5D96C

Oxidoreductase fragment of mouse qsox1 in complex with a fab fragment from an antibody targeting mouse and human qsox1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
220
structure length
214
Chain Sequence
QVQLKQSGPGLVAPSQSLSITCTVSGFSLTGYSVIWVRQSPGKGLEWLGMIWGDGRTEYKSALKSRLSITKDNSKSQVFLKMNSLQTDDTARYFCASDSMDPGSFAYWGQGTLVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfhydryl oxidase 1
publication title Overcoming a species-specificity barrier in development of an inhibitory antibody targeting a modulator of tumor stroma.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 214
sequence length 220
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d96C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d96C01
1G7QA 4JZJB 2GAZB 5BO1H 2ADGB 5AG8A 2B20A 3BE1H 4LLMB 3TO4B 4QYOA 3LRHA 1X5AA 3QUXA 5E7BA 2Q87A 3RIAK 3VXRE 4HWUA 1ZA6B 4NHCL 4PJ7F 1UM4L 2WUBH 1P2CB 3O8XC 2VQUA 2MCPH 4GS7C 1EMTL 3MO1A 3N85H 3PQYE 5H35B 4Q9RL 5HYSA 1V7NH 3WNKA 3I6GB 3MJ6A 3T77B 1GPOH 1EHLH 2DMKA 4TULL 3QYCA 4JRXE 2R56H 1IVLA 5ACLA 1X5JA 2H26A 4XPAL 3VFTB 3FQNA 2MMXA 5D2LA 3MBXH 3O2VH 1T20B 3OKKB 4JY4B 3LKNA 1DVFD 3V5DB 1P7KA 2FD6H 2J6EA 2FGZA 2AJZB 5GRJH 4L4VD 2J6EL 3LH2L 5IOPA 3RHWK 4NO2A 4ONHA 4Z7OE 5C09D 4MB3A 4PJAE 3VXSB 4P57A 4JPVH 3TN0D 2B4CH 8FABA 4PJIA 4Z0XB 3V6BR 3BKML 1FLTX 5CILH 2F15A 1IBGH 4PLJC 2NZIA 1ZHKA 4HQQH 1QA9B 5ID0B 5FUOL 1CN4A 3G6DH 4QHMA 3PUCA 3I3BA 2BY3A 4DUWA 5DWUH 1KF9B 3QUKA 3ILPA 5DO2C 4E41E 1Q9KB 4U1LA 1EEZB 2NNAB 5I73C 1BF2A 4G7VH 1DUYA 2MWCA 2MCG1 4WJ5A 2ITCA 4G7YH 1J1PH 5CJQL 4DN4L 3Q2CA 3JWDL 1S9WB 5GGRA 4RMQA 2GJZB 3DRTA 1ED3A 2NW3B 4JPKH 1ODAA 3SDYH 2VDRH 3TA3C 3RGVA 1MCJA 1DBMH 1ZS8B 1SJXA 3MMEB 5J1TC 3KNBA 1CFQA 4YDJB 5FA3B 3WIIH 3H9HA 3IJSB 5E9DA 3V8CA 2YPKA 2Q6WA 4Z7WF 4G5ZL 2B2XL 4I0KA 4PJ8D 4GRWF 3QULB 1R3JA 2Y1VA 1TETH 1VESA 3PGCA 3RFZC 1TCRA 3H7BA 3W9DB 3ET9F 3D5OF 3DGGA 2D31A 3EJZD 5E0QA 3HE7A 2EDQA 3UTTA 1N4XL 3JV4A 4QRTA 1IJ9A 3D0VB 4H20L 2KUTA 2NW2A 4KROB 1H3WM 1AP2A 1K4CB 3IFLH 2IANB 2QKIB 4K7FA 5EBLA 3GSWA 1P6FA 5JTWA 1TCMA 3BX7C 1ZVYA 3Q3GB 5I30L 4P2QB 3M1BB 4J8RA 3VFVA 1KJ2A 2Z92B 1P53A 4KRPB 2E9JA 5SWZE 1H8SA 3M17B 1KJ2L 1RIUL 5I71B 3HE6D 4R6UA 2I9LB 5I8EB 1MIML 1QR1A 4C83A 4D9LH 3GMNB 2A74B 3TM6A 3SQBA 5D2NC 3NGBB 3MNVA 2HRPH 5DQDH 5I8CB 2DWEA 1T80A 1YEHL 32C2B 3HUJB 1MCLA 1OAYH 4ZSOA 4Y4KB 2ZG2A 2O93L 4X4YB 1FP5A 3QDME 4I0PC 3FTGB 1YMMB 3WIFA 4LCUA 5DMKA 3U7WH 1UEYA 4FTVE 3UO1H 3D2UD 3PWNB 4PJ9A 2Q7YA 4NRXA 5FUOH 1I1YB 4FXKA 4PRAB 4PRBA 4MCYB 3RY6A 5HI3D 2DL9A 2XQBL 1BD2A 43C9B 1R3IH 4YBQD 2VUOA 4TSBL 3A6BL 1T1WB 1VFMA 1J86A 3DURA 1CLYH 5T33L 1HWGB 4AMKH 1FDLH 3NABL 4NNXB 3OKYA 3P30H 5CJQH 3K2UH 5EZJB 5F9DC 4C56B 3KPNA 2PYEE 4BZ1L 2H32A 3QUMA 2HN7A 1WCQA 3C8HA 3V4PH 3EOYG 4DN3L 5HDQL 3QUML 4Q6IA 5AYUH 3VI3F 1I3GL 4D0BB 1K4DB 2R4RL 2X9XA 3V0VB 3FB6B 1MVFA 2YR3A 1FL6A 1C5DB 2XFXB 4GXUM 2VJXA 2VZ3A 1HI6A 3ZYZA 4PJCE 2B2XH 3KYMA 3LHPH 3HR5A 3F8UB 2OTUB 1FCGA 5J6HA 4PJHE 5MHSE 1DEDA 3A6CL 1YEGL 1YEJH 5EUOA 3DETC 4JN2B 3I3EA 1M71B 5EORH 2P5WD 4MZ2A 3V4VL 3C5SB 4IOFC 5SV4A 5A1AA 3ULVH 2F8XC 3MRQA 1AD0B 3MRLA 3OPZH 3QDGE 2AK4A 1CXEA 4J4PC 2ERJC 2DLEA 3RWFA 3DYMA 3OMZA 1MNUH 5MENE 1ZA3B 3BZEB 2MQCA 3PHSA 2LVCA 4PUBH 4S1DC 5IROC 4IS6B 1JPTL 3NPSC 2AV1A 4YE4L 3ARDC 4EXPX 2BVPA 5E6IB 2VO5A 3VXMA 5E4EB 1D9KB 4Y8DC 1F58H 5C9KA 3CSGA 3VDBA 3U1SH 4CGTA 4ZFFA 3LEVH 1BECA 3R4DA 4OTXH 1AO7B 5JORA 5FDWB 1RURH 4HUUA 5C86A 1SMAA 4FZ8H 4WEBH 3WJJC 3P0YH 3MOAL 1FNEB 1DBJL 1PEWA 4ZQKB 2F53E 3IDMA 3JTSA 1SM3L 4TRPL 1P5UA 1W8OA 1ZT4A 1R24A 5BV7H 4PLOB 3HRZB 4EDWH 2G9HB 1GHFL 3KPMB 4EDXB 3MREB 4IRJA 5DUBB 5TQ2H 3D6GA 1WIPA 1X6LA 5GGUA 4JDZA 1TPXB 5T33H 1OAXL 1ZWIA 3BKJH 1U9KA 4QLRA 4PRPA 4XCCH 3JZ7A 2P45B 2BC4A 5LGJB 2GITB 2DDQL 4NBZB 5HHQB 4TVSa 1X7QB 3BO8A 2BVQB 1HHIA 4POZD 4YDKL 5EU3B 5DVOA 2EDXA 1T0MA 4YBLC 3TC9A 1J10A 5DJYA 4NQSB 4JJ5A 2CK0L 4IBLT 2R29H 1N0LA 1KEMH 4ZUTB 1BOYA 4FQIH 4R8WH 1UJ3A 1KCRL 3QB7C 4NT6B 3OB0H 2FLBT 3DRQB 1NDMB 1REIA 4LSUH 4P5KA 5DJAA 1DQQB 4GRLB 2SEBA 1KJVA 2H1PL 3SGDH 3C8KA 25C8H 3BYYA 1JRHL 2ZOLA 5J1SC 4D9RD 5SV3A 2E8ZA 3Q6GH 3OKEA 4KC3B 3V0WL 1CICD 2C1PA 5IF0A 4XNUL 1YDPB 3SKJH 2OJEA 4KVNH 1CTNA 3MXWL 2W60B 1A7OH 3ZKSD 1LEIA 4OIBA 5FGBC 3O3BA 4UT9H 5GGTH 5D7KD 5IWLC 2Y72A 2V5RA 3CXDL 1CD1A 3LIZL 4S1QL 2W65B 4Z7OF 2AJUH 4O2FB 3RNQB 3SN6N 4X9FA 1P4IL 5F7DA 3J7HA 2V2XA 3MNZB 5GS1C 3WNOA 4G6AD 4JANA 2H6PA 2A1WH 1BOGA 5F9OL 4GO6B 3C60D 3QIUC 1K8DB 3HG1E 1UB6B 4AEIL 2VZVA 4J2XA 2R1XA 1GZQB 3BRGC 3FAWA 4IHOB 5GGSY 3SBWC 1QHOA 2AKRB 4NDMB 1CQKA 3HZMB 2AJXH 5C0IA 2DQEL 3BSZL 3IU3A 4OT1H 3C8DA 3RVWD 2BSRA 1JFQH 3MSPA 1AR1D 3P4MB 1K3ZA 2WIIB 3DVGB 2D2OA 1UM6H 4XP1L 1BX2B 3O8XB 3P11L 4GS7B 1HH6B 1FH5H 5FKAB 1T2XA 4UINL 1SYVB 5KVGL 1RD6A 1UQSA 4DW2H 1CFVH 1QFWH 1H0DA 2Z31D 3HCVB 1OCWL 1E28B 5KZCD 1VEPA 4QRPA 4OF5A 1RPQA 1GAFL 2VLRA 1IAIM 1LE9A 3C9NB 3I9GL 2BY0A 1H5BC 4WHTB 4JO3L 1I7RB 3FB7A 5DD0L 3WLWD 5SWSD 2GJ6B 3SGJC 1U8HB 3ZSTA 4Y2OA 4U0RC 4XCYB 1RZKC 1T3FB 3EFFA 5ESAB 1DBKL 3AVEA 2AQ2A 2Y5TB 3W0WB 1KCRH 1CE6A 4FHBD 1J0IA 4APQA 1MAKA 3QEQD 5JUEL 2O61A 2F54A 4Y5VC 3QFJE 1OVZA 1UH4A 5T3ZE 4RA3A 5CUSH 5J11B 4LLUA 3RWHA 5C6PB 1DLFL 4Q58C 4EVNB 1XR9A 2DWDB 1DBAL 1KT2A 3O11A 2Y06L 3NTCL 3SKMA 3SY0B 2PW2B 5I73B 3HI6L 2DQHH 4LL9A 4XXCA 2EXYD 3RI5F 3HFML 3ULVD 1A9BB 3DUHA 3LB6C 5F1SA 1X4YA 5FGCE 3MA7B 3F58L 2ZUTA 2J2ZA 4HWBA 5D1QC 4HS8H 2I27N 3TA3B 4HPOH 2YOCA 4HWBL 4NKMA 1LQSR 3OJ2C 5IMMB 5T5NG 3BQUD 2EE6A 4AEIH 3C2AH 1TMCB 1EH9A 3RZWA 1MCQA 4RWHA 5KVFH 3E6FA 1P7QD 4OZFB 5F44A 2YD8A 5JW4Q 3T4YB 1YPZB 1HILB 4R0LA 2X4TA 3I02B 3D18B 4NRZB 1CFSB 5E6ID 2R1YA 3H3PL 4YUEL 3BVNA 4BFEA 3WXWL 4JFFB 4NNPH 2VLJB 4W6XB 2RQ8A 4JHAL 2GCYB 1AO7D 1DQJA 5KAQG 2BOBB 5SX4H 1XGPB 2EZ0D 1A3LL 3IDJB 1WAAA 3Q6FB 1A5FH 3MRHB 4IRZH 4YQXL 1U3YA 4ZTOH 2GT9B 4PJCF 3MRCA 4U1KB 2H8PB 3WNLA 4CVZA 2BSSB 1D5MB 5ISZE 4PJHF 3DV4B 1UA6H 1QLFA 4K94C 5T3XH 4IDLA 1EFXB 5D2NB 5CZKA 3NZ8B 1M6OA 4KZEH 1LO4H 3KWWB 5DURB 4OLXL 1AQKL 2XN9A 3FOMA 4RDQF 1JPFB 4I0PB 1HSBA 4MDIA 1ZHLB 4EUPB 4LLQA 4XCNA 1I1FB 1MCRA 5F1KC 3WLBB 2VDML 3NZHH 4X7TB 4DGVH 4G43A 3VD9A 1RZFL 2JJUA 4YFDB 4UUJB 1T2JA 4JFDB 2WANA 5KTEL 2JJSA 2ZUWA 4Y16C 1YY9D 3TYGL 3CLFL 4X5XA 3VFMB 1HKFA 3H42H 3HI6H 5E8EB 4GRLD 2V5TA 3D0LA 3H0TB 1ORQA 2CR6A 5INDA 3FQTA 1R3HB 1FORL 1ZVHA 4R97B 2QJDA 3KS0H 4N8VG 2R0WL 4G8IB 1KIRB 2IG2L 4AM0B 3V9FA 3F58H 5K9KB 3REVA 5DT1L 1LO3L 4Y1AB 4FQ2L 5IV2A 3PWUB 4PTUA 1RVFH 3W9EA 1ZEAH 2PXYA 4XP5L 5I9QC 4WWKA 5J06A 4U1MA 3FFCB 1G7IB 4IRSC 1J8HD 4JO2H 2R8SH 3KPLA 2O5ZH 2WWKT 3O4LB 3CVHA 4NC0B 3BP4B 3ULUL 3PP3K 4Z78B 1KIQA 3CVHL 4KMTL 5GXBB 2O5YH 2Q76A 1KELL 5DZNA 3MV9A 3BEWA 5GGRY 3DO3A 1ES0A 3T8XA 1NGYA 4U31A 1OSPH 5I2IA 4RWYH 4LCWB 3VCLB 2CUMA 1KJMA 3WJLC 1OARH 1G84A 2ERJB 4YGAB 4OZHE 2ESVD 1EJOL 2AABH 3DROA 2DN7A 2DQCH 1T5XA 1V7MH 5HHNB 4AT6B 1CI5A 1RQ5A 4K3GA 3NPSB 3VRLE 2DM4A 3ARDB 2YMXH 3UPRB 4AENA 3K0WA 3UTOA 4LSVH 3F12B 3EYUL 4ZPTB 1A7RL 4TOYL 4UOW0 4EEEA 1ZGLM 2AV7A 2LQRA 5CEYB 4UTAL 4W4OC 4NFBA 1UB5A 3LY6A 3CLEH 1JE6A 5JLZB 2R9HC 3EYQD 4NQVB 5D7LD 3P77A 1Y18B 2GJ6D 3TESA 4GG8A 1XCQA 3PGFH 3QXAB 5L2JA 4JQXC 1ZLUK 3UJTL 3QPQD 3LN5A 4MAYD 2LE9A 1G6VK 2KZ1B 3W0WD 2AXFB 5KTEH 5DHVA 3VXNA 5AZ2L 5MI0C 2DMBA 2EIZA 3FO0L 1RIVH 35C8H 3PNWB 5IVXE 5HHOA 1KN4L 5CINH 4F2MA 3DARA 2QQKH 2HKHH 3M8OH 4R4BB 2IQ9H 4WHYH 3IDIA 1AY1H 1OTSC 3EDJA 4HDIB 3ZDYE 2GYSA 4YAQA 1QKZL 4YBLB 2Z8SA 4R4FL 1MCKA 1W0VB 3E0GA 4MA7H 4OCXH 4Z5RB 3BKCH 4ODXB 1QEWB 1HWHB 3TWCL 3QIWC 1MWAA 4XNXL 2YKLL 2BY1A 3PJSB 4I77L 5ELIA 5CAYB 5E94A 1MWAL 5F89B 2EH7L 1I4FB 4KMTH 1A7NL 2I24N 4XVUD 3X13A 3K4AA 4WFGE 3DGCR 4X9BA 3IDGA 5DJXB 3PL6B 3IDUA 4X8JA 1KNOA 2K3TA 3OXRB 4QOKB 4S0SD 2VRAA 2W9EL 4LVHB 4KAQL 4YHMH 1WV7T 2QHLA 3BT2L 4CW1A 4I1NB 1ZSDA 5KSBA 4X6BB 3TBWB 3LN9A 5HY9A 5K59E 2XA8L 1F90L 4KGLA 1H8OA 2P5EE 2QHRH 1YNTB 3QIBA 5EOTB 4EOWL 1Z0NA 3RU8L 5GS1B 3O4OB 4PJ7B 4EI6A 5BQ7B 2EE9A 5ENWA 3L3IA 4OKVB 4N5UA 4PGDA 3MXVL 3QIUB 4WVRA 4O9HL 4HUXB 3GZKA 5ITFA 1MCEA 2P8MB 1ZHBB 3SE4C 1RZ7L 1PY9A 1WT5A 1ITBB 3BAEL 3VH8B 1NKOA 4QHUA 5T3XD 1I7TB 3MCLH 1X6NA 1ZHNB 2BNRB 3E6HA 3LQMA 4MJ6B 3ZHDA 5L9DL 3RVTD 5E00A 3OXSA 1QBML 3TN0A 4Z9KB 2BMKB 1FIGL 7FABH 1CXHA 3S8WA 1PVHA 3STZB 2A6KA 5DYOA 3SDCC 4JO1H 5DURD 4M7LL 1LEKA 4PJFE 2FL5A 4CVUA 2NY2B 3OV6A 4R26H 3RVUD 3WD5H 1FG2A 4WI4A 3FO0H 1I7UA 3QUZC 5EZIH 4R2GD 4NNYA 4FQQB 4L4TA 5ERWA 1OF2A 3JTTA 1N64L 3UTSD 3GSRA 3HAEA 4LSDA 1ZT1A 3MRIB 1YN7A 1LP9A 2BNUA 2Y7QB 2JJVA 1S7XA 4OLUH 1XEDA 4K3EH 3MTRA 4ZFZB 1ZANH 3O6MH 2DIJA 1EAPB 4Q2ZA 3NA9L 4D0CB 4G80A 1IM9B 2NLJB 5FHBH 5EFIA 3GHBH 3VWJC 5JR1H 2W0FB 1QLRA 4GQ9H 4MA8H 3S3SA 1ZAGA 4I77H 2C3GA 1FGVH 2C7UA 3K74B 4Y5VB 3QO1A 4EXKA 1BFVH 5F7FA 5C8JB 2FX8H 5E2JA 3VFWA 2FATH 4O5LH 4WEUD 4HH9A 2IADA 1G9NC 1IGTA 3BN9D 3TBVA 1VSCA 2F5BL 4GG6E 2QSTA 3AREA 3V79C 2OJZH 1PKQE 5F1IB 3ZTJH 4AJ0A 3S88H 4S1SH 1QPPA 5ICXA 3NCJL 4W70A 4V1DA 2BK8A 2Z35B 4Z7WB 4L8BA 5GJTH 5IFAL 4GAGH 3MLVH 1I1CA 1F90H 3ROOA 4RGOH 1MREH 1IKFH 5D1QB 2ENSA 5HHME 5H94A 1CXIA 4GRWH 4IMKC 3HE6A 1U41A 5F3BB 4HKXB 4O9HH 1KEGL 4U6YA 5D1XC 2F8VA 4GBXC 2GI7A 1IC4H 4ORGA 1EGJH 4G9FE 4P2RE 5GHWL 4XWOC 4L8DB 1S9KC 1A7BA 3GGWB 3KLAA 5DQ9B 3FQRA 1RZ8A 3X3GH 3KPSB 5IB3A 1UXSA 4YFLI 1VGKB 4JR9H 3GRWA 3ZTNL 4U1JB 1OSZA 3L3HA 2RB8A 3GRWL 1HEZA 2XKSA 4I3RH 1AC6A 4HK0B 3V0AC 4U6VL 1FFQA 3RA7L 5K9OA 4AG4L 1KN2L 1TENA 3V7AG 3ARVA 4PRIE 2DQFB 4Q74A 3GBML 2DKUA 1F97A 4BELD 4GMTL 4WHDA 3IVKB 4JM4L 4KY1L 1FL5A 2YPLA 4LU5L 5I1IH 4QTHB 1QSFB 4HLZG 3CFKA 4XTRC 4HKBA 4PJ5B 3SJVD 3E8UL 3FCTA 1Q9OA 1WZ1H 3VGBA 1G7JA 1G6RH 4ODUB 1F00I 2PO6B 4OGAC 4OBRA 3S96B 4O4YH 1MAMH 5GS0C 4NQCA 4OZHF 3QZWA 4TNWK 1YECH 1E6OH 3DMMD 4ZUVA 3UAJC 3WFHB 1VKXA 4G8GB 4NQED 1JPGB 3P2TA 1VEOA 1ACYH 2FZ3B 3JV6A 3N9GH 5AUMB 4FFYH 2HRLA 4TVPE 5C0AD 4JREC 2G5BB 3D39A 3VRLF 3LMJH 3KJ6L 3MBEC 1N3NB 2F5BH 3GMOB 3KYKH 5KVDL 5E1AB 3DIFA 2BNQB 5I66A 4Y16B 1FZMB 3IFNH 5DD1H 4MS8D 4X80H 5K93A 3QO0B 3GMLB 1I8MB 2QQLH 5J1AA 1RZGA 4X7DC 1ZGLB 4LLDA 1OAKL 4FFZL 1J87A 1A0QL 1FZKB 5KW9H 5I0DA 3DO7A 1T03L 4HWZB 4HEPG 1QFPA 1X5FA 3QEGH 2GAZA 2ADGA 4OLYH 3PL6D 4EIGB 3IS0X 4LLMA 3TO4A 3QCUL 2X89D 1YMHB 5D5ME 4JVPA 5I9QB 2X05A 4YXLL 3ILQC 5I1DB 4XVTL 1GGIH 2EIDA 4TSCH 4MSWB 5H35A 1S7WB 1ZLWK 3I6GA 4QHNB 3T77A 2GIYA 3B8SA 1AIFA 3D9AH 3L3KB 2X42A 5IVXF 1MIEL 5J0BA 1J88A 4ODVH 4LSTH 3TNNB 3VFTA 1OQOA 4UQ3B 4DK6A 1P84K 3HLAB 1T20A 3ZDYF 2QR0B 3OKKA 4JY4A 1I8LC 3V5DA 5CIPH 2HVJB 1FNFA 2AJZA 5A16B 1P4BL 3OZ9L 2X9YA 4CVXB 5KSVB 2B1HH 4NWUL 2APWA 1FGNL 1VFBB 2MNUA 3I50H 1I85A 4DK3A 1KGCD 3VXSA 5HD8C 2KL6A 1C08B 4KHXH 4KI5C 3VMPA 4Z0XA 2VL5B 3FT3B 5FYJL 3KYNB 4WTZG 3CXHK 1D5ZB 1QA9A 5ID0A 5I1EH 3HNSH 1X5LA 3S35H 3I75B 4F9PA 5CZVL 1Q9KA 5CWSB 3VFOA 2ICWA 1EEZA 2NNAA 1ZLVK 2WBJD 4NO3B 1BP3B 1TJHL 2HG5B 5K59F 3T0ED 4GQPH 5TDOB 4F3FB 1T2QL 3IETB 1S9WA 3VXRB 1UWGH 1FYHB 2GJZA 1YEFH 2A6DB 5F9WC 2NW3A 2XT1B 4UBDC 2LAGB 4MA1B 1KFAH 3PQYB 1UCBL 1AKJB 3RVXC 1JZ3A 5DDHB 3SKNB 5H2BB 1JWMB 4ZS6D 5MI0B 1ZS8A 3MMEA 4JRXB 5BW7A 4YDJA 5FA3A 2WZPD 5I8KL 3IJSA 4I18C 2QSCL 3WXVL 4P5TC 4UNUA 4PB9H 4WW2C 4KKBC 2APFA 4FQPA 2XIDA 1E4WH 4UV7H 2OXGA 3QULA 1S7QB 2X1WL 1B0RB 5C07E 4YX2L 4MJID 5CP3A 1WBXB 1MFCL 4R90L 1FE8H 1CR9L 1LO5B 4OJFL 2IPTL 4PJFF 1K4CA 4PJAB 2IANA 2QKIA 5F21B 5TE7L 1J5OL 3LS4H 4QTIH 3MLTB 4URTB 3Q3GA 4DVRL 1MUJB 4P2QA 3M1BA 2ZCLH 5CCKL 2Z92A 4XVSH 5A2IH 3M17A 1NKRA 3V6FB 5I8EA 5T1LB 4E41B 1JGUH 3GMNA 2A74A 4MLSA 2VDPL 4EBQH 5I8CA 1IQDA 32C2A 3HUJA 2FECL 4UV4H 4M8VA 2YWYA 4Y4KA 1FFRA 1WUNT 2UWEE 3R1GH 4XAKD 4LCIL 1YEIL 1N0XL 3GMPB 3CVIL 1XH3B 2AXHA 2Z31A 4ZD3L 1EO7A 3TZVC 5HGDB 2COQA 2X7LB 1YMMA 1VFAB 1PFCA 4NBXB 4BYHA 3PWNA 3R06B 1I1YA 4PRAA 4MCYA 3CFCL 4RMSA 3LZFL 1MFEH 1IC5L 43C9A 1CWVA 4K71B 4ZOCA 1T1WA 1E6JH 1HQRB 2AERT 4P9HH 1OM3L 4LQ1A 1IGIL 3T2NH 5FM5O 3BD3A 4UAOC 3GKWH 4RAUB 1MCOH 4NNXA 1TFHA 3QQ4B 5EZJA 5D7IE 3QEQA 5TFSH 1QSFD 4D0DB 2IH3B 4C56A 2OMNA 5D7JC 4PJ5D 3SDCB 2E6JA 3CFIC 1NC2D 3EIFA 4XBPB 2X2YA 3MA9H 2PO6D 2QADD 1J8KA 5JZ7D 3LKQB 3CNKA 4D0BA 1K4DA 1N8ZB 3QUZB 2IBZX 4K9EH 3V0VA 3FB6A 1RIHL 5IB5B 3ZHKA 1C5DA 2XFXA 4CL7A 3NCCB 3MLXH 5SWZB 2F58L 4LRNL 2OTUA 1U6AL 1YYLH 4FOMA 2AEIT 4HV8A 1D6VL 4JN2A 3ZKQD 1M71A 4OD2B 4R3SB 2DQIL 3H9SB 4PD4J 3C5SA 3QXDB 4PRHE 1AD0A 1JK8B 3CX5J 3L9RB 3GB7B 2VISB 3BGAA 1VA9A 5TE6H 4GLRI 1ZA3A 3BZEA 4GAJL 3QDMB 3C5ZC 2YC1B 3VU2A 1BZ7B 3J8F7 4IS6A 3CDGB 4RAVB 4NZDA 1CBVL 1C12B 4WFHE 5I1KL 2Y6SC 1L7IL 3VGDA 1UXWB 5DMIL 3LQAC 5E6IA 4AEHH 1E0OB 1JNNH 1INDH 1JZ2A 4EQ2A 5C0FB 3DSNA 6CGTA 2NY3C 3T04D 1HXYB 3EFDL 5LXGH 1L0QA 2K7QA 1AO7A 4P4RB 5FDWA 1JGLL 2PYEB 4KKAD 1CL7H 1FNEA 5D1ZD 4ZD3H 4U7MA 4ZQKA 2BSTB 3O9WD 4IDJH 2FEEL 3HRZA 3FL7A 5D1XB 2G9HA 5FECB 3KPMA 4GBXB 4EDXA 3MREA 5DUBA 4EI5B 12E8H 5EA0H 4ACPA 1CLCA 4HPYL 3S3JA 4OD3L 3T09A 3H3KA 1T0NB 3V52H 1NCBH 4XMKL 4PJCB 1KCVH 4PJHB 5LGJA 2GITA 5DJCB 4N0CD 5C3LD 5HHQA 4PJXE 2YD7A 1F3JB 1X7QA 2DQGH 3ZKNC 2BVQA 2BDNL 2NY7H 3PWPE 5EU3A 3L1OL 2A9NH 3QDGB 4XC1L 5D5MF 4NQSA 1RULL 1JI2A 2L0DA 5GZNC 3CZFB 1CXKA 5MENB 2ZUYA 5EU5B 1AHWC 3AY4C 4NT6A 2Y07H 3LCYA 3DRQA 4G6KH 1J0YA 1NDMA 1PX3A 4P46D 5D72H 1RZJL 4Z95H 3BZFB 1DQQA 4GRLA 5MEPB 1GCFA 1MHPL 3VXRD 3MV8D 2D7OA 1FQ9C 3L3JB 4XX1G 4KXZH 2C3XA 3PQYD 4HIEB 3RX5A 1NUDA 3RL2B 1YDPA 2W60A 5A2KH 3O6LL 1BLNB 5C0RH 4NQDD 2CKBB 5EC1B 3ULSB 4K8RC 1T89C 5T5NF 2W65A 3TH2T 4QRQB 4O2FA 3RNQA 2F53B 2HTLC 4PRDB 4JREB 1QNZH 3MNZA 3MBEB 4M6NL 3H6JA 3GMQB 1MQ8A 1L7IH 2NPLX 1C1EL 1X9QA 2B0SL 2NY5H 5KOMC 1K9TA 3UZQA 4A2MA 1K8DA 1YNLH 3S36H 1UB6A 3S7GA 1AFVL 4MB4A 1GZQA 3MQIA 1WBZB 1FVCB 4IHOA 2DQUL 2AKRA 4NDMA 4MNGE 3HZMA 4MJ5B 4AL8H 3B4NA 5DGQA 5C6WH 5KAQF 5JHDE 2A9ML 4X6DE 4MZ3A 3P4MA 2WIIA 1U93B 1INEH 3MJ9H 1BX2A 3O8XA 1ULVA 1HH6A 5DJ8B 2X4PB 1N6UA 3EYVB 5FKAA 1WGOA 1IARB 3B5HA 1SYVA 2PYFB 4EQ3A 4P4KD 3CK0L 4WUKH 4XMKH 3HCVA 4JHZA 1E28A 5I19H 3D85D 4L3AA 1KB9K 1NGQL 1Q1JH 4L3EE 3MZGB 1KBGH 5IB2B 5E8NB 1OTTD 3C9NA 4WHTA 1A4KB 1D5BB 1I7RA 3SCMB 3WFEL 1I9RH 4RMRA 4LP5A 2GJ6A 3EKCA 1CG9A 1V3JA 1JZ4A 1U8HA 4M1CC 2HWZL 3O81A 4XCYA 5JIPA 5ESAA 2DQDL 5KJRL 4U6TA 5I18H 1PSKH 2Y5TA 3W0WA 2IPKB 3B2UD 1NH6A 2VQ1B 3VXPB 1R0AL 3EZJB 4Z7NE 1FNLA 2HA1A 5I17B 3V6OA 2YRLA 3MUGB 5EOCJ 1NL0H 3ESUF 2X1XR 5FA4B 3FFDB 4EVNA 4OLWH 2DWDA 3HG1B 5K33A 1TZIB 3FRPG 2UY6A 4GRMA 3SY0A 1BZ9B 2ZSVB 2PW2A 5L2KE 5ACMA 4J3SA 3G6AB 5F7YC 4MWFB 4HJJL 4FQLH 1KB5B 5SWZD 2UWEF 2Y36L 2ZZUT 4DAGH 3V7AE 3MRFB 3MA7A 1RUML 1BQSA 1ITCA 1GOFA 2D7QA 5F9WB 1S5HB 3UDWC 1VADB 1GGCL 2JKXA 3TA3A 4CMHC 4E5XB 5KVMC 3JWDC 3O2WL 5IMMA 1OLZA 4QGTA 2L7UA 5BZWB 3QPXH 3MV11 3QDMD 4G3YL 4P5TB 4WW2B 2XZCH 5EU6D 3O3DA 1ZK9A 2AEPL 3ZT6A 4FTVD 4KKCD 3T4YA 1YPZA 1HILA 3W11C 3GFUA 4HCRL 5D7IF 3GSNH 3QDJD 4Z7QF 3RGVC 3BRDA 3QJFB 3I02A 3D18A 1BBDL 1CFSA 4NRZA 4BQCA 4MVBC 4YXHH 1N59B 1A1MB 1KPRB 1SEQH 4JFFA 3AUVA 4L4VE 1OP5K 2HJFB 2VLJA 2V6HA 1CXFA 4OGYH 4LLYA 1X5YA 4U6XA 2GCYA 5C09E 4JPIB 5L7XH 2BY2A 3IU4H 1AXTL 2BOBA 1XGPA 4P59L 1IAOB 3IDJA 4LASL 1WWAX 5B4MD 3Q6FA 3MRHA 3HE7C 2GT9A 4Z7VF 4U1KA 2H8PA 2XRAH 2BSSA 1D5MA 2NY6D 1NCNA 4H26B 5F7EH 3B6SB 1EFXA 2VLKD 5D2NA 3L3OB 3NZ8A 4EI5D 3BKYL 5BS0D 3KWWA 5IR1B 3IDNB 4OLVH 5KJRH 1O7VA 4MQXD 1UKQA 1JPFA 4I0PA 5FGCB 3TBSB 1PEZA 5JDSB 3CGTA 4JM2F 1ZHLA 4YFLF 4EUPA 3QWOA 5F7MC 5FYLH 2CDFB 3UTSA 1XGRB 3WLBA 4RSVA 4X7TA 5DMJB 1BEYL 2R2EB 4DQOL 4UUJA 4X5WB 1YEEH 5B39B 4JFDA 1SY6A 4OLZL 3VFMA 5D6DC 3ZYOA 1SY6L 1HIML 4ZPVB 5E8EA 5IBUG 1JHLL 3VXQB 1FCCA 2HP4A 4LIQH 3H0TA 4PJ9C 4MQTB 1QACA 5DRZB 2HJLB 1R3HA 4NIKB 3RY6C 3UTQB 5KSAD 3O3UN 2XI9A 4G8IA 1KIRA 3HB3D 5D7JB 4AM0A 4UZGA 5K9KA 4CKVX 4K7PH 5GJSL 3VGFA 1GGCH 5DK0B 3KYAA 3PWUA 3WUWB 4O02H 1KG0B 4LSRH 3FFCA 1G7IA 3KLHD 1QYGL 2XQYG 2EYSB 4YHLH 2FJHB 3B9KB 3EGSB 5JXED 3O4LA 4QO1A 2F53D 1CU4L 2ARJB 4KDTA 4FP8L 3BP4A 4Z0BH 2VDOL 5ISZB 4Z78A 1L9NA 3PWLB 3KPOB 4HCRH 3OKMB 4PJXF 4OZFH 1N6QH 2JELH 4WI8A 3CH1B 5CGYC 1HDMB 4U1GC 1CLZH 5GRUL 3QQ9D 1GC1H 3ES6B 1A14L 4LCWA 3VCLA 1U3HC 1D5IH 5M95B 1IC7H 3MRNB 1DL7H 1FO0B 5E2UH 1CT8B 2FJFB 3C5ZB 5LG1A 2FWOB 2YEZB 3RTQC 1PY4A 5HHNA 4AT6A 4KK9C 2KDGA 4Y2DD 4XWGL 3PP3H 1B0WA 3ARDA 3U7YL 3UPRA 2E3VA 3F12A 4ZPTA 3X12B 3U82B 5ALBL 4XB8A 2NY3B 4KKLD 5CEYA 1ZTXH 5E8DL 2D4FA 2C9AA 3TGXA 3EDFA 3U0WL 3WJJA 3CSBA 1RMFH 3BHBB 4QRSB 5ILTL 3D87B 4HF5L 2NY1D 2HJKB 4NQVA 1S3KH 3PGDB 4LK4A 1Y18A 4TQEL 3QXAA 4PY7B 5HYEA 1B0GB 1ZV5A 4U3XA 3IRPX 4BH7B 2HLFD 1S78C 4BFIB 1WEJL 4FQCH 2AXFA 1S5IH 4F9LC 3PNWA 2W91A 1NEZB 5FUCE 5IBTH 4R4BA 4KK6C 3QCVH 2R15A 3WE6B 4O58H 3HR6A 4FG6C 5KS9B 4IRJC 4CMMB 1QSED 2ZJSH 4HDIA 4X6DF 2P5WE 3NBNA 5ITBH 3KHQA 3HG1D 2VXVL 3IFPB 1YY8B 4POUB 3SGDI 1W0VA 5JQ6H 5IW6B 5KOVC 4Z5RA 3ARFD 4OZHB 1QEWA 1VDGA 3LPWA 1F4WL 4KDWA 4H8WH 3UTZB 3PJSA 3VRJB 3S5LG 5F89A 1JZ5A 1QR4A 1PKOA 3U9PL 1I4FA 5I1JH 5BJTB 5IFHH 5DJXA 3PL6A 2ADJB 3OXRA 1IAIL 4QOKA 5FGBA 4H88H 5AZEH 3VXTB 3ARBC 3TBTB 5IWLA 1S7SA 4OCSL 1DJSA 3GSQA 1HSAB 1NMAH 3K1KC 4X6BA 3TBWA 3VFPB 3TNMB 5F93C 1OGAD 5E99H 4Z7NF 1XGQB 1YNTA 3UYOD 4U0QB 3S4SG 5EOTA 4LHJB 4F7MB 5FGSA 2ZKHH 2VR4A 5GS1A 3U7YH 4PJ7A 3ZHLA 3K81A 1KV3A 5T1DH 2ARWA 5BQ7A 5FEBA 4OKVA 4OI9A 3QIUA 4HUXA 2P8MA 1ZHBA 1K2DB 1NSNL 4Y7MA 5IVXB 3VH8A 3QFJD 1I7TA 4GXVL 3FB5A 3MC0A 1ZHNA 3PXJA 2BNRA 1A6ZB 4MJ6A 4G42B 2DAVA 5ILTH 4FFVD 1QFWI 2BMKA 4YJZL 3STZA 5C08D 3VDAA 3QHZH 4OCWH 1NGWB 1TVBB 5FYLD 2VH5H 4HW6A 3EYSH 4XNMB 1BJMA 1QBAA 2G2RB 2ZSWB 2WW8A 1LO0H 1UC6A 3IDXH 2ZUQC 4LGRB 2JIXB 1HE7A 4FQQA 5JW3L 2DQJL 2G75B 5DLML 4D9RE 4XHJD 3MRIA 3STBA 1GGBH 1S9YB 4NBYB 4RX4D 4ZFZA 3SGJA 1OT1A 3OAZK 3GHEH 2R0KL 1EAPA 4D0CA 2NLJA 2FB4L 3BFOA 2QQNL 5F96L 1Q0YH 4RQQB 3MODH 2W0FA 4JG1L 2WP3O 3V8OA 5C2UB 2V9TA 2LTQC 2P5EB 5HGBB 2NTFA 1GOGA 2P24B 3GNML 4Y5VA 1T7WA 3MLWH 1XR8B 5C8JA 1PX4A 3BDBA 4WI2A 5CP7B 2BRRL 1XIWD 2LABA 4JJHA 2NZ9D 1CDHA 2BJMH 5F1IA 3B9KD 1NUNB 5D70L 3HRPA 4RGNC 2J8UE 3MNWB 3I2CL 2DJSA 2EDLA 2Z35A 4Z7WA 1CIDA 3LRSB 4LNRB 4BSJA 3BWUC 4WHYG 1R3KB 4PLKC 3MACH 1QVOB 5J6GB 4X4ZA 1J11A 3F62A 5D1QA 2IF7A 3DHMA 4BH8B 4YHKH 3ZKMC 3T1WA 1CYGA 1A6UL 1B6UA 4CMHB 3SE8L 4NFDA 4X9GA 4NKDB 2OZ4H 5F3BA 4HKXA 1W72H 4XX1E 3QG7L 4KDVA 1CF8L 3OAYK 4WRLA 2FLRT 4XMPL 3QHFL 1UYWH 3NPZB 4L8DA 4QHLA 3GGWA 4KMQA 1BM3L 5DQ9A 3OF6D 1J0JA 5SX4I 3KPSA 5LQBL 1VGKA 3WEXB 1MPAL 4K23L 4M1DL 4U1JA 4JPWL 3KNBB 5SWSE 1HZHL 5F3HB 1FL3B 2BVUA 2C3VB 4HK0A 4LSSL 4GJTB 3VD7A 1GXEA 4TNVF 3AB0B 2VAAB 1R3JB 1YEKH 3PGCB 5LWYH 2AEQL 3CSPA 2DQFA 1CGSH 3MLYL 3VD3A 4FXLA 4OCYL 3V4UH 4JM2C 3UTTB 5TE4H 4LVEA 3IVKA 1DQMH 2WINB 4FQJL 3VI4E 4GG6B 3N1QC 4QTHA 1QSFA 1PKQB 4PJ5A 4K94L 3P9LB 5MEOB 15C8H 3ARXA 4JFQB 1QOKA 3OR7B 3VFVB 5HYFA 1I3VA 1UM5L 2NXYD 2PO6A 4ODUA 3S96A 4XH2B 1BGXL 3ULVE 5IW1B 3LDBB 4POYA 1RZKH 2Y23A 5FCUH 3WFHA 4G8GA 1JPGA 4HUKB 4JGJA 4HULB 3L5XL 5AUMA 5F6HI 1F4YH 4HIXH 1ADQH 5HHMB 3T0WA 3QCTH 3TV3L 2VDKH 2G5BA 3BJ91 2G5RA 1N3NA 3GMOA 1WC7B 5E1AA 2AGJL 5E2TH 1EUTA 3G9AB 2BNQA 3BZDA 3OSKA 4Y16A 1FZMA 4XNYL 4G9FB 4P2RB 3WIFB 3UCRA 3QO0A 3GMLA 1I8MA 5FOBB 2LAAA 1OP3H 1ZGLA 1FZKA 2GSGB 2CRIA 4HWZA 5FYKL 2AXGB 3HZKB 5DRWA 3DURB 3TPKA 4J4PD 1QBLL 1NEUA 2E9BA 1I1AD 1YMHA 3HMXA 5I1DA 2FGWL 3GMMB 4Y4FC 2E5EA 4MSWA 5EPMB 1P69B 3HMXL 1S7WA 4PRIB 3TIDA 4QHNA 2CRMA 2RFXA 3QI9C 4NCDA 4A2LA 3L3KA 2R1WB 5DUMH 1NUGA 1IGYB 4NO0B 4QXGL 4UOW1 5JA8B 5CD5C 1JN6B 1NC4B 5T5FH 2P1YA 4HJ0D 4YHZH 1AD9B 4HFUL 2PXYC 3RNKB 4WWKC 1T1ZB 3TNNA 4WO4D 4XPHL 3VD5A 4UQ3A 5I1GH 1AH1A 2PTUA 1MRFL 3HLAA 2CRYA 4U1GB 1ZOXA 2QR0A 3P3YA 1WK0A 3O9WA 2HVJA 3SDXF 3ZTJG 5A16A 3EOTL 1U3HB 3WJLA 2R0LH 4U7KA 4GT7A 1IEBB 1KCSH 4CVXA 4J6RL 5KSVA 4HX1B 4M9OA 1F2XK 4PB0L 5DXWA 1VFBA 2R2HB 2CLVB 1B6DA 4OFIA 3RTQB 1ZLWH 4JB9H 1C08A 4N1EA 1VGEH 2VL5A 4NKIL 3HPLB 3FT3A 3KYNA 4UT7H 1F5WA 4WFFD 1ZLSL 1GIGL 1D5ZA 5AD0B 4K3HA 1NBZB 2DQTH 3W39B 1Y6KR 3I84A 5K9QG 4LSPH 3I75A 1ROWA 3EDDA 2CGRL 1TVDA 3SDAC 3EUUA 3VFRB 4KJPD 5CWSA 3QNZB 1F42A 5JXAH 2GSIB 4P2CG 1BGXH 1A02N 1LK3L 4PP2B 4NO3A 5B8CC 2GEEA 3GIZH 2YRZA 1JWUA 3SDDD 2VXTH 4ODHL 1Q0XL 3S97C 4P9ML 4F3FA 5CGTA 3NH7H 4D8PB 3IETA 2CUHA 4DTGL 1BIIB 3VXRA 3FHAA 5D5MB 1H9VA 4J7RA 4M1GH 5FOJA 1J8HE 2A6DA 4MLIA 2O5XL 3PQYA 3VG0L 4ZFGH 5DDHA 3SKNA 5H2BA 1JWMA 3S34L 3S35X 6FABH 5K9JL 4JRXA 5IGXL 4PP1D 3S98A 1ZLVH 3WBDA 2ORBH 4F33B 1S7QA 5LGHL 1A6WL 3UJJH 3QWRD 2DTMH 1B0RA 2HTKD 1IZKA 1WBXA 5D7SL 4F58L 1BHGA 5EWIL 5I8OL 2ESVE 3RUGE 1LO5A 5IK3B 4XVJH 2HT2D 5D96C 1UGNA 2FX7H 5EC2B 4DGIH 4K3DL 5DJDB 3GSUB 1NAKL 4P99A 4PJAA 5E2VL 2ZUXA 3HI5H 2YPVL 3MLTA 1MUJA 3RWIB 3EJYC 4ZXBC 4HXBH 2YUZA 4FNLH 3TT3H 2YD2A 3VWKC 4X6CF 3V6FA 4E41A 2H41A 3MUY1 5IKCB 4U33A 3EOTH 3ARBB 2CMRL 5F8QC 4X7SH 5MP6L 5ETUB 5H37H 3AFLA 4HK3N 2DBLL 3CPLB 1BAFL 2XWJB 3VXUD 2VSCA 5FAAA 4P4KA 3GMPA 5D7LE 1T6WA 1XH3A 3IKKA 5EZOH 4G9DB 4NKIH 5JA9A 5HGDA 4HUVB 1VFAA 1JV5B 2VMFA 2JB5H 5B21A 1NDGB 2JK5B 2WQ8A 3R06A 4NC2B 4Z7UE 2B5IB 4OV6F 3GJFB 3SE4A 1FBIH 5JHLL 1F4HA 1OD7A 2XKNB 2NY0B 2YHGA 5D2LF 2J8UF 1HQRA 1F8TH 4X6EB 1RUPH 2VXUL 1LILA 2P8PB 1KENH 1HHGB 2CH8A 4RAUA 2EDHA 3QQ4A 1G9ML 1DVFC 3KPRE 2VZTA 4D0DA 1RUAL 2IH3A 2ZCKH 5C07B 3WV0A 1TZHB 3SDCA 3JWOH 4XBPA 2YD5A 4RZCB 5IESH 4OFYD 5C0IB 1GL4B 1S9XB 3DTXB 3ARGD 3LKQA 3TN0C 1N8ZA 4FZEL 1CFNA 2K7PA 3QUZA 5AEAA 2ZUQB 4X4ME 2WMPA 4M7ZC 2D03L 4YIQB 5IB5A 3NFSH 5BVJB 3DVNB 3MLZH 2J4WL 3CCHB 4HS3B 5HHMD 1GGTA 5SWZA 3SE3C 1FJ1B 2KZWA 2OXHA 4N8VB 1V3LA 3IKCB 4OD2A 4R3SA 5ALCH 1YQ2A 5EUKB 3QXDA 1K6QH 1JK8A 1NGXB 3L9RA 3GB7A 3TJEL 2UWEB 2VISA 4TUJB 1KIPB 2ZG1A 3QDMA 4X8XA 2YC1A 3Q0HA 1BZ7A 3VI4F 3CDGA 3PDGA 4RAVA 4FTVA 4JFED 4N0UE 4YK4C 1B4JH 5IMLB 1MHHB 2DJUA 3ARRA 2XZAH 1UXWA 4R7DB 2WUCL 3NACH 4RISH 5T3XE 4CUCA 1MLCB 5C0FA 5E7FA 3BDYH 5DMYA 4L5FH 4NJAL 3ULVF 1HXYA 3RWHB 4GW1B 2FO1A 2PTVA 5K9QI 4KU1A 4P4RA 1BVLB 1GOHA 2VZSA 3AREC 5D7IB 2E9WA 4H25A 2PYEA 2EDBA 3SKMB 3EJZC 2AJSL 2BSTA 3HMWL 4OV5B 4RFEB 5CJBA 1JHTB 3T0DA 4IMKA 1A3RL 5D71L 1MF2L 5E5RB 5FECA 4GBXA 3MUZ1 5F72S 4EI5A 3MZTA 5BVPH 4KRNA 1EEUA 1T0NA 2WAHA 4M7KH 5CJOH 4F15C 1CGVA 5H8DA 4M43H 1HN1A 2AI0L 4PJCA 2J1KA 5CSZB 4H0HB 4PJHA 3HE6C 4NCC1 2RHEA 5DJCA 1N5YL 4U6HB 4EN3B 3GBNH 1F3JA 2YBRB 1BMGA 1YC8A 4M5ZL 3BUYB 4U49A 1U91B 5DFVD 5EOCH 4F7CB 5J3HD 5DQJB 1DSFH 4PRHB 1FSKC 3QDGA 4QRRD 1BFTA 1JGVL 2C4FT 2APXA 3CZFA 4OIAA 5MENA 2WBKA 5EU5A 1AGEB 3BVNB 2ED8A 4JM2B 4LEXL 3PDOB 3BZFA 4JGMA 1NLDH 5MEPA 2WNGA 4ZNCD 3G5ZB 2KQMA 1LO2H 4ONFH 5HI3C 2B1AL 3KXFE 3L3JA 4HIEA 4YBQC 1JF6A 1NLBH 4NN7C 4HGKC 4PY8I 4YXKH 4NGHH 5F7HA 4L8CB 3U83A 2W9DL 3VGEA 2OR7A 1BLNA 3EO9H 2VITB 5CZXD 3TJEH 2CKBA 4UMGA 5EC1A 3ULSA 2VN4A 5JOEA 5GS0L 3TVMD 2W07A 5C3TA 5IQ7L 3X3FL 1UADC 2CKBL 2OL3H 4QRQA 1C5CL 2F53A 1E27B 4RMWA 1X4XA 4CJ1A 2DYPD 3MBEA 4GMSH 3FOMB 1U8QB 3GMQA 4M8QB 2NR6D 3VFGH 1G9NH 2IFFL 4PJGF 1HSBB 2VDQL 4BUHA 4M6AA 1JHKH 5C7XL 1INQB 1T66D 1WBZA 1SBSL 4PGZA 1FVCA 5FUCC 5ICZB 4V2CB 4QCIB 2M26A 1CDJA 4DKAA 4MJ5A 4PJXB 5DA4A 3SQOL 4NOBA 3F7RA 5C0JB 4KUCF 3DSFH 4KK5D 3PWPB 1JP5A 3Q5YA 1U93A 5E24E 4N9OB 4Y4FB 1W0WB 5DJ8A 5EO9B 3WL9B 5JMRA 3EYVA 1RAMA 3W2DH 3QI9B 2PYFA 1FRGH 2V5MA 5DFWH 3S36X 4OCLC 3GO1L 3I6KB 1XF4B 3PV7A 1FYTD 2WLYA 4MNQD 4GW5B 2XZQL 2F19L 4M6ML 3FJTA 3RZCB 5IB2A 2BXZA 5E8NA 5GISL 4TYUA 3SJVE 4GXUN 3RIFF 4TTGA 1A4KA 1NAMH 5IVZB 4XP6H 1D5BA 4MD5B 4PGCB 4UTBL 3SCMA 5FV1L 4CN4A 2NY0D 4M62H 1OHQA 3AC0A 3JWNC 1A7PH 2VLME 3ZT7A 4NQEE 1CIUA 2CIIB 3LN4B 1ES0B 4JDVB 3SGKA 2IPKA 2VQ1A 2Q86B 2VQTA 3VXPA 4ZTPL 2PNDA 5C0AE 3EO1B 2DD8H 3T2QA 3QT2A 4X6FB 3GI9H 1JCKA 4RRPA 4XBGB 5I17A 5I6XB 2A2QT 2VWEE 3MUGA 5FA4A 3FFDA 3TO2B 4NN6C 3HG1A 3SDAB 3RWEB 2R4SH 2AK1H 4JFPB 1CFTB 1TZIA 3N50A 5DUPH 1OLLA 5E95B 1BZ9A 2ZSVA 3NAAH 3G6AA 4MWFA 5B8CB 1FLRL 1KB5A 4GAFB 4HZLB 2ATKB 3DX9B 4OD1H 3A67L 1KB5L 4U7SA 3B3IB 5JHDB 2ENYA 4POZC 4WCYL 1J18A 3MRFA 3BP7B 4W6YB 3P0GB 2FO4A 5FYJU 3VE0B 1S5HA 1VADA 5IVNA 4XBEL 1JMZA 3IT8D 5F71A 2UUDK 4Z7UF 3EOAB 3QUYD 7CGTA 4E5XA 5C71A 4DKEL 5BZWA 4L29B 4NZTH 1HXMB 1WIOA 4PJEE 1A6VH 4N0RA 3WDIA 4P5TA 1UACH 3K46A 4WW2A 4R7NB 2VL4A 4L3EB 4I3SL 3OKNB 1NCAL 1JYVA 3BPOC 3CFEB 1CICC 1OTUD 4XCFL 3WO4C 3QJFA 3UC0H 1HHKB 1A1MA 1KPRA 4A6YB 4ZS7L 3TH4T 4S0TD 3L5WB 3QG6B 1EEQA 5C2BH 3R8BB 1U8LB 4HIIB 3E1F1 1N7MH 5J9PB 4N0YL 4JPIA 1KGCE 1RUKH 3T1FB 4JY6B 1YQVH 4JHWH 1AI1L 4HC1A 1IAOA 3QFJA 5IHBA 1QTYT 5JO5B 4ZXBB 1NCWL 4HC1L 3WFDL 4G6AC 2JCCE 5EH1A 3VWKB 5F6HJ 1RU9H 5T3ZL 4KROC 4H26A 3C60C 2J5LC 3L95B 4JN1H 1B2WL 1W0YT 1N2RB 1JMXA 3B6SA 4OGZA 3L3OA 3LV3B 5L2KB 5IR1A 1OP5H 2WQRA 1C5BH 3IDNA 4WU7B 5CBEB 5BMFH 3DUUB 1F4XH 2DTSA 4F37F 3RL1B 1WWCA 3JSSA 1RHHB 3O3EB 3T0EE 3RVWC 3ZMRA 3EYFB 1AR1C 5JDSA 4EN3D 5DHYB 4XNZC 1A7QH 3DI2B 2X9WA 1HK6A 4BK5A 1UWXK 1UENA 3NGBC 1EDQA 2CDFA 1XGRA 2VIRB 1DN2A 2DIBA 4LHUG 1JPSL 1UKSA 2R2EA 4X5WA 4TUOB 5B39A 5IB4B 3WFBL 2Z31C 3F7PC 4OM1H 1MJ8L 4JCMA 1EO8L 4DCQB 5CEZH 4WUUD 4ZPVA 3VXQA 4UB0H 3NA4A 5DRZA 2HJLA 4WFHD 3UTQA 1DVFB 3N1GC 3UJIL 4NSKB 1ZT7B 5D7JA 1QRND 3WLWC 4MJIE 4OIIL 2I60H 4L4VB 1KCUL 1VENA 1CDCA 4XBEH 5DK0A 5TF1L 3WUWA 1KG0A 2VDLH 4HT1H 5C09B 5B38B 1P4LB 3KPQB 4GRWE 1TNMA 5JNYB 4M7ZB 2EYSA 2JF1A 2FJHA 3B9KA 2ID5A 3EGSA 1YJDL 4XRCB 2I9TB 4NQTA 4BKLB 5IFJB 1G0XA 2UY7A 2ARJA 1MH5B 3G6JE 3Q1SL 1DANT 3NMEA 1KYOK 5ISZA 3OG6B 1LEKB 3PWLA 4D9QD 3KPOA 3OKMA 4BK4A 1FG2B 3CH1A 2RCSL 1HDMA 5HHPB 2HFFB 2IALB 1S9VB 1IGCL 3ES6A 2OYPA 4K7PX 2AJVH 3QEUB 5HYJD 4K07A 1BVKB 2EXYC 4M6OH 3MRNA 4Y19D 4GKOA 4XAKE 4F57L 1FO0A 3RY4A 1QFUL 1VB9A 2J8HA 1CT8A 4GSDH 2FJFA 3C5ZA 3OL2A 2YEZA 2X1PA 1FO0L 4WU5B 3OKLB 4YDIH 2NX5E 4LOUD 3PWPD 1AE6L 5F7KC 1AGBB 3VD4A 1MEXH 2OSLB 1FNSH 2G60H 2VOTA 2X1QA 4X9IA 1B2WH 3BQUC 2R2BB 4YHOH 1PLGL 1DQDL 2DKMA 3MFGB 5F7NC 3P0VL 3RX8A 2DJ4A 4HG4K 4LAJH 4PJ8B 1IGTB 5KBNC 4JQIH 3RZCD 4NC1E 3ZDXE 5E6IC 5AYQA 4QRSA 3BHBA 3ALPA 1VPOL 3RY5A 5KVEL 4NM4H 3GSOB 2L7JA 1XGYL 2HJKA 4ORZC 5DI8A 4Z8FL 3PGDA 2YK1H 2D7NA 1WAAF 3R8QA 4PY7A 4R96B 1B0GA 4KTDL 1CE1H 4BH7A 5KN5B 5BV7C 4BFIA 2EZ0C 1P1ZB 1GGUA 3O6FD 1A64A 1LEGB 2V17H 4F15B 4FQXD 5B3NA 2E6QA 4RFOL 5AWNH 1NEZA 1CCZA 3U30B 4OSUL 4PLNC 1IFHL 3WE6A 4WI6A 3MRMB 5A2LH 4PFEA 3C08H 1CGTA 4CMMA 5IQ9B 2PR4H 3IFPA 1JIBA 1TPXC 1YY8A 1DFBL 1FSKB 3R0NA 1UWEL 5IW6A 3HC3H 3FQRB 1T04B 4OZHA 4KXZI 1TJIL 3CFJB 1KPUB 1K5NB 3NIGF 4ODSL 5HVWA 3OBAA 3AY4A 3CIQA 4DZ8B 4WI5A 3UTZA 3VRJA 4LAQH 4F8TA 3D2UB 3WNMA 4OAWB 2GUOB 4UIKH 4XAWL 3KHOA 3HNTL 3LKSB 4P3DB 5E5UB 5EBMB 5BJTA 3NCMA 2I25N 3LSOB 2R0ZH 1YY9C 4NN7B 1IQWH 1XF2B 5BRZD 2ADJA 1I9JL 1MFBH 1J05B 4ELKB 4GRLC 4XP9H 3VXTA 3TBTA 1Z9SA 1HSAA 5DD3L 4OB5H 4CNIB 1T89A 5IHUH 1UEMA 2D7TL 4F7TB 3BJLA 3VFPA 5I75C 2EDDA 3HI1B 4JRYD 4WIQA 2HH0L 1HNFA 1XGQA 3RBSA 4JG0L 4F7MA 3BWAB 1RUQL 1NCCH 4ZO8A 1NBVL 5FUZH 2E7MA 2OK0H 3CDCA 3THML 3UPCA 1BWWA 2EDOA 4P2OD 4RGMB 3LQAH 4H1LH 5IVXA 2FEEI 4OGXL 5HHVL 1TTFA 1Z6JT 3RWJB 3S37L 2ILLA 1CDUA 1LDPH 3KG5A 2IGFL 1A6ZA 4G42A 3LEYL 4OFVA 4OZFG 3BW9B 2P5WB 2FBOJ 1OQXA 3RVVC 4P23B 4PJDE 4HBCL 4OQ1A 4NJ9L 4ERSH 5DD5H 4UILH 1NGWA 1TVBA 1RFDH 1KXTB 4Q7DA 5ADPL 1MFDL 4XNMA 2G2RA 2ZSWA 4HKZB 2ADFL 1AQDB 4JDTH 4PJEF 2V2WB 2JIXA 4XPFH 3MV8E 2G75A 1JNHA 2AXJA 2XZZA 5CEZD 4OCRL 4JEGB 3CFDB 2Z91B 4NO5B 1AIFB 5L88L 3FOLB 1S9YA 3O6KH 4CDHA 4NQDE 4L8SC 5T1KD 3VRIB 4PV8B 4OQTA 4NQXA 2DMCA 3BPLC 4ODSH 4RQQA 4TSAL 4OQTL 5GGVL 2E27H 2P5EA 2P24A 3MCG1 2MSPA 5HGBA 1FN4B 3UYRL 4JVUA 1XR8A 4XPBL 3RVXD 2VXSL 1J12A 2JCCF 4PGBB 4EUPG 5CP7A 1LD9B 4MAYC 2A6IB 4J3VA 4C54A 5EZLB 4GKZA 3G9VA 4NN6B 1IGFH 2RAMA 1EZVY 1G0DA 2OR9L 4Y4HD 5DRXB 3NVQA 3OAZH 5M94B 1OAUH 2YD9A 3TJHD 3MNWA 3BRFA 1DQTA 4F8QA 5ECJE 3V6OC 5D93C 4PV9B 3LRSA 4LNRA 5I16B 5J11C 2HFGL 1T1XB 4K8RH 1R3KA 1D5XB 4J3TA 1QVOA 5J6GA 4IIQC 3VFOB 2ICWB 3CAFA 1PQZB 5A40E 5DJZB 4YWGL 3UDWA 2VXQL 4BH8A 4FQHB 2FSEB 3WIHA 4PJFA 4NKDA 1CK0H 3RGHA 3SEPA 4XI5D 1PG7H 3ZE2E 3WIHL 5HI5D 4KQ4L 3NCYP 5FHAH 3MX0A 4YHNB 5DTFA 2EC9T 1QFWM 4XVUC 3BPOB 1QPXA 1CICB 3VW3L 4S1RL 3WO4B 4DEPC 4Q0XL 1HINL 2KQNA 3WEXA 4P2YA 1L4IA 5C0CD 5I15H 5AAMA 2LU4A 5F3HA 1F11B 1FL3A 1UZ8B 1AR2A 2C3VA 2W9LA 4PY8J 4XC3H 1EV2E 2VAAA 1FFOB 1MFDH 3TZVD 1X44A 3RBGA 1EXUB 4NHUB 4TUKL 4NZUL 1HQ4B 3JBG7 3OAYH 3G6JF 4DOHE 1J1OL 4NHCH 1WFOA 3MV7D 1UM4H 1XF5B 2WINA 1EMTH 2BVYA 1TJGL 4MMXC 4RCAA 1KLFA 3C60B 4Q9RH 1OPGL 2J5LB 3KR3L 5HVHC 4GG6A 3EAKA 4TULH 1PKQA 3VFNB 5GPRA 2DOCA 3P9LA 4ODTL 5MEOA 4JFQA 2IPUG 2J8UB 4XPAH 3OR7A 3W81A 1Q72L 4OFYA 2V7NB 4KVCL 1EUUA 4XH2A 3RVTC 3RAJL 5IW1A 3U9UB 3TT1L 5BOPA 1HYSD 4HZAA 4XNZB 4LARL 2OP4L 3F7VA 4R4ND 5IP4A 1IGJB 5LGKA 2J6EH 3DYOA 3LH2H 1IQDB 3RPIB 1AXSB 1I8IB 3E3QE 3RVUC 2EEAA 1WC7A 3BKMH 2Z31B 4R2GC 3PV6B 1LP9F 5KZCB 4G9FA 5D6DA 4P2RA 5LJYH 5EU6E 5GRYA 5FOBA 2YD6A 3DXAD 4ZAKD 4D94A 1MCWM 1AGFB 2GSGA 3QDJE 3ZDXF 1EVUA 2RBLA 2AXGA 3HZKA 5SWSB 1JBJA 1T5WB 3L3DB 3ZKXB 3U6RB 3D1MC 5MEQB 1IAKB 2FBJL 4WW1B 4TTDC 4I4WB 3GMMA 1KOAA 4G6JL 4DN4H 4R97C 3QEQB 5EPMA 4PRIA 3C6LD 3JWDH 2MKWA 1U36A 3V5HB 1HHJB 2R1WA 1NCUA 5E08L 1IGYA 3PXHA 4NO0A 5C0DB 1Q9LB 1JN6A 1NC4A 5JIIA 2A77L 3BN9C 1II4E 1AD9A 1T21B 3RNKA 3QEHA 3ESVF 1U8KB 1T1ZA 3AS1A 4MA3A 3OAUL 2DI8A 1HINH 5DEZA 2VLKE 3IDYB 5BS0E 4X7CC 4KDTC 1H3PL 3BUTA 4G5ZH 1U3HA 1IEBA 2EEBA 4X0KB 3ZSSA 4HX1A 1SMOA 4HV8B 2R2HA 2CLVA 1JJUA 3RTQA 3BH8B 4P23D 1N4XH 3HPLA 4H20H 3D69A 4M5YL 3KR3H 4MDJB 4TVPL 1I9IL 5AD0A 3BQUB 1NBZA 1R5VB 3W39A 1S7VB 5I30H 5TH2B 1P7QB 3VFRA 1IGML 4FMFA 3QNZA 4NM8L 2GSIA 1B88A 3X17A 4PP2A 5CLWA 1KJ2H 1RIUH 3RIAF 4EIZC 4NP4L 1MIMH 3NCEB 4JGUA 5GRXG 2ZOKB 3B9DA 4D8PA 1B9ZA 1BIIA 4N5ED 5D5MA 1YEHH 1QQDB 3P9MB 3GSXB 1K8IB 3MLRL 5BV7B 1ORSB 4M7JL 4G6FB 4Q9QL 4P3CL 4JKKA 2KKQA 1CZ8L 1V05A 1A1OB 4F9LA 2YZ8A 3WKNA 2DLIA 3VMOA 4UT6L 4P5MB 2XQBH 3TVMA 2X70B 3RHWF 2VNCA 3RKPA 4TSBH 4F33A 3A6BH 4PJDF 2CSPA 3U4AA 4K8RD 4XPTL 1NCDL 2YWZA 5GIRB 3NABH 3RWGB 5HYIA 2J88L 3NCFB 4XMLL 3BMVA 4XGZB 3DMMC 1YA5A 5IK3A 4OM0L 5EC2A 5EIIB 4KPHL 5DJDA 3GSUA 3HC4L 4BZ1H 2AJ3A 4LQFL 5E08H 3B2VL 4M4RA 4DN3H 5HDQH 2H32H 3QUMH 3RWIA 2Y5EA 1I3GH 4JKPL 1S7TB 2VWEC 1G7HB 1BZQK 2R4RH 1KXVC 1SQ2N 4MS8C 5IKCA 1KTDB 3IGAB 3ARBA 4OZIE 5ETUA 3A6CH 1YEGH 4PYGA 4O2EB 3CPLA 1NMBL 4P49A 2XWJA 5I75B 5ANME 5EBGA 2UVFA 3PL6C 3V4VH 4F7EA 4D3CL 4HAFA 4G9DA 1RJYB 4LVHC 1X5ZA 4HUVA 3MROB 1J8HB 1MI5D 1JV5A 4M5YH 1NDGA 4X98B 4AYFA 3WCYA 2JK5A 4TPRL 3RX7A 3GJFA 3QUXD 3MLSL 2XKNA 1JPTH 2CDEA 4X6EA 4YE4H 3O4OC 4N0FB 2P8PA 4NP4H 1HHGA 1DZBA 4DGYL 1QSEE 5JIHA 1MCFA 4U2ZA 5C07A 2BHUA 4U3CA 1TZHA 3CH8A 1MVUA 4DVBB 3F7YB 3PDDA 4RZCA 2ESVB 2UZIL 3RUGB 1S9XA 1YNKL 3DTXA 4ZOEA 3MOAH 3ZE2F 3WN5C 3O3AB 1DBJH 5LCVL 1SM3H 4TRPH 2P8LB 3SHSA 4O51B 4YIQA 5ESVB 5FM5M 5BVJA 3W5NA 3DVNA 5IBUB 1F02I 4UT6H 3CCHA 2DLHA 2Q8BL 3C09C 4HS3A 1GHFH 3WKML 5E2WL 4YPJA 1FJ1A 4JFZL 4N8VA 5D6CB 2NY2C 4QF1A 4NWTL 4JY5L 2OCFD 4CU6A 3MGTB 4Y0GA 1OAXH 3IKCA 4L8SB 1Z0MA 2WBJC 3BPLB 5EUKA 2DDQH 3FMGL 1NGXA 1L0YA 5E5MB 3NCBB 1OGAE 2UWEA 2EXWD 3T0EC 3OJDB 4TUJA 5DK3A 1KIPA 4YDKH 5D7LB 1MJ7L 1CG9B 1AXIB 2CK0H 4MAYB 1U58B 5IMLA 1MHHA 4Z7UB 1L7TL 2MPAL 1G7LB 4FABL 4ZS6C 4R7DA 3GUTB 2M2DA 4ALAL 3NFNB 5HXMA 2H1PH 4CU8A 1XAUA 3RGVD 3LPGA 1MLCA 5D93B 4OBSA 1JRHH 3WFCL 3B9EA 4JRWA 1X5IA 4GW1A 5TDPB 3CZJA 3V0WH 4XNUH 1BVLA 5D7IA 2VZUA 3KPRB 1X5GA 5E9DD 4IIQB 4WEMB 3MXWH 5IEKB 4GRMB 3IAGC 5C08E 2PKDA 2XACC 4OV5A 2DKSA 4RFEA 1JHTA 4QXUL 5FYLE 2HT3D 1U2HA 3CXDH 4YBHA 4S1QH 3LIZH 5AG9A 3HA0A 5DJ0B 4XPGL 2BVOB 2ED7A 2DLFL 4KTEL 1P4IH 4NUJA 2F5AL 5E8PB 2JB6B 4AQOA 2ZUVA 1J1XL 4DGYH 5CSZA 5F9OH 3U4BL 1ACZA 4Z18A 4DEPB 4LIQE 4U6HA 2XA3A 1MCBA 4MAUL 4EN3A 2YBRA 5I1HL 2A6JB 2R69L 3BUYA 1U91A 4F7CA 1EO5A 3O3DB 3HNVL 5DQJA 3FQXB 3FKUS 4PRHA 3DX6B 5J13B 2DQEH 3QNXB 3BSZH 4NKOB 1CDGA 5H37G 3BOVA 4M93C 1AGEA 5C6TL 4XZUB 2XQYK 3WS3B 4JM2A 3FZUD 2EH8L 3PDOA 4XP1H 4LDLB 2X4OB 3VFUB 3P11H 4N0UB 3G5ZA 1KTKE 4YHYC 3B5GA 4LLYB 1FVEB 4U6XB 5HVHB 4UINH 4E0RB 5KVGH 2HKFL 4TN9A 4NWTH 1OAZL 1CDBA 4L4JA 3B5TA 5EN2A 4G6FD 1SEBB 4PJ9D 1OCWH 4L8CA 1GAFH 5EOQL 1BD2D 1IT9L 2VITA 2VDNL 3I9GH 2NTSP 3ARQA 4JO3H 4NC1C 3LD8C 1BQHB 5DD0H 2A0LC 4WHCA 3BGMB 3S5LB 1E27A 3FO9A 5L6YL 2PO6C 2QADC 1DBKH 4KHTL 2XTJD 5JZ7C 1U8QA 4FABH 4M8QA 3ZZ1A 4R2GB 5JUEH 3QWOB 1FZOB 5GGVY 8CGTA 1YEDB 2EYRB 5DR5L 3UTSB 2P43B 1INQA 2AJYL 5ICZA 1DLFH 4QCIA 1FFPB 4PJXA 2CJUL 1DBAH 5C0JA 3G5XB 4YDLC 2Y06H 3NTCH 1A6AB 1L6ZA 3PWPA 3S4SB 4KQ3L 3O2DA 3AM8A 4Y4FA 3HFMH 1W0WA 5EO9A 3WL9A 3U0PB 4KK9D 3FRUB 3GI8L 3Q5OA 3K4DA 3QI9A 3OR6B 4KUCD 4FQ1L 4LVOC 2AK4D 4IEFB 1JNJA 3I6KA 1XF4A 1J1XH 2YSSB 4HWBH 4GW5A 3GK8L 3T0VA 3RZCA 5A2FA 1QLEL 5FYKU 2AW2A 3TIEB 5IVZA 3N1PC 4MD5A 4MXWL 1YUHB 4PGCA 4JVWA 3SPVB 1QFHA 2C26A 4QKXB 3DLQR 3VXMD 5F6IC 4Y1AE 2CIIA 3LN4A 3H3PH 4YUEH 4JDVA 4KKAC 5D1ZC 4YFEA 3WXWH 4FQXA 2Q86A 4EJ1C 4MXQD 3O9WC 2P49B 2R39A 3EO1A 1S78D 4X6FA 3BXNB 5C0ND 3ZE1F 4JAMB 2VYRE 4JHAH 3VMNA 3QXUA 4XBGA 2HKFH 1A3LH 3TO2A 3SDAA 3RWEA 4JFPA 1CFTA 3AXLB 4YQXH 2E7CA 3ZO0A 4OZIF 4IRJD 5B8CA 3MOBL 4MNGA 4ENED 4N0CC 4HZLA 2ATKA 4LPWA 3DX9A 1T22A 3LS5L 2OQJB 4NZRL 3ALXA 3MUJA 1MRCL 3OB8A 3B3IA 5JHDA 4PRPD 4X6DA 4OLXH 3BP7A 1AQKH 2MKLC 5C0BE 3VE0A 4IJ3C 5FFLA 1Y6MR 4HMCA 5FO9B 5DC0A 4QXWA 3EOAA 3ARZA 1ETZB 4AIXA 5D8JL 4YR6B 4LGSB 2WV3A 4P46C 3EO0B 5CJ8A 4LGPB 4L29A 3INUL 1HXMA 3NCYS 4OKDA 2VDMH 3UBXG 4R7NA 4G8EA 1RZFH 4L3EA 3OKNA 4MA1C 1I3RB 1K85A 2EDTA 5FF6B 1LE5B 3SJVB 3CFEA 5TPWL 4N8CL 2Q8AL 3TYGH 3CLFH 3GJEB 5ESQB 1HHKA 4A6YA 1MCDA 1FORH 3DMMB 3L5WA 3QG6A 5CFHA 1U8LA 4HIIA 4A6YL 5J9PA 3GM8A 2R0WH 4NQEB 4L9LC 1DBBL 2IG2H 2UUDH 4JHBA 3RKDD 4QWWD 1KJ3L 4C58B 3T1FA 4DFHA 2ICCA 4JY6A 4GW4B 1F6LL 1V3KA 1LO3H 3KPRD 4FQ2H 5DT1H 3WSQL 5C0AB 5JO5A 4XP5H 4WFFE 4ZXBA 4LNVA 2D0FA 3VWKA 1SYSB 4KFZC 5I1CL 1VFOA 3QQNA 3L95A 1N2RA 2IWGA 3LV3A 2DM2A 5L2KA 3ULUH 4I2XE 4MYWB 3CVHH 3SE9L 4WU7A 5CBEA 1KELH 1G1YA 4HUNB 3DUUA 4JO4L 2M8XA 1CLOL 3RL1A 1RHHA 2ZCHL 3O3EA 5JW4N 3EYFA 4V2BA 5DHYA 4GKSB 5EG6C 3PF2A 1MJUL 1S7SB 2OTWA 3GSQB 2IAMB 4WY7L 4U1HB 4HXAL 2VIRA 1EJOH 3DI3B 3ROLB 4TUOA 2N1KA 3CDYA 4K3JL 5IB4A 4ZFOB 4P4KC 1QG3A 1PYWB 4PJEB 2X4QB 4FA8A 4HKJB 4DCQA 4RMVA 1FAKT 1YYML 3PHQB 2VC2L 5DMGD 1OTTC 4P9HC 3EYUH 3IJHA 4HIJB 5BXFB 1DVFA 4J23A 1A7RH 4NSKA 2JLLA 4TOYH 1ZT7A 4QRPD 1D3CA 2ADIB 2VLRD 4K71C 4LSQL 4L4VA 2X4SB 4UTAH 4LCCC 3FB5B 1G9MC 1MRDL 3JUZA 5C09A 2NXZD 3WN5B 5B38A 4PS4L 1P4LA 1T4KB 3KPQA 1NGZB 1KC5L 5JNYA 4MCZB 4XRCA 2I9TA 4BKLA 1T0PB 5IFJA 1MH5A 4K9EC 3LQZB 3C09B 3UJTH 2JCCB 3SE3A 4APQD 2F54D 1MFNA 3QNYB 5CBAB 5KANG 5AZ2H 1IL1A 4HH8A 2H2SD 5HHPA 3IXAB 2HFFA 4OZ4B 5DHVH 2WBJB 2IALA 1S9VA 1KN4H 3QEUA 1BVKA 4K2UL 5F70A 2P48B 5ACZB 3VXUE 4OUUB 3T0EB 2GKIA 4HHAB 1G9EA 1QKZH 4R4FH 1AJ7L 5LAXB 3MFFB 4WU5A 3OKLA 1IEAB 5FB8B 1AGBA 1KLGB 1XFPA 3TWCH 2OSLA 4XNXH 2YKLH 3E3QC 2R2BA 2NTFB 1MWAH 2IH1B 4ZUSB 2EH7H 3SOBL 4YHPB 1A7NH 4KKCC 2X10A 4PJ8A 3PP4L 5F7LB 4L1DA 3KXFD 4MJIB 2W9EH 4KAQH 3GSOA 3BT2H 1FG9C 5FO7B 4R96A 4WTZA 2XA8H 4GRWB 5KN5A 2FHCA 3G5VB 1P1ZA 3BISA 1LEGA 4EOWH 2D7PA 1Y6NR 3G6JB 3CMOL 3RU8H 1DLHB 2NY6C 1X3DA 3MXVH 2D0HA 4M48L 1RZ7H 3MRMA 1UVQA 5TQ0L 3BAEH 3ISWA 5LBSL 4EI5C 3UBXI 3AU1B 5IQ9A 4O2CB 4QHLB 3NIFF 1HKLL 1N5AB 4N9GB 4NUGL 4MQXC 1T04A 4PGEB 5L9DH 4M93B 4PPTA 1QBMH 3CFJA 1KPUA 1K5NA 4ELME 4DKFL 2NYYD 3VG9B 1FIGH 4DZ8A 2XN9D 2NX5B 4JFEE 3TCLB 3D2UA 4YHYB 4M7LH 3T0AA 3U0TB 4W68A 1U8MB 2GUOA 4OAWA 3O0RL 1SHMA 3LKSA 4P3DA 5EBMA 5ADOL 3LSOA 4PBVC 3V95A 2DB8A 1XF2A 2EE2A 4GKNB 5T1MB 4ELKA 1J05A 3IB4A 4JQVA 1N64H 4KZDL 1MCPL 3OJVC 1G6RB 2D3VA 3CU1A 5KSAC 5IHZB 4CNIA 3LD8B 3HAEH 2DLTA 1FPTL 4F7TA 3HB3C 3HI1A 1NC2B 3QQ3B 4NYLB 2QTEA 3NA9H 1U95B 4JFXB 2QADB 5GGSA 3BWAA 2X09A 3KLHC 4BFGA 3D3VE 1JYNA 2VLMD 1J0KA 2V2TA 5JXEC 2NY5C 2H3NB 3BIBX 2N7BA 5E56A 3RWJA 3ULUD 5KG9B 4YDLB 5C0GB 1MHCB 4H0GA 2B8OT 3BW9A 2P5WA 3QQ9C 3GM0A 4P23A 4KUZL 3ZL4L 1Z3GL 5A3IC 2PTTB 3ZDZE 3NCJH 4QRRE 3MV9D 5IFAH 5BO1L 1B90A 4HGMA 3BE1L 5DRWB 4LVOB 4HKZA 2WUBL 1AQDA 4BQ6A 2MCPL 4PJBE 1LK2B 4Y2DC 2V2WA 1WITA 5FKPB 1N6VA 3N85L 4OZGE 1V7NL 4M9PA 1GPOL 1KCKA 1EHLL 1KEGH 2IAMD 2R56L 1JZ7A 3TIDB 5GZOD 3CFDA 2Z91A 4KK8D 2RFXB 4NO5A 1FNGA 1GJIA 1JTOA 3FOLA 5GHWH 1EX0A 5CIPB 3MBXL 4LRIC 5F6IB 3VJ6B 3VRIA 4PV8A 5KANI 5D1ZB 5SX5H 3ZTNH 5GRJL 5CD3B 4HMEA 3LAFA 1QFOA 3O9WB 3GRWH 3SCMC 2NY1C 1FN4A 1J0HA 3T4AB 4U6VH 3RA7H 2C3WA 5IUSA 4KJWD 4DZBB 4JPVL 4PGBA 2B4CL 2HLFC 4AG4H 1KN2H 1LD9A 2A6IA 5TF0A 3A0OA 5CILL 1IBGL 2X4RB 5EZLA 2PW1B 5IBLD 3SGKC 3W82A 3GBMH 4HQQL 4GMTH 4JM4H 5DRXA 2FDBP 4KY1H 4YPGB 5B39G 2H2PD 3WNPA 4LU5H 5DWUL 1JTTA 3G08B 4PV9A 3IAQA 5I16A 2ZWLT 1T1XA 2WSKA 3E8UH 1YZZA 4Z6AT 4OFKA 5HHOD 1D5XA 4PJDB 4GAYB 4Q9CA 5GSRB 1TTUA 1AGDB 4IJ3B 1PQZA 4WV1B 4G7YL 5DJZA 1VHPA 3Q5TA 3ARFC 1QHPA 1RJZB 3JVGC 3FT4B 2P44B 4FQHA 1JWUB 2FSEA 4NCC2 4P46B 1OD9A 1PZ5B 4Z76B 4JPKL 3SDYL 5HBBA 2VDRL 1FYTE 4YHNA 3BEVB 4XHQA 4MNQE 3KJ6H 3UZEA 1DBML 3MV8B 1JNLL 5KVDH 1MOEA 1CICA 3WIIL 3MPCA 4KUZH 3LOWA 4UDUB 4NQDB 1OAKH 4FFZH 5ICYB 1F11A 1A0QH 1UZ8A 1FAIL 1TETL 4L9LB 1T03H 1DTUA 4HMDA 3QAZC 1FFOA 1JYXA 1XCTB 1PG7X 4ONGL 1EXUA 4NHUA 1HQ4A 3QCUH 4UNTA 3F6IA 4YXLH 3DECA 4XVTH 2H45A 3IFLL 3S37X 1XF5A 2BFVL 2VAJA 2YA0A 2HVKB 4ZDHB 3C60A 3QIBD 3TF7C 5CEXB 3VFNA 1P7HL 3DX7B 1MIEH 4H1LG 4LBEB 2CDGB 2J8UA 3E2HB 2V7NA 4D9LL 4FS0A 2HRPL 5DQDL 3U9UA 4FFVC 4Y5YB 1P4BH 3OZ9H 2CIKB 1OAYL 1IGJA 2IMNA 2I07B 4NWUH 4N90D 3RPIA 1FGNH 1NJ9B 4QY8B 4J3UA 4FFWD 2D4DA 1AXSA 3PHOB 1I8IA 2VABB 3UTPD 4P4KB 3U7WL 3UO1L 4AQ1B 3OTTA 3PV6A 2MHAB 5FYJH 1TITA 3D85B 3IFOB 5F7WC 4CDGC 2NX5D 2W0LA 1FFNB 1NANH 2Q3ZA 4XHJC 1R3IL 2YXFA 3TCXA 1AGFA 1A6PA 4HAGA 1NEZG 1CLYL 5IT2L 2V5SA 4AMKL 2V7HB 4L4TD 5CZVH 3IYLW 3VGAC 1FDLL 5SWSA 5TJWK 1VCAA 1T5WA 2CLRB 3L3DA 3NIDE 4LCCB 3P30L 3U6RA 3K2UL 1EVTC 1IAKA 5MEQA 1TJHH 2QEJA 4WW1A 3OQ3B 4I4WA 3GKZA 4Z7QE 1OL0A 3V4PL 1T2QH 5AYUL 4DOHB 3DVFA 3V5HA 1HHJA 1P84J 3QRGL 5C0DA 1JNLH 1Q9LA 1XIWC 2DIAA 4MQ7B 1CVSC 1UCBH 2K9UA 1T21A 1U8KA 5KSUB 1YJDC 2NZ9C 4OFPA 1VACB 1CFNB 4TNWF 1X5HA 3ZT5A 1LNUB 3B9KC 3MLUL 3LHPL 5I8KH 2QSCH 3WXVH 1FHGA 1YEJL 3ARED 1FAIH 1GC1C 3QXWA 4Z7VE 2ZG3A 4X0KA 4ELMF 5EORL 2EYTB 4ONGH 3EYOB 3ULVL 3OPZL 4V1DD 3CXHJ 4YX2H 3BH8A 1MFCH 4R90H 1BVZA 1CR9H 1JI1A 1MNUL 2BFVH 4OJFH 3KPTA 5CP3H 2EICA 2IPTH 2X1OA 4UI2A 4PUBL 4MDJA 3BQUA 5EBWB 1J5OH 5TE7H 1R5VA 1S7VA 4DVRH 1E4XL 5EU6B 4WUUE 5TH2A 1P7QA 5CCKH 4FTVB 3QDJB 1F58L 3H9SE 1JYWA 3U1SL 5HHXL 1QRNE 3LEVL 4KV5E 2E7LC 2ZOKA 4OTXL 2VDPH 2CXKA 5FK9B 5F97E 1RURL 2VN7A 4FZ8L 4WEBL 3P0YL 3QR2A 1QQDA 4G8FB 3DBXB 3P9MA 3GSXA 1K8IA 1ORSA 4LCIH 1YEIH 1N0XH 4H25B 3CVIH 1ONQB 2CRZA 2HMID 5BV7L 1NFDE 1DQLL 5HVGB 1MELA 1A1OA 2FH6A 3FRPA 4PIRF 4EDWL 3STLB 3W5MA 2NY6B 5TQ2L 4KJQC 4D9QE 1I7ZB 1A21A 3CFCH 3IAPA 4P5MA 5E70A 5IT2H 3VFSB 3LZFH 2VLKB 2X70A 1IC5H 2WP3T 3BKJL 5BS0B 4XCCL 4UNVA 3ZDZF 5HYJE 2YPLD 5HYSG 3OGOE 1OM3H 4JZNB 1IGIH 2NXYC 4ZOBA 2NY4D 4LPTA 5GIRA 3RWGA 2E7BA 3C87A 5FM8A 4Y19E 4QGYA 4XGZA 3AS3A 1OW0C 5EIIA 4HD9A 2R29L 4PJBF 2AEWA 1KEML 1TIUA 4NQCD 4H8WC 3QRGH 4KJYB 4OZGF 4FQIL 4R8WL 4UQ2B 3K8LA 3MLPA 4LSUL 4F80A 3CFBB 1S7TA 1M7XA 4JCLA 1G7HA 4OF3A 4PJGA 5HDLA 2DM3A 3RI5K 3MLUH 1RIHH 3D39D 1OOAA 5FO8B 25C8L 2KPNA 3IGAA 1KTDA 3BD4A 1TXKA 2F58H 3Q6GL 4LRNH 3SKJL 5KSAB 1U6AH 1BBJB 5GGTA 4KVNL 4K55A 4O2EA 1A7OL 1D6VH 2I5YL 3MRPB 2DQIH 4UT9L 5GGTL 4MXVE 5JW4M 1I1AC 1RJYA 2F74A 4ZG1A 2AJUL 3MROA 1J8HA 1QZ1A 5IMOB 3IS1X 4X98A 2GFBB 1I9EA 4GAJH 3TO4D 1E4XH 4I9WD 5I0ZA 1F3DH 1MCNA 1B3JA 2A1WL 1CBVH 5A2JH 4HJ0C 3F7QA 3SO3B 2FYYB 3EW3B 3RDTB 5I1KH 4WO4C 5DS8A 4N0FA 5DMIH 3MGAA 5HHXH 4RMTA 2JJTA 1BPVA 1AC0A 2AJXL 1R5WB 5F1NB 4PR5B 3EFDH 2PETA 4OT1L 4DVBA 3F7YA 1JFQL 2ESVA 3RUGA 5IIEB 3EBAA 3MJ7B 4YC2B 4LHUB 1JGLH 5C70A 3WMSA 1UM6L 3O3AA 5C0EB 5JQHC 1DQLH 4Y2DB 2J8OA 2P8LA 2Y9RT 1FH5L 3DUSB 1F13A 2HT4D 4O51A 5ESVA 4MD0B 3VXSD 5FYJD 4DW2L 1U8JB 1CFVL 2UYLB 1QFWL 3KPPB 5BRZE 1K3IA 5D6CA 4HPYH 4OD3H 1HCFX 3MGTA 3OX8B 4KJPC 3BI9X 4HS6B 2V9RA 4L8SA 3MRJB 4OZIB 1C7SA 3P4NB 5CS7A 2IFGA 5E5MA 3SDDC 5ID1B 3K1DA 5ANMB 1FZJB 4JRYE 3OJDA 2BDNH 3F5WB 2KBGA 2NY1B 3OHXB 5DJ6B 5D7LA 2V9QA 2VE6B 3T65B 5LVEA 3L1OH 3ORJA 1ND0B 2OI9B 3QJHA 4XC1H 4B7IA 1MSPA 1RULH 1U8NB 4WNQB 2O26U 4MAYA 3CX2A 1U58A 4LF3B 4ZO7A 1N26A 3OKDB 4Z7UA 1JVKA 1P5VA 1G7LA 1WZLA 5J7CC 2BERA 1IILE 1RZJH 4GOSA 4W4NA 1H3XA 5CUSL 3GUTA 4CN1A 3F6LA 1MCSA 3NFNA 4PP1C 1MHPH 2E8YA 2YD1A 1JWSB 4OUOA 4UDTB 3QH3B 2VTFA 1QSEB 5TDPA 3TEUA 2BHYA 2I5YH 3KPRA 1JF1B 2DQHL 4IIQA 5IEKA 2JJWA 3O6LH 4B41A 5I1AB 2HTKC 3ARFB 4PJAF 3BN3B 4KI5E 2HT2C 3V7MA 5DJ0A 2BVOA 4HS8L 4X4MA 2FRGP 4HPOL 1RZIA 5E8PA 2FO4B 2JB6A 4M6NH 4KROD 4KWUA 1C1EH 2IAND 4MB5A 3C2AL 5CEZE 2B0SH 3L5IA 1F6AB 5HPOA 5KVFL 4P2QD 3GSNB 5HGAA 1AFVH 2YUXA 1RK0B 2A6JA 3NIDF 3LVEA 4KRPD 3MRKA 3FT2B 4WGWB 2DQUH 3DV6B 3RPKA 3FQXA 1BJ1H 2HLAA 3MYJB 5JPNB 3BH9B 3DX6A 3QNXA 4NKOA 1OGAB 3QAZB 4NNPL 2YUVA 5J4MA 2A9MH 4XZUA 3SKUD 3WS3A 3P4LA 1EAJA 3VFUA 2X4OA 4N0UA 4Y4KD 1R6VA 1FVEA 5EU4B 4E0RA 1A5FL 4IRZL 1VERA 3AB0C 1YMMD 4ZTOL 3CK0H 3QFJB 3V2AR 1SEBA 1UA6L 4JFHD 5T3XL 1NGQH 4B53A 1GZPB