V1YA 3QJZA 4NNJB 3HK0A 1KJTA 2WDTB 2LWPA 4TQ1A 2IBIB 3VTUA 3QWZB 3UIPB 4FHJA 3OJ3A 1A5RA 3K9OB 4DWFA 4EKUA 4EEWA 2L8JA 1VCBA 4KIKB 4M0WB 2KX3A 4ANWA 4FBJB 4G0NB 2N1WA 2BF8B 2C9WB 3NOBA 4KSKC 4MJSB 3T8MA 3W1SA 4DDID 2GBKA 1WGYA 4G11A 2W9NA 2KXJA 5CHVC 3ZTDA 4IUMB 4RM9A 2KJRA 2K8BA 2NCNA 1E7VA 3QK0A 2K8HA 4WWPA 4WQOB 5CX3A 5AZHA 3LDZE 2ZVNA 2KJHB 2KHWB 4MM3A 3DCGA 3ZO5B 2KOXA 4KZ0A 2OJRA 2VRRB 3B0AA 3I3TB 4IW0A 3RYTA 3KYCD 1V86A 1WGDA 1WMHB 3ZIMA 2I1JA 3QAQA 2REXA 4K7SA 5HKHA 1OEYA 4XX5A 3EC8A 2IY1B 3H7SA 4GDKB 4ANVA 1WE7A 3EFUA 1WZ3A 4WWOA 2L76A 3KW5B 2FCSA 3WANA 3ZDTA 1YJ1A 2RR9A 3A1QB 4AWJA 4KSLC 1LXDA 1WFYA 4GB9A 3VTVA 1RRBA 1GC6A 4B95A 3ENEA 3OAWA 2BWFA 4GDLA 3VUXA 2ASQA 3L16A 4IC7B 4HDOA 4X57B 2DYBA 3KUCB 2IO0B 1WIAA 3DOWA 4XC2A 3A4RA 4E71A 3SU8X 2MP2A 1J8CA 3PS6A 5D2MB 1V80A 2J0MA 3R3MA 5BO4B 3A9KB 1C1YB 3DVGX 2L7RA 3U30A 2ZZPB 2Z0DB 2DZJA 1WGHA 1LQBA 4IM2A 1EF5A 3JSVB 4IM0A 2KO3A 3RUIB 1GNUA 2ZNVB 3VH3B 1WXSA 2LRUA 3MHSD 3A4SC 1YX5B 3ZKJC 2Z59B 4W9HA 3DBHI 1WRDB 2BGFA 4W9EA 1WI0A 4HK2A 1TBEA 1P3QU 1WJUA 2IY0B 4PYUA 4LDTD 1Q0WB 3P2BA 1XD3B 3L13A 3HHMA 2FUHB 3QIJA 1OTRB 3PT2B 2O6VA 2J7QB 2LVQA 5LLIA 3UQBA 1WM3A 4A3PA 2B3AA 2D11A 1CMXB 2J0KA 2K6DB 3K9PB 4LDTB 4NJ7A 2FCMA 2KKCA 2M8SA 1I35A 1T0YA 4WAAA 2RGFA 2NPTA 3IHPC 2XBBC 3VAWA 2EMTA 4BKGA 1Z2MA 2MSED 2AEHA 2PE9A 2JT4B 2C60A 1H8CA 3X23A 2KWUB 2LXAA 1KLVA 4A20A 1X1MA 2NBVB 4AUQC 4DHJD 4FULA 3BY4B 2JRHA 2AL6A 2PE6B 4GU2A 4P7IA 2N9PC 1HE8A 3ZTCA 1WZ0A 3ALBA 4ICVA 4NPNA 2LGXA 3W1SC 3QQ8B 3N30A 3WALA 3KYDD 1OEYJ 1OGWA 2FCQA 3VH4B 1UD7A 1IPGA 2K25A 3QHTA 4MELA 3M63B 2NBUA 3JW0X 5L83A 2FAZA 3X0WA 3A9JB 4AJYB 1SIFA 3V6EB 1UBQA 2GBNA 2KC1A 3A33B 3APCA 3ZNZB 2JZZA 4NQKE 3M62B 4NQLB 1Q5WB 2PJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMS A;  2ZJD A;  3APD A;  3VQI A;  1WGR A;  2CS4 A;  2KNB A;  3PRP B;  3WAM A;  2LVP A;  1WXA A;  3L08 A;  4II3 B;  1P1A A;  3DVN V;  5IAA C;  2O2V A;  1KM7 A;  1WYW B;  2ZPY A;  4HLE A;  2N9X A;  2LUE A;  1NBF C;  1E8W A;  2UYZ B;  4TKN A;  2LZ6 A;  2YVC A;  4DHZ E;  2KWC A;  2ZEQ A;  2LVO A;  2FNJ B;  1V6E A;  4HWI B;  4WWN A;  4ICU A;  2JPH A;  2BYE A;  2N7E A;  2GBJ A;  2WX0 A;  4ZYN A;  1P0R A;  2DHZ A;  1WE6 A;  2HE7 A;  2JY6 A;  3PZD A;  3TJP A;  4DHZ B;  4J6I A;  3IBE A;  3TL5 A;  3SHQ A;  2KMC A;  4DBG A;  1S3S G;  3JYU A;  2PPH A;  3CF6 E;  2LJ5 A;  3IVF A;  4YL8 A;  5GMV A;  4B6W A;  2KDE B;  4BKT A;  4N9F 4;  4JLC A;  4MGY E;  1SGH A;  4ANU A;  4PYZ A;  3D32 A;  2DX5 B;  2KZR A;  1TTN A;  1U4A A;  4LJO B;  4TQ0 A;  4JIO U;  4HJK A;  5D7G A;  4K81 A;  2C7N B;  4LCD E;  3DVN U;  4NAW B;  3S2A A;  4ZRK A;  1RLF A;  4M8M A;  2WYQ A;  3NS8 A;  3RT3 B;  4PS7 A;  2HTH A;  3QA8 A;  3ZDM C;  3KUZ A;  4KZC A;  3UIO B;  4AJW A;  5AEK B;  2AL3 A;  3R7Q A;  3WAO A;  2MP2 B;  4KIK A;  2KC2 A;  3U8Z A;  1ZKH A;  2G4S A;  3JVZ X;  4W9C A;  3PVL A;  4DXA B;  2LXC A;  5LXI B;  2ZNV C;  4F1S A;  2GBR A;  3UIN B;  4B9K A;  1MG8 A;  4MGK E;  4G3X B;  1WJ4 A;  4W9D A;  1E90 A;  3L17 A;  4PS8 A;  3CST A;  2RD0 A;  2KFK A;  4FHK A;  5LXH A;  3ZW3 A;  2KQS A;  1R4N I;  3AU4 A;  3PRZ A;  4HVB A;  5E6O A;  2M0X A;  1WM2 A;  4RMA A;  5JH5 C;  2NS5 A;  1M94 A;  2A4Z A;  2NVU I;  2K1F A;  4BBN F;  4KVG B;  3AI5 A;  3ZNG C;  1C3T A;  2JUO A;  1E5W A;  1WGG A;  4A3O A;  4W9J A;  1WH3 A;  2EKE C;  4AP4 C;  4MSM B;  4K1R B;  1WMH A;  3IG3 A;  1E8Y A;  1YD8 U;  2Y5B B;  2L0F A;  1YX6 B;  2L0T A;  5JHB A;  4XZ4 A;  4PS3 A;  1SE9 A;  3PGE A;  2KX0 A;  2DAF A;  4I6L B;  2N1V A;  3QC8 B;  5D94 A;  4IWQ A;  2JWZ A;  3DBR I;  4MEM A;  2KDI A;  3C0R B;  4FAD A;  3PRE A;  5KHQ A;  4HCP B;  3B1L X;  2A5U A;  2JXX A;  4FJZ A;  5G55 A;  2NPT B;  3N3K B;  3CMM B;  3L0W B;  3ZNI D;  2L05 A;  4E74 A;  2DEN B;  5DPS A;  1H4R A;  3NY5 A;  3ZVV A;  1F9J A;  1QZE A;  3PV1 A;  2AWT A;  2KDF B;  2KDB A;  2KQ7 A;  4IWO A;  2FID A;  3PLV A;  3NZS A;  5CHF A;  2PEA A;  4MSQ B;  3V6C B;  1V5T A;  5CTR C;  2KLC A;  4JQW C;  4E3C A;  5IA7 A;  2MQJ A;  1GC7 A;  3VUW A;  1JRU A;  1LM8 B;  2LGY A;  2C5L C;  2G3Q B;  1TGZ B;  2YLM A;  4ANX A;  1OQY A;  4I6P A;  3TIX A;  3DBL I;  4BBN C;  2C7M B;  3H1U A;  3H6N A;  1EF1 A;  2IO1 B;  4TUU A;  4W9K A;  2RPQ A;  4FLH A;  2KFJ A;  3VTW A;  2KN5 A;  3DDC B;  2RSU A;  2MLB A;  4BOS C;  3N32 A;  2BKR B;  5CHW A;  4W9F A;  3EEC A;  2M1M A;  4DHJ B;  1ZGU B;  3WIM A;  2ZVO A;  3HM3 A;  2KTR A;  3AUL A;  2CU1 A;  5DPW A;  3L54 A;  4W9L A;  5JHA A;  2KK8 A;  4IM3 A;  4ZRI A;  4KDL B;  1V9J A;  1WY8 A;  2GOW A;  1S1Q B;  5J18 A;  3OJ4 B;  2HJ8 A;  4NJ6 A;  2J0J A;  4HDQ A;  4F7Z A;  1UZX B;  2MA9 B;  3SDL C;  3UQA A;  3T9L A;  2G4D B;  3DBS A;  3H7P A;  3TBL D;  4ZDV A;  1IYF A;  1P9D U;  2UWQ A;  1BT0 A;  4EFO A;  3PHW B;  2KMA A;  4BVU C;  1Z5S B;  1E8X A;  1WR6 E;  2D2Q A;  3RZW C;  4EZK A;  3TCA A;  2JF5 A;  2XK5 A;  3VHT C;  1IP9 A;  3UF8 A;  5KHO A;  2K8C A;  1UEL A;  2L00 B;  1TZ1 A;  4WJP A;  2KLG A;  3QAR A;  4FA6 A;  5C1Z A;  2L3Z A;  3RZF A;  1G6J A;  3A9J A;  3LJ3 A;  4LJP B;  2NR2 A;  1ISN A;  1XQQ A;  3GZN I;  4CO7 A;  5E6N A;  2BYF A;  1L2N A;  3IFW B;  2NBW B;  2MBE A;  1AAR A;  4IWP A;  3HM6 X;  3ONS A;  4KV2 A;  4K7W A;  4BKS A;  4GDL B;  2BKF A;  4HCN B;  2MW5 A;  3VXW A;  3DVG Y;  2WX1 A;  3WAP A;  5D6J B;  3M95 A;  2KFK B;  4HXD A;  2MBO A;  1R4M I;  3RD2 A;  1WR1 A;  1WX9 A;  4WJN A;  5FR6 A;  2GMI C;  3Q3F A;  2DYM A;  3VUY A;  4MJS A;  5JZE B;  3V62 A;  3MTN B;  1EO6 A;  4FJV B;  2N9E B;  4EUT A;  3TMP B;  2IZV B;  5AZF A;  1E8Z A;  4OVV A;  2ZPN A;  1UBI A;  3RUL A;  5DPR A;  3PSE B;  4GGQ A;  4JGH B;  4ZRJ A;  4AOF A;  2MBQ A;  4WJQ A;  3SD5 A;  1Y8R C;  2O6V D;  2MBH A;  4MGZ E;  1VD2 A;  2ZCC A;  1RFA A;  4FN2 A;  2LAS A;  2AYO B;  4NAW A;  1WF9 A;  2I1K A;  1V81 A;  3ML8 A;  1V49 A;  1LFD A;  4GDK A;  2DYO A;  2O6V B;  4RM8 A;  3QCA A;  5DPT A;  5AZG A;  3M3J A;  1XT9 B;  2BPS A;  3BIN A;  1EUV B;  2KTF A;  1YIW A;  4BFR A;  4EOY A;  3A1Q A;  3PHX B;  4DDG D;  4F8C B;  3AXC A;  3Q3J A;  2CR5 A;  1UGM A;  2MRP A;  2MBB B;  2Z0E B;  2JRI B;  3APF A;  3ZLZ A;  4NY0 A;  3VVW B;  4TV3 A;  5J2R A;  4OVU A;  2LI5 A;  3NZU A;  2DAJ A;  2JZ3 B;  4I6N B;  1WXV A;  3PLU A;  3ZRC A;  2GBM A;  3KH0 A;  1Q1O A;  4GOC A;  3R7R A;  3V61 A;  2N4F A;  5DCN A;  3OLM D;  1WX7 A;  3CSF A;  2N7D A;  1I42 A;  2MX2 A;  3A9K A;  1K8R B;  2KD0 A;  4IG7 B;  4JL9 A;  3R66 C;  3DQV A;  1D3Z A;  2MCN B;  2V4L A;  3ZUN A;  2FCN A;  2HD5 B;  3L10 B;  1J19 A;  1L7Y A;  1WJ6 A;  2CHX A;  3JSV A;  2KVR A;  2R2O A;  3ML9 A;  2G45 B;  1YQB A;  4GIV A;  2MWS B;  4ASW C;  1WXM A;  5J17 A;  3GOE A;  2KJ6 A;  2KAN A;  4MH0 E;  4W9G A;  2CKH B;  2K6Q A;  3NHE B;  3V60 A;  3PTF C;  4CHK A;  4W9I A;  4EZL A;  3RCZ A;  2R2Q A;  2C7H A;  2M17 A;  3VFK A;  4GSW A;  1KOT A;  1WJN A;  1ZW7 A;  2KWV B;  2KTR B;  3W1Y A;  1GUA B;  3ZRF A;  2K39 A;  2FIF A;  5G2N A;  3ZNH B;  2IO2 B;  1FXT B;  1RAX A;  1PQS A;  2QHO A;  2OOB B;  1NDD A;  4KDI C;  2D10 A;  1UH6 A;  3B08 A;  3UGB B;  2V3S A;  3VDZ A;  1GJZ A;  3U7D A;  1J0G A;  2IO3 B;  3PRM B;  3HIZ A;  1P98 A;  4URK A;  3ECI A;  2WWZ A;  4II2 B;  2O2V B;  3KVF B;  4CYE A;  2BWE S;  4HPL B;  4MDK E;  5C23 A;  2D07 B;  4GMV A;  4G50 A;  3KUD B;  3MJW A;  2LGD A;  4GXB A;  4M8N A;  2D3G A;  2DZM A;  3EHV A;  3H7P B;  3O65 B;  4FJY A;  5E6P A;  1E7U A;  5EDS A;  3QX1 A;  2BYV E;  1NI2 A;  2CHZ A;  1GG3 A;  2XEW A;  2LD9 A;  2ZCB A;  3H9D A;  4HPM B;  5L95 C;  2XK5 B;  4K7U A;  2LRW A;  1WX8 A;  4BKS D;  4WJO A;  4GN1 A;  2CHW A;  2IYD B;  2DZK A;  3AU5 A;  2DZI A;  4MGI E;  4EZJ A;  3PPA A;  1V5O A;  5TR5 A;  4DK5 A;  2M4N A;  3WA0 A;  1V2Y A;  2JVC A;  3DPD A;  4BOZ B;  2V1Y A;  3QJZ A;  4NNJ B;  3HK0 A;  1KJT A;  2WDT B;  2LWP A;  4TQ1 A;  2IBI B;  3VTU A;  3QWZ B;  3UIP B;  4FHJ A;  3OJ3 A;  1A5R A;  3K9O B;  4DWF A;  4EKU A;  4EEW A;  2L8J A;  1VCB A;  4KIK B;  4M0W B;  2KX3 A;  4ANW A;  4FBJ B;  4G0N B;  2N1W A;  2BF8 B;  2C9W B;  3NOB A;  4KSK C;  4MJS B;  3T8M A;  3W1S A;  4DDI D;  2GBK A;  1WGY A;  4G11 A;  2W9N A;  2KXJ A;  5CHV C;  3ZTD A;  4IUM B;  4RM9 A;  2KJR A;  2K8B A;  2NCN A;  1E7V A;  3QK0 A;  2K8H A;  4WWP A;  4WQO B;  5CX3 A;  5AZH A;  3LDZ E;  2ZVN A;  2KJH B;  2KHW B;  4MM3 A;  3DCG A;  3ZO5 B;  2KOX A;  4KZ0 A;  2OJR A;  2VRR B;  3B0A A;  3I3T B;  4IW0 A;  3RYT A;  3KYC D;  1V86 A;  1WGD A;  1WMH B;  3ZIM A;  2I1J A;  3QAQ A;  2REX A;  4K7S A;  5HKH A;  1OEY A;  4XX5 A;  3EC8 A;  2IY1 B;  3H7S A;  4GDK B;  4ANV A;  1WE7 A;  3EFU A;  1WZ3 A;  4WWO A;  2L76 A;  3KW5 B;  2FCS A;  3WAN A;  3ZDT A;  1YJ1 A;  2RR9 A;  3A1Q B;  4AWJ A;  4KSL C;  1LXD A;  1WFY A;  4GB9 A;  3VTV A;  1RRB A;  1GC6 A;  4B95 A;  3ENE A;  3OAW A;  2BWF A;  4GDL A;  3VUX A;  2ASQ A;  3L16 A;  4IC7 B;  4HDO A;  4X57 B;  2DYB A;  3KUC B;  2IO0 B;  1WIA A;  3DOW A;  4XC2 A;  3A4R A;  4E71 A;  3SU8 X;  2MP2 A;  1J8C A;  3PS6 A;  5D2M B;  1V80 A;  2J0M A;  3R3M A;  5BO4 B;  3A9K B;  1C1Y B;  3DVG X;  2L7R A;  3U30 A;  2ZZP B;  2Z0D B;  2DZJ A;  1WGH A;  1LQB A;  4IM2 A;  1EF5 A;  3JSV B;  4IM0 A;  2KO3 A;  3RUI B;  1GNU A;  2ZNV B;  3VH3 B;  1WXS A;  2LRU A;  3MHS D;  3A4S C;  1YX5 B;  3ZKJ C;  2Z59 B;  4W9H A;  3DBH I;  1WRD B;  2BGF A;  4W9E A;  1WI0 A;  4HK2 A;  1TBE A;  1P3Q U;  1WJU A;  2IY0 B;  4PYU A;  4LDT D;  1Q0W B;  3P2B A;  1XD3 B;  3L13 A;  3HHM A;  2FUH B;  3QIJ A;  1OTR B;  3PT2 B;  2O6V A;  2J7Q B;  2LVQ A;  5LLI A;  3UQB A;  1WM3 A;  4A3P A;  2B3A A;  2D11 A;  1CMX B;  2J0K A;  2K6D B;  3K9P B;  4LDT B;  4NJ7 A;  2FCM A;  2KKC A;  2M8S A;  1I35 A;  1T0Y A;  4WAA A;  2RGF A;  2NPT A;  3IHP C;  2XBB C;  3VAW A;  2EMT A;  4BKG A;  1Z2M A;  2MSE D;  2AEH A;  2PE9 A;  2JT4 B;  2C60 A;  1H8C A;  3X23 A;  2KWU B;  2LXA A;  1KLV A;  4A20 A;  1X1M A;  2NBV B;  4AUQ C;  4DHJ D;  4FUL A;  3BY4 B;  2JRH A;  2AL6 A;  2PE6 B;  4GU2 A;  4P7I A;  2N9P C;  1HE8 A;  3ZTC A;  1WZ0 A;  3ALB A;  4ICV A;  4NPN A;  2LGX A;  3W1S C;  3QQ8 B;  3N30 A;  3WAL A;  3KYD D;  1OEY J;  1OGW A;  2FCQ A;  3VH4 B;  1UD7 A;  1IPG A;  2K25 A;  3QHT A;  4MEL A;  3M63 B;  2NBU A;  3JW0 X;  5L83 A;  2FAZ A;  3X0W A;  3A9J B;  4AJY B;  1SIF A;  3V6E B;  1UBQ A;  2GBN A;  2KC1 A;  3A33 B;  3APC A;  3ZNZ B;  2JZZ A;  4NQK E;  3M62 B;  4NQL B;  1Q5W B;  2PJH A; 
#chains in the Genus database with same CATH topology
 2CS4 A;  2KNB A;  1VRA B;  3WAM A;  3DVN V;  5IAA C;  1WYW B;  2HDE A;  1FCC C;  1J7C A;  1YQ4 B;  4HKQ A;  1I4R A;  1V1P A;  2JPH A;  3RNC C;  2GBJ A;  1TS2 A;  2HE7 A;  4DHZ B;  2KQ4 X;  3TL5 A;  3SHQ A;  3PO0 A;  1S3S G;  2PPH A;  3CF6 E;  1K50 A;  3IVF A;  4N9F 4;  4ANU A;  2DX5 B;  2KWD A;  1MJD A;  4ZRQ A;  3R2I A;  3S2A A;  4ZRK A;  4M8M A;  4PS7 A;  2BTE A;  3ZDM C;  3UIO B;  2OED A;  2MP2 B;  2G4S A;  4W9C A;  4DXA B;  2Y5P A;  3UIN B;  1MG8 A;  2K3U A;  4JPS A;  1E90 A;  1GPX A;  1ENF A;  5IP4 D;  5LXH A;  1R4N I;  3PRZ A;  2K22 A;  5H92 C;  1WM2 A;  2NS5 A;  1M94 A;  2NVU I;  2JUO A;  1E5W A;  1WGK A;  4A3O A;  2ZW0 A;  3IG3 A;  1E8Y A;  4A6Q A;  2JU6 X;  4CQN A;  2L0F A;  4RGT A;  2DAF A;  1BXT A;  2IJ0 A;  3I57 A;  4I6L B;  2N1V A;  5D94 A;  4O1N A;  4HRO A;  3C0R B;  4FAD A;  3PRE A;  3AEA B;  4FJZ A;  2IGH A;  3ZNI D;  2WXK A;  3FC4 A;  2DEN B;  2AWT A;  2KDB A;  2FID A;  2KT7 A;  3NZS A;  2PEA A;  1D4B A;  3V6C B;  1V5T A;  5IA7 A;  3W5U B;  1JRU A;  1J7A A;  1LM8 B;  2LHE A;  2YLM A;  1N5W A;  1A70 A;  1OQY A;  3TIX A;  4BBN C;  2C7M B;  1EF1 A;  2IO1 B;  3VTW A;  2KN5 A;  3DDC B;  1GOZ A;  3N32 A;  4W9F A;  4DHJ B;  3WIM A;  2W82 A;  3L54 A;  4IM3 A;  3KLS X;  3EFC A;  2GOW A;  1K52 A;  4Q2J A;  4HDQ A;  1FFU A;  1UZX B;  2RPV A;  2MA9 B;  3SDL C;  3P63 A;  3MC0 B;  3T9L A;  2G4D B;  3TBL D;  1SE3 A;  4ZDV A;  3B2G A;  1P9D U;  1M4V A;  2KMA A;  1Z5S B;  4REZ A;  2MJ3 A;  3VHT C;  4HJG E;  3UF8 A;  2N7J A;  1OFF A;  2KLG A;  5C1Z A;  4YXD B;  3RZF A;  2RDB C;  1G6J A;  3DBL B;  4XWW A;  3RPF C;  1ISN A;  1XQQ A;  3GZN I;  4CO7 A;  2BYF A;  4IWP A;  4KV2 A;  2OHF A;  5EE0 A;  4DXF A;  2MBO A;  1R4M I;  1WR1 A;  4WJN A;  3VUY A;  1DYQ A;  4MJS A;  1YOV B;  3V62 A;  4S17 A;  3MTN B;  1FNU A;  3Q69 A;  4A90 A;  5AZF A;  3V3X A;  3TSS A;  3PSE B;  3IAM 1;  4GGQ A;  4ZRJ A;  2MBQ A;  3C19 A;  2MHJ A;  4A55 A;  2MBH A;  1MHH E;  1VD2 A;  3IT4 B;  1RFA A;  4FN2 A;  2LAS A;  4TSS A;  1PUT A;  3PZ7 A;  3NVV A;  3ZXV A;  2GB1 A;  1NEN B;  2ONQ A;  2KYW A;  2O6V B;  3QCA A;  1AN8 A;  3M3J A;  5AUI A;  4EOY A;  1EUV B;  1UGM A;  1HQR D;  2MBB B;  5G5G A;  3R2T A;  4RGN A;  3NZU A;  4KKJ A;  3KH0 A;  1Q1O A;  2N4F A;  5DCN A;  3KWV A;  5G5H A;  5C3J B;  3GE3 C;  1F1H A;  3P1M A;  5BMH A;  4RCO A;  3ZUN A;  1L7Y A;  3JSV A;  3ML9 A;  5HKH A;  2KVR A;  2G45 B;  3Q8A A;  3UI3 A;  4ASW C;  5J17 A;  2KJ6 A;  2KAN A;  4W9G A;  2R61 A;  4HKZ E;  3PTF C;  2BT6 A;  1JAL A;  3W5V B;  3RCZ A;  5BMI A;  2M17 A;  1ROE A;  1GUA B;  2K39 A;  5G2N A;  3ZNH B;  4IOI E;  1T3Q A;  4QAY A;  1C9F A;  4KDI C;  2D10 A;  3VDZ A;  2V3S A;  3U7D A;  4URK A;  4II2 B;  4CYE A;  2VH2 A;  4G50 A;  4GXB A;  2LGD A;  2D3G A;  4JWU C;  3O65 B;  3RNF C;  2ACZ B;  4K3C A;  2BYV E;  2XEW A;  3ETR A;  4BKS D;  2CHW A;  2N9L A;  2QJL A;  3AU5 A;  1NEK B;  3N1Z C;  2G9H D;  3PPA A;  4DK5 A;  2MJE A;  2JVC A;  2XNA C;  3DPD A;  2FUG 1;  2V1Y A;  3HUI A;  5I4D A;  3P4S B;  2N0S B;  2WDT B;  2LWP A;  3VTU A;  3QWZ B;  3UIP B;  1JWB D;  4FHJ A;  1A5R A;  3BK1 A;  4DWF A;  1XCQ L;  3I63 C;  1CK1 A;  4M0W B;  4ANW A;  4G0N B;  4KSK C;  3T8M A;  4DDI D;  4KGR A;  2WLB A;  3U4E G;  1LO5 D;  3ZTD A;  2KJR A;  1Y56 A;  2J4X A;  3QK0 A;  5AZH A;  1L5P A;  4WQO B;  2JWU A;  2AQ3 B;  2KJH B;  2Y3A A;  3DCG A;  4KZ0 A;  4IW0 A;  3RYT A;  3KYC D;  1WMH B;  1I4G A;  1MI0 A;  1F0Z A;  4ANV A;  3ZDT A;  3WAN A;  3KW5 B;  3DHI C;  1YJ1 A;  3A1Q B;  2V9H A;  2WXQ A;  4KSL C;  1WFY A;  2WU2 B;  4GDL A;  4IC7 B;  3E56 A;  3DOW A;  3PS6 A;  1T0R C;  3W2D A;  1XLQ A;  5D2M B;  3Q3O C;  2J0M A;  3R3M A;  5BO4 B;  1C1Y B;  3DVG X;  2L7R A;  3N9Y C;  2Z0D B;  1LQB A;  4IM2 A;  4PK1 A;  1ZUD 2;  3RUI B;  2LRU A;  1QOA A;  4HK2 A;  2IY0 B;  4OZA A;  3L13 A;  3WCQ A;  3QIJ A;  4M01 A;  2J7Q B;  4RGO S;  3UQB A;  4A3P A;  2B3A A;  2J0K A;  2KKC A;  5GXG B;  2M8S A;  2CJN A;  2NPT A;  1IBX A;  3BZD B;  3RNG C;  3IAS 1;  2JT4 B;  2FBW B;  5FKA C;  1CZP A;  2MJD A;  1KLV A;  4AUQ C;  1C4A A;  1SB3 C;  3BY4 B;  2JRH A;  4P7I A;  2LHD A;  1HE8 A;  2N9P C;  2LGX A;  2BB6 A;  1RYJ A;  4MEL A;  3NZ3 A;  1E6E B;  4XDD A;  3FAH A;  5L83 A;  2VZK B;  3V6E B;  3DBR B;  1UBQ A;  2KC1 A;  2PVG C;  4NQL B;  5H8Y E;  1Q5W B;  4II3 B;  4JX1 C;  2O2V A;  2Z8L A;  1NBF C;  2LZ6 A;  2YVC A;  3MFG A;  2RDG A;  2KWC A;  2INP E;  2LVO A;  1V6E A;  2WNM A;  4ZYN A;  2DHZ A;  2MH7 A;  2JQR B;  3JYU A;  2KAJ A;  4BKT A;  5GMV A;  2KDE B;  4JLC A;  4C4V B;  3D32 A;  1E9M A;  3I9V 1;  4XGA B;  3QA8 A;  4KZC A;  2AL3 A;  1L4Z B;  4KIK A;  3JVZ X;  1JQ4 A;  4JWS C;  5LXI B;  3DHG C;  1TKG A;  4MGK E;  4G3X B;  1WJ4 A;  1WRI A;  3L17 A;  2KFK A;  3ZW3 A;  2KQS A;  3ZXR A;  3AU4 A;  4HVB A;  4RMA A;  1YMH E;  5JH5 C;  2A4Z A;  2NTS A;  3AI5 A;  5D3I B;  3VRB B;  1PGX A;  1RFK A;  3AE1 B;  4MSM B;  1C4C A;  3ZYY X;  5JHB A;  2KX0 A;  1Q10 A;  4YSZ B;  2KAC A;  3DBR I;  4MEM A;  1FD6 A;  5KHQ A;  2A5U A;  2JXX A;  5G55 A;  3AH7 A;  3AE8 B;  5C2T B;  4K3B A;  5DPS A;  3NY5 A;  3ZVV A;  1XXG A;  1SSN A;  1HTQ A;  1F9J A;  1QOF A;  1QZE A;  3Q3N C;  2LGS A;  3PLV A;  3FIL B;  4GLS C;  4OW0 A;  5CHF A;  4IKG A;  1FMA D;  1EWC A;  2W55 A;  2LGY A;  4L2Y A;  3V05 A;  3BWU D;  1T6B X;  3H1U A;  3NVW A;  4TUU A;  1DOY A;  1IGC A;  3MJ5 A;  1TYG B;  1DGJ A;  3N1Y C;  2E3T A;  2M1M A;  2B76 B;  2V3N A;  1TKE A;  3AUL A;  1SBB B;  5DPW A;  3Q8F A;  5JHA A;  1V9J A;  2JSV X;  1S1Q B;  5J18 A;  2HJ8 A;  4NJ6 A;  3L4P A;  2J0J A;  1V1P B;  5T8I A;  4DXG A;  1IYF A;  3PHW B;  4MM3 B;  1E8X A;  2D2Q A;  2M0A A;  4EZK A;  2GLS A;  3AE4 B;  3TCA A;  1GB4 A;  2JF5 A;  1FO4 A;  2K9X A;  1UEL A;  2L00 B;  1TZ1 A;  4WJP A;  2L3Z A;  2I38 A;  3A9J A;  4N59 A;  2NR2 A;  2WXP A;  3RI7 C;  5E6N A;  2WXO A;  1K53 A;  3IFW B;  2NBW B;  2L83 A;  4K7W A;  2NTT A;  3TEY A;  2MW5 A;  3VXW A;  2WX1 A;  3WAP A;  5D6J B;  1B1Z A;  2JXT A;  3RD2 A;  4HXD A;  3Q3F A;  2WHI A;  4M02 A;  1EO6 A;  1EU4 A;  3CWI A;  2IZV B;  1YN3 A;  4OVV A;  2ZPN A;  1UBI A;  4JE3 B;  5DPR A;  2Y5C A;  2WXN A;  4WJQ A;  3SD5 A;  2O6V D;  1I4P A;  2AYO B;  4C00 A;  1KRH A;  1D5M C;  3B2F A;  1WF9 A;  2ZW1 A;  2I1K A;  2JYE A;  1LFD A;  4GDK A;  1V8C A;  1YIW A;  3BK2 A;  3GZN B;  2CR5 A;  2Z0E B;  4USA A;  3APF A;  1XF5 L;  1ET9 A;  2LI5 A;  4I6N B;  2DAJ A;  1T5X D;  1WXV A;  2KDM A;  2BYT A;  4GOC A;  1WX7 A;  4WUR A;  1R4M B;  1K8R B;  2KD0 A;  2WDV B;  1CQV A;  2QSD A;  4US9 A;  3R66 C;  1FPY A;  2HD5 B;  3L10 B;  2CHX A;  2R2O A;  3AE5 B;  1YQB A;  4GIV A;  1I4H A;  2HJ1 A;  2CKH B;  3NHE B;  4RF0 A;  4CHK A;  4W9I A;  4EZL A;  2W54 A;  1WJN A;  1JWS D;  3AMZ A;  3ZRF A;  2IO2 B;  2QHO A;  4M00 A;  4EE2 A;  1EM7 A;  3UGB B;  1GJZ A;  3P4P B;  2IO3 B;  1P98 A;  3ECI A;  2WWZ A;  1YN4 A;  3LYY A;  4FJY A;  3QX1 A;  5IOI A;  5EE3 A;  3H9D A;  4WJO A;  2IYD B;  1NI3 A;  2DZK A;  1D5X C;  2DZI A;  4EZJ A;  2QC8 A;  2M4N A;  4KGS A;  1V2Y A;  2GRI A;  1MVK A;  3QJZ A;  3IT6 B;  1KJT A;  2WDQ B;  4TQ1 A;  1WSP A;  2IBI B;  4TMA B;  4EKU A;  4EEW A;  1XO3 A;  1XEE A;  2KX3 A;  4FBJ B;  1T0S C;  3W1S A;  2BF8 B;  3NOB A;  4MJS B;  2BQQ A;  2GBK A;  1WGY A;  2W9N A;  1TS5 A;  5HG2 A;  4IUM B;  4RM9 A;  1VZ6 A;  2NCN A;  1E7V A;  1FXI A;  4WWP A;  4WAF A;  5CX3 A;  1QQR A;  3LDZ E;  2ZVN A;  2KOX A;  2OJR A;  3I3T B;  3NUH B;  4ZHP A;  1WGD A;  3QAQ A;  1LGR A;  2IY1 B;  3H7S A;  3EFU A;  1WZ3 A;  4AWJ A;  3NRZ A;  3AEC B;  4GB9 A;  3TEX A;  1ZDV A;  3OAW A;  2BWF A;  3VUX A;  5JXV A;  4E71 A;  1QF6 A;  4ITK A;  5FR3 A;  3JSV B;  2KO3 A;  1P7E A;  3VRA B;  1GNU A;  3VH3 B;  1F2R I;  3MHS D;  1PGB A;  1YX5 B;  2Z59 B;  5AUK A;  4W9H A;  1WRD B;  2INC C;  1BML C;  2BGF A;  4YSX B;  4RGM A;  1WJU A;  1OQR A;  3RNE C;  1Q0W B;  1MFW A;  2FUH B;  3IXS A;  2O6V A;  4S0R A;  1N5X A;  2LVQ A;  1TY0 A;  3AV8 A;  2IDY A;  2QIE B;  3K9P B;  2FCM A;  3ZJT A;  1T0Y A;  2IND C;  2XBB C;  4BKG A;  2AEH A;  2BB5 A;  1GAQ B;  2LXA A;  3SFE B;  2WDR B;  1X1M A;  3RNB C;  4YSY B;  2LMC A;  1N61 A;  2WXG A;  1ZP0 B;  3ZTC A;  3DWM A;  4ICV A;  2VZK D;  1KLU D;  1JRO A;  3KYD D;  1OGW A;  2QDF A;  2K25 A;  3QHT A;  2RMM A;  3M63 B;  2NBU A;  2SEB D;  2FAZ A;  3X0W A;  1TJE A;  3Q8B A;  1L6V A;  2EKI A;  4NQK E;  1JCK B;  3EUB 2;  3NJT A;  4YTN B;  1FIQ A;  3X23 A;  1SE2 A;  2JYT A;  2CU3 A;  3VQI A;  1WGR A;  3DHH C;  3PRP B;  1FM0 D;  1WXA A;  2QEJ C;  1P1A A;  3C8Y A;  4MT5 A;  2ZPY A;  2LUE A;  1E8W A;  4TKN A;  2DWQ A;  2ZEQ A;  2FNJ B;  4HWI B;  4WWN A;  3I5J C;  2IGD A;  2BYE A;  2N7E A;  2WX0 A;  1P0R A;  3PZD A;  2JY6 A;  5TSS A;  4J6I A;  1QT9 A;  3LB8 C;  1B9R A;  2KMC A;  4DBG A;  3GP7 A;  1T0Q C;  3MC8 A;  2LJ5 A;  3U7Z A;  4YL8 A;  4MGY E;  1SGH A;  4YT0 B;  3BVM A;  2KZR A;  1FNV A;  3GS2 A;  4JIO U;  4HJK A;  5D7G A;  4K81 A;  5LNK 1;  2C7N B;  4LCD E;  4NAW B;  1PDX A;  3RT3 B;  2HTH A;  4XWT A;  3KUZ A;  4AJW A;  2WXH A;  3U8Z A;  2KC2 A;  1ZKH A;  1SEB D;  3PVL A;  4C7Z A;  3HVD A;  2ZNV C;  4B9K A;  2L32 A;  1V97 A;  2L52 A;  4W9D A;  4PS8 A;  3CST A;  4FHK A;  3P4R B;  2PKO A;  2E6X A;  5E6O A;  1I4X A;  2M0X A;  1R7S A;  2BVC A;  3MHZ A;  4W9J A;  2EKE C;  4AP4 C;  1WMH A;  1D6E C;  2D3C A;  2QMT A;  1YX6 B;  4OVZ A;  2L0T A;  3U2S C;  4XZ4 A;  4WQM A;  2WU5 B;  3PGE A;  4PS3 A;  3QC8 B;  4L1B A;  4IWQ A;  2JWZ A;  1UNS A;  2KDI A;  2M19 A;  4HCP B;  3B1L X;  2NPT B;  1IBX B;  2AQ2 B;  3CMM B;  4E74 A;  3RN9 C;  1H4R A;  1KLG D;  2BBC A;  1IGD A;  1STE A;  2KDF B;  3P4Q B;  2KQ7 A;  4IWO A;  4MSQ B;  3EGR A;  5CTR C;  3Q2A C;  4JQW C;  1ZXH A;  4E3C A;  1FCL A;  3AEF B;  2PTL A;  4ANX A;  4I6P A;  2MEK A;  4FLH A;  2KFJ A;  2DLB A;  1MG4 A;  3NG0 A;  2MLB A;  4BOS C;  2BKR B;  2WS3 B;  4ZHO A;  4D2K A;  4MH8 A;  1VZ7 A;  3HM3 A;  2KTR A;  2WXL A;  2CU1 A;  2LJI A;  2KK8 A;  4ZRI A;  4KDL B;  1WY8 A;  2K0P A;  5IKC M;  3DBS A;  1GB1 A;  1JML A;  3H7P A;  4P6V F;  1UGJ A;  2JZP A;  2UWQ A;  4EFO A;  1BT0 A;  2D3B A;  1SJH D;  1JWM D;  1HA5 A;  3FKY A;  3RZW C;  4C56 C;  2XK5 A;  3J9C A;  2W3S A;  5KHO A;  2K8C A;  4LNK A;  3LJ3 A;  2N9K A;  2W3R A;  1L2N A;  1YJI A;  3R8B A;  1AAR A;  3LXF A;  3ONS A;  4BKS A;  1ESF A;  4HCN B;  1DOI A;  3DVG Y;  3M95 A;  2KFK B;  1N62 A;  1ET6 A;  1ZDX A;  1WX9 A;  4OZB A;  1WXQ A;  2GMI C;  2DYM A;  3ABV B;  5JZE B;  4FJV B;  3ZJV A;  3TMP B;  1SJE D;  1E8Z A;  2OJW A;  1TIF A;  1AYF A;  1Y8R C;  2D3A A;  4C4V A;  2ZCC A;  1EWY C;  4LNF A;  3SEB A;  5EE1 A;  1HZ6 A;  3AE6 B;  5DPT A;  4BFR A;  2AX5 A;  1FEH A;  2KTF A;  3PHX B;  3TUO A;  3AXC A;  3Q3J A;  2MRP A;  1PFD A;  2JRI B;  4LK0 M;  4NY0 A;  3VVW B;  4TV3 A;  5J2R A;  3Q14 C;  2JZ3 B;  3GB1 A;  3PLU A;  3V61 A;  3R7R A;  3CSF A;  2N7D A;  3AE3 B;  3A9K A;  4IG7 B;  3DQV A;  1D3Z A;  1HXY D;  4H2A A;  1J19 A;  1WJ6 A;  2BS3 B;  4MH0 E;  5BYQ A;  2IPK D;  1WWT A;  2K6Q A;  3ZJU A;  2J42 A;  2DNF A;  2C7H A;  3VFK A;  1NYR A;  1FNW A;  1KOT A;  2KWV B;  1VR9 A;  2FIF A;  1FXT B;  1UH6 A;  3B08 A;  4BZA A;  3SFD B;  1ACC A;  1J0G A;  3PRM B;  2BWE S;  4MDK E;  4KGT A;  2D07 B;  2D5G A;  4GMV A;  4M8N A;  4OHJ A;  1C78 A;  5E6P A;  1NI2 A;  2CHZ A;  1J7B A;  2ZCB A;  4HPM B;  5L95 C;  1SF0 A;  4GN1 A;  1JW9 D;  2QIL A;  2TSS A;  2RDH A;  2INN E;  2QCZ A;  4MGI E;  1E10 A;  4N6E B;  5TR5 A;  1HTO A;  3WA0 A;  4HEA 1;  4NNJ B;  4XE0 A;  2ON8 A;  4A9A A;  4AS1 A;  1MHX A;  2L8J A;  1VCB A;  3NVY A;  2N1W A;  4G11 A;  1XLP A;  1TZO A;  3CIR B;  2K8B A;  4C7Y A;  2K8H A;  2V0G A;  2KHW B;  1C4P A;  4MM3 A;  3ZO5 B;  1YJJ A;  1DOX A;  1VZ8 A;  4YWG G;  3PZ8 A;  4ARI A;  2REX A;  4K7S A;  1OEY A;  4XX5 A;  1QOB A;  4GDK B;  1WE7 A;  2L76 A;  2RR9 A;  1LXD A;  1YQ3 B;  3VTV A;  3ENE A;  3L16 A;  4X57 B;  4HDO A;  3BYT B;  3AN1 A;  1F52 A;  3KUC B;  1WYG A;  1WIA A;  2YEP F;  2V4I B;  3A4R A;  2MP2 A;  1J8C A;  3AE2 B;  2PVO D;  1V80 A;  4XYC A;  1KH0 A;  4N58 A;  3N20 C;  2ZZP B;  1MPE A;  2DZJ A;  1EF5 A;  3BYY B;  4IM0 A;  4P16 A;  3O13 A;  3ZKJ C;  3DBH I;  4KKI A;  1P3Q U;  3P2B A;  4YTP B;  1XD3 B;  3HHM A;  1D5Z C;  1SE4 A;  2L1A A;  1TY2 A;  4LDT B;  4NJ7 A;  4RNA A;  3W9C B;  4ARC A;  4WAA A;  4FXC A;  4XDC A;  3IHP C;  4HPP A;  3NS1 A;  4KX6 B;  2KWU B;  4A8X C;  2BS2 B;  1WZ0 A;  3ALB A;  4NPN A;  1L0X B;  3QQ8 B;  3WAL A;  1OEY J;  3Q8C A;  1TS3 A;  2FCQ A;  1UD7 A;  1IPG A;  3RMK C;  3VR8 B;  2UU7 A;  2GI9 A;  2KVZ A;  2WXM A;  2YEP B;  3JW0 X;  1SIF A;  3AB5 A;  2GBN A;  5IN7 A;  2PJH A;  2EMS A;  2ZJD A;  3APD A;  1OQQ A;  1XLN A;  2LVP A;  3L08 A;  2WP9 B;  1QOG A;  2WXI A;  1KM7 A;  1NVI D;  4ACF A;  4HLE A;  2N9X A;  2UYZ B;  3AEE B;  4DHZ E;  3GE8 C;  3SR6 A;  1VJK A;  1I7H A;  3Q6B A;  3T3O A;  4ICU A;  1I42 A;  3TJP A;  1WE6 A;  3IBE A;  3BVZ A;  4B6W A;  4ZRP A;  4C80 A;  4PYZ A;  4LJO B;  1TTN A;  1U4A A;  4TQ0 A;  4NZL B;  3DVN U;  1RLF A;  2ICI A;  2WYQ A;  3NS8 A;  2J52 A;  5AEK B;  3R7Q A;  3WAO A;  3Q8E A;  1BUI C;  4HRS A;  3RNA C;  1F77 A;  3ZGZ A;  5IO9 A;  2LXC A;  4F1S A;  2GBR A;  2FE8 A;  2RD0 A;  2H89 B;  1C79 A;  1ZE3 D;  3BII D;  4BBN F;  2K1F A;  4DQO C;  4KVG B;  3AEG B;  3ZNG C;  1C3T A;  1WGG A;  1WH3 A;  4K1R B;  4P1B C;  3TEZ A;  1YD8 U;  2Y5B B;  1VLB A;  1SE9 A;  1ZXI A;  3KWL A;  5BMG A;  4WWM A;  3N3K B;  4ZYS A;  1RM6 C;  3L0W B;  2L05 A;  3BVG A;  1KTK A;  3PV1 A;  2H88 B;  1N63 A;  5HHD G;  2V3P A;  2KLC A;  2MQJ A;  1GC7 A;  3VUW A;  2C5L C;  2G3Q B;  1TGZ B;  4L23 A;  3DBL I;  4LTU A;  3H6N A;  3N1X C;  4W9K A;  2RPQ A;  1RWS A;  2M56 B;  2RSU A;  5CHW A;  1TS4 A;  5HI1 A;  2LGI A;  3EEC A;  3U52 E;  2HTM E;  3DWG C;  1ZGU B;  1TKY A;  2ZVO A;  2WXR A;  4W9L A;  1XLO A;  2Q5W D;  3OJ4 B;  4WH4 A;  4F7Z A;  1L0Y B;  3AM9 A;  4LNN A;  3UQA A;  3KQ4 A;  3Q3M C;  4RFB A;  4BVU C;  1WR6 E;  1IP9 A;  4FA6 A;  3QAR A;  4NAM A;  1PYW D;  4LJP B;  4MAC A;  2MBE A;  1AWD A;  3HM6 X;  1E7P B;  4GDL B;  2BKF A;  2PLP A;  2WXF A;  4IDI A;  4LLG M;  1KFY B;  5FR6 A;  4M0W A;  4YTM B;  1SXT A;  2CJO A;  3E9S A;  2N9E B;  4EUT A;  4B0E A;  1FRD A;  4RH6 A;  3RUL A;  1N60 A;  4JGH B;  4AOF A;  1QLB B;  4MGZ E;  4B0M A;  1YNT E;  3T3N A;  1L4D B;  3H8H A;  4NAW A;  3OG5 A;  5EE9 A;  4LNO A;  1V81 A;  2X38 A;  1UF0 A;  2X8X X;  1V49 A;  3ML8 A;  2DYO A;  4RM8 A;  2WXJ A;  5AZG A;  1XT9 B;  2BPS A;  3BIN A;  4F8C B;  1I4Q A;  3A1Q A;  4DDG D;  2BS4 B;  1JWA D;  3ZLZ A;  4US8 A;  5MPO A;  4OVU A;  2BW2 A;  3ZQ4 A;  3ZRC A;  5E6J A;  2GBM A;  4R3D A;  3OLM D;  1L6U A;  2SAK A;  2PW9 A;  1FFV A;  2MX2 A;  4JL9 A;  2MCN B;  2V4L A;  2FCN A;  1UWM A;  3AE7 B;  1C77 A;  1K51 A;  2PMV A;  2MWS B;  1WXM A;  3GOE A;  4LNI A;  3V60 A;  4BAX A;  2R2Q A;  4GSW A;  1ZW7 A;  2KTR B;  3W1Y A;  1IUE A;  1UUP A;  1E0Z A;  3MC9 A;  1RAX A;  1PQS A;  2OOB B;  1NDD A;  5D3D A;  1FRR A;  1ZOY B;  3HIZ A;  2DBY A;  2O2V B;  3KVF B;  4HPL B;  5C23 A;  3MP9 A;  3KUD B;  3MJW A;  2DZM A;  3EHV A;  3H7P B;  3RFZ B;  1E7U A;  5EDS A;  1GG3 A;  2LD9 A;  5BYR A;  1VDV A;  1AW7 A;  2XK5 B;  4K7U A;  2LRW A;  1WX8 A;  3EA6 A;  4NJC A;  1V5O A;  4BOZ B;  1EU3 A;  1L0V B;  3HK0 A;  4OZC A;  3OJ3 A;  3K9O B;  4KIK B;  2WGS A;  1PGA A;  1CJE A;  2C9W B;  4ZOH C;  1C76 A;  2KXJ A;  5CHV C;  1JRP A;  2KN4 A;  2VRR B;  3B0A A;  1HEZ E;  1V86 A;  3ZIM A;  2I2Y A;  2K5P A;  2I1J A;  4J3O D;  2G1E A;  2LFI A;  3P42 A;  3B9J A;  3NVZ A;  3EC8 A;  3AED B;  2IGG A;  4WWO A;  1ZPS A;  2FCS A;  2LUM A;  2PIA A;  2KMM A;  1RRB A;  1GC6 A;  4B95 A;  4RF1 A;  2ASQ A;  2DYB A;  2IO0 B;  4XC2 A;  3SU8 X;  3AEB B;  1NYQ A;  1V1O A;  2LEK A;  2XN9 C;  3A9K B;  3U30 A;  2J53 A;  1WGH A;  1QIL A;  2ZNV B;  1WXS A;  3A4S C;  1UWX A;  1N6Z A;  4W9E A;  1WI0 A;  5FK9 C;  3HVZ A;  1TBE A;  4PYU A;  2JX5 A;  4LDT D;  3AE9 B;  3URY A;  3HRD D;  1OTR B;  1SIJ A;  3PT2 B;  4PT5 A;  2NMQ A;  5LLI A;  1WM3 A;  2D11 A;  1CMX B;  2K6D B;  5BYS A;  1I35 A;  1FXA A;  2RGF A;  2WQY B;  1F2R C;  3VAW A;  2VH1 A;  2EMT A;  1Z2M A;  2MSE D;  2PE9 A;  2C60 A;  2AQ1 B;  1H8C A;  1R4N B;  3VR9 B;  4AQ7 A;  1HZ5 A;  4A20 A;  1QKZ A;  2NBV B;  4DHJ D;  4FUL A;  3FIL A;  2AL6 A;  2PE6 B;  4GU2 A;  3OWE B;  1KF6 B;  1TT5 B;  3W1S C;  3N30 A;  3VH4 B;  1XCT L;  1YN5 A;  2EEL A;  3DBH B;  1JWU D;  1P7F A;  5HFY A;  4P1C C;  3A9J B;  4AJY B;  4UDU C;  4WIP A;  3A33 B;  3APC A;  3ZNZ B;  2JZZ A;  3TEW A;  3M62 B; 
#chains in the Genus database with same CATH homology
 2EMS A;  2ZJD A;  3APD A;  3VQI A;  1WGR A;  2CS4 A;  2KNB A;  3PRP B;  3WAM A;  2LVP A;  1WXA A;  3L08 A;  4II3 B;  1P1A A;  3DVN V;  5IAA C;  2O2V A;  1KM7 A;  1WYW B;  2ZPY A;  4HLE A;  2N9X A;  2LUE A;  1NBF C;  1E8W A;  2UYZ B;  4TKN A;  2LZ6 A;  2YVC A;  4DHZ E;  2KWC A;  2ZEQ A;  2LVO A;  2FNJ B;  1V6E A;  4HWI B;  4WWN A;  4ICU A;  2JPH A;  2BYE A;  2N7E A;  2GBJ A;  2WX0 A;  4ZYN A;  1P0R A;  2DHZ A;  1WE6 A;  2HE7 A;  2JY6 A;  3PZD A;  3TJP A;  4DHZ B;  4J6I A;  3IBE A;  3TL5 A;  3SHQ A;  2KMC A;  4DBG A;  1S3S G;  3JYU A;  2PPH A;  3CF6 E;  2LJ5 A;  3IVF A;  4YL8 A;  5GMV A;  4B6W A;  2KDE B;  4BKT A;  4N9F 4;  4JLC A;  4MGY E;  1SGH A;  4ANU A;  4PYZ A;  3D32 A;  2DX5 B;  2KZR A;  1TTN A;  1U4A A;  4LJO B;  4TQ0 A;  4JIO U;  4HJK A;  5D7G A;  4K81 A;  2C7N B;  4LCD E;  3DVN U;  4NAW B;  3S2A A;  4ZRK A;  1RLF A;  4M8M A;  2WYQ A;  3NS8 A;  3RT3 B;  4PS7 A;  2HTH A;  3QA8 A;  3ZDM C;  3KUZ A;  4KZC A;  3UIO B;  4AJW A;  5AEK B;  2AL3 A;  3R7Q A;  3WAO A;  2MP2 B;  4KIK A;  2KC2 A;  3U8Z A;  1ZKH A;  2G4S A;  3JVZ X;  4W9C A;  3PVL A;  4DXA B;  2LXC A;  5LXI B;  2ZNV C;  4F1S A;  2GBR A;  3UIN B;  4B9K A;  1MG8 A;  4MGK E;  4G3X B;  1WJ4 A;  4W9D A;  1E90 A;  3L17 A;  4PS8 A;  3CST A;  2RD0 A;  2KFK A;  4FHK A;  5LXH A;  3ZW3 A;  2KQS A;  1R4N I;  3AU4 A;  3PRZ A;  4HVB A;  5E6O A;  2M0X A;  1WM2 A;  4RMA A;  5JH5 C;  2NS5 A;  1M94 A;  2A4Z A;  2NVU I;  2K1F A;  4BBN F;  4KVG B;  3AI5 A;  3ZNG C;  1C3T A;  2JUO A;  1E5W A;  1WGG A;  4A3O A;  4W9J A;  1WH3 A;  2EKE C;  4AP4 C;  4MSM B;  4K1R B;  1WMH A;  3IG3 A;  1E8Y A;  1YD8 U;  2Y5B B;  2L0F A;  1YX6 B;  2L0T A;  5JHB A;  4XZ4 A;  4PS3 A;  1SE9 A;  3PGE A;  2KX0 A;  2DAF A;  4I6L B;  2N1V A;  3QC8 B;  5D94 A;  4IWQ A;  2JWZ A;  3DBR I;  4MEM A;  2KDI A;  3C0R B;  4FAD A;  3PRE A;  5KHQ A;  4HCP B;  3B1L X;  2A5U A;  2JXX A;  4FJZ A;  5G55 A;  2NPT B;  3N3K B;  3CMM B;  3L0W B;  3ZNI D;  2L05 A;  4E74 A;  2DEN B;  5DPS A;  1H4R A;  3NY5 A;  3ZVV A;  1F9J A;  1QZE A;  3PV1 A;  2AWT A;  2KDF B;  2KDB A;  2KQ7 A;  4IWO A;  2FID A;  3PLV A;  3NZS A;  5CHF A;  2PEA A;  4MSQ B;  3V6C B;  1V5T A;  5CTR C;  2KLC A;  4JQW C;  4E3C A;  5IA7 A;  2MQJ A;  1GC7 A;  3VUW A;  1JRU A;  1LM8 B;  2LGY A;  2C5L C;  2G3Q B;  1TGZ B;  2YLM A;  4ANX A;  1OQY A;  4I6P A;  3TIX A;  3DBL I;  4BBN C;  2C7M B;  3H1U A;  3H6N A;  1EF1 A;  2IO1 B;  4TUU A;  4W9K A;  2RPQ A;  4FLH A;  2KFJ A;  3VTW A;  2KN5 A;  3DDC B;  2RSU A;  2MLB A;  4BOS C;  3N32 A;  2BKR B;  5CHW A;  4W9F A;  3EEC A;  2M1M A;  4DHJ B;  1ZGU B;  3WIM A;  2ZVO A;  3HM3 A;  2KTR A;  3AUL A;  2CU1 A;  5DPW A;  3L54 A;  4W9L A;  5JHA A;  2KK8 A;  4IM3 A;  4ZRI A;  4KDL B;  1V9J A;  1WY8 A;  2GOW A;  1S1Q B;  5J18 A;  3OJ4 B;  2HJ8 A;  4NJ6 A;  2J0J A;  4HDQ A;  4F7Z A;  1UZX B;  2MA9 B;  3SDL C;  3UQA A;  3T9L A;  2G4D B;  3DBS A;  3H7P A;  3TBL D;  4ZDV A;  1IYF A;  1P9D U;  2UWQ A;  1BT0 A;  4EFO A;  3PHW B;  2KMA A;  4BVU C;  1Z5S B;  1E8X A;  1WR6 E;  2D2Q A;  3RZW C;  4EZK A;  3TCA A;  2JF5 A;  2XK5 A;  3VHT C;  1IP9 A;  3UF8 A;  5KHO A;  2K8C A;  1UEL A;  2L00 B;  1TZ1 A;  4WJP A;  2KLG A;  3QAR A;  4FA6 A;  5C1Z A;  2L3Z A;  3RZF A;  1G6J A;  3A9J A;  3LJ3 A;  4LJP B;  2NR2 A;  1ISN A;  1XQQ A;  3GZN I;  4CO7 A;  5E6N A;  2BYF A;  1L2N A;  3IFW B;  2NBW B;  2MBE A;  1AAR A;  4IWP A;  3HM6 X;  3ONS A;  4KV2 A;  4K7W A;  4BKS A;  4GDL B;  2BKF A;  4HCN B;  2MW5 A;  3VXW A;  3DVG Y;  2WX1 A;  3WAP A;  5D6J B;  3M95 A;  2KFK B;  4HXD A;  2MBO A;  1R4M I;  3RD2 A;  1WR1 A;  1WX9 A;  4WJN A;  5FR6 A;  2GMI C;  3Q3F A;  2DYM A;  3VUY A;  4MJS A;  5JZE B;  3V62 A;  3MTN B;  1EO6 A;  4FJV B;  2N9E B;  4EUT A;  3TMP B;  2IZV B;  5AZF A;  1E8Z A;  4OVV A;  2ZPN A;  1UBI A;  3RUL A;  5DPR A;  3PSE B;  4GGQ A;  4JGH B;  4ZRJ A;  4AOF A;  2MBQ A;  4WJQ A;  3SD5 A;  1Y8R C;  2O6V D;  2MBH A;  4MGZ E;  1VD2 A;  2ZCC A;  1RFA A;  4FN2 A;  2LAS A;  2AYO B;  4NAW A;  1WF9 A;  2I1K A;  1V81 A;  3ML8 A;  1V49 A;  1LFD A;  4GDK A;  2DYO A;  2O6V B;  4RM8 A;  3QCA A;  5DPT A;  5AZG A;  3M3J A;  1XT9 B;  2BPS A;  3BIN A;  1EUV B;  2KTF A;  1YIW A;  4BFR A;  4EOY A;  3A1Q A;  3PHX B;  4DDG D;  4F8C B;  3AXC A;  3Q3J A;  2CR5 A;  1UGM A;  2MRP A;  2MBB B;  2Z0E B;  2JRI B;  3APF A;  3ZLZ A;  4NY0 A;  3VVW B;  4TV3 A;  5J2R A;  4OVU A;  2LI5 A;  3NZU A;  2DAJ A;  2JZ3 B;  4I6N B;  1WXV A;  3PLU A;  3ZRC A;  2GBM A;  3KH0 A;  1Q1O A;  4GOC A;  3R7R A;  3V61 A;  2N4F A;  5DCN A;  3OLM D;  1WX7 A;  3CSF A;  2N7D A;  1I42 A;  2MX2 A;  3A9K A;  1K8R B;  2KD0 A;  4IG7 B;  4JL9 A;  3R66 C;  3DQV A;  1D3Z A;  2MCN B;  2V4L A;  3ZUN A;  2FCN A;  2HD5 B;  3L10 B;  1J19 A;  1L7Y A;  1WJ6 A;  2CHX A;  3JSV A;  2KVR A;  2R2O A;  3ML9 A;  2G45 B;  1YQB A;  4GIV A;  2MWS B;  4ASW C;  1WXM A;  5J17 A;  3GOE A;  2KJ6 A;  2KAN A;  4MH0 E;  4W9G A;  2CKH B;  2K6Q A;  3NHE B;  3V60 A;  3PTF C;  4CHK A;  4W9I A;  4EZL A;  3RCZ A;  2R2Q A;  2C7H A;  2M17 A;  3VFK A;  4GSW A;  1KOT A;  1WJN A;  1ZW7 A;  2KWV B;  2KTR B;  3W1Y A;  1GUA B;  3ZRF A;  2K39 A;  2FIF A;  5G2N A;  3ZNH B;  2IO2 B;  1FXT B;  1RAX A;  1PQS A;  2QHO A;  2OOB B;  1NDD A;  4KDI C;  2D10 A;  1UH6 A;  3B08 A;  3UGB B;  2V3S A;  3VDZ A;  1GJZ A;  3U7D A;  1J0G A;  2IO3 B;  3PRM B;  3HIZ A;  1P98 A;  4URK A;  3ECI A;  2WWZ A;  4II2 B;  2O2V B;  3KVF B;  4CYE A;  2BWE S;  4HPL B;  4MDK E;  5C23 A;  2D07 B;  4GMV A;  4G50 A;  3KUD B;  3MJW A;  2LGD A;  4GXB A;  4M8N A;  2D3G A;  2DZM A;  3EHV A;  3H7P B;  3O65 B;  4FJY A;  5E6P A;  1E7U A;  5EDS A;  3QX1 A;  2BYV E;  1NI2 A;  2CHZ A;  1GG3 A;  2XEW A;  2LD9 A;  2ZCB A;  3H9D A;  4HPM B;  5L95 C;  2XK5 B;  4K7U A;  2LRW A;  1WX8 A;  4BKS D;  4WJO A;  4GN1 A;  2CHW A;  2IYD B;  2DZK A;  3AU5 A;  2DZI A;  4MGI E;  4EZJ A;  3PPA A;  1V5O A;  5TR5 A;  4DK5 A;  2M4N A;  3WA0 A;  1V2Y A;  2JVC A;  3DPD A;  4BOZ B;  2V1Y A;  3QJZ A;  4NNJ B;  3HK0 A;  1KJT A;  2WDT B;  2LWP A;  4TQ1 A;  2IBI B;  3VTU A;  3QWZ B;  3UIP B;  4FHJ A;  3OJ3 A;  1A5R A;  3K9O B;  4DWF A;  4EKU A;  4EEW A;  2L8J A;  1VCB A;  4KIK B;  4M0W B;  2KX3 A;  4ANW A;  4FBJ B;  4G0N B;  2N1W A;  2BF8 B;  2C9W B;  3NOB A;  4KSK C;  4MJS B;  3T8M A;  3W1S A;  4DDI D;  2GBK A;  1WGY A;  4G11 A;  2W9N A;  2KXJ A;  5CHV C;  3ZTD A;  4IUM B;  4RM9 A;  2KJR A;  2K8B A;  2NCN A;  1E7V A;  3QK0 A;  2K8H A;  4WWP A;  4WQO B;  5CX3 A;  5AZH A;  3LDZ E;  2ZVN A;  2KJH B;  2KHW B;  4MM3 A;  3DCG A;  3ZO5 B;  2KOX A;  4KZ0 A;  2OJR A;  2VRR B;  3B0A A;  3I3T B;  4IW0 A;  3RYT A;  3KYC D;  1V86 A;  1WGD A;  1WMH B;  3ZIM A;  2I1J A;  3QAQ A;  2REX A;  4K7S A;  5HKH A;  1OEY A;  4XX5 A;  3EC8 A;  2IY1 B;  3H7S A;  4GDK B;  4ANV A;  1WE7 A;  3EFU A;  1WZ3 A;  4WWO A;  2L76 A;  3KW5 B;  2FCS A;  3WAN A;  3ZDT A;  1YJ1 A;  2RR9 A;  3A1Q B;  4AWJ A;  4KSL C;  1LXD A;  1WFY A;  4GB9 A;  3VTV A;  1RRB A;  1GC6 A;  4B95 A;  3ENE A;  3OAW A;  2BWF A;  4GDL A;  3VUX A;  2ASQ A;  3L16 A;  4IC7 B;  4HDO A;  4X57 B;  2DYB A;  3KUC B;  2IO0 B;  1WIA A;  3DOW A;  4XC2 A;  3A4R A;  4E71 A;  3SU8 X;  2MP2 A;  1J8C A;  3PS6 A;  5D2M B;  1V80 A;  2J0M A;  3R3M A;  5BO4 B;  3A9K B;  1C1Y B;  3DVG X;  2L7R A;  3U30 A;  2ZZP B;  2Z0D B;  2DZJ A;  1WGH A;  1LQB A;  4IM2 A;  1EF5 A;  3JSV B;  4IM0 A;  2KO3 A;  3RUI B;  1GNU A;  2ZNV B;  3VH3 B;  1WXS A;  2LRU A;  3MHS D;  3A4S C;  1YX5 B;  3ZKJ C;  2Z59 B;  4W9H A;  3DBH I;  1WRD B;  2BGF A;  4W9E A;  1WI0 A;  4HK2 A;  1TBE A;  1P3Q U;  1WJU A;  2IY0 B;  4PYU A;  4LDT D;  1Q0W B;  3P2B A;  1XD3 B;  3L13 A;  3HHM A;  2FUH B;  3QIJ A;  1OTR B;  3PT2 B;  2O6V A;  2J7Q B;  2LVQ A;  5LLI A;  3UQB A;  1WM3 A;  4A3P A;  2B3A A;  2D11 A;  1CMX B;  2J0K A;  2K6D B;  3K9P B;  4LDT B;  4NJ7 A;  2FCM A;  2KKC A;  2M8S A;  1I35 A;  1T0Y A;  4WAA A;  2RGF A;  2NPT A;  3IHP C;  2XBB C;  3VAW A;  2EMT A;  4BKG A;  1Z2M A;  2MSE D;  2AEH A;  2PE9 A;  2JT4 B;  2C60 A;  1H8C A;  3X23 A;  2KWU B;  2LXA A;  1KLV A;  4A20 A;  1X1M A;  2NBV B;  4AUQ C;  4DHJ D;  4FUL A;  3BY4 B;  2JRH A;  2AL6 A;  2PE6 B;  4GU2 A;  4P7I A;  2N9P C;  1HE8 A;  3ZTC A;  1WZ0 A;  3ALB A;  4ICV A;  4NPN A;  2LGX A;  3W1S C;  3QQ8 B;  3N30 A;  3WAL A;  3KYD D;  1OEY J;  1OGW A;  2FCQ A;  3VH4 B;  1UD7 A;  1IPG A;  2K25 A;  3QHT A;  4MEL A;  3M63 B;  2NBU A;  3JW0 X;  5L83 A;  2FAZ A;  3X0W A;  3A9J B;  4AJY B;  1SIF A;  3V6E B;  1UBQ A;  2GBN A;  2KC1 A;  3A33 B;  3APC A;  3ZNZ B;  2JZZ A;  4NQK E;  3M62 B;  4NQL B;  1Q5W B;  2PJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...