5D96B

Oxidoreductase fragment of mouse qsox1 in complex with a fab fragment from an antibody targeting mouse and human qsox1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
b'DVVMTQTHKFMSTSVGDRVSITCKASQDVSGAVAWYQQKSGQSPKLLISMASQRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYAIPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfhydryl oxidase 1
publication title Overcoming a species-specificity barrier in development of an inhibitory antibody targeting a modulator of tumor stroma.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 214
sequence length 214
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d96B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d96B01
2OK0H 1CDHA 1QFWL 4GUPB 4JKKA 4RMWA 1KELL 3K46A 1QR1B 3HZYA 4JHZA 2FIKB 5E8OB 4OFYA 4XHJD 3G5ZB 3U2SB 1QLEL 3QUMH 5T1LB 2E8ZA 1WF5A 4GRWH 3QUYA 3WIHH 4F7MB 3SPVB 1HKFA 4OGZA 5I1GH 1X5FA 5EBWA 5H2BA 1OTTC 5I6XB 4F7CA 5GS1C 3DVIA 4JFDB 1EMTH 4WTWA 1T7XA 4KQ4L 4JREB 3F7VB 3QSKB 3V7MA 4RFNC 1LO2L 3W2DL 3BHBB 2CMRH 3VI3E 5FO8B 4LPYA 2PO6B 4C55A 3MGTA 5D96B 2XZAH 3RL1A 4JM4H 1QLFA 1HYRC 5E08H 4ZPTB 1RUAL 3KJ6L 1U93A 3B6SB 5IM7B 1IM9B 2GJ6A 1XF5A 4NP4H 1MFDH 3MODH 5KSBA 3D85B 1T4KB 2NY1B 1CFNA 3U48A 3VXMD 1GAFH 1N26A 3SDXF 3QFJD 1JHTA 3OGOE 3WBDA 1UXWB 5HHOB 3QXAB 2BMKB 3VWJA 2BFVH 5I71C 3ARBD 5DJ8B 1EGJH 1H8OA 3MZTA 4HKZB 1SM3H 1MFNA 3LKNA 4I18B 2J12B 3P30L 1X5AA 1JI1A 1QO3B 4UILL 1L4IA 3BP4B 3RDTB 3S98A 1SJHA 2BVTA 1UT9A 2O93L 4BQCA 1KTDA 3GSOA 5IFHL 3HKFA 4LSTH 4AYFA 3WDIA 3ZSTA 1T7VA 2ZUSA 2J5LC 3BISA 3BT2L 4YUEH 1TETL 2BDNH 1MAMH 1HHJB 4KJPC 4G80A 1ZS8B 4UIKH 4LARL 4X5WB 1NGWB 1ZA3B 4KJQC 1Q72L 1DANU 1S5HB 4YDJB 2XN9D 4XX1G 3IAGC 3KG5A 4NRXB 1NMAH 4OCWL 1RUQL 3ULUH 2F74B 4MNQA 1XCTA 1J11A 4ZOCA 4PJHE 4I77H 1CXKA 5CP3H 3K2UL 4TUOB 3RVVD 3RWIA 4Q9RH 2BNRA 4GRMA 1CFQA 4PLKC 3LEVL 2OR9L 3DXAE 1NFDF 3EOTL 3TCLA 5KBNC 4F7CB 3MR9B 5IROA 1Q0YH 3P4LA 1V7NL 1YYML 4JPVH 3WNOA 3D18B 2QKIB 4ODVH 5TJWK 1RURH 1GOHA 2R1YA 5T33H 3NPSC 1U2CA 2EEBA 4LK4A 1NMCB 5IW3A 3MA7B 3BO8A 5DDHA 1OARH 5C09E 3RWEA 3UTTD 5EBLA 4M1DH 3MBED 1QFWM 1MFBL 3PNWA 4HJJL 4PJ7A 4LLDA 3S6CA 2YWZA 3BW9B 2HRLA 1NLBL 5I8KL 1RK1A 1UKSA 1U93B 4XNQA 1KC5H 2FECI 3IT8D 4OM0L 1TMCB 4C83B 4K3GA 4TRPH 3U7AA 1XF5B 3V6ZA 2XQBH 3BPNC 2EYRA 5FGRA 3WD5H 1FVCA 1PVHA 1CFNB 5CKAA 4KU1A 4NCC1 1JHTB 1A5FL 1QSZA 1D5XB 1TJHH 1S5IH 4N9OB 4L5FL 4Y5XB 3VWJB 1FZKA 1PEZA 3AU1A 2IGFH 3IGAA 5T1KD 3RI5K 3WO4C 1CICC 5AZEL 2CRMA 2R2HA 4LIQH 5IK3B 4YHZH 1SJHB 2VC2H 1MFAH 1AGEA 1WIOA 4G6KL 3UJIH 1KTDB 3GSOB 1TTGA 5IVNA 4CU8A 3DVNB 4Z9KB 2HT4C 4YLQT 5CMAA 4B7IA 1E4XH 2VDNH 2WAHA 4HK0A 5DZLA 5FM4A 4KKAD 1FN4A 5EU6D 5SX4H 1JPGA 1FH5L 3QIWD 3RPKA 1HK6A 3VXUE 3C2AH 4TSBL 3Q48A 2BJMH 4YHKL 2IH3B 4YX2L 2ZNWA 4D0BA 1X5LA 1PG7H 4PJEB 1VEMA 4P4RB 1RV6X 3NIFE 3O45B 1CLYL 1DBML 3BPCB 4HH9A 1EXUA 1XCTB 5I1JL 5LGJA 4HGWA 5IGXH 4HGMA 2I25N 1CXHA 4QTIH 4U1KA 4JANA 3UC0L 3NZHL 2B4CL 4LP5A 2R4SH 2NY2D 4MS8C 2VZOA 3GSNA 2QSTA 5INCB 4PD4K 1F8TH 2X4RB 2H2PC 4KVCL 4RAVB 1OOAA 1DBAL 3MA9H 3O4OB 2D7TH 2EZ0D 4AMKL 3JWDL 3HCVA 3RWEB 4RIRA 4CL7A 3S96A 3PNWB 1TJIH 2AJVL 4LLDB 1MCPL 4P5MA 1VACB 1Z3GH 1MJ7L 5FGBA 5JUEL 4LCIH 2PW1A 4XNQB 1H3VA 3R0MA 2DMBA 4MQ7A 5TE4H 3ROLA 5TDNA 4FQQA 3BPOB 2QSCH 2EYRB 4QKXB 2NXZB 4X4ME 2J2ZA 2OL3H 1FVCB 3X11A 4DUXA 1OAUL 5F7WC 5L0QB 4JR9L 3P9LB 4YPJA 4ZAKB 3KPLA 5ESVB 2X9XA 4PIRF 1MCKA 1FG9C 2HTLD 5BV7L 3KYKL 3ZDXE 1YNLH 1FZKB 4QHUA 4J4PA 2YD3A 4R7NA 1RIHH 5FHBH 5ICYA 3MLSL 4WCYH 4MA7H 2O5YL 2EC8A 4ZFOA 1XF3A 1LP9B 3QJHB 1OP3H 5DZOA 4OB5H 2O26U 4OSUL 5DUBB 5D1QB 5CZKA 3CSPA 4ODHL 1QSVA 5CMAB 1QBML 1ZLSH 2YUVA 1IL1A 1CI5A 4DTGH 4D9QD 1FN4B 5GRZA 1KULA 5JLZA 2YEZA 1KJMB 3L6FA 1VEPA 4D9RE 4C56D 1MRDL 1BEYH 3ULVE 4U33A 1A6WL 1DTUA 4YGAB 4UT7H 5KVDH 4RMTA 4BZ1L 2FGWL 4MZ2A 3VFRA 4PGDA 1FLTX 1P4IH 1A4KB 4XT1C 3CLEH 4KKCD 4LVOB 3FO0L 1OGTB 1YC8A 3GJEA 3D3VE 4Y4HC 2XNAB 2AEQH 1FZJB 4YZFE 5LGJB 1FGNL 4TVPL 4HGWB 2CUIA 2DIAA 2O5ZH 3IU3B 4A6YL 4S1QL 3QRGL 4H5SB 4MAYC 4Z7WF 1MIEL 4U1KB 3ZKND 4RZCA 4PRHE 2OMBA 4S0SD 3GMPB 1R3HA 4XXCA 3GSNB 4Y0GA 1PGRB 1G0DA 2FJFA 3GI8L 1BAFL 1PYWB 1NH6A 3GO1H 5E7BA 1V5JA 3HE7C 4NWUH 5GRVL 1I8LC 4Z7VE 4PJGE 1B4RA 1NDGA 5IUSA 3WV0A 5TPWL 3I02A 4RIRB 1M1SA 2DIJA 2JIXD 3N1PC 3H3PH 3PWVB 3TN0C 5D1XD 3W39A 3S96B 3ZE2F 4P5MB 2H9GB 3EYSH 3DURA 3DMMC 5H8DA 1J8HE 1D9KB 3T0BA 4N0CC 1S9KC 4M5ZL 2BRQA 4QRRE 1NC2D 4UNUA 1NCCH 4JDTH 4Q6IA 2RHEA 3ESUF 3MJ7A 2OYPA 1A1NB 4PJ5A 1NCBL 4U2YA 3VCLA 1XIWB 4MYWB 2YUWA 4OD3L 5DJCA 5SWSA 4ELME 4KHXL 1RFDL 4NKQB 3VG0H 1C5BH 4QHUB 4Z7NF 4R7NB 3WIIH 5DJYA 3L3JA 4OD1L 1FBIH 4DOHE 4YHMH 5CJQL 5IF0B 4PR5A 3P0VL 2MPAH 5MP6H 4L9LA 4OLEA 4ZFOB 2I27N 1RJYA 3GMMA 3SE9H 1XF3B 4GG6E 3W81A 4JG1H 1MSPA 3SKUD 4KUCD 4F15C 1LEGA 1S7XA 3W11D 1IC1A 4U6VH 3PDOA 2J8UE 1IL1B 2X9YA 3TBVB 4P3CL 5DK2A 4QNPF 5F7LB 3LRHA 4X6FB 4HDIB 2XQYG 3L3KA 4NN5B 4NQUA 1KSRA 2FH6A 4KDVA 3S5LG 4HWNA 1I7RB 1HHHA 3EDKA 3EYFA 4HUVA 4OZGE 3KR3L 3HNSL 2ESVE 3GJEB 4LSRH 4LRIC 2Y5EA 1RZ7H 4FQIH 3OPZH 3H9SE 1MLCA 2CRYA 5I0ZA 3H42L 1PZUB 1T6VN 3V4VH 1T0MA 2P5EA 3DOSA 2IQAB 3LKQA 5BQ7B 3FMGH 1L6ZA 4CNIB 1XR8A 3KHQA 4XI5D 4AH2B 4Y19E 5IFJA 2E7HA 4XPBH 2YUZA 4XPTH 4Y5YB 5ENWB 4X0KA 5HYJB 1AR2A 2VDPL 2P46B 4JQVC 2FJFB 4IMKA 1KJ3H 1IC5H 4PRIA 3AROA 4B0MM 3KPTA 2IPTL 1CDBA 2R0WL 4NQEE 2WANA 4HIXL 4JG0L 3QDJA 4XVSH 5J57B 4P2OD 1ZHKA 3QDGB 5FYLE 2JB5L 3W39B 2IBBA 2WK2A 2FLRT 4KK8C 3IFLL 1P1ZB 3DXAD 5JHLH 3C87A 4NQSB 3BGFB 3BP5A 5T1DL 4RMUA 5B22A 1UGNA 3X13A 4HXAL 2FECL 2BY0A 2VDQL 2VXSL 4OV5B 1IM3B 5KVMC 3BKMH 1A14H 3TGXA 4W81A 4YE4H 3RWDA 1QQDA 3MJ7B 3ZKQD 1F11A 3EJJX 1BLNA 5CWSB 1NBYA 1SBSH 1CTOA 4UV4H 5C09D 3VCLB 1TCRB 1HOCA 4OFKA 2APVA 3KNBB 4NC1C 5DF0A 2NYYD 3ALXA 4I0PA 5DJYB 2NY4C 4TTGA 2LVCA 1HHGB 4IEFB 1MCBA 2UVFA 1D6EB 4HIEA 2HFTA 4L9LB 4BQ6A 1LE9A 4PD4J 4KXZI 1RSFA 1LEGB 1KFAH 1S7XB 3BZFA 2JF1A 3U0PB 3F7QA 4PJDE 3VGBA 2P8LB 3Q5OA 5HGAA 1S7VA 1WISA 1Y6NR 3G5VA 5DK2B 4LF3A 5IKCA 3MV8E 4CRPA 2YA0A 2CO7B 4RX4A 4JVWA 3IS0X 3BUYA 2CK0L 1OP5H 3B8YA 4JRXE 2XWBA 4JN1L 5JMRA 1RU9H 2C1OA 5HY9A 4MJ4A 1HHHB 1K4DA 2W9DL 4HUVB 4GKOA 4P46B 3PHOA 5GRXG 1CVSC 1YDPB 3G04A 1F6FB 1HINL 2NY0D 5L2JB 4NSKA 4PJXE 4GMTH 2XZQL 2P5EB 3LKQB 1BM3L 3VXUD 1XR8B 3T0EE 1TVBA 2R0LL 4EI5D 5IFJB 3DX8A 4WTZG 4XPAH 5J3HC 3LKSB 5L9DL 1ZK9A 2QQKH 3PHQA 2Y36L 3VFWA 1ZLUK 2AJ3A 3TVMB 3LD8B 3IDYB 3UO1H 2YMXL 5DJXA 5IB2B 1T5XA 4XVUD 4ZS7H 2EXYC 4MA8L 1MHEB 3QDJB 2NTFB 2OJEA 4PB9L 4AG4H 1G6RL 4KROB 1ZHKB 3G6JF 4WI4A 1EEUA 1X5YA 2OSLB 4Z7UB 4HPOH 2I07A 4ZO6A 2CK2A 1E4KC 1FAIH 2V2TA 4J3OC 3IDNA 3WIFB 4DZBA 4HUXA 1MRFH 2A6JA 3LS5H 1BZ9A 4UT6H 2AV1A 3UCRA 5EC2A 5EPMB 3DSFL 1A21A 3PWNA 3EYOA 2B0SL 4PPTA 1OAZL 1UWXK 4LQFL 3RWDB 1QQDB 5GS2D 4OQ1A 3R06A 1F11B 5BO1L 3MLVH 4L3EE 1X9QA 4G8IA 1HOCB 1K6QL 4O00A 1CWVA 5DMKA 4BFIB 3SGJA 2ERJC 2OS7A 3PL6C 2IG2H 1V3LA 3S4SA 4JFEE 2B4CC 4OGAC 5I1LB 43CAA 2R4RL 2OLDA 2HJFA 2E27H 5F6IB 4M8QA 2NY5L 3GHEH 4HWUA 3SDDA 2BY2A 2WBJD 1LE9B 3DUHA 4EUPG 3LQAH 5L8JB 2QQNH 2X4OA 4OT1H 1JRHI 4HFUH 5HGAB 4UBDD 1S7VB 5IHZA 3JWDC 5E8EA 3BUYB 4QOKA 3ARRA 3FFDB 5DHVA 5ESQA 4PB0L 4J1UB 1HHIB 3ARGD 2B5IB 1AE6H 1IC7L 5I1AB 4EVNA 3WE6A 3HE6C 2IF7A 1SY6L 1JNNH 2C1OB 2Z92B 4RISH 3C60C 3O2VL 2YSSA 3F5WA 3V7AE 2X89A 5IHUH 4ZUTA 2PYFA 1BBDH 4NSKB 4JFFA 2F5BH 1QRNB 1VPOH 3MRPA 4EIZC 4GFTB 3ILQD 4LKCA 3V52L 4ZOBA 3A6CH 3BPLB 3QXVA 5BV7C 1S9WA 5KVEH 3ULVD 4ZSOE 5J7CC 3U9PH 1TVBB 3TA3C 1NEZG 4RDQG 5DURB 3UTOA 4F9LC 2V5SA 3PHQB 2YPVH 4U1LB 1L7TL 2V6HA 3GSXA 2DKMA 2VABA 2AJ3B 1F3RB 3I6KB 5C6TL 2JJTA 3KPPB 3WHE0 2YR3A 3D3VD 1UA6L 1YY9C 4DUWA 5DJXB 1JP5A 1T0PB 4CU7A 2OJEB 1A6VL 2JTDA 2CLZA 4YBQD 1NL0L 2NW2A 4ALAL 4EEEA 3U36A 4MAUL 1XGYH 4B41A 2I07B 3IFNL 3PQYE 4KKLD 4D3CL 5D2LA 5KS9F 1OSPL 1X44A 1JZ3A 1T7ZA 4DZBB 3FO9A 4PBWD 4LFHD 3H0TA 3HFMH 3O0RH 3QCUH 4HUXB 1PZ5B 4TSAH 1BZ9B 4UTBL 2BSED 3O4LE 3PWNB 3O3AB 4GKZB 2VXQL 3B5GA 3X3GH 4P23C 5CHNB 3W2DH 1NJ9A 3U4BH 2W1NA 4HK3N 2VDRL 2FDBP 2G2RA 4AQOA 5IMLB 4G8IB 1XFPA 5AG8A 4C4KT 4F37K 5FCUL 1OGAE 5DMKB 4NFDA 4OI7A 1HHKB 2FLBT 1Y0LA 5HHXL 3RL2B 4X7EC 3U30B 1J8HD 5M94B 3U7WL 1R5IA 5E00B 4M8QB 4NHUA 2F54E 3TT3L 2VERN 3O2DH 2XRAL 3OJDA 3SDDB 1BOGB 2V5YA 3GMNB 1U8IA 1ZTXH 1H3UA 2IMNA 5EUOF 4IJ3C 1UB6B 2XTJC 5D5MA 3T65A 4DGYH 1RZ8B 5E8EB 4AENA 5D7IA 1ORQA 5ESQB 4YWGH 5KG9B 5B38B 3OX8A 2O61A 3KPRB 2KPNA 1KN2L 4F2MA 2DQFA 4O2FA 1AR1C 2ORBL 3K8LA 5DT1H 1JZ2A 1MAJA 1EUTA 3CFCL 1ROWA 4K7PL 2EDXA 5ABDE 3MLYH 2Y6SD 4LDLB 2PXYD 3MMEA 3WJJA 3T3MF 4PJIE 4LARH 3U4EB 4HLJA 1VADA 5SX5K 1Q72H 2UWEB 5KJRL 2H2SC 3CUPB 6CGTA 4IIQA 4M7JH 3DX9A 4I4WA 2ESVD 4WVRA 4C58B 2KQMA 2VLKB 1X5ZA 4FQCL 2LU7A 3H9SD 3QNXA 4JDVA 3V4PH 1X5JA 4XPGH 1NAML 1EK3A 2CLZB 3CFDA 3K2UH 1AIFA 3U36B 4X8XA 4Y5VC 5TH2A 3RWFA 4Y19D 1NMBL 1BD2A 1V3JA 5D2LB 2OR9H 1DE4A 3VWKD 3EOTH 3O81A 1DLFH 3FO9B 3H0TB 3RBSA 4Y4KA 3DVGA 1QKZL 1V7NH 4Z78A 2CXKA 2WUCH 4NO0A 4XBEH 5I1EL 2VTFA 1F4YH 2YRLA 4NQED 5DR5L 5KZCB 5I15L 1W72B 2J8HA 1NJ9B 1NANI 3CX2A 5D2NE 4O51A 3L1OL 3QFDA 2ADFL 1K8DA 1Y0LB 3MX0A 1NLBH 1QUNA 1MOEA 5I8KH 5JO5A 5IK3A 1GGCH 1U8KA 3GMOB 5D7JB 4RFEA 3P73B 1R5IB 4OM0H 4GKNA 4NHUB 4L4TA 1YMHB 3EO1A 4MVBC 3SO5A 4NKMB 4FOMA 1NUDA 1U6AH 5JA8B 3EDEA 4YXKH 3ARPA 5HI3D 1KTKE 4Y4FC 3SCMB 4WFGE 1LDPH 5D5MB 5L6YH 5GS1A 3RKDD 5C0GA 1ZANL 4BQ8A 4BSVB 5IR1B 5D7IB 1ORQB 3KPMA 4HZLA 4XP5L 4KK5D 1SEBB 3QG7H 4AL8H 1TFHA 1E4WH 3VE0B 4PJAA 3OX8B 3KPSB 3TNMB 4F2MB 4X6DB 2ATPB 1NGXB 1NBVL 2CH8A 2DQFB 4O2FB 1OTSC 1OAXL 1HIMH 4I13B 2JJUA 1GRWA 4P59H 3IFPA 4DGIH 1XZ0A 1QFUL 2VLJE 4ZUUA 2CR6A 4OBRA 3HC4H 3MV8D 1OCWH 2JELL 4QGTA 1WBYA 1BVKA 4X99B 4MJ6A 4M03A 3MMEB 1JVKA 1QR4A 4KRPB 4LSSL 4JRXD 3MO1A 4FXGB 4ODUB 1SHMA 3U7YL 1P2CA 1JGLH 1UZ6F 1IAII 4P5TC 2DTML 4D0DA 5F7MC 5I0DA 4M9OA 4EN3C 1CLYH 3Q6GH 3IDMA 4I4WB 4LBEA 1EZVX 5DRXB 4X4XB 3FT3B 1CFSB 1JNJA 4YFLI 3FONA 1WWAX 1EFXD 4WDIB 5EIVA 2CKBL 4LLMB 1GC1C 3QEUA 4XNYL 3ALPA 3TO2A 4DVBA 5C0IA 5TGBA 4RWYL 5DWUH 3T0ED 1BD2B 5LBSL 1NCWL 1CGUA 4FQLH 5EUKB 4PBVC 1FFOB 4HWBL 4Y4KB 1U41A 2VQ1B 1A6UH 2A6KA 4Z78B 4NO0B 4RGMB 2BVPB 4OF8A 3TJHC 4KRNA 3B9AA 4JY4B 1QLRB 2RJMA 4H1LA 5I18L 5IVXA 2PR4L 1J1OL 1WICA 4O51B 2EDRA 3QFDB 2AJVH 2IADA 1MCPH 3SDCD 3LZFL 5TQ2H 1K8DB 3L7FB 2N7BA 3E3QC 4ONGH 5HGHA 5JO5B 3QEHA 2MMXA 4RFEB 4XMLH 4N1HB 5EULV 1QSFA 5F3BB 2WIIB 4ZG1A 2D0FA 1AFVH 2BHYA 3CZJA 3TT1L 1EV2E 1LMKA 1ZLWH 3FCTA 3K74B 5T5FL 4L3ED 1QPPA 5DJAA 1T2XA 2EXWD 1JRHL 4Y1AA 5BV7H 4DUVA 1CF8L 4KKBD 5IB5B 4ZNEA 4WJ5A 1U91B 4Q9BA 5C0GB 2HH0H 1VERA 4E42B 4JFED 3BH8A 1GL4B 3IDXL 1FO0A 2X4TB 3D0LA 4PJAB 4J2XA 2EH8L 1BQUA 1IT9L 3PGCA 1MUJA 1EVUA 2HFFB 2ZUTA 2DLFL 5TDPA 1UWEL 1GPOH 1FNHA 2DYPD 3GKWH 5BS0E 3IFPB 4JO3L 1XZ0B 4ZUUB 3MRLA 1N3NA 4P3WA 2YBRA 4B5EA 1WBYB 1JMXA 1BVKB 1BWMA 4KQ3H 1FIEA 2XWJA 4R6UA 1DQLL 3QRFM 3QAZC 5F3HA 1P2CB 1KYOK 3H3BC 4WFEE 2ZG2A 4D0DB 2WUBH 4M02A 4K07A 1KCVH 2DQTH 2NY5C 3ARSA 4WUUE 4LBEB 1FSKC 3QZWA 5F7EH 4Q0XL 2GUOB 4UNTA 1G0XA 3DYMA 3QEQA 2DLEA 3QRGH 5L88L 1P4LA 3P0YH 3W5MA 3GMRA 3TO2B 2CSPA 3E2HB 5TGBB 4Y2DC 2GJJA 15C8L 5H37H 4MNGE 2VITB 1JWSA 5FYJH 4M5YH 5IBUG 4FTVE 1IGML 1PY9A 5J1AB 4PJBF 1YMME 5DUML 4GW1B 4UTAH 1QSEE 3X12A 4JFXA 2FATH 1LK2B 3UAJD 5JDSA 4UOW0 3DARA 4DGVL 3MNZB 4V2BA 3BDBA 3QIBD 1I1YA 3KYMA 4M4PA 3P40A 1FPTH 3PQYD 1HILA 2IADB 1AKJD 1X6LA 2E5EA 3M17B 5HGHB 3QEHB 4WW1A 4PJFB 5FXCH 5GS2H 1DJSA 1ACYL 1FNEA 3KYOA 1QSFB 3TNNA 2AQ1A 3O4LD 2Z8RA 4GS7B 2F15A 2X9WA 3BQUC 3E6HA 3QUZD 4Z18A 3VXRB 3HB3C 1PX4A 3FQTA 3SDAD 3D9AL 4P0DA 5J89A 1AXSB 1SVZA 3OKMA 2P24A 1J0YA 4Y1AB 2E6JA 4Z95L 4O9HL 1OGAD 3CFIC 4R26L 4PJCA 2RR3A 5KVFH 1VGKA 1N8ZB 5JW5A 4P2YA 4QHKJ 3EOBA 3BH8B 3DBXA 1FNGA 3BH9A 3U0TA 1PKQE 4TUJA 1INDL 2DIBA 3EYVA 3PGCB 4NM4L 5TDPB 4F8TA 1Q1JH 4JAMA 2DLIA 4YO0A 4CVWA 5B4MD 5ID1A 2A73A 4I0KA 4RMRA 4XC1H 1F58L 1SJEB 1N3NB 1NCAH 2JK5A 1MH5A 1WLHA 2NXYD 2YBRB 4N8VG 5DMIH 4JDZB 2VQTA 3BMWA 1WAAE 2X42A 4R96A 1IGYA 2XWJB 4DCQB 2NMSA 5AYUL 3FQWA 1KIRB 1XAUA 5EORH 1DQMH 4OZ4A 2X1WL 3W0WA 4XWOC 4JY5L 4M1GL 4P2RA 3HG1B 1W8OA 1MCOL 3KR3H 2X7LA 3QZWB 1X5XA 1MAKA 4CBPA 3WO4B 3ULVH 1IJ9A 3QEQB 5C0JA 4EDXA 1P4LB 4DEPC 1OL0A 4XAWH 3C09B 5CUSL 3TBWA 3GGWB 3SDXA 5GZNC 4ZO7A 5AUMA 1JWSB 4MQTB 5EFIA 5IEKB 5EU7C 4LKXA 5IOPA 1Q9OA 3ARDD 3QCVL 5T3ZL 3T3PE 5J0BA 5JW4M 1JPSH 4MCZB 4ZXBC 3BSZL 5DD0H 5HI4C 4OCSL 3T0XA 3OJMB 1KCRH 3M8OH 3RY6C 1JMZA 3V5DB 2FZ3A 5JDSB 1NGQH 4FNLH 1J9CT 1RZKH 4DQOL 1CQKA 3KYMB 3IFLH 1YEHH 1HILB 1T3FB 1O7VA 3CXHK 3T08A 5LG1A 5I76A 4FQXB 1P5UA 3UTSB 3SE8L 4V1DA 4U49A 5I2IA 2X05A 2P7TB 4R90H 4N0YL 2DQGL 5SWZA 5I1DA 5TQ0H 1AI1L 2VDQH 4N0UE 3MC0A 3TNNB 1JNHB 4OM1H 4MAYA 3RIFF 1KB5H 2D03L 3U1SH 1C1EL 1QNZH 4JM2C 2IWGA 3IXAB 1G84A 4G5ZH 3OKMB 2P5WE 2QADB 4ZOAA 2P24B 1EEZA 1X5HA 4M43L 1U8NA 3IDUA 1JFQH 5F21B 3VFNA 3RY4A 1KPUA 4FQJH 5JW5B 5F7DA 1T03H 3V6FB 3P9MA 3HE7A 5F88A 5MENE 3BH9B 4LHUD 4OJFH 3U0TB 4TUJB 3MRCA 5I30L 4L1HA 1NFDA 3HMXA 3UBXI 2RIKA 1GC1H 2A9NH 4YHLH 2GK0B 4YHNA 3UTQA 1A02N 5JHDE 3DMMA 1HH9A 3G6DL 2JK5B 1MH5B 3C5JA 3LAFA 4G6FB 5FUCC 2P44B 3VXNA 4LEOA 2XIDA 5EC1B 3VG9B 4MD5A 1DUZB 3C5ZD 3Q6FB 5LJYH 3CH1A 3FQWB 4FQ2H 1IKNC 4HIJB 1FIGL 2C3VB 4YGVB 4RGOL 1IAIL 2DJUA 3ARBC 4OZ4B 5D7SH 5E4EB 4P2RB 3MRDA 3Q3GA 3HAEH 3SOBH 1GIGL 4QXUL 1XT5A 4XP6H 1AXIB 5C0CA 4OFPA 3JSSA 4HULB 4QTHA 2VLJD 2FSEB 3D6GA 3TJEL 2F19L 5C0JB 2GJ6E 4EDXB 1JN6A 5KSBE 3GB7A 1RULL 2VIRB 3ZTJH 1FL3B 3JV6A 1Q0XL 4HAFA 5AUMB 1G1YA 1R5WB 5DRNA 5EFIB 4XBPA 1N4XH 2Y5TA 1Q9OB 3WNLA 4PREB 1J10A 2FX8L 5CD3A 3TLRA 5HI5C 2BSSA 2YMXH 1T1ZA 3FQNA 1I1RA 2PTTA 1M05B 1KV3A 1MI5A 3BDYL 4PRNB 5D6DC 4PB9H 3O11A 4Y16D 5E95B 3TCXA 2APWA 3L5IA 4U1MB 3I75A 1MWAB 2GCYA 2Q86A 2YPLB 1LWRA 1Q9KA 5I76B 1SJXA 3CSYA 4LRIA 4V1DB 1U8LB 4NZDA 3RHWK 4NO3A 3ELAT 3GHBL 1BQLL 1CK0L 2HFEA 5FYLH 3TBSA 2HN7B 2FD6H 2YK1L 4POZD 5EOCL 1OAZH 3WN5B 5DLML 3RGHA 1KYOJ 2EDKA 4P49A 1K6QH 4Y8DC 5GS0H 1U8NB 5HDOA 3CC5A 4KI5E 1KPUB 3UYRL 3B9KC 1A6TA 4MNQE 3TF7C 2H1PL 5F88B 1LEIA 2G5BA 2X4QA 2KQNA 3NOIA 5JW4N 1MHHA 4FXKA 3T1WA 2JJSC 3MRCB 4IBLT 3SJVD 5E2WH 5IJVA 4F9PC 3IFOA 3C8DA 4O5LH 3ZMRA 1OAKL 2BNRE 1CD8A 1NFDB 4L29A 2CXGA 2VR9A 5I75B 5BVJA 4WO4D 3O9WC 3TO4C 3O8XC 3V2AR 3UTQB 3RTQB 2F58L 3TZVC 3CFEA 1HH9B 3FQRA 4Z76B 3D2UA 3C5JB 2AGJH 5B39A 4BSWB 3WFHB 1FZMB 4LEOB 1KEML 1O5DT 1D5BA 4KUCF 4FZ8H 3LVEA 3IRPX 2E7CA 2BNQB 1ZWIA 1M7XA 2C5DC 2CDFA 3O2VH 2VDOH 1RHFA 4UB0L 2H45A 4XH2A 3MRDB 4ZFFA 4JCMA 4PJ7E 5I8EA 2COQA 4AIXA 4S1SH 5BS0D 3E0GA 4QTHB 2MCPH 3GK8H 3ZTNL 3MQIA 5KOMC 4JPWL 5FFLA 5DD3L 4IS6A 1A9EA 4LNRB 3GB7B 1AJ7L 1U8QB 5ETUA 1VSCA 2QTEA 4KKAC 5IJKC 4XCYB 2DS4A 2VQUA 3GMLA 4WFED 4G3YL 5DRNB 4XBPB 3T8XA 5FO7A 2PYEA 2X4NA 4WUUD 1CLCA 5I1IH 4K94H 3EOAA 3CZFA 3FQNB 1MJUL 2EDLA 3B2VH 5D1ZC 4X7SL 4Q7DA 3U6RA 5EZLA 2PTUA 4TYUA 4N5UA 2A74B 3VD7A 2Q86B 3ZKMD 1R3LA 2F53D 2A1WH 5E2TL 4YFLF 3VGAB 4OGXL 4FTVD 5KTEH 2AP2A 3SHSA 4EBQL 2KKQA 5C0NC 1YMMD 1QSED 4S1RL 2HFEB 4XB7A 3O3EB 3TBSB 2MHAB 1HI6B 3UYPA 3DRTB 4C4KO 2VXQH 4ONOA 1J18A 4E41E 2AEIT 1H8SA 3V9FA 3GI9H 4TVSa 4KK9D 1TTFA 4U1HA 5KSAB 5DFTA 1CDIA 1B4JH 5I74C 3AS1A 1YEIL 3CC5B 3FB8B 3CAFA 2YXFA 2Q7YA 2VDKH 3M1BA 2EE9A 4FFWC 2FYYA 4H88L 4RGNE 5C0BE 3SE4A 2R39A 2J1KA 2R1WA 6FABH 3U7WH 4QY8A 2G75B 4Z7WA 1NSNL 2Z4QA 1MHHB 5HHQA 1CU4L 2ENSA 3WXWH 3ZKXC 3RZCA 3CNKA 5DD6B 3Q2CA 2MFNA 3CDCA 1RIVL 4ZTOH 3PG2A 4L29B 4MDIA 5BVJB 2P4AB 3QCTH 3QR2A 5K93A 5T3XL 2NY3D 3JWOL 4JO2L 5ADOL 1D5BB 2BOCA 1NAKH 2HTLC 2B20A 2EO1A 5C7XL 1ZWIB 2CDFB 1T2QL 4WW2B 1G7JB 3QQ3B 4KK6C 4PJ8C 4XH2B 3ZDZE 2XWTB 3HC3L 4FP8L 4P4KC 1MVFA 3MRBA 2CDEB 2XYCA 4HUWA 4U0RB 3PL6A 4OD2A 3AS2A 2DBLH 1H15B 2WLYA 3PV7A 1HSBB 1HSAA 4HD9A 4NN7B 5LCVL 2V2XB 1L0QA 1A9EB 3QUXC 1JGUH 3ILPB 3NPZB 1A7OH 5GGUA 5ETUB 4P9ML 2J88H 3KJ4C 4JE4B 3IF1A 4ZO9A 1Z5LB 1I9EA 3GMLB 4WI3A 5C0EA 3QI9D 1LO5A 3O2WL 2X4NB 3MLXL 5DQ9A 2EYTA 4XVTL 4QXGH 3LIZH 3DROB 3MNWB 1M71A 4NUGH 1IZJA 3H7BA 5EZLB 4KTYA 2ED8A 1QOKA 3VDCA 2DQIL 4YDIH 1FCCA 4RSVA 1NMBH 3GSWB 3WSQH 3V6OC 4ENEC 1CFTA 2VKWA 2XOTA 3NIFF 4ZD3L 1ACZA 1R3LB 4CAGA 2B7DT 2Y07H 4JKPL 2HG5B 4HJ0D 1JPTL 2DF3A 5DUPH 3GRWL 4DVRL 2VN4A 4ONFL 1IGCH 3FOLA 1FDLL 4H25A 3F62A 3IKKA 2YS4A 3TA3A 2VXTL 3VFGL 4U1HB 1DL7L 4YHIA 4EKXA 3L1OH 1GGBH 1X5IA 5C08D 2ADFH 5HHMB 1CL7H 4FFVC 2FYYB 3EJZC 1JTTA 2OQJA 2R1WB 4Z7WB 4UT9H 2Z4QB 3RGVD 3EYUL 3RZCB 1F90H 4XCFL 4G6AD 3LDBC 2FHFA 2OX5A 4JKWA 4QF1A 4XCNA 4KXZH 4MDIB 4PY8J 1A1OB 4GG8A 2P5WD 3UTPD 4JO1L 5CS7A 4WEMB 2DQDH 2BVYA 5HYFA 4OFYD 5KW9H 5TFSL 3C6LC 4NGHH 4X80L 5MEND 2BOCB 3B43A 3AFLA 2JLLA 4K3DL 4P23A 5HYSA 1CGYA 1QRKA 3QUYD 2FBOJ 5D8JL 4J3WA 2BVEA 3T0WA 1OP3K 2W65A 1OAXH 1A47A 2BHZA 4NN6B 4A6YA 4WWKD 1ZA6A 4OD2B 4JHAL 4R2GD 1WT5C 3BGMB 1IBGH 5JHDD 1I4FA 3CFKA 4FFZH 1HSAB 4PJEF 4U0QB 4WU5B 5GGUB 2YD1A 3RVXD 1FNAA 1UH2A 3SKOA 3NCCB 4PJ5E 1F13A 3G5YA 5C0EB 2DTMH 3THML 3T2NH 5SWSE 2QQLL 4W70A 4FQHB 4NOBA 4POYA 2C26A 3S5LB 3MREA 2OI9C 5C71A 1OTUC 2EYTB 1A7RH 3UPCA 3H7BB 2GJ6D 2AK4A 1LK3L 3PWJB 2FNBA 4LU5H 1I7UA 2YN3A 1IC4H 4ZFGL 1KCUL 5ANMA 4ZNCD 2W0FB 3PE9A 1L0YA 4IRZH 4YXHL 4QWWD 4UINH 3MJ9H 1M7IB 4XI5C 5DQDH 5ALCL 1IAKB 1MJJA 2HKFL 5IQ7L 3DVFA 3O3DB 3PV6A 1XF2A 1P7QA 1YNTA 2XFXA 2DQJH 3QXUA 5IG7A 4JREC 3AREB 5JXEC 4RBPK 3S7GA 5CIPB 5C8JA 2WLZA 1ETZA 2GT9B 2ADIB 4LLYB 2M8XA 1XF1A 2PO6C 4XRCA 3RUGF 5D96C 1WSST 5DMGC 5EDXA 4PJGF 2NPLX 4IRSA 3TT1H 2Z31B 3A6BH 4OZHB 2J6EH 2OTWB 4Y5VA 5J6GA 4HX1A 4K71B 5FYKE 4X7FC 4UUJA 1AD0B 2NY1C 1HE7A 4PRIE 2L7UA 1LP9F 4KI5D 3OV6A 4MNQD 1J0ZA 1ZSDA 4LFHG 4K23L 4XTRC 3V8OA 1ZHNA 1YEKH 1YECH 3DV6B 2JCCF 3G6JA 1IT9H 5HYSB 2XACC 1L7IL 4I18C 3JWNC 5ISZE 2NYYC 2BNRD 2AXJA 4ELMF 3DTXB 3RDTC 1U3JA 4A6YB 1ZA6B 2FL5A 1P7KA 5EU4A 4EUPA 4OF0A 3CFKB 5FK9A 1A64A 1UJTA 4M00A 1AY1L 4PRAB 4P3DA 4U6XA 4GG6F 3NFNA 4NBXB 4DAGH 3SKOB 3JZ7A 4QRPA 3ARYA 2J8UF 3ALWA 4Y4FA 3S34L 1CD0A 4H0IA 3MREB 1JYWA 4Q0XH 2HLAA 3IB4A 4ZUVA 4NZUL 5GGRA 3FRPA 5EZJA 5DJDA 3ZE0E 2CPCA 3SGEH 5FGCE 1OM3L 3GSQA 1XEDA 1I7UB 5C2BH 4CN1A 5ANMB 3L3IB 5DA4A 5E6IA 3TIDB 4Q2ZA 2AJYL 2VLLA 5C07E 4NQDD 2GAZB 4H26A 3UBXG 3S37L 3IJYA 5EZIL 1DQDL 5DA0B 4TTDC 1ADQH 1MJJB 2NX5E 3HAEG 4HFWB 3PV6B 1XF2B 1YNTB 2XFXB 3VRLE 5ELIA 5IG7B 5INDA 1FZOA 1NMCC 1S7SB 1A2YB 4FS0A 4L4VA 1T21A 3MLUH 5C8JB 1ETZB 2VZTA 4FFYH 4M7LT 4EN3A 3ES6A 2AV7B 3HI1A 4LVHB 4E0RB 1YYLH 4HF5L 4XRCB 3VFVA 2MSPA 4N90E 5F7UA 2DRUA 3MLTA 3ZTJG 4IRSB 5A2KH 5GSRA 1UZ8A 2OXGA 2EDQA 3LSOB 3MUJA 1OSZB 5CZXD 3CCHA 4IRJB 3B5HA 1DUYA 3D9AH 4TNVK 3OAZK 4E41D 5J6GB 2YD5A 4Z95H 3I50L 1G7PB 3ORJA 4PRPE 1HCFX 3QP3A 5C2UB 1ZSDB 5C0BD 4RGND 3GUTB 1YEJL 4I1NB 4Y5XC 3HR6A 3VWJC 1ZHNB 4XP1H 3PDGA 4P5KA 4U3XA 3HRPA 3E6FA 4NM4H 2W9EL 5C6WH 5E5MA 5JW3L 3PP3K 4YDVB 5KS9A 4JLRB 4GRLB 3FT2A 1YEEL 5GZOD 1P7KB 5EU4B 2HVJB 4EUPB 1F58H 4HG4K 3QXWA 3KDMB 1UM6L 3O3UN 5FK9B 1K8IA 5AAMA 4L3CA 3MLWL 3MFFA 2FBJH 3ABZA 4U6XB 1OP5K 5FV2A 3NFNB 4CVXA 3S88H 1KEGL 1UYWH 3WFDL 1MQ8A 2BVUA 2VMFA 4KHTL 1U3HA 1XH3A 4QRPB 4NKDA 1PG7W 4PJDF 1TZGL 3OWEA 4HBCH 1MCNA 2DJ4A 5CGTA 3ARQA 5F96L 3B9EA 1G6RA 3CJJA 4WIQA 1L6XA 4CGTA 5JW4R 5BZWA 1OD7A 5DJDB 3WFBH 3TH2T 4JFOA 4U6YA 1BF8A 3OKLA 5CUSH 4IDLA 5EUOA 3MXWH 1A3LL 2OJZH 3JWOC 5E2UH 5E6IB 3NA9L 5CEZL 1NEZB 1SYSB 4P9HL 3C8KB 1F2QA 3VFTB 5T3ZH 1YUHA 1I1AB 5A16A 1JUFA 5J11B 4QOKE 2YUXA 1LEKA 3EUUA 4OKVA 5C0DB 2P8MB 3WMSA 1FV1A 1S7QA 4J6RL 3FT4A 1FZOB 4P2CG 3O4OC 3S35L 3ULUE 3ARXA 2CLRB 3WL9A 5MERA 3V79C 1T21B 2VH5L 5JIIA 3ES6B 5K9OB 3HI1B 3O6ML 5JOFA 3K3QA 3SE8H 4JZOA 3VFVB 2R56H 2DQGH 1T1YB 1TZHA 4JFFE 2B1HL 5F9OH 1UZ8B 3QDMA 4BUHA 2IALA 1INEL 1ONQB 3SN6N 4ETYA 1DUYB 1FRGL 3ZLQC 3BPOC 2X09A 3N85L 4A2MA 2NXZC 4M43H 1NFIA 4U1JA 3VMOA 4KV5E 2EH7H 5L0QC 3OKKA 4ZAKC 4WGVB 1L9NA 3NZ8A 4QCIA 1SY6A 4WU7A 1DBJL 4MXQD 2HTKC 1J1XL 2EDEA 4M7LL 4KGLA 4YFEA 4GJTB 1Z0MA 5EO0B 4KJYA 4P5KB 5JXAH 3E6FB 5K9JL 4HV8A 4NQVB 5E5MB 3OR7B 3VI4E 1UWXH 5D2LE 5D70L 3QG6B 3WUWG 3HLAA 4YNYA 1X5GA 2Y25A 3V5KA 3LQMA 3RWJA 5D1QC 3MRIA 1K8IB 3TIEA 5DS8B 4L3CB 3F8UB 3X3FL 1D5MA 1QP1A 3BD3A 1IZKA 3MRGA 4ZTPL 1I9JL 3IKCB 3C6SA 4LSUH 1U3HB 4P48A 2G60L 1HYSC 2D7OA 5IW1B 3PABB 5DGRA 1ZAGA 3OL2A 1S7UA 2V7NB 4R4NC 4LIQE 1JZ6A 3X14A 2C7UA 2HRPH 2DQHL 3DUUA 5LWYH 4LVOC 4LMQE 3T4AB 3KLSA 5I8OL 3ET9F 4KZEH 4IM8A 1U58A 5BZWB 3FFCA 3TJEH 5HXMA 4XB8A 2UY6A 4JFOB 3P4NA 2OL3B 1RULH 4PFEA 3ARFB 2XZCL 1ED3A 5EUOB 4PJ5D 2ITDA 1N64L 4N9GB 4Z77B 3DO7B 5FIEA 3QHZL 1KIUA 1UACL 4WUKH 3MRKB 5SWSD 3RQ3A 4ZFZA 5HVHB 2VNCA 4OF7A 1GOGA 1RZGA 1YUHB 2VUYA 4OLUL 4Z7UF 2F9BT 3IU4H 5FDYA 2K1MA 1JUFB 4MCYA 5A16B 1YPZB 1WWCA 1MCDA 1KTLA 4TQEH 1LEKB 5FCSH 4OKVB 2W60B 5C0RH 2UZIL 1S7QB 3IJHB 4HQQH 4J8RB 4PLOB 5IESL 4OIIH 2GSGA 5C3TA 1HQ4B 3WL9B 1JZ4A 2ZJSL 4PGEB 5JOFB 4JZOB 2P49B 5FB8B 4RAUB 1TZHB 4I3RH 4JZNA 2ZG3A 1CK0H 4LPWA 5FGBC 1D9KC 5ADPL 2IALB 3NIDF 2EKSA 1DVFA 5DLMH 2DWDB 2P8PB 1IMHC 1HQRA 5I1CL 3SDYL 4HUMB 4F7TB 4YR6A 1U8OB 1NFIB 4U1JB 4KZDH 1N7ML 1XIWC 4WU7B 5DHXB 3U9UA 4JQIL 4OTXH 1YEGL 4YDKL 4J4PC 3MRRB 3MV9E 4PJ9A 4KJYB 1GHFL 5JQ6L 4HV8B 1QBAA 4M7KH 3MUHL 2UY7A 5FYKD 4YNYB 4ODBD 1A7QL 4LLQA 3V5KB 3C5SB 2F58H 3RWJB 2DD8H 4PRID 5D4QA 3MRIB 5F72S 5CCKL 3TIEB 3EGSB 1CZ8L 3DNKA 3VFPB 1D5MB 2PTVA 1MVUA 3AAZA 3MRGB 1KCKA 1Q94A 4JM2A 2W0KA 3TEUA 1U92A 4XGZA 4OCYL 2HT3C 4NN5C 5FUOL 5ISZD 1BX2A 2BC4A 4J23A 1NAMA 4KK5C 2C7UB 3EJYD 5CD5D 3LRSA 2Y9RT 5IB1A 2FX9L 3FFCB 1W72L 1MQKH 3BRFA 5H35B 1T20B 3DIFA 2A6IB 2R0KL 4L4TE 4UQ3A 5GJSH 4LSPL 2GTZA 2IPKA 1ED3B 4NWTL 4JJHA 3MACL 4NNPH 5JZ7C 4O4YH 3KS0J 4PUBH 3TFKD 4WHCA 4HWZA 1B6DA 1KT2A 4ISVB 4XP4L 1JGVL 5HTSA 1A4JA 1WZ1H 3HNVL 4XXCC 4Y5YC 5DVKA 4I0PD 4S2SA 4HXBH 5GSVA 1ZKAA 4APQD 1LO3H 3ECBA 4TSCH 3VA2C 4GSDH 4PJIF 3DYOA 2APXA 5F70A 4PJAE 3L5XH 3LOWA 2IAMB 2X10A 2I5YL 3WJLA 1IKNA 3CLFH 2GSGB 1CFVH 3ARBA 2FGZA 1CE1L 2VDML 4GBXD 4HEPG 4AIZA 3BP7A 5E94A 4HG4J 3L9RB 5SX5H 1S7WB 5C07D 1F4WL 4X9IA 3NH7H 3CVIH 1JBJA 1W0WB 4RX4D 3BGFC 3D25A 1AHWA 1DVFB 4POUB 4MDJA 2NX5D 3OXRB 1RY7B 4AEHL 3MBXL 3BAEH 1HQRB 2NY7L 3VFSA 4FQ1L 1MF2H 5GGSA 3N0PB 4KUZL 3DETD 5E0QA 5I19L 1JHKL 4H88H 4N90D 2SEBA 2APTA 3W9DB 2NR6D 1NSNH 3D0VB 4I48A 5D6DA 5GISH 5I66A 3R1GL 4QRQA 4PJ9B 2XN9A 4K7PX 4PTTA 2VLRA 1BVLA 2L0DA 4KH2A 1RIVH 1KLUA 4D2NA 4KPHL 4L9LC 2MKLC 1MCWW 3MV7A 4NC0B 4PJBA 1IGJB 5T3XH 4PP2B 3RWCB 4HMEA 2CKNA 4K9EH 5DVLA 3VXSA 4PRPD 3SBWC 3CMGA 3QXDB 3UJJH 1MEXL 1MVUB 3GEWB 3STZB 1P84K 1Q94B 3DV4A 1SEQL 5IVXE 3GBNL 1T66D 5GRJH 1BX2B 4E5XB 4LCUA 3VRJA 1NAMB 2ZCLL 1LO4H 2CKBA 3I6GA 3LRSB 5EO1B 4P46C 3WHE1 5IB1B 5F1NA 3RVWD 5LCVH 1FAKT 3UTTA 3MBEA 3TM6A 1FNSH 2JJSA 1A6PA 5GGTL 4P9MH 1T1XA 4HWBA 4F9PA 1PJ9A 4LHUG 4J3SA 3QUKA 3OJ2C 2OZ4L 3EO0B 1I8IA 4HWZB 3ARUA 2DLHA 1KT2B 4RFOL 1CLZH 3O8XA 3EFFA 3O2WH 4ZNEE 1A4JB 3B2UD 2NCMA 3TZVA 3F7PC 3MLXH 3AGVA 3IDJB 3I9GH 5HVGB 5GXBB 3MRMA 3TVMC 3GSUA 1INQA 3ECBB 4LVNB 3LD8C 3IDYC 3VXMB 3QFJB 4Q97A 3D69A 1NDMA 1JCKA 3CDGB 2NNAA 3K0WA 4YIQA 5DJ6A 2H8PB 3ARBB 3KLDA 4AIZB 2FEEI 4KROC 5E94B 3BWAA 2ID5A 4KTDL 1B0RB 2P47B 1BJ8A 1R3IL 1MJ8L 3KLAA 5IBUB 2V17H 4DVRH 1FL5B 4QOKD 1EEYA 3D25B 4YXLL 1AHWB 4XPHH 4JPKH 3UZEA 3MV01 1QFHA 4R8WL 4OFVA 3VFGH 3V0WL 2QSQA 4NZRL 5GIRA 3DYPA 3VFSB 5IJKA 2IANE 3ULUD 3PGFL 2BY3A 3GKZA 2X89D 1UKTA 3O3BB 1W0YT 1IQWH 1EJOH 2FX7H 2QSVA 4N8CL 4QRUA 4XP9L 5FOBA 2SEBB 2ZUWA 1Q9WA 4TUKH 3DGGB 4JFFD 3UZQA 3G9VA 3HS0A 3P11L 5MI0B 12E8H 1CT8B 1BVLB 2VL4A 2XA8L 3HI6H 3NACL 4PRBB 1W0VA 4X4YA 1KLUB 5E8DL 2CRZA 1VENA 4JO1H 2XZZA 1C16B 1K3IA 2IBGA 4X9GA 4JHWH 3NTCH 1Z9SA 1HCVA 2Z8WC 2R29H 1A7NH 4X80H 5JMOC 3GSNH 1XF4A 4M1CD 5C86A 4Z0BH 2O5XH 5DRZB 3C8HA 3WFCL 2B5IC 5IFAL 2WBKA 1RUML 3VRJB 1NKOA 1MRCH 1MREH 1QA9B 3PWLB 5FEBA 5F1NB 2OR7A 4MQXC 5IMOB 3UTTB 3TV3H 2AEPH 3MBEB 4NJAH 5I9QB 3EOYG 2MQ0A 4QXTB 1AQKH 4XCCL 4LAQL 1PSKH 3GJFB 4C57C 1FVDA 3BDXA 3T77A 3FAXA 3BPLC 1N6QL 2NXYC 1I1AD 3QHFL 5F7NC 1RAMA 5B8CA 5GQBA 3N1FC 4PJCE 5I8CA 4JFYA 1MIML 1UH3A 2IQ9L 1BZQK 1HNGA 1KENH 3VH8G 2HKHL 3MRMB 8CGTA 4M6MH 2X6MA 5IIEA 1LK3H 1DLHB 2AABH 1GGIH 5CSZA 1A0QL 2MQCA 2KL6A 4YIQB 2NNAB 3BEWB 5DJ6B 5T1KB 1MCJA 4M7ZB 1QZ1A 4P4KA 3BEVA 3MUGA 1F02I 2LABA 3CVHL 4LLWA 4BZ2L 1FJ1A 3FB7A 1J86A 1EEYB 3CU1A 5ALCH 1JYVA 2HKFH 3QUXA 1XCQA 3FQXA 5HD8C 1R24A 3NVQA 5JR1H 4OCXH 3W0WE 1KJVA 2BXYA 1U3ZA 3LPFA 4K3JH 5EU6B 3GFUA 5EBGA 5IEHB 3QIWB 2J7LA 1IE5A 4C56A 3KLHD 5F9DC 1FLRH 5FOBB 2AK1H 2FB4H 1EUUA 4R4FH 4OZFA 5ALBL 1V8HA 1WZMA 2WINA 2XY2A 4NCC2 3U30C 3E8UL 5A3IC 3PWUB 5L7XL 1YJDL 1FQ9C 3O6FD 1OQOA 5DD1L 3SDXE 1W0VB 3AXLA 2FHCA 2VDLL 2GK2A 1BQHG 3SDDC 4M4RA 1FYTA 3OKDA 3L5HA 5TE7L 2WM0A 1EO8L 3EDDA 3OKEB 1NLDH 1S78D 4NQCE 3NAAL 1G9NL 3RVUD 1J5OH 5EO9B 1QFOA 2NY2B 4L9DA 2YA2A 3MV9D 2L7JA 1XF4B 4D9LL 5E8PA 4AK1A 4D8PA 1C12A 1PY4A 1K2DB 2X44D 1P69B 2E9JA 1FGVL 4G7VL 1UG9A 3SQOL 3EZ8A 1G7HB 4I3SH 4MLSA 1IAOB 5DEGA 1FL6A 4NNXA 5SWZE 1AY1H 3ZYIA 2JIXA 5K9KB 3MLPA 1YQVL 2YKLL 2XV6B 2GJZA 4G9FE 5DQJA 5C92A 1MY7A 3T77B 2XI9A 2EYSA 4FABH 3PP4H 4GAFB 1CVRA 4YDLB 5B8CB 3S34H 5I8CB 4F57L 1DSFH 1NC4D 1XR9A 3C5ZC 5GRWA 1X5KA 2CLVA 1ZLVK 3TBTA 3VXPB 2B1AH 5EH1A 4EI6B 1WTGT 5HYQA 3WXVL 4O2CA 3Q5YA 1GGTA 3DPBA 4PLJC 1BFVL 4L4TD 4MNHA 3PJSA 4I2XA 1LE5B 2Q6WA 1A1MB 3R4DA 3WLWC 1A7PL 2VAJA 5MHSD 4LSQL 2C1PB 5IB4B 1I9RL 5E2VH 1S3KH 1OTTD 3MUGB 4LLWB 5FKPB 4WFHE 2IEPA 1WT5A 5ACMA 3K1KC 1FJ1B 1LQSR 2FHBA 3FB7B 4NRYA 1D6VH 5IHBA 1XCQB 4U6HB 4QHNA 1DBKH 1YY8B 3L5WB 3KXFB 1KJVB 4E9LA 2A77L 3DJ9A 4C56B 3T3PF 1QACA 3RWGB 5M95B 1T7WA 5C0CE 5BCAA 1G1CA 4GT7A 5HHVL 5ESAB 5HVFB 3MOBL 3OHXB 1JIBA 2WINB 1DQJA 3FTGA 3G5ZA 4HIHA 5D7JC 3U2SA 4ZS6C 2ZUUA 1RUKL 2XPGA 5FO9A 1PKOA 4R3SA 3SPVA 3OKDB 1QBLH 1AXTL 1H3WM 5TDOA 2Q20A 3EKCA 5HGBA 5DEZA 3SCMC 5F9WC 1YEJH 3NCMA 1MI5E 5AZ2L 4HLZG 3NFSH 4NUJA 4OLWH 5E8PB 2V5RA 4D8PB 3HTLX 4G43B 2IC2A 1B88A 2VZSA 5JXEA 3F7VA 2KBGA 1X7QA 1DR9A 2Y7QB 3BHBA 5FO8A 5DEGB 2Y06L 1U3YA 1UM6H 3ZL4H 1Y6MR 2AJSH 4P2OA 1T0NA 1HXYB 2JIXB 3I2CL 5EB9A 5D1XB 2GJZB 1WBZB 1C5CL 1P7HL 2Q3AA 4KJPD 3ZHLA 4XVJH 1M6OA 1MWAL 3DXAA 4HMCA 4L4JA 4OCRL 1IM9A 3AB0B 3WFDH 5JOPE 3T1FA 5CGYC 5IM7A 1E6JH 1ZEAH 3WJJC 4KRPC 5KVGL 1T4KA 1NC2B 2EICA 3HNTL 4WENB 5F7HA 3ZHKA 4KWUA 4K3EH 3QO0A 2CLVB 3NABH 4OQTL 3T0AA 4LRNH 5HHOA 3QXAA 5AG9A 1N6VA 5HYQB 5C09A 3V95A 3V4UL 1GJIA 3QB7C 3PJSB 1WQVT 4YBHA 5IP4A 4YHOL 3BP4A 3NA9H 2FEEL 3DX7A 1MLBA 4YQXH 2VSDA 3CH8A 1X4ZA 4MMZC 1XGQB 4NQTA 2ICWI 4KAQH 4XMPH 1A3RL 5I1HH 2EC9T 3GBML 4Y4KC 2W07A 2I26N 4QHNB 1JJUA 3U0WL 1GXEA 5DHYB 4RGMC 1HHJA 4HUNB 1ZS8A 2VH5H 2QLVB 2GIYA 4GLRH 5EWIL 4TNWF 3SGDH 4IOIB 4WI5A 1NGWA 2XKNA 4NC1E 4AEEA 3TESA 2IFFL 1DEEA 5CP7A 4LEXH 3RAJL 1CXFA 1S5HA 4HUUA 4YDJA 2VXVH 4HPYH 4NQXA 4BK5A 4EOWH 2B1HH 4KY1L 1TJGL 4NRXA 1DQJB 2YD8A 1GCFA 3FTGB 2F74A 3QHTC 4ERSH 1BJMA 1RMFL 2VZ1A 3FKUS 4HIHB 2DI9A 4FZEL 2Z9TA 4HT1L 1CIDA 4RMVA 2XPGB 5FO9B 4Q9QH 4R3SB 1E6OL 2IAND 4TUOA 4XMKL 5C9JB 1IQDB 5GGQL 2PYEE 5TDOB 1MFEH 1KXTB 4R0LB 1NCDL 1CD1A 1KIPA 5HGBB 1CICD 4HCRL 1RZFL 1J1XH 3MR9A 4IMLA 2Q8BL 3WEXB 4KMTL 2ZCKL 2QKIA 3D18A 4NUJB 3CFJA 3OAUL 1PX3A 5K9JH 3EZJB 2BSRA 3WS3A 2BY1A 4IOFC 3BD5A 3MA7A 1OB1B 4KI5F 5GRUL 4JGUA 2HT4D 1X7QB 3MOQA 4MXVE 3SE3C 4PJHB 1NGPL 4P2OB 1T0NB 5J9PB 3P3YA 2V7HA 3BW9A 3G5XA 2AXGB 3EHBC 2GSIB 1AO7E 4MJIE 1NCUA 1M6OB 3DXAB 1CIUA 4C83A 3T1FB 2G60H 2VR5A 4MB4A 5ILTL 1EAJA 4LOUC 5D6CA 3H8NA 3UPRA 3QO0B 25C8L 4PRDB 1D5XA 4Y5XA 3MNVA 3REWB 5C09B 3MZGB 3OKYA 3ETBF 4LASL 3O6KL 3C08L 5FUZL 4PJ7F 5DK0B 3E2HC 3DLQR 1TENA 4MS8D 2YOCA 3DX7B 1MLBB 3Q1SH 2OP4L 4OIBA 4OIAA 4ETQB 3JTTB 2H2PD 3DVNA 1ZOXA 2YA1A 2W0LA 2CJUH 3SEPA 4HK3J 4M62H 1AD9B 4OGYL 3WKMH 5DC9B 5E5UB 1EERB 1P53A 4NJ9H 1VA9A 3X17A 2VISB 2F5AH 1RIUH 2R2BA 2ADJA 2IH3A 1CLOH 3S36L 2XKNB 5DHVH 2PUQT 4Z7OE 4U4BA 1DEEB 2AS5M 5CP7B 4HUUB 3PF2A 4WGWB 4PJEA 1OPGL 4P4RA 4NQXB 3O45A 4F58H 4WHDA 1J0KA 3BPCA 4NT6A 4M61B 3N9GH 1TNNA 4XPFH 4MZ3A 3SKNB 4GS7C 5FF6A 2NY0B 3W0WD 4P2QD 1BVZA 4LCCA 1T22B 2A0LC 3B5TA 1TVDA 3EFDL 3VXUB 3QQ4A 1CD1B 5ITFB 1KIPB 3NCYP 4EI5B 4JQIH 5INCA 2Y1VA 2VZ3A 2X4RA 1FE8H 35C8H 4IMLB 1OW0C 4LL9A 5L2KE 1UB5B 4X5XB 5C0AE 3CFJB 4RAVA 2BSRB 3WS3B 1KCLA 3OKOA 3R0NA 1KCSH 1BGXH 1K5NB 4QNPE 3JUYA 1R3JA 3P4MB 1IGFL 5HPMB 3AMKA 4X6CE 4G7YH 4G6AC 1EHLH 3F58L 2B39A 1VACA 2AJXL 2V7HB 4NQCD 3G5XB 4UV7L 1BOYA 5GS3A 5KANI 1N59B 1F4XL 3QPQC 4X6BA 3MXVL 2NZ9C 3MLRH 1FG2B 2Q76B 7FABH 3RUGA 1G9MC 5D6CB 3P9LA 1RJZB 4ZAKA 3RU8L 5ESVA 3UPRB 4NKIH 4Y4HD 4MA1C 5MEOB 5SWZD 3MNVB 3LHPH 1U8HB 3HC0B 2NY6B 1C7TA 4H8WL 1WFTA 4Z8FL 5ACZB 2FEDC 4MAYD 4N1CA 4OLXL 4NWTH 4G9FD 5B3JE 1E4XI 1UM4L 3GRWA 2DWEB 5I1KL 1G9NC 3C09C 4K8RL 5TF1H 1LP9A 5SX4I 3QJHA 1ZT4A 4JFQA 4M48H 5DUBA 5D1QA 4CMHB 3EO9H 2WBJB 1SMOA 1WBXA 3FZUC 3HE7D 5LGHH 4N0FA 5EA0L 2JCCA 3D39E 5HYEA 1KJMA 4S1DC 2VXUH 4BKLA 4ELMA 4M6NH 1UCBH 4TVPE 1JHLH 3TN0D 3MRFB 2R2BB 2ADJB 1YEFH 3K7UA 4GMSH 2HWZL 1A4KA 2VZUA 3ARGB 4LLUB 3WFEL 4WFHD 3DMMD 1OGTA 4N0CD 5CILL 1C08B 4FQXC 4TPRL 4NT6B 5FYJE 2XNAA 1FZJA 3CXDL 2HFGH 2J8UA 3IU3A 4URTB 3BP6B 4H5SA 5FF6B 1BF2A 4CVZA 4MXWH 3RWHB 4LCCB 2XTJE 5FYKL 5CBAB 4KUZH 1JGEB 2QADC 32C2B 3GMPA 2PXYA 3QQ4B 5C0CD 5ITBL 2DQEH 1BFOA 4XNMB 1PYWA 2FR4A 5CBEA 2AK4E 1X3DA 5CJOL 4DN4H 4NHCL 1CR9L 4Y88A 3WS6A 3OKOB 4R9HA 3D3VB 4LSVH 3UROR 1R3JB 3ARWA 3CK0L 3PWVA 3RX7A 4WW2F 5EOQH 1GH7A 4X6EB 2H9GA 3OR6A 4Y19A 3F12B 3STBA 1MI5D 1D9KA 2YHGA 1KXVC 1QVOA 3VWKA 5B21A 4NO2A 3S3JA 5TF0A 3VG9C 4X6BB 4L8CA 1VGEL 5BVPH 1CGTA 1A1NA 3RUGB 4Z7VB 3P77A 5M7QA 4PJGB 5E4EC 1XIWA 2Q87A 2UYLA 1EA9C 2Y23A 4QRTA 4JO4H 2IBZY 4P99A 1KB5B 5TE6H 2VJXA 4XWGL 3WFZA 1HKLH 5HDQL 5IF0A 5JOPD 4G8GE 4KC3B 4HS6B 3ARZA 1J8HB 1MFCH 4G9DA 3MRJA 5F9JA 4WEBH 1ZT4B 4JFQB 4QRRB 5D72H 4ZYKA 1JV5A 3H6JA 3QIUD 1EPFA 3SO3B 1J0HA 1WBXB 3TBVA 2JJVA 1V3KA 4N0FB 1UVQB 2JCCB 3KXFD 3G6JE 1AP2B 4X6FA 2OK0L 4HDIA 1AGCA 2A2QT 4BKLB 4ELMB 5BXFA 5D93B 2ZCHH 4KK8D 3DHJA 1I7RA 4CW1A 3QUML 3AS0A 3D2UD 5E24E 3WIHL 4GG6B 4YXLH 3UBXB 4DKEL 1S7RA 5I1GL 3LS4H 1WTLA 2J8UB 3V0WH 3ZT6A 4NZRH 4PJDA 4CVZB 2IQAA 5BQ7A 5EU5A 3MV8A 3HAEB 3WN5C 4CNIA 4YK4B 4AH2A 1H3PL 3BE1H 1NUNB 1EMTL 1S9XA 2YXMA 2PXYB 4Y5YA 5ENWA 5HYJA 3FJTA 3M45A 3FO2A 1BFOB 4HAGA 3VU2A 4X7CC 3RP1A 2CMRL 2FR4B 5CBEB 1KG0B 2H32B 4OLVH 3FL7A 1CGWA 1NEUA 1VFBA 1R0AL 3OZ9H 4OZGB 3ZYZA 5E08L 1WFNA 2ESVB 2WSKA 2NLJA 3H9SB 4KRMB 3QDGA 4JB9H 4RBPH 1EFXA 1JZ7A 4AY0A 2MTPA 2PYED 5I75C 1MFDL 3MODL 1XGPB 1P1ZA 3OR6B 4J3TA 4Y19B 3RTQC 2I9TB 4OZIE 4NQSA 1B2WL 4OLZH 1GAFL 1QVOB 2X4SB 4PV9A 1KN4L 3VWKB 4QRSB 5IW6A 4NO2B 1O7SA 5DJ2B 4OV5A 1IM3A 2BFVL 4L4VE 4L8CB 5AAWA 2D9CA 4XNUH 3IVKA 1DANT 1EGJL 3CD4A 1SM3L 1S9VA 1B90A 4W6XB 5CWSA 3P77B 4NQEB 1TCRA 1NCTA 3CFBA 2UYLB 5J4MA 1I85A 4H1LH 4QRTB 3KNBA 3SDCA 1HHGA 1AO7D 3MLZL 4GAGH 4LAQH 4L1DA 4LSTL 4L3AA 4MJID 4ODTL 5BRZE 5J3HD 1D6EA 3QHFH 3MTRA 2ZUQB 3MRJB 4G9DB 5F9JB 5CZVH 4YUEL 4ZYKB 1JV5B 2BDNL 1KJ2B 1MAML 2DQCH 4UIKL 2HKHH 3O6LH 3U0PA 5EG6C 4LVEA 3SBWA 2P8LA 2EXYD 3FB6A 1I9IH 2L4OA 1AGCB 4G6JH 2ARJQ 4S10A 5F6HJ 5KS9E 5BXFB 1NMAL 1BHGA 2GITB 3MOAH 5IBLC 5E8NB 3E3QE 4DK6A 4CW1B 2ZOLA 3DSNA 1FO0H 4P46A 5EZOH 1V7MH 3ZE0F 4BH7A 2DDQH 4OLYH 3VGAC 1JI2A 4Q9RL 4W6YB 1YDPA 2DYPA 1S7RB 5L2JA 3ZDYF 4PJDB 2UZXB 1UWGH 5E99L 5EU5B 3MV8B 4JPVL 5BJTB 1RURL 1S9XB 3LKSA 5T33L 5KSAC 4OZHF 3QEGH 3PL6D 4JRXB 3FO2B 3TVMA 4OGAD 3BJ91 1OARL 1G9MH 1VFBB 4M1DL 4BK4A 5IB2A 5LXGH 2PF6A 1MHEA 2E3VA 5DO2C 2NTFA 2NLJB 4EDWH 3INUH 3CSGA 4GRWF 1KC5L 2OSLA 4Z7UA 4PJXB 1EFXB 1IEBA 5TE7H 4TRPL 4LCWE 3NFPA 2XQBL 3WD5L 3BXNB 4XNZB 1MNUH 3WIFA 3T0EB 2HLFC 4JPIB 4FG6C 3HI5H 5E03A 3RHWF 4PV9B 2ZSWB 5IW6B 4CDHA 5L2KD 5FGSA 5C0AD 5EPMA 3HE6D 1TJHL 3W82A 3C60D 5GGVH 2IGFL 1N5AB 2HA1A 3IVKB 4ZUSA 1FGVH 3OAZH 5FDWA 1S9VB 4QEGA 4WW2C 1Q9LA 5BMFL 2X5PA 3BKJH 3KS0H 4LIQL 3CFBB 4YHZL 4BFIA 4U0RC 2VC2L 1MFAL 3LRGA 1KUMA 4HHAB 3UJIL 3QDME 3T3ME 4LDOB 3PQYA 4ODWA 5I1LA 3LN4A 3SDCB 1IGIL 4NN7C 3S37X 2DL9A 2HT2C 3TA3D 2ZOKB 3HPJA 1E4XL 2VDNL 3FQUA 1IRAY 1P6FA 1WC7B 1FHGA 1F3DJ 2A9MH 5DSCB 3HUJE 3PP3H 1BFTA 3MCLH 4RRPA 3TC9A 3QUZA 2J4WH 3C2AL 1J1PH 3SDAA 1YY9D 2BJML 3DI2B 1RUPH 5LQBH 4L3EB 3FB6B 1BFVH 2ARWA 4NBZB 1G9EA 1YN6B 3FFDA 1OGAA 1PG7L 3H9HA 4O58L 1A7PH 1G7QA 2DQUH 4J1UA 1HHIA 5I1AA 4Z7QE 4JFEB 2Z92A 5SV4A 5IGXL 4J3VA 2ZOLB 2ED9A 4LDEB 4QTIL 4XC3H 4PG9A 4BH7B 5JDJA 3HMWH 3IDGB 2DYPB 1JYXA 4WHTB 2NQCA 2BP3A 3D39D 4CJ0A 1QRNA 4JRWA 1F8TL 4P23D 2Z93A 5GJTH 1FCGA 4TVPD 3JV0A 5CFHA 2VKXA 3TWCL 3KVQA 2VE6B 4U1LA 3MA9L 5ERWA 3MCG1 5CINH 5HHVH 2AQ2A 2QHRL 3I6KA 3GIZH 4PGBB 4LHJB 3SGKA 3ESVF 4WI2A 1LILA 3KPPA 3S4SG 2XKUA 3SE4C 4K8RC 5FYJD 3ULUF 1HZHH 1P4BH 5I16A 2R9HC 3RZCC 4AIOA 3OBAA 1EAPB 5TE4L 2XTJD 2AXFB 1IEBB 1UH4A 4PLNC 3NFPB 2QSCL 4ZSOB 2OL3L 4IDJL 4PP1C 1WWBX 1PZ5A 2AK4D 4BH8A 3QISA 3ZE1E 3JV4A 3O3AA 1ODAA 3ARDA 3FB5A 4GKZA 3AY4C 3TYGH 3QXTA 4ZUSB 3T4YB 5FDWB 3VJ6A 5CHNA 5J06A 1EX0A 1EHXA 1RIHL 5FHBL 1AR1D 2ICES 1Q9LB 2NY6D 5IMLA 4WCYL 4MA7L 2ICEA 4PGJA 4NN6C 1HHKA 3QIBB 3RL2A 2GYSA 4OB5L 3PQYB 4ODWB 3LN4B 1AKJB 1UZ6E 4OCRH 5DEFA 1P7QD 3HPJB 2ATKB 5E00A 3GNML 1ZLSL 3FQUB 4DTGL 4CMMA 5KVGH 1BOGA 1NBQA 2X2YA 5EU7E 3GMNA 3O4LB 2H2SD 3QUZB 1BEYL 5K9QG 3S35X 1UB6A 3SDAB 4UT7L 5KVDL 4RDQF 1P4IL 3CLEL 5D2NA 1RZ8A 4PS4H 2I60H 3H9HB 1OGAB 3UDWC 4KJWC 1G7QB 5IT2H 5KG9A 5B38A 4G8GD 3KPRA 2AEQL 2V2WB 4CN4A 2O5ZL 2X1XR 2B2XH 5IQ9B 4B53A 1FFRA 4PG9B 2VSCA 2QHLA 4GQ9H 2K3TA 3LMJL 5J1TC 4ODSH 3HMXH 5KANG 2JB6A 4UMGA 2Z93B 4D9RD 1ZVSB 4N1EA 4ZUWA 3GO1L 2NXYB 4TOYH 4PY7A 3PWPE 3UP1A 3RZWA 3U4EA 5J12B 4NWUL 3VMNA 3AREC 5ERWB 3C5ZA 2UWEA 3A67L 1QFWH 3BIKB 1KELH 3CUPA 4NZTL 4Q58C 3BZDA 5FKAB 3H3PL 2VLKA 1QLEH 4MVBD 4FZEH 2C9AA 5LAXA 5I16B 5ICXB 2APFA 1E6OH 1U95A 2Z31C 1UENA 4PRHD 2EC9U 4K2UL 4K71C 1NCCL 5FUCE 4JDTL 3AS3A 4PJIB 2Q8BH 2D2OA 1RZIA 2JJWA 4KMTH 4BH8B 3JV4B 4KQ4H 3ARDB 3FB5B 3VG0L 1DFBL 4XZUB 4DZ8A 1D5IL 3WIIL 2GW5A 1W72A 3VJ6B 1OTSD 5GRUH 1LO2H 1NGZA 1FBIL 4YHML 1GZPB 4Y16A 3ZT5A 2ICEB 5K33A 2LU3A 5MP6L 2MPAL 4YHPB 2R15A 4JG1L 1RUAH 3KJ6H 3GMOA 4U6VL 5D7JA 5DEFB 3P73A 3L7EB 2P1YA 4KMQA 4YFDB 4QRRD 2ITCB 4CMMB 1YMHA 2W91A 5JORB 5D9SB 4P5TD 4L4VD 4NKMA 3QWOB 1Z0NA 5F44A 3RJQB 3QULB 1MCSA 3SCMA 1CBVL 2GTWB 2BK8A 1OLZA 1BBJA 3G08A 1LHZA 4BSVA 1M7DA 5D2NB 5IR1A 2XN9E 1GGUA 3S8WA 3P30H 3DHMA 2VLRE 1YPZF 3FO1A 1SEBA 4UILH 4LSRL 1F5WA 5BRZD 2QR0B 3VE0A 1RZ7L 4FQIL 3ULSB 3OPZL 1JE6A 5SWQB 3KPSA 3TNMA 3MV7E 4PJBE 2ATPA 4X6DA 1NGXA 4LHUB 1GYAA 3V4VL 3VXSE 5IFHH 1I3RB 3SJVA 3FMGL 4F8QA 1K85A 1B9ZA 4XPBL 5HJ3B 4XPTL 1BIIA 3EDJA 3BT2H 4WO4A 3TJHD 1TETH 2JB6B 5JTWA 2ZKHL 4X99A 4U1NB 1KJ3L 4ZUWB 4FXGA 4PY7B 3LKPA 3LKRB 4ODUA 3BZ4B 1CN4A 4HSQA 3C5ZB 4XVSL 5E2JA 3VD5A 4LVHC 4OCWH 5DRXA 1RUQH 4X4XA 3FT3A 1CFSA 5LAXB 4IRSC 2DBJA 4IOSD 4WDIA 5JHLL 5BS0A 2CO6B 4LLMA 1U95B 2VLJB 4NKOA 1E27A 1F6LL 4IRJC 2QEJA 4GW5B 3LEVH 4N5EC 3BKML 5FYKU 1A14L 1JGDA 4YE4L 5EUKA 1FFOA 1RZIB 3HZVB 2VQ1A 1YYMH 1SBSL 4UV4L 1PFCA 4GKSB 2APBA 4DZ8B 2BVPA 3CX5K 4JY4A 1CE6A 1QLRA 1NGZB 1IEAA 4ACPA 5FYLD 2LV4A 1IGFH 2WIMA 5GGTA 4D0CB 4Y16B 2DB8A 1Y6KR 1MFBH 4GRLC 4HJJH 5DD5L 4LCWD 1N0LA 2OZ4A 3L7FA 4MNGA 5GS0D 1KFAL 4JFZL 2F53A 3K1DA 4BELD 1S9YA 5F3BA 2WIIA 4FTVA 4X9BA 1YMMA 1QSEA 2AI0L 2Q3ZA 5D7LE 3BN9C 4OI9A 3RU8H 3K4DA 1A5FH 3UPAA 1DCLA 3BZEB 5F9WB 3O41A 4L5FH 1BBJB 4HMDA 5IB5A 1UXSB 3G08B 5FAAA 1U91A 5IVXF 5AZEH 1M7DB 4E42A 3QDMD 1EBPA 3FO1B 5F1OB 4Y2DD 2X4TA 1TQCB 3MJ8A 1JF1B 4Z5RB 1VCAA 2XICA 4G6KH 2LFGA 3FN0L 2HFFA 3SE3A 4GMTL 4JKLA 5E6IC 4LPVA 4Q74A 3SJVB 43C9A 1PQZB 1ES0B 1T1WA 1YNKL 2IH1A 4XPAL 4MJ5A 5FA3A 2QQKL 1I1AC 3VH8B 1BIIB 3NGBB 2H6PB 4WO4B 5J11C 3HR5A 1TPXB 1FH5H 5DC4B 4TSBH 2FO4A 3UO1L 4YHKH 3I3EA 3LKPB 4H1LG 4YX2H 5IVZA 4ZS7L 2HWZH 3WFEH 4LLVA 1PKQA 4AG4L 5CILH 5LGKA 1NQBA 4ODXB 2LAAA 1DBMH 5CJBA 4HPOL 1EO5A 5I1JH 2GUOA 3BQUD 1G6VK 3HB3D 1FAIL 4HEME 3U4AA 5BS0B 5ACLA 1MRFL 3WYRA 3LS5L 4NKOB 1E27B 3UC0H 3NZHH 1RHHA 2B4CH 1GSMA 2VWEC 2VITA 2YRPA 1JGDB 1JK8B 1RVFL 3LB6C 3VD9A 5J1AA 4KVCH 1M4KA 3MLVL 4GW1A 3K4AA 1DBAH 2D9QB 1A7BA 1LK2A 4WUUB 1WCBA 4AMKH 2BOBA 2IG2L 3JWDH 2DM4A 4JQXC 1CE6B 4UAOB 1IEAB 3MNZA 1BQHB 3GHEL 4FMKA 1MJ7H 4YC2B 1HWGB 5JUEH 1RK0A 3M17A 2E7LC 4MNGB 3LQAL 4C59B 2QQNL 4PJFA 2F53B 4OT1L 1S9YB 3I85A 4HFUL 3HRZA 4FTVB 3VXRA 1YMMB 2Z8VC 3GSVB 4XWOD 1QSEB 3L3HB 3V0AC 1OAUH 3QNZB 3RVUC 2HMIC 4TNVF 1U3HC 4JR9H 1AXSA 3LQZA 5F8RC 1AE6L 3KYKH 3O41B 5JPMA 2V9QA 5EOCJ 1JNNL 1OW0A 1VB9A 3QZWG 4RISL 3VDBA 1H5BB 1N8ZA 5KSVA 4XWGH 4F3FB 5IHUL 3CVHA 5C08A 1AGDA 2WNGA 3MJ8B 3MLSH 3V6OE 1W8NA 2HJLA 2O5YH 3BN3B 5GZND 1CD9B 2E7MA 1BBDL 3E1F1 1FYTE 3ARFC 2HJKB 2F5BL 1VPOL 4OSUH 3A6CL 4ODHH 43C9B 3GBLA 5KVEL 1QBMH 1T1WB 4ZXBD 3U9PL 1T83C 2IH1B 5HI4D 5HVHC 4MJ5B 5FA3B 1SJEA 1WJ3A 2YPVL 3RRQA 2GHWB 2P5WA 4KRLB 1MHPL 2X1OA 2R8SL 3HR5B 3SY0B 2WW8A 4JDZA 4PV8A 2ZSVA 1MRDH 1OVZA 3KGRA 1MCWM 1A6WH 5E9DE 2FO4B 2NY3B 4DCQA 4PJCF 1WIUA 4BZ1H 1IFHL 1KIRA 2FGWH 5IVZB 3W9EA 1EH9A 3IXTB 3FO0H 4LLVB 5MENA 1PKQB 3HG1A 1SYVB 3VFOB 1XGYL 5DFWH 4DKEH 1KEGH 1TZIA 1FGNH 2PN5A 4TVPH 4WWKA 4JM2D 4A6YH 5T3ZE 4HIIB 4S1QH 1A6AB 5HDBE 1MIEH 3HFML 3O0RL 2R2CA 3QCUL 4TSAL 5JHDA 1H3PH 1RHHB 3F65A 5DFVC 3D5OF 3GGWA 3PWPD 3QQ9C 5EOTB 3CSBA 1VESA 1IGTB 5IEKA 3KPOB 3X3GL 3GI8H 1BAFH 1I7ZB 3U4BL 3QI9B 5JIPA 4MD4A 4MCZA 1R0AH 4I2XE 3DUSA 4JZJA 4YHYB 3B9DA 1WCBB 1ZGLB 2BOBB 3WHXA 3V5DA 5TPWH 3T09A 5CEYA 1G7MA 4LSDA 1L0XA 3RJDA 3O2DL 1T3FA 4FQXA 4W6WB 3UTSA 3WLBB 2BSTB 1B2WH 1RK0B 1ZTXL 3IAPA 2P7TA 4JRYE 4M5ZH 1KN4H 1ZHBB 3V5HB 3HRZB 2F8XC 4NRZB 1JNHA 4L8SB 1I3GL 2CDGB 4Q9CA 4DGYL 3IXAA 5DVNA 4GXVL 3MGAA 1NCBH 3WNKA 4YWGL 3LQZB 1H0DA 4OD3H 4N0RA 4KHXH 5JPMB 1RFDH 1ORSA 3IDIB 5CLWA 4OD1H 5KSVB 3GDBA 3V6FA 3CVHB 2KDGA 5C08B 3MLZH 1AGDB 5CJQH 4ODTH 1KNOB 3EW3B 5DT1L 2D3VA 2H41A 5EN2A 2HJLB 5DVMA 3P0VH 3BFOA 2F54D 3FAWA 3RGVB 4N0UB 2YWYA 3MLYL 4UDUA 5HI5D 3U82B 1XGUB 2GK0A 4P3CH 1PLGL 2YZ8A 4JFDE 2J8OA 3K80A 3KYNA 2P5WB 2DM2A 4PV8B 2ZSVB 3CX5J 3HZYB 2FCBA 2RFXA 2GFBA 4M7JL 5EC1A 2VLRD 1DUZA 3Q6FA 2IAMC 1KACB 3W9EB 1T5WA 4HIJA 5F7KC 3V4PL 2C3VA 3MV7D 4YGVA 4XPGL 5MENB 2EDHA 3EYQC 3VXSD 4MA1B 1T2JA 2YC1A 1KBGL 3QUYB 3HNSH 3QDAA 2P45B 2FH8A 1ZLVH 5KN5A 1TZIB 5EBWB 4WWKB 5H2BB 2FSEA 3H42H 2GKIA 3CMOL 1DLFL 1JWUA 3F6IA 4R2GB 4Z0XA 5E99H 4B7LA 4EUPH 1DVFC 2D7PA 5JHDB 4Y8AA 2VIRA 5F1SA 2WUCL 1FL3A 4XBEL 3MRHA 1F4YL 2N7AA 1R5WA 2VDPH 3B9KD 5HHOE 4PREA 2AJUL 3AMLA 3MGTB 4MD4B 3RVTC 2IPTH 3RL1B 3DUSB 4JZJB 1M05A 1QLFB 3WDJA 2R0WH 4Z6AT 4HIXH 2C4FT 4JG0H 4PRNA 3WHXB 8FABA 5HHNA 4PJ9C 5DGQA 5JIHA 4HZAA 3TP4A 2FWOA 4CKVX 3MUZ1 5CEYB 1G7MB 1GGCL 2JB5H 4HWEL 4C54A 1JZ5A 4U1MA 3O9WD 3TO4D 2GJ6B 3O8XD 3SKMA 1REIA 1MCLA 4XHJC 1MWAA 2YPLA 3TZVD 5KSBB 1U6AL 5T1DH 1U8LA 1UJ3A 4YXKL 4HXAH 4NQDA 2VXSH 1LDPL 2HN7A 5L6YL 2DM7A 4OQTA 3DX6A 3WN5A 4ELKA 3LKNB 4JGMA 4U1SA 4WI8A 5BMFH 5L8LB 1H0DB 3QG7L 4AL8L 1E4WL 2FRGP 1U8PA 2AJZA 1ORSB 1OF2A 1IGIH 1QHPA 1HIML 5AEAA 5E1HB 5EN2B 3JXAA 4P59L 4DGIL 4EJ1C 3HC4L 1OCWL 5D7LD 4LHQB 5DRWA 4UDUB 4L8DA 4G80B 1WFUA 4OF3A 4E41A 2AAVA 4NC2B 4WFGD 3RTQA 4YH6A 5D1ZD 5F7YC 5ECJE 4Z76A 1JGLL 3KYNB 4R97B 4BSWA 3WFHA 1FZMA 4LVNC 2B8OT 4O58H 2CK0H 4U7MA 2RFXB 2GFBB 3Q6GL 3VGGA 2DL2A 4JN1H 4MNQB 5C0BA 4G8EA 3WJLC 1XGRA 1T5WB 2BNQA 2W9DH 2GEEA 4HUKB 2ICCA 2YC1B 1IARB 3RWIB 5C0ND 5DWUL 2BNRB 3OF6D 4GRMB 5KN5B 1CFQB 1HINH 4AQ1B 2E9IA 3PDDA 4Y7MA 3TCLB 2XZQH 3OMZA 1JWUB 4FQLL 4Z0XB 1AHWC 1BM3H 4HCRA 4LNRA 4ZPVA 1A6UL 2R0LH 1U8QA 2EO9A 5L9DH 2R1YB 1B0GA 3TWCH 4XCYA 3MRHB 2Y36H 3U79A 4FFWD 2QHRH 3BO8B 5K59F 5DDHB 2BNUA 5EBLB 2VB5A 2WWMD 2DI7A 4PJ7B 4MA8H 1KOAA 5TQ2L 1MELA 4PYHA 8FABB 4WV1A 5HHNB 4ONGL 1G6RH 5MI0C 1RK1B 2FWOB 3TPUA 2A74A 3JVGC 4XMLL 3V6ZB 3SKMB 1G7LA 3T2PA 1AFVL 2VZVA 1OT2A 2ZG1A 4IDJH 1C5DA 3OAYH 4BQ9A 4JGJA 3RVVC 1UJ3B 3ZHDA 5B39G 1X6NA 4NQDB 3DSFH 3O3EA 1EJ6A 2B0SH 1BJ1J 2MHAA 1HI6A 3DRTA 3AU1B 4LQFH 3DX6B 3IGAB 4ELKB 1J12A 2HH0L 1JF5A 4KK6D 4PJ8D 4P4KD 5BO1H 2R2HB 4U1SB 5KSAA 2EDNA 1U8PB 4PJEE 2AJZB 4JY6A 1AGEB 3FB8A 1OF2B 7CGTA 2GQHA 5AD0A 1MCCA 5IWLC 4HS8L 3QUXD 1GPOL 1EEQA 4YBLB 3OTTA 2R4RH 3GKWL 5T3XE 2G75A 1EDQA 2NTSP 3GNMH 2NY5H 4HK0B 3MBEC 4HJGA 3B8SA 5I9QC 2IMMA 3VI3F 4MXVF 4NO5A 3BJLA 4Q6YA 1FNLA 5DD6A 4EQ3A 1JPGB 2YZ1A 1F42A 2OMNA 5DRWB 4L8DB 3P9WB 4F80A 4KQ3L 5CLTA 4E41B 1H3GA 4O2EA 2X41A 1Z6JT 3CPLA 1JPST 5GRYA 2WUBL 4D0BB 1KCVL 2DQTL 3WUZA 4PB0H 4DW2L 5DI8A 2BZDA 1IC7H 4HH9B 4ENED 1EXUB 5F7EL 5C0BB 4G8EB 4RGNB 1SY6H 2UUDK 1XGRB 1FYTD 3LEXA 4LGSB 1G7JA 3LQAC 3QQ3A 1CYGA 4WW2A 4FHBD 4M7ZC 3P0YL 2XWTA 4HC1L 4DWHA 4JANB 2CDEA 3LMJH 3MROA 1HN1A 5EBMA 1N2RA 3B83A 1H15A 1HSBA 4M5YL 5FYJL 3V52H 2V2XA 3P4OA 3ILPA 4ZPVB 5E9DD 4UTAL 4WTXA 1B0GB 3RUGE 2FATL 1Z5LA 1L7TH 2I9LA 3A67H 3HPLA 2DTSA 3EJZD 4FFVD 3QIWC 5C6TH 3HCVB 4NZTH 3F7YA 2DICA 2BNUB 3CU7A 2EEDA 2EDWA 1UA6H 1IVLA 4QLRA 1FPTL 3DROA 3EAKA 3MNWA 2ZUYA 4M93B 5T3ZD 1A6VH 4WV1B 2PW1B 3HHRB 1NL0H 4ALAH 4Z7OF 1SMAA 1LP9E 4MQ7B 1IAIM 4MAUH 3ROLB 5TDNB 3TPUB 3FN3A 3GSWA 3IFNH 4FQQB 3TYFA 4DK3A 4K2UH 5BOPA 4D3CH