5DA4A

Structure of a nanobody recognizing the fumarate transporter slc26dg
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
SQVQLQESGGGLVQAGGSLRLSCAASGRTFSSDVMGWFRQAPGKEREFVAAVTRSGGKSYNADSVKGRFTISRDNAKNTVSLQMNSLKPEDTAVYYCAAGDTAITSWYGYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a prokaryotic fumarate transporter reveals the architecture of the SLC26 family.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
molecule keywords Nanobody recognizing the membrane protein SLC26Dg
total genus 32
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5da4A00
1XGQA 4O51B 1UG9A 4XWGL 5E2TH 1JMXA 1X5YA 2YC1B 3MLYH 3CH1A 4HFUL 3LQZA 4RGNB 2PUQT 3DMMD 1T66D 2Y36H 4LEXH 43C9B 4HEPG 1I1CA 5E2VH 3CUPB 3O4LA 1DFBH 1V05A 2CIKB 1UQSB 3TZVB 4HJGA 3BN9C 3QUYB 1RJLB 1CG9A 2FB4H 4KY1L 1FNLA 1WAAE 5T3XH 5DGQA 3HR6A 3LKRA 3VE0A 1XGYL 1X7QB 3LIZH 5FOBB 2FEDD 1EXUA 3HNVL 3MZTA 4TNWK 5A2JH 1PW3A 2CQVA 4H1LG 4MA8L 1UM4L 1SJHB 2ID5A 5MERB 3QWOB 5DRNB 3LAFA 2X05A 1W8NA 1X7QA 5FOBA 3CDYA 4EBQH 3L3JB 2WBWB 3BPNB 4XP6H 5D1XA 5LGHH 1A0QH 1YEGH 4M43H 3U6RB 3BHBB 3O8XD 1ZV5A 5EUKB 4KUCD 4TTGA 4TUKL 2QKIA 3V52H 3GSRB 4FP8H 4YZFF 1XGPA 3P4LA 4ISVA 4POUB 1MFCH 2KQNA 2UZIH 3ZE2F 3E8UH 1T21B 4L9LA 5ITFA 4WIQA 2D7PA 3OKLB 1IARB 2X4UB 3MACH 2R0WH 4LMQE 4DJMA 3MNWB 3ARGA 3TNNB 4WGVB 5C0JB 3FRPG 1T21A 3KYKH 5J11B 4G8GD 4QYOA 1P9MC 3SDAB 1DDHB 5E00A 1CFBA 1DBBL 2GEEA 1INQB 3V6FB 3TVMC 4LHUB 4OD3H 4WU7B 1IC7L 3NZHL 5F7NC 4YXLL 1ZK9A 1MRCH 4P5TD 3CK0H 4CBPA 1U8MA 3BRDA 1XF3A 3BP5A 4LVOB 3D85A 1JV5B 3ZKNC 4NGHH 3RZCA 1JNHB 1I1YA 3D9AH 4WI5A 3GBLA 1KJ3L 3LKRB 5SWQA 4X7EC 4PJFA 3WXWH 3ROLB 4PGDB 4BSWA 4HIEB 3VXUD 5BV7H 2H6PB 3NCCB 3KAAA 4A2MA 2OCFD 4PJEE 3GSOB 5D1ZC 3VGFA 5I1JH 2Z35A 2G5BB 1PZ5B 1NFDB 1OAKH 3DHMA 4K94H 5DYOB 1JI1A 2QHLA 4YHYB 5GRUH 3RHWF 4QOKD 4POZD 3ARSA 3FN3A 3EZJB 4MQSB 5A43C 3KYMB 1KXVC 1FVEB 5FM4A 3GUTA 3MCG1 3QIUD 5DUBB 3S37L 2JCCA 3G6JE 3L3DA 3S88L 4OLWL 3U36A 1EJ6A 5I74B 1R3HB 5TDPA 4PS4H 1I7TB 2IAMA 3DTXB 1IC4L 1RZGB 4ODHH 5F7UA 4QF1A 5JNYB 2EC9U 3PNWA 3S96A 4ZUSA 4PTTA 1UWXK 3N0PB 1T3FA 3AMLA 2VE6A 2WP3O 5DD5L 5F89B 1RIHH 3K1DA 4CNIB 1G7QA 1J1OH 4KAQL 4YQXH 4OIAA 5FECA 1W72H 4HIIA 2ZPKL 2WZPD 4N0UA 4GG6B 1FLRH 2OTUB 3C60D 4LPVA 3GIVA 5HHPA 4JANA 1F97A 1JN6B 2FIKA 3CVHA 5I1HH 2YZ1A 3LSOA 2Q3AA 2OSLB 1KIQB 5AYUL 2V7NA 5EO1A 2V2XB 5HGHB 3GSVB 4WCYL 1MFCL 1W8OA 1PZ5A 5EIQA 3MRRB 3D18B 1HYRC 4LVNC 4OFIA 1IKFL 5F1NA 3O6FD 2HYMA 2FSEB 5IWLC 1G7HA 1MNUH 4G8EA 3LDBB 1CFNA 2WAHA 5JHDD 3TPUA 3C5ZC 4WY7L 3GK8L 3IJYA 3P4NA 4NQEE 2A6JA 5K9JH 5HJ3B 2X1WL 3TZVD 1UB6A 5BO1H 3EOTL 2FL5A 4ZO7A 5IQ9A 1A7NL 1JPFA 5J6GA 2H9GB 1PQZA 1CDGA 1ZHLA 3OKDB 1XT5A 5BXFB 4RMRA 3MLTA 4KGJA 2R4SH 4LRIC 1RZJC 4A6YB 3BE1H 4TSAH 5SX4I 4EZMA 3L3IA 4AEIH 1H3UA 3ULVF 3MJ8B 4M61A 4YHNA 4ZNEE 1KSRA 1HHJB 4BFIA 1K6QH 3WLWC 1MIMH 2DQHL 4RFNB 5L9DH 5BZWA 2OJEA 1NC2B 4LQFL 1BOGB 4OZIF 3MV9E 1I9IL 1U8HA 2HTLC 3DXAA 1JWUA 1JWSB 2HP4A 1MCPL 4LSPL 3SDCC 1ZLWK 3BQUB 1PLGL 5M95B 4JR9L 4GRWF 4OBSA 4U1SA 3VRLF 2C3XA 5KANG 2PNDA 1SMAA 3TO2A 4EQ3A 5D2NA 1AXTH 2J6EA 5GGTA 3O4OC 4UT7H 4FA8A 4JZOA 2FGZA 3QXAA 1M7XA 4PFEA 4G7YH 5E9DE 1DZBA 5KW9L 3MOBH 1WGOA 5HI3C 1QA9B 4EXPX 2AGJH 2WNGA 1QNZL 4J3OC 4EUPG 2I60L 3NFPA 2NLJB 4QNPE 2Q1EA 4OZIA 3KPPA 1FAIH 5E1AA 5TQ0L 4DUWA 2VYRE 1QA9A 4RBPH 1Z3GH 3UZQA 3EOAB 1NUFA 1CIUA 4UDUB 2QJDA 5DHYA 1H15A 3MYZA 3BP6A 3I6LD 3EYFB 1K2DA 2AEWA 2DM2A 2XKNB 1U58B 1I85C 3C2AH 5A3ID 2R2HB 1WQVT 2WMPA 3T0VA 2O61B 3VG0L 1UXWA 4PGZA 1HH9B 5JHDB 1NGWB 2IALB 3QNXA 4ZAKC 4U1MB 4PJXE 5E03A 5I1EH 4PJ5B 3G5ZB 4RAHA 1LMKA 5EU5A 2OJEB 1WBYB 2EDTA 1BD2E 4JO1L 3IFOA 3O4LE 4ZMAT 4BFIB 1BPVA 1OPGH 4F9PC 3DJ9A 4ODWA 3EYUL 4OFYA 1F3DH 1MHHA 5BW7C 5D2NE 4EOWH 1PX3A 4JFFA 2MNUA 4TPRL 4MZ2A 1VFUA 4K2UL 4KI5D 3FN0H 3CNKA 4ZUUB 5AD0B 1U8PA 3CPLB 5IGXL 3QEUA 5IOPB 4L3EE 3LKOA 3VXUE 4BZYA 3NIDE 2FJFB 4ZOAA 3QXWA 4Y16C 5IMOB 5B4MD 5F6HI 1DUZB 3P73B 4L4TB 4UTAH 5C86A 4PJ9C 2FJHA 5KSBF 5FM8A 3MLPA 2AEQH 1BVKB 1NGXB 3O2DH 3VFOA 1DLFL 3ECBB 1CU4H 5J6HA 3BDYH 3TZVA 3WIHH 2X44D 1NAKH 1OT1A 4IOIB 1DEEA 4XB7A 5F1IB 1S9XB 3V4UH 1N0XL 4G9FA 4P2QD 2X70A 3D87B 4NM8L 4DVBB 3V0VA 2GITB 1XH3B 1WFOA 3H8NA 4U1JB 1AGFB 1FL3B 4LHQB 1FYHB 4LARH 4XCYA 5C0EA 2YC1A 2P45B 2F5AH 3CVIH 1NGZA 1IKNA 2CH8A 2ICWI 4KTYA 4HS8H 4OFDA 3MV11 5FYKD 2JB6A 3WO4B 3MV7B 3THML 3TA3D 1DBMH 4L8CB 3VRJB 3ULUC 4NQCE 3MUZ1 1IM3B 3RJDA 3HI1B 3D3VE 3BEWB 2QADD 2H2PD 3UJTL 1M7DA 5D2NC 3MLRH 1KLGA 2PF6A 3X17A 2GFBB 4KRMB 3FONB 3LKPA 4LSQL 2IGFL 3ARBB 1T0MB 1G6RA 3T0ED 2HJLA 1IM3A 1WT5C 4JPWH 1CDHA 4LCWB 5I1LA 4L8BA 3VXUA 3UCRA 5CD3A 3S9DB 3H9SA 3EO9L 5FGCE 4NHCL 1KGCD 1K5NB 4ZUTA 4NQSB 1OGTB 5J1TC 1K8IB 4RWYH 2F53A 1CE1H 1MCJA 1KCUH 3KJ4B 1BQHB 2CRZA 1A1MB 3S5LA 1NCWH 2WBJC 4MA8H 4HWEL 1FLTX 1WT5A 3QT2A 1DBAH 5EO9A 2Y6SD 3GMMA 3MLWL 3HI5H 4KMTH 5DEFB 3ECBA 1UCBH 1U42A 4JHZA 4XHJD 5DQJA 2V5TA 3SDDD 3SJVD 4Q9QL 5J8OA 3BKYH 4PJIA 4NSKB 2J4WH 3DGGB 4JDTL 2CKBL 3FQRA 3P77A 4QHLA 5EU4A 1DUYB 1FAIL 2VITA 2GJZB 2IBBA 4MYWB 3FO2B 3HMXL 3UTTD 3UROR 4AIZB 1FNGA 4ZOBA 4QXGL 3SGEI 3QO1B 5CCKL 2FHCA 4OZ4A 3HRZA 3TJEH 4PGBA 1A6TA 4N8CL 5KOMC 3HE7B 3JBG7 1J0ZA 4JY5L 2DLTA 4QRPE 3VFUA 1MFAH 3WDHA 2N1KA 2VKXA 1RU9H 4F9PA 1XF3B 1B2WH 3U0TB 4WI2A 1FYTB 4RIRB 3VFGL 1AR1D 3V5DA 3ES6A 1U8JA 4FTVA 5E94B 3FQWB 1HZHH 3SBWA 4UILL 4M6NL 2LU4A 4TUOA 4ZFOA 5DSCB 1F13A 5MEOB 3RP1A 5L8LB 3ULVE 1QNZH 4XCEB 1UH4A 5JO5B 3IFOB 3BSZL 5DURD 5ESVB 3UXFA 1JF5A 1K6QL 2YK1L 4OTXH 4P5TB 3SDCD 1V8HA 3QZWA 3Q48A 2IPTL 3EHBC 2NY7L 5B38B 5MENA 1DQQB 2D7TH 1NBVH 3Q1SH 2J8UB 4HLZH 1GOFA 4JR9H 2A9NL 1NCBL 1MOEA 1G0YR 4E41B 1WZLA 3R06B 4JEGB 3G5XA 4BSVB 1TVDA 5IV2B 4OZHE 3TH3T 4F8TA 4J2XA 3AM8C 5L9DL 4LMQI 1ZT4B 2AK1L 2BY1A 5I1AA 4PGCB 4POZC 4NRYB 5CEYB 4PRID 2DLFL 4B53A 2VSCA 4TVPL 1HHHB 2VDRL 1HXMA 1RIVL 3HRZB 2JE8A 4OB5H 1IGJB 5C2UB 4G6JH 2NW2B 3ARVA 3RVVD 2X6MA 3QEQB 3TWCH 3AS0A 3QIUB 2EYRB 2H26A 1WICA 1RJCA 5GRJH 1NLDH 3AROA 3EOTH 2A73B 3DX6B 2NXYD 4AQ1B 5C0AA 3RWHA 3QUXB 4HIXH 2NW2A 1CT8A 4KVNH 2OTUA 1S7TA 4NUJA 4XMPL 1OP9A 3QCTH 3DBXA 4H26A 4PJBA 4R9HA 1OM3L 4PJXF 2Y4SA 4Z7OF 3G5YA 2BDNL 1HHKA 1KG0B 3PL6D 4IJ3B 4PG9B 2JLLA 3QZWG 5IQ7H 4QRPD 1F90L 1QRNB 1YEHL 3T8XA 3R4DA 3UBXA 5DJYB 2VLLB 1FZKA 4H1LA 5FM5M 3T0DA 3QIWC 3ZYJA 5ESQA 3LEVH 3PHQB 1CD9B 4X6BA 3VFGH 2DQDL 5ID0A 1R3KA 2DAVA 2F54B 3DTXA 3L9RB 2P5WA 3IU4H 3QIUC 1FJ1B 2CDEB 2DWEA 3KPMA 3KXFB 3QEHA 2C9AA 4OLUL 5K59F 5IHBA 5IB5A 2I5YH 2NR6C 3L95A 3WD5H 3AS3A 2VISA 1VFBA 3CFIC 3LRGA 4YAQA 3RUGA 2BCKA 5ICYA 2VDOL 4RQQA 1CE1L 2VABA 3HMXH 1FZMB 4F57H 2HMID 3SKNB 3MUJA 5IGXH 4P2RE 4NUGL 1A7QH 2VZSA 1T1ZB 4K2UH 2IADA 2F53E 4MNHA 3QDGB 1S7UA 5F3BA 5I9QB 3LS4L 2L4OA 3HI5L 1GGCL 3IS0X 4M7KL 1DR9A 3BGFC 4TN9A 3I3BA 4WFGD 1NMAH 1NGYB 3QJHA 2Y7QA 5E1AB 2WINA 1ZGLB 1R3LB 1BBJA 3FKUS 4UT9L 5DJ6A 1II4E 1U0QA 5J3HC 3GFUA 4Y4HC 1WJ3A 3QDGD 4N90E 4DVRL 2PW2A 4KROC 3W0WB 1FGNH 3GRWA 3CD4A 4Z9KB 5DJYA 5C6PB 3G04B 3M8OL 3VWKD 1T6VN 2F5BH 1TJHL 2DMKA 3OKLA 2X4PA 1I3VA 4KDTC 4MA7L 4NBXB 1NUNB 3C5SA 4UUJB 3HE7D 4ELME 1A4KB 1FVEA 3HE7C 2EIZB 3MRDA 1YZZA 2JJSC 2FLBT 3ZDYE 3GKZA 5ISZB 5EU6E 4PJCA 1ZSDA 1YYML 3O6MH 4QY8A 2WQRA 2AGJL 2JB6B 4EIGB 4JJHA 1MHCB 2Y06H 5D1ZA 1K9TA 5D93C 5HVHC 4OZGF 5HPMA 1HHGA 5DDHB 5EUOF 3LD8C 5FYJE 3BH8A 4X9BA 3QNXB 1Q0YH 4NPYA 1ZLSH 3K8MA 1BFTA 1S5HB 4L29A 1GHFL 1MFBH 4PJHF 5E7FA 3O6FA 1RMFH 3FHQA 5DD0L 4KZEH 4X80L 1ZEAL 4NKDB 1LO3L 1CD0A 4GBXD 2EIBA 3OJDA 3OKYA 4DOHE 1GGCH 4X7TA 2C4FU 1CDUA 2CR3A 4XCFH 2WIMA 1QLRB 4PJ7E 2JIXD 4LF3B 3RWJB 3WBDA 3OXRB 2LAAA 1I3GH 3QIWA 5CS7A 5IG7A 1QR4A 3VFSB 2GJ6E 2XNAA 1QYGL 2AK1H 4KJWD 3VXMD 1QBBA 4LKCB 2I5YL 4Q7DA 4FNLH 3HPJA 5ANMB 3ZE0E 3MA7B 5D2NB 1TVBB 1MREH 1UA6H 5LQBL 1A6WL 1WC7B 1S3KH 4AK1A 1CBVH 3FT4B 2FGWH 3QJFB 3EGSB 2VLRE 2DQDH 3WO4C 1D7FA 2J2ZA 4X6CF 4XPBL 5BJTA 1WEJL 4NC1C 4CVZB 1YMMD 2O5XH 3KLAB 5CEXA 2HJLB 5I66B 2IH1B 2XN9E 3WIFA 2VIRA 3L5IA 1N3NA 4PGEA 1MCCA 1P9MA 2BMKA 1PKQA 5IFJB 4NN7C 1Z2KA 4QXUH 4UDUA 3KLAA 5CEXB 1S5IL 3SJVE 3HE6C 3K7UA 4GW1A 1V7ML 5F7EL 4L29B 1QPXA 2GJ6A 1TNMA 4ZFGH 1D5IL 2Q87A 1T1WB 2GW5A 4L9LC 5FUZL 4BFEA 5F7FA 1Z9MA 1QHPA 4JFED 3VXNB 5EUOA 3O2VH 2YZ8A 3RY6C 5BV7C 3CZFA 3SGJA 4XBGB 1G7JB 2QADB 1FGNL 2EXYD 3GSXB 3O6LL 1JWMA 2FEEI 4PJIB 4UT6H 2DQTL 5DA0B 4ZD3L 5B38A 3TA3B 4HWUA 1ZGLM 4GBXA 1CGYA 4OKVB 4WFFD 4N1CA 1NFDF 1EZVX 3W81A 2R4SL 3EO0B 4GW5A 4M6MH 2VDRH 4OI8A 3QDJE 1BM3L 1A7OL 3OAUL 4MAYB 5AAMA 4ZFOL 4XMPH 1JWMB 1YEDA 2EDNA 2FX9L 1CLYH 4Z7OE 2BVPA 5D7LB 4Z6AT 1NEZB 2V7NB 4LBEA 2WSKA 5KS9E 1NBZB 4LQ1A 4ODSH 1MCDA 3GJFB 4K3EL 5IMMA 1SYVA 3TWCL 1AE6H 3INUH 1DBKH 4WFHD 4NQED 4D0BA 1O5DT 1D9KD 2DQJH 1Z9SA 5EZJB 5EZOH 5TE7L 5E94A 3TIDA 5I66A 2C3VB 4OB5L 4HUWA 1OCWH 4MD4A 2BVQB 3OKMB 3KPNB 3GHBL 3CAFA 5KZCD 4CVZA 1UYWH 5JA8B 3QRGL 4K8RH 4PGEB 2R23B 4WV1A 4Z76A 1IAMA 2RQ8A 1S7RA 3EFDL 4PGBB 4WWKC 1A6AA 2UVEA 3NZ8B 4F2MB 1NGZB 2MHAA 1NAML 2A6IA 4F15B 1GHFH 2HFTA 3Q5YA 1V7MH 4UB0L 2VLJE 4J3TA 1IRAY 2F74B 4AENA 4YC2C 4GG8B 4O2CB 2GKIA 3RIAK 2VZ3A 4XAKD 4HKZA 1JRHI 4OGAC 1J7VR 4ZXBA 5CJ8A 5IQ7L 4PTUB 4FQHB 1J1OL 1MAKA 3VMOA 5I1AB 5BVPH 1HI6B 2X4QB 1JZ2A 4HH9B 4OZGA 1MFDH 3OKKB 5CBEA 5EORL 3P73A 1JRHH 3GBNH 1DCLA 1T89A 3EJYD 4U1IA 3QEQA 3WIIH 5HYEA 4C56B 1NPUA 1IC4H 4WU5B 3O4LD 4CVXB 5FOJA 4FNLL 4PB9L 4PG2C 2ZG1A 1UFUA 5DJAB 2EDWA 2AEPL 2Q7NA 3LEYH 2FATH 3EYSL 1MQ8A 4Z7UE 2YBRB 1HH6B 4Y5VA 3GNMH 3OBAA 4GMSH 2ZCLH 3V8OA 4M7JL 1QFOA 1ZVHA 1QRNA 3OAZK 1H0DA 2DL9A 15C8H 2X4OA 1EEZB 2DB8A 4XH2A 4NC0B 3S35L 4S1RL 4LVNB 1BZ9B 4KKBC 1L6ZA 1YN7B 2AK4D 9CGTA 3DO7A 3LPFA 1C7TA 3FQUB 4J3WA 4O2CA 5E99H 3MGOB 5DEGB 1WCBB 5TF1H 1MCFA 1P69B 4GUPB 4I77L 3SKOB 1UWXH 4JFDB 5I19L 5JQ6H 3QFJA 2LFGA 3VXNA 4JKLA 2R69H 5HHXL 3BHBA 5EUKA 2XRAL 1U3JA 1YEFL 3QEQE 4NQDB 4PGDA 3UO1H 3I6KB 5E8NA 3A6BH 4O9HL 2E27L 2PYED 2X42A 4JO4L 2ZOKB 3WFBH 4OCYL 3K8KA 5FYLE 1JRHL 2YUXA 3WFEH 4HPYH 3IJSA 4WNQB 3WFDH 4PY7B 2QTEA 4MA1B 1LEKB 1X3DA 5KSBA 4X5XB 3N50A 4N8CH 3SKJH 3MOBL 5HYJB 3SDAA 2F54D 1U3YA 3BX7C 3ELAT 3L95B 3R06A 2O5XL 4NFBA 2E7MA 5HHMB 4G6KL 2NY5L 3B9KC 3N1PC 4PY8J 1E28B 5KTEH 4NM8H 4BA8A 4O51A 5DO2C 4GW4A 5B39B 4EKXA 1QFHA 1ZVSA 1C5CL 3WJLC 3PGDA 3TESA 5DVMA 3LQZB 5KVDL 4PJAE 1DLFH 1IQDB 3G5VB 5I76A 6FABL 5CINL 2ATKA 1FNFA 3KPRE 3MOAH 3OX8B 1P4IH 3GMLB 3BZ4A 3VD9A 2CRIA 3DX9A 4XPGH 2BVTA 2Z8SA 4FXKA 1U3HC 1KIRB 2V9QA 1IQDA 4Z7NF 2GI7A 4ZTPH 1T7ZA 4PRDB 4C54A 5KSUB 2A6JB 4MGXA 1KN4H 4NO2A 2X1OA 4FQ2L 5ADOH 4X6EA 4DFHA 5F9JB 5T1DH 1ONQA 4BH7B 4ZOEA 2GY5A 5EO9B 4JB9L 4JFYB 4JM2C 4XPFL 4ORGB 2HLFC 5EO0A 2PW1A 3L7FA 4JPIA 4WEBL 2KBGA 1OOAA 3LH2H 3HAEG 4Q0XL 5TH2A 4I5BB 4P46B 2FB4L 4KY1H 5CUSL 3BRGC 2P46B 1QSVA 3QPXH 3LEXB 5C3TA 3BZEB 3HG1B 2EEDA 4HMEA 3SDAC 5EO0B 5LGKA 4NNYA 1DBML 3SDDC 4CADA 1BF2A 4P59H 5J11C 2VLRA 4P2OB 3PDGA 2YOCA 4L3EB 3BSZH 5SWZA 3VH8B 4M5ZL 1NC2A 4M00A 1DQDH 3HCVA 5B8CC 3IXAA 4KH2A 1XCTA 3JV5A 3ZKSD 3PP3K 3Q6FB 2VXSH 2VKWA 2HLAB 3B5GA 4YHPB 5MEPA 1OTSD 4FQLH 1INDH 5I76B 1EHAA 1MRDL 3BZFB 5AZEH 1AJ7L 4E42A 3PXJA 3UYRL 5DZOA 3CMOL 3KYOA 2HVKA 4CMHB 3EJJX 2VL4A 5FB8B 3EKCA 3V7MA 4HBQA 4U1GB 2IQ9H 2DQFB 4M62H 4N8VB 4PBWD 3D18A 3TO4C 3I2CH 3MRLA 4LNVA 1R24A 4DGVL 1YNLH 2D0GA 5I1CH 1F11A 5F1NB 5DTFB 4CJ0A 3IB4A 4KHXL 2XWTA 3GSRA 4QRUB 4P23C 4QRRA 1PYWA 1RUKL 3FAXA 2YPLA 3U7WH 5ADPL 1OAZH 2AJYL 2Z35B 4RISH 2I24N 3QUYC 1GOGA 2OL3H 2XKNA 3VW3H 3PQYE 3RAJH 2R56H 4I0PA 3KPRD 3MLUH 2DQEH 5J1AB 3MREA 2RAMA 5HGAA 4R4FH 2UWEB 1V3MA 3OQ3B 3KPSB 3U9PH 1J0JA 4MA1C 3QEHB 3MV7A 4LGPB 3E1F1 2Z4QB 2H8PA 4F7PB 3MREB 4LNRA 5AYQA 3BKCH 3MLYL 1QVOA 5E2WH 2FCBA 2WBJA 2ITCB 2APXA 3SQOH 4KRLB 4QRPB 4C56E 2H2SD 3QNZB 5I0DA 4E0RA 4GRMB 4BH8B 2ZSVB 1LO2L 4R90L 2OTWA 1ZA6A 2Z92B 1IBGL 1OLZA 1XCQA 5JPMB 1KPRB 4JAMB 4PG9A 3VI3E 1OTTC 2DI9A 5DF0A 3STLA 3ZTNH 1TCRA 5CZXC 3ZYIA 2AI0L 3VXOA 3F7PC 1BVZA 1FPTH 4PRPD 2YD9A 4X4ME 4PRAA 2YR3A 3PL6C 1URLA 2VL5B 1IGFH 5LXGL 1P2CB 3WN5C 4DK3A 4MVBD 4ZUUA 3D3VA 3C5ZD 5FGRA 5IEHB 4PD4J 3PWUB 1S7XB 1KN2L 5DK0A 5HSFA 2DBJA 3WS6A 5EU3B 4EDXA 5D4QA 2PCPB 1DBAL 1G6VK 1KTRL 1JF1B 1NSNH 4OM0L 5ACZA 4HPOH 1PEZA 1YYLL 1M7DB 1J0HA 2XN9A 3KR3L 4ZUWA 1I8LA 1G9ML 1MCWM 1GSMA 4H25B 3HG1D 5JOPD 3QIBB 3RWDA 5CJXC 4XP1L 2H3NA 3BT2H 5BVJA 2XV6B 3NGBC 2AJVH 2CIKA 1T20A 3WHE0 4Q58C 5GZNC 1PAMA 3NCMA 3PUCA 4R7NA 2Y23A 3WHE1 4JY4A 4LLYA 1OAUH 1QG3A 2HJFA 2ATPB 3SN6N 4EI5D 3IAGC 4D0CB 4HUVB 3W9EA 3TBYB 5GZOD 4ZPTB 2OSLA 4YO0B 1I7UA 4JFZH 3THMH 4GQ9L 2ZG3A 4J12A 4NCC1 3DXAD 1U8HB 4IRJA 3UX9B 2YS4A 4DZBB 3L3JA 3RA7L 4F15C 2RBLA 4KTDL 3MYJA 3NTCH 2ED8A 2DBLL 3HS0B 1CI5A 4EXKA 1A3LL 3LN5B 5CEZD 4JLRA 2OR9H 5EU3A 1Q9OB 4FOMA 3MBED 4Y8AA 3FMGL 5D2LA 5CSZB 5CIPB 1JHTA 3A6CL 3HC0A 5C0BD 5ESAA 3HZKA 4XBEH 5DD6B 3UPAA 2XKSA 5JW4N 4PG2A 4OBRA 1OAXH 1CXKA 3GSNL 25C8L 4H5SA 1NGPH 3K4ZA 3MBXH 3UMTA 2BVPB 4K7PL 3EJYC 4MD0B 5D7LA 3HNSL 1T04A 1U91A 1ITBB 1MJUL 3X3FH 1RJZA 4MXQD 1YC7A 2KQMA 2W91A 4O4YL 3M1BB 1LO0L 5A16A 1BX2A 5D7IA 4JZNB 2FJGA 1U3ZA 4J4PD 5I75B 4NJAL 2OP4H 1Q9WB 3EYFA 5C0BB 1YJDH 5C6WH 5C08E 4FABH 2BNQA 4M4PA 1TIUA 4Z18A 2EXWD 3L7EB 5IHLB 1EDQA 1CTNA 5JIPA 3OR7A 5D7IB 1AO7E 5TQ2H 3W11C 2Z93B 3U0WH 4Y5XA 4EI6A 2GJ6B 3FOMB 1FZJA 1S9WB 2XXMB 1G9MH 3BQUD 1N4XH 1SVZA 2B4CH 4MNQE 3CFCL 4OF8A 3NVQA 5BV7B 3BH9B 5GHWH 1EIBA 2B1HL 4Z0BL 1UM4H 4CGTA 3HUJA 3VXSD 3TBWB 1F4YH 2VB5A 1EMTH 1XGYH 3LIZL 3IT8D 3DURB 2NNAB 1MCSA 4RMVA 4IHOA 1W0WA 2JJWA 2NX5D 1CFQA 2Z31D 1CDBA 1RUKH 3TF7C 3QG7L 4NRXA 2ESVA 4CMMB 5DMYA 1FYTD 3BESR 1T4KA 1HNFA 2NNAA 2IAMD 1LEKA 1NBQA 3NGBB 1CFSA 5EUOE 3RWHB 4WNQA 1EVTC 3S35X 1CD1A 2J5LB 4M6OH 3QSKB 5BZDA 3QIBD 1RULH 3NCJL 2I9TB 2P8PB 2IQAB 3GSQB 5HGBA 3GMOA 1T3FB 2PYEB 2YUWA 1KJMB 2AVGA 4PJBF 2V5YA 4Q2ZA 1M71A 4GSDH 1QHOA 5DUPL 1NAMH 1DQLL 4TULL 2R0WL 2WWKO 3VGEA 4WGWB 4XT1C 3T0XA 3BISA 1RJLA 3QI9D 5C08B 4YQXL 1KIUA 3DO7B 3UDWA 2XPGA 3UAJC 5L2KA 5E0QA 1DVFC 4KRPC 4PP1D 3PL6B 4MJ5A 4XHQA 2V2XA 5HGHA 3VFPB 1DQMH 1RHFA 4X99A 4Z0XB 1MI5E 1TMCB 2YPLB 3IDIB 4TSBL 3KHQA 4OF6A 5J06A 1N64H 1KJ2B 2OQJA 1GZPA 4JO3L 1GGYA 4UV7L 4Y89A 3S4SB 2DTSA 3QEGH 3FQWA 4I8DA 1GC1L 1K4CB 3HE6A 3MV8E 5KSAD 3LD8B 2BOBB 4LSUH 5BQ7A 1ZT7B 4NCDA 3MA9L 1L0YA 4HZAA 5SWSD 1I8IB 4DN4H 3K2MC 4JGJA 4K94L 4JVPA 4PRIE 1CFVH 2VLJD 4FHBD 5IT2H 3H9HA 2ADFH 1EERB 1GGUA 1B9ZA 4YR6B 4CNIA 4HWBL 3TP4A 3CDCA 4YDJB 4QHLB 1SY6A 5EU4B 3OGCB 2K7PA 4WHDA 4BSJA 2PYEE 4WFED 4RA3A 3KXFE 1BBJB 4I18A 4JFEE 5JMOC 5ANME 1KELH 4YXHL 1G9NL 4KV5E 5E8PB 1ZGLA 2R1YA 2R2BB 2OP4L 5DJZB 5F1SA 3VXQA 4KTEL 1PDKA 1AQDA 2EKSA 1DQDL 4KJWC 4O4YH 1B4RA 5EU6A 2KZWA 1FHGA 3W11D 4M6OL 2Y9RT 3FB6B 4KK5D 1IQWL 5F96H 1MI5D 3ZKND 3BQUC 1B0WA 1RAMA 3TO4B 4CRPA 3BUYA 3IDXL 2XKUA 4U1GC 1C08B 4XB8A 4ZTOH 3BGFB 4B7IA 2Z91A 5HHOB 2BFVH 3VJ6B 3H3PH 3MJ9L 4LLQA 4P9HC 4KQ3L 1JV5A 2HJKB 4CMHC 4QY8B 5E4IA 4MA3B 2HVJB 2ZOKA 4PGJA 3QDJA 2R15A 1KLUB 1FJ1A 2CDEA 1KCRH 5EOQH 1HKLL 2E6JA 1FO0A 2A6DB 2NY4B 3DVFA 1BQHG 4AEIL 1NAMB 3NN8B 2B4CL 4S0SD 1JP5A 1HQRA 1KPVA 3UTPD 5I73B 2X7LB 4K8RC 3DRTA 4QF1B 5JNYA 1ZHNB 3UYPA 1QR1A 5F1KC 2VWEC 4C83B 4LKXB 4YR6A 2NY6D 4MXWL 4AL8H 4YHPA 1NGWA 2IALA 5CGYD 3SDDB 3WEXB 1HILB 3RKPA 1P53A 1A6VH 3LDBC 4TVPE 3TNNA 4IRSB 5DGRA 1TTGA 1YJDL 4J3VA 2G9HB 5T33L 1IM9D 1IC5H 1CZ8L 1E28A 3V6ZB 4G7VH 1V7NL 5F7WC 3RWFB 3K4DA 4MB4A 4L3EA 1NBVL 3A0OA 4ZS7H 4U1KB 5L88L 4WWID 3GMRB 5ALCH 3H42L 2XNAB 3HCVB 4GMSL 3O9WA 3IFLH 4TSBH 3AY4A 5CZKA 4Y5VB 5CGTA 4JHAL 1CT8B 4YHZL 1G1CA 3DX6A 1KIQA 4KK6C 4ORZC 1ZMYA 1BFVL 4I3RL 4JFHD 5IWLA 1R5WB 3K8LA 2VDMH 1RUPH 3FO0L 2F8XC 5A2IH 1F02I 3NA4A 4M1GL 4JFXA 1KXQE 2IH1A 3HB3D 5D96B 5DK0B 1B0RB 4K3JH 5C0GA 4DVRH 3O41A 1JPSL 4OLVH 3V6OE 4F9LA 1TQBC 4I77H 4WWKD 2AJSL 1ZTXL 3MV7E 5EFIA 1WEJH 4HF5H 3AREA 4PRIB 2DI7A 5D71H 4BZ1H 1HSBA 3O2WL 3S3JA 5C0JA 1CCZA 5J9PB 1HILA 2D03L 4LOUD 1D6EA 1TZHA 5D96C 1UA6L 4OI7A 4W6YB 1K3ZA 2V2WB 4WJ5A 1NJ9A 2FBJL 4WI7A 4GXUM 4IEFB 5I1DB 2YXFA 2I9LB 4NQVB 4HUXB 3MLSL 5DO2D 4YGVB 5JORA 1BOGA 4J23A 2F19L 4ZG1A 3GIZH 1Q9OA 1G6RB 4DKAA 4RCAA 3RVXC 5EN2A 1LEIB 4IS6A 3ZKQD 5H94B 5E4EC 1XGRB 2DL2A 3GJEB 4KI5E 1FDLH 1VGEL 2XACC 5KSBE 5J3HD 1X5ZA 5IVXF 5D7SL 1YPZA 1I1AC 2JB5L 4AEEA 4F33B 5E24E 1ZANH 3PWPA 2Y36L 4G9FE 4KROD 1RJYA 4R26H 5GGSY 1DBKL 1NGYA 4P4RA 1DVFD 4AJ0A 3H7BB 2IJ0C 35C8L 3KPTA 5D6CA 1WITA 3QO0A 3LMJL 2AJZA 3L3GB 4GRWB 2CMRH 3TV3L 4B41A 1EHLH 3TVMB 3RFZC 2GSIB 5H2BB 4IRSC 5I1KL 1KEGL 3QPQC 5KG9B 1BGXL 4XP9L 4G8GB 3O2WH 5KS9B 3PWNB 4M6ML 1E4KA 2UVFA 1FVCA 2AERT 5IBUG 4PJFE 5T5NF 3Q3GB 3OAYH 1T7VA 1Q1JH 3SGEH 2BNRB 2MHAB 4UU9B 2CDFB 2YRPA 5HHQB 2QQQA 3D69B 4MD0A 5IQ9B 3MGTA 3FB5B 2VE6B 1F3JB 2L7JA 3BMVA 3MV8B 1LHZA 5TE4L 1HNGA 4UNTA 2WBJB 3AXLA 5IESL 2R23A 2B0SH 4U4BA 5FHAL 4R7DB 1SMOA 1NLDL 5D7KE 1HN1A 3VMPA 1ETZA 1DL7H 4GKSB 2XY2A 2AXFA 3BUTA 4GLRH 3RPKA 3X12A 4FFWD 4NZUL 4OLYL 3ILQC 4MCYA 3BEVB 4MNQB 3PDOA 4JHAH 3IF1A 4YFLF 1FZOB 2K9UA 3T77A 1W0YT 4Y19B 1XGUA 3OF6D 2K7QA 5GGSA 3TN0A 4J3SA 5I30L 4KKAC 1CZ8H 1F8TH 3FT2B 4RGOL 5CHNB 2VITB 3B9KB 1LNUA 3ORJA 5D1QC 5TDNA 2DYPD 5J6HB 2VZVA 5HDQH 2D7TL 3D25B 2B1HH 4WWKB 5DJ0A 2Q20A 3T4YB 5ISZA 5LJYH 3FO1A 1KJVB 1VFOA 5JDSB 1JGLH 1N59B 5CLTA 3VI3F 4F7PA 4LASH 2CXKA 4PR5B 2DIAA 4QOKB 1SM3H 3LKNA 4HEME 4UOW1 2MCG1 4NKQB 8FABB 4LLVA 3HC0B 6CGTA 5IMLA 3SGKA 5AZEL 2QSCL 1F3RB 2FR4B 1HZHL 4JDZA 1BQSA 3K2UL 1U8QA 4JN2A 2YD6A 3GSQA 5HGBB 4LOUC 4NQCB 3QQ3B 1FVDB 1M05B 4Z7QE 3H0TB 4GAFB 1V5JA 3LRSB 2W0KA 3KLSA 4JRXB 3JVGA 3VDBA 1IC7H 4ZTOL 1UWEL 1F58L 4S1SH 4YNYA 2X09A 4NQDD 4GAJL 1VACB 3GMQA 4YDIL 4QXGH 3ARBD 1FV1A 4DKEL 5D70H 1MF2H 2I26N 1IFHL 2VLKB 5EU5B 5JORB 5F7DB 5H35A 4L8CA 3L5XH 3UTTE 1KB5B 5E8DL 1DVFB 2E5EA 4Q0XH 4WUKL 1IBGH 4YNYB 2ORBL 3LH2L 1Q38A 1J5OL 4FFYH 4HH8A 4X99B 4L8SA 3P0YL 4HGMA 3KJ6L 1A9EB 1K8DB 2GUOB 4G42A 5IM7A 1TJGH 3WSQL 2X4UA 1NL0L 4OLWH 4EN3D 4L9LB 4FP8L 2VRAA 2AEIT 2I07B 3BRFA 4M43L 1O7SA 2R1YB 4Q6IB 5I19H 4KZDH 1FO0H 3WE6A 4R4BA 5I8KL 1V3LA 2V9TA 4M7LT 3L6FA 4R2GD 5CP7A 4R2GC 3FO2A 5FO7A 5DMKA 2JELL 4XHJC 3BWAA 1CGTA 1FG9C 1A6UH 5IJKA 4GOSA 5SX4H 3LPWA 3LOWA 3GBML 1Q8MA 3SJVB 1EGJL 1ULVA 4RGOH 4POYA 2XZCL 2BP3A 3GMMB 1CFSB 4WO4A 5SX5K 2RCSH 2IEPA 1CD1B 3U7AA 3MNZA 1D5BB 4IMKA 4WUUA 4FQJH 3OPZH 2A83B 4C56D 1ZLSL 1UM6L 5E95B 4MJ4A 3ZDYF 2MMXA 1A1NA 4Z76B 3RNQA 1YNLL 4LSVL 1AO7D 5D71L 4BZ1L 1MRCL 1N5YH 4X4MA 5BW7A 3O4OB 1RZ7H 1RUAL 2EDKA 3DVGB 1T7YA 2ZZUT 4HXBH 4U6TA 3MSPA 1D5BA 4WUUB 4Y5YC 3D39D 2BSTB 4LCCC 4HDIA 2JK5A 4TUJB 5CFHA 1SHMA 1P1ZA 3QUMH 4DN3L 4GKSA 2RIKA 4MDJB 3RGHA 2EDFA 3ZKMD 2BJML 1AJ7H 1XF2A 1CXFA 2ORBH 4UAOB 5JOFB 4RFEB 2G2RB 4NP4H 1INEH 4PRBA 3LCYA 1FRGH 3CGTA 2EYSA 4RMTA 4NOBA 5E2UL 3MRHB 2R69L 4LHUD 5I75C 5J4MA 2AV7B 3TBTB 4P48A 3MOQA 3P4NB 4BFGA 1N2RB 3QDJB 5HJ3A 3MV9D 1E4WL 3NN8A 3Q2CA 1XMWA 2FECL 3MTRA 1UKTA 1RZKH 5DEFA 1FNEB 1UC6A 2V2TB 1HOCB 1MH5A 4UIMA 4F37K 2YD8A 5TF0A 5GS2H 2CKBA 3KLDA 4RA0C 3MBEB 4PY7A 4H8WH 3QUMA 4NUGH 3V5HA 5EOTB 1JN6A 2X9WA 2MWCA 2FIKB 4FQPA 5EBMB 3ULSA 2EDHA 3EUUA 2NY6C 3HMWL 5GHWL 5E9DB 3GO1L 1P7HL 1T83C 1A1NB 2UUDH 4G6JL 4PRHE 2R8SL 1JNHA 4NQXA 1AQKL 3EYQD 4AEHH 3JZ7A 1OCWL 2C7UA 3JUYA 1I1AB 1WIOA 1OP3K 1AO7B 1P1ZB 3IGAB 4HFWA 4NNXA 1DN0A 4H88L 5GGUA 1MHPH 3D39A 3LQAC 2COQA 4RSVA 2GCYA 1X5IA 4X98B 4X83A 4NQXB 5GGQL 5JOPE 3O0RH 5GRVL 1YN7A 1RURL 4LPUA 2LE9A 3PNWB 3VFNA 1T1YA 2CDGA 5ELIA 4Y88A 3UC0H 2NW3B 1LP9A 2BNUA 1DBJH 4R0LC 5DMIH 4IRZH 1JZ7A 1GL4B 1Z5LB 1S9KC 4Z5RB 3FCTB 5GGRY 1YPZE 3QZWB 3I3DA 1M7IB 1MIEH 2X89D 5DRXB 5EWIL 3MLVH 4NSKA 1XZ0A 4C83A 4ZD3H 2K1MA 4JRWA 4PUBH 3ZDXF 4J1UB 1S9YA 1QBLL 2QKIB 5EB9A 1OQOA 2HKHL 1TQBB 1QP1A 5GS0C 4JY6A 4G5ZH 1KJ2H 5KAQG 1YJDC 5IVXE 1L9MA 1D5ZA 4LSPH 1EFXD 1BP3B 2W0FA 3LV3B 5C6TL 3ULUD 4JVUA 5GGTH 1C8PA 5IF0B 1XIWA 1KGCE 1ZT1A 1A9BA 3RA7H 1N5AA 4HIIB 4Y2DD 1YEKL 5AUMB 1CTOA 1MHHB 5HYFA 1CFVL 12E8H 5K93A 5IEHA 5IROA 4Z7QF 1AIFA 5IHZA 3OX8A 4EDXB 4PJFF 5E6IC 1CBVL 3UTTB 4KKNA 5EZIH 4LVOC 1RUQL 4KPHH 2ICEB 5ETUA 4MWFA 4KWUA 4PV8B 5IROC 5IFAL 1B88A 4KV5F 4LCUB 2JELH 3QUZA 1HDMB 3QUXC 1UB5B 1MPAL 4WUUE 1KCUL 4Z7VF 1AD9B 1I3GL 2E7CA 3C2AL 3ALWA 5L6YH 1F3DJ 5DRWA 3C6LD 3UYOD 5ITBL 1A7RH 4HBCH 4MNGA 4X8JA 5E5MB 4RMUA 4RX4A 5FKPA 5FUZH 1Y0LB 4PJGB 1U95B 2WUBH 3FQNB 4QTHB 1ZT7A 3VXRE 1FCGA 4Y19A 3C6SA 5HY9A 3GRWH 4PP2B 1KJ2L 4YIQB 2M1KA 3PJSB 4ZAKD 4OGYH 5IF0A 4NDMA 4P23B 2VQUA 3VRIA 1CD8A 4JQVA 4HLJA 4V1DD 3HZMA 1ETZB 1J05A 3PIQB 2IADB 3HR5B 3ARFB 2BVEA 1RUMH 3BPLC 1G7LA 1CN4A 1FAKT 4WFFE 3PV7A 3ARFC 5I1DA 3EZ8A 1ODAA 4P5TC 1KJVA 2XIDA 1A3QA 3T77B 1DBJL 4BYHA 5JXAL 3MO1A 5FYKL 4KQ4L 1WZMA 3PDOB 4FRWA 3DURA 2VLME 1I1AD 3K4AA 2C4FT 5HHPB 4YXHH 3SY0A 2F5BL 2XYCA 5CHNA 3B6SB 5ESQB 2GK2A 4AY0A 1A7RL 3TBSB 4JFOA 2BC4B 1HIMH 4YHKH 2XWJA 4RWYL 3QQ3A 4UTAL 3U0PA 2APVA 2QEJA 5IBTH 1AKJA 3FTGB 4RGNC 4PIRF 3W0WA 4X4YA 5CIPH 3EBAA 2IQAA 4OUUB 4B50A 3OR7B 5T1MA 5ESAB 1ADQL 4FTVE 1IC5L 3IXAB 3BGAA 1S9VA 1XCTB 3ARPA 1AP2A 5DHXB 2BZDA 4GXVH 3RL1B 1CGSL 5IBLC 3DRQB 3N1FC 1E0OB 1RJZB 4FFYL 1CR9L 1G0XA 1WZKA 4BUHA 4JM2B 5E6IB 4MAUL 4NQDE 1JYWA 2HH0H 2CPCA 2WUCL 1A7BA 4PTUA 1DBBH 1I7UB 3U83A 3LEYL 3G9AB 3B5TA 1VPOL 4M6AA 4Z0XA 3JV4B 1AC0A 2OXHA 2DQTH 4LARL 4PRPE 1VFMA 2VDKH 1G7PA 4XCNB 3PWPD 1IGMH 5E6IA 1T20B 4IOIA 5T1KB 1YPZB 2DLGA 1IEAA 4NZRH 4KK6D 3UTZB 3V0AC 2BJMH 2MFNA 4JFPA 3EDJA 3GBNL 4YHLL 4LU5L 2UZIL 3GSWA 1MWAL 3MXWL 3ARBC 4DKEH 4KAQH 3MMEB 1CDCA 5D6CB 5GSVB 1AGCB 4Z7UF 3E3QC 5T1LD 5CZVL 1MAMH 4JM4H 2DKUA 3WUWB 3QDMA 1T04B 1U91B 5DT1L 1KV3A 2F15A 4U6XA 2NR6D 2PCPA 4QCIB 2BNRA 4UU9A 1G9NH 4OD2A 4Y1AE 5T5FH 1H9VA 1N8ZA 1PG7H 4R0LB 1RUQH 4NYLB 2BVOB 4LLMB 1JZ4A 4GW4B 2PO6A 4HIXL 5EULV 3EFDH 3T3PF 3OL2A 1QKZL 1MHPL 1GIGH 1J1XL 2XG5A 3ES6B 3DIFB 1U58A 2ZCKH 3PGFL 3MV9B 2ATPA 3HI6L 3MUGB 4PJ9B 1QSFA 3DSFH 1ND0A 3RVWD 5E6ID 4WDIA 2AABH 5IIEB 1I75A 4ODXB 4H8WL 3F5WA 1Z6JT 3ARFD 1F8TL 1JHLL 1A22B 1A7NH 2YA0A 1BAFL 1W0VB 4XBPB 1T1WA 2FBJH 1OSZA 3D9AL 3VFMB 1T5XB 4LP4A 1YN6A 3HZYB 5JLZB 2CXGA 3MBEC 1JPGB 4BZ2L 4M5YL 5CJOL 1CICB 3L1OH 3WLBA 2HKHH 1MFBL 1P84K 4Y19E 3WHXA 5JQHC 3ISWA 3H9HB 3IFPA 5HHME 4M1DL 1GH7A 4KRNA 3VWJC 2E3VA 3BIBX 1NAMA 2EC9T 2FJFA 3PWPB 2ADGA 4FXGA 4S11A 2R1XA 1VFAA 4HKJA 3I50H 1ZWIA 2APTA 4WI4A 4M4RA 2ICCA 1GGIL 3JWNC 3MJ9A 4MXVE 5LBSH 1F6LL 4PJ7A 3T4AB 2HG5A 3RRQA 2PETA 4YZFE 3W0WD 5TE4H 3FFCA 1INDL 4MDIB 4ZYKB 1GPOL 1HH6A 3QUXA 4LRNH 4OQTH 4TRPL 4YHOH 4OJFL 1T7XA 3KJ4C 4OCYH 1YNKH 4QHUA 2P47B 4UAOC 1IGIH 1MCIA 3TO4A 3AAZB 5C0FB 4I3RH 3TIDB 3MFFA 4TUKH 1JYNA 4DGIL 2CSPA 3BKCL 5T3XD 5L8JB 4HKBB 2CKBB 2FX7L 3KYOB 4LIQL 4Q9RL 4NQCA 2JB5H 2LV4A 3PGCA 4LCCB 43CAB 4PJAF 1XEDA 4TVSa 2V9RA 3FB5A 4GKNA 1R0AL 3UBXB 1YNTB 4Y8DC 4Z78A 5EA0H 1NMAL 3QFJB 4YFLI 3BKYL 5GGVH 3ESUF 1YN6B 2I27N 1T1XB 2OLDA 3JSSA 3VXTA 2ADIA 2Q86B 4EVNB 5EU6D 3AS2A 3FRPA 4WY7H 1IVLA 2X4SB 1QD0A 1HINL 3SDCB 4ZAKA 3MRRA 4KHXH 3L3KB 4KJPD 5I0ZA 3IETB 1TFHA 1E4KC 3FZUD 3SPVA 4JPKL 1A9EA 2GUOA 1EPFA 2HFFA 4IRSA 1YDPB 3E0GA 3MUHL 3CCHA 7FABH 5KVFH 1IC1A 2ESVB 3QIBC 3DYPA 1K85A 3UPCA 5C07E 3RWIA 1R5VB 3V8CA 2VABB 4APQD 4XVJL 3WIHA 3QHZL 3I6GA 3QWRD 2BRRH 4U1KA 4P9ML 4X80H 3VG9B 4W4OA 3HKFA 3OR6B 4OFVA 3QDMB 1OVZA 2Z0BA 2Z8VC 3MRGA 1G7MB 1U3HD 3VI4F 4R3SB 1ZT1B 3C5ZB 4MAYC 1FPTL 2C7UB 1F90H 1YEHH 1S7QB 4M5ZH 1F00I 3G6AB 3TT1H 3S97C 2WUCH 3RUGE 5C0IA 2AXHA 1Q9KA 1F4WH 3TA3C 4YK4C 3UEZA 1X5GA 3GRWL 3E6HA 3VXRB 4HUUB 5I1KH 2VC2L 5DK2A 1KF9B 3QUMB 4O58H 3ARDB 4OCNC 2QADC 1BBDH 5L88H 2AK4E 2VR5A 1CGWA 1NANH 4P5MB 4HJGB 4QHNA 2DQCL 3PGDB 2QSCH 3IRPX 3SE4A 3S8WA 2BXYA 3H6JA 5F9JA 5TDOA 5DJCB 1FGVL 3TCLA 4ZAKB 5C09A 1RD6A 1QSED 1AI1L 2QHRL 1KTKE 1CE6B 3QCVL 4K23H 5KG9A 2G5BA 2O5ZH 5JUEL 1NCUA 4OZGE 5JXEC 1HHIA 2PR4H 5HI5D 3NFPB 4ODUB 4U6YA 2W07A 4PJEA 3VDAA 2EECA 3DECA 4GJTB 2E7LA 1YEIH 1MCLA 3LN4B 2ZP0T 3LN9A 3O11B 1AFVL 2VLRB 1NEUA 2XZCH 4TPRH 4KUZL 3KS0H 1KCRL 1CQKA 1WTGT 4S10A 1JVKA 5EOQL 5T3ZD 1ZLVH 2AJYH 4RISL 4K3DL 3WIFB 1XGRA 2NMSA 3FB7A 3FFCD 4IBLT 4U1HA 5D1QB 5GIRB 3T65A 3P0YH 1MCBA 5IUSA 1LK3H 1H3WM 3KPOA 1PKQB 4P2RD 4NO3B 4OZIE 2X4RB 1C5DA 1A7QL 5DFTA 4MJIA 2OM5A 1T2QH 4G43A 1JHKL 2WWMC 3NZHH 4YXLH 5HYJA 2YEZA 1CYGA 1E27A 2AJUL 1IGTA 1ZVYA 4XNXL 3STLB 3V5HB 2X4OB 3HRPA 1IGYB 1CICD 2A0LC 2NX5E 4YHYC 3KLHC 4Y1AB 2AQ1A 4JHWL 3U9UB 5C9JB 3WXVL 5CBAA 1M1SA 2DMCA 3L5JA 3V9FA 3PWVA 2UV3A 2GSGB 1GPOH 3N85H 5DFVC 3MR9B 3RWEA 1F4HA 2V5MA 2X40A 4PY8I 4XWOD 1TITA 4TOYL 3VU2A 5BOPA 5KS9A 2AEQL 1UB6B 3GUTB 1NMBL 3C87A 2YUZA 1VENA 5D9SB 4GRLA 5IMOA 3B43A 2Q7YA 1MI5B 2NZ9D 2XN9B 3CX2A 3MRFA 1KBGH 4KJPC 2H6PA 3STZB 3QO0B 5KW9H 3ROLA 2BHYA 2E9IA 4OLXL 3CXDH 4XTRC 3FOLB 3OKOA 4JPKH 5B8CB 4KTEH 4TNVK 5D93B 5HVHB 3MV8D 4X5LA 1T03H 1LK3L 4MA3A 5JZ7D 4QT5A 4P2OC 1HINH 5A40E 2CMRL 3KNBA 5KSAB 2YN5A 3QNYA 1T5WA 2GAZA 3EFFB 4CDHA 1H8NA 2X2YA 1A5FH 1XF5A 4P46C 3RBSA 1TVHB 1IT9L 1UZ6F 4XNYL 2OL3A 5CWSA 1I4FA 4P3DA 3RI5K 4P4KA 4ALAL 2X4NA 5FKAA 4X8JB 2VAJA 3N1GC 4NHUB 2ESVE 2ZCKL 3AU1A 4KROB 2H32A 4LCYB 1HHJA 2Z92A 1OB1B 2FECI 1E27B 1S7SB 4Y1AA 1FFPA 3QHTC 4NJ9H 2WM0A 3EO9H 1U8LA 3TNMA 5AWNH 5L7XL 5EZIL 4MMZC 1IGIL 3VD3A 5EBWA 5FHAH 1NL0H 3F7YA 5IHZB 3HZKB 2BY0A 5CD3B 5EC2A 3VFNB 3IFPB 3OXRA 2VC2H 3D2UB 3DXAE 2D9CA 4MB3A 1VA9A 3BP7B 1TTUA 3F7RA 1R3LA 5LBSL 5FHBL 2C26A 2Y7QB 4L9DA 5ICZA 3D6GA 2PO6D 4X6DB 1QFPA 4OTXL 4PBVC 1R5WA 5IVZB 4UT6L 4U6HB 3V4PL 1JF1A 4HS8L 1SBSL 1LNUB 2GQHA 4KXZH 1KC5L 1G7IA 5A16B 4LDOB 3V4VH 3D25A 1TZGH 3NACH 3WFEL 3AM8A 1D5IH 4I0PB 4HGKC 1OAYH 5C92A 5D1QD 2BSSA 3WKNA 4Y0GA 3BP6B 4KVCL 4H8WC 5GSRA 1FV1B 4OD2B 1JHLH 2BCKB 1T80A 4Y4FA 1C12A 2DTML 4RMWA 3SKNA 5E8OA 3LRHA 4GG8A 43C9A 4X4XB 1AKJD 3V2AR 4XP4H 1T0PB 3D3VD 4LCIL 3GHBH 3AVEA 4M1CC 4I4WB 5ACLA 2DQJL 4FQHA 4N1HB 4NKIL 4GRLC 4Y5VC 4YGVA 3HAEH 4PRPA 3SBWC 1A6WH 4MAYD 4JFPB 3AXLB 3P9LB 3PF2A 4N5EC 1FE8L 5JOFA 5DJ6B 4Y4KA 1IGCL 1MCOL 4MXWH 4Z0BH 2C3VA 1FFOB 1N64L 3LN5A 1G6RH 2P8LA 1XGTA 1KN4L 3SY0B 4MD5B 1QFUH 5HYQA 1YEKH 5A3IC 2R2EA 2YD7A 5GPRA 5I17B 4JPVH 4HGWB 4HMCA 5J13B 2YN3A 5J1SC 2EDYA 1XF1A 2Y1VA 5DHVB 4LKCA 2R2CA 1BIIB 4JCMA 5I1GL 5GS0H 2R2HA 3M45A 4AEFA 4J6RL 2JTDA 3R8QA 1U6AH 5FYKH 5KN5A 3WIIL 1J12A 5A2LH 1JPFB 2IFFH 3H2WA 1DSFL 4ZNCD 3VH8G 1P84J 3Q6GL 4P46D 3VWJA 4KK5C 2HMIC 5E8PA 5FYKE 5F96L 3RL1A 3WNMA 4E5XA 1S8DA 4PRNA 2J7LA 1FQ9C 1L7IL 3S5LG 2AJUH 2LVCA 4HWZA 3WNKA 2UYLB 2E7LC 4FFWC 3O2DA 1KENH 3PWPE 2Z93A 3OF6A 1INEL 3JVGC 4P5MA 3UC0L 1QO3A 3H42H 1KIRA 4J7RA 1HYSD 5EC1B 1CK0H 3T2NH 3DX7A 5CSBA 3BP4A 1D3CA 2RB8A 3WFBL 3LQAL 3BDYL 4Z7WF 3R0MA 2J8UA 1H5BC 1K8DA 1F6FB 3B6SA 1KCVL 4AIXA 1AFVH 5C0AE 2XRAH 5C7XL 3QQ4A 3CDGB 1OL0A 3D3VB 4P23D 1UVQB 5D7SH 3OB0K 2PXYC 4K8RL 4HKJB 5I17A 3O45B 1S78D 1PY4A 5HYQB 1R3IH 3FJTA 4NWTH 4P46A 1CLOH 3VWJD 2C3HA 4Y4FD 3JV6B 3GIZL 3HS0A 1CVSC 1PY9A 1U36A 5CSZA 3WUWA 5T33H 2H2PC 4AG4H 3WLBB 4HAGA 4U1HB 1JF6A 4JLRB 5D1QA 1OW0A 1GC1H 2XTLA 1MJJB 3U0TA 5EOCL 6FABH 4O02H 4XVUD 1EFXA 1AHWC 3HPLB 1D5XB 3IU3A 3S4SG 3SHSA 2EKSB 4KQ3H 4PR5A 3F7VA 1RZGA 4AIZA 1TDQA 12E8L 4P3WA 1GAFH 2A9NH 1IL1A 1RZKL 2NY0C 4GUPA 4JRYA 3VXSE 2CRMA 3SGKC 4DEPC 4Z7NE 5MHSD 4U49A 3LKNB 2EXWC 4U1JA 5KOVC 4DUVA 3BUYB 4LLAA 3GMRA 1TZIB 3LKSB 1N7ML 2C1PB 3BIAX 2YK1H 3KYKL 5IR1A 2NY3C 5EBLA 2FEDC 2JJTA 3MR9A 4XH2B 5DQDH 1MLBB 4X6EB 3OV6A 5F97E 4KRPB 2EDRA 4PYGA 4ENEC 1I9JL 4XWGH 5SWSE 3IJHA 3CLEL 5CZXD 5JIHA 2AK4B 1SEBB 5F72S 5GGSB 2MPAL 4O2FA 2YKLH 5C08D 3CFKB 4LPTA 4X0KA 4LCCA 5E8EB 3CU7A 3S37X 2PW1B 3G6JF 3L7FB 3BIKB 3VXRD 2BHZA 5FYJL 1P7QB 4DCQB 5I1LB 3HE6B 3L5WB 1YEJL 1TJIL 3KPMB 3QXUA 3I75B 2X7LA 1BVLA 2P5WB 1AHWA 4C58B 4IRZL 4NN7B 1MPAH 4P4KD 4U6XB 1L7TH 4ZS6C 1U8KA 3C8KA 1VADA 4AMKL 2BHUA 4OZFH 3QCTL 3V6FA 1EH9A 3O11A 3B9KD 1V7NH 3NABH 3RAJL 1N5AB 1HE7A 8FABA 4PJCB 5JW4M 2X89A 3BZ4B 4ZUSB 1KCSH 4HS6B 5HHOE 4Z7WB 3TFKC 1XR8B 3S88H 5ALBL 4WJ5B 3DGCR 2HTKD 1QBAA 1I1FB 3CUPA 3O4LB 4NRZA 5B39A 5BRZA 1JMZA 1TZIA 5GRUL 4OGZA 4O00A 3HUJF 5KVEH 3VXQB 1XFPA 4RDQF 3HC4H 1HK6A 5GJSL 4Y16B 4BH8A 4PLNC 3TIEB 3SGDI 1X6LA 2J8OA 3F7QA 4JGMA 5CMAB 5BRZB 3BKMH 1W0VA 5D8JH 3SO3B 1S8DB 4AENB 5F44A 3VFVA 2VDLH 2EDDA 3E2HB 4XPAL 3ULVC 1C16B 1RJYB 4I13B 1KN2H 1OGAA 4QKXB 4KQ4H 3ULVD 4I18B 2GHWB 3MRBA 4KKAD 1DEDA 2RGSA 5SWQB 1FIGH 4XPTH 5FK9B 4G6FD 4PJ5D 5CZVH 1Q0YL 1DTUA 2UWEF 2IPTH 1IM9A 1U8OA 5C09E 1S7VA 1W0WB 3RTQD 4NC1E 4WTZA 3FL7A 4N5ED 5GRXG 1KLUA 2P24B 4F9LC 3STZA 1WVZA 5BRZD 1VKXB 3RIFF 2EO9A 2X5PA 3SKOA 4P2RA 1J9CT 1BVLB 1G84A 3C6LB 4CVXA 3K80A 3FQXB 2BDNH 5JIKA 4D8PA 2QQLL 3FMGH 5E70A 4G3YH 2Z91B 5HHOA 2APWA 3L3OB 1KB9J 1AD9A 1MY5A 1JTPA 3U36B 2ARJB 4JQVC 4NQEB 3MGTB 1JZ5A 2ED7A 1VPOH 1MUJA 5DVNA 5DQ9A 1ZA6B 3IJSB 5DD1H 1KPUA 3L3OA 3RIFK 5MHSE 2X4NB 5GRJL 2EDQA 2A9ML 1I4FB 4JFZL 4P3DB 5DD5H 4D9QD 2LU7A 3W39B 5TPWL 2YD1A 4YPGB 4LCWE 3GI8H 4LF3A 3RWJA 2Q76A 3KWWA 2FGWL 2AJZB 3F8UB 4OF5A 3DROA 4EN3A 3H7BA 1RSFA 4Q9QH 4MLSA 4PREA 4N9GB 2V17H 4P9HL 3IDYC 1LWRA 4LFHG 1S7TB 4NUJB 3MRFB 4EN3C 3CFCH 2OJZL 3T1FA 4R97C 5EO1B 4LAJH 4NZTH 4Z95H 5I9QC 1OAKL 4OD1L 4KMLB 3JTSB 2MQCA 5IB1A 3MBXL 4MJID 4AH2B 3S36L 5SWSB 3TC9A 4V1DB 4BQCA 3QHFL 2LQRA 4FQXD 2PXYD 4NP4L 2EE6A 4YHNB 1MCWW 1EEQA 1M7IA 4HX1A 2ICEA 4R0LA 1NGQH 2R4RH 1HSBB 1X5XA 5FCSH 4ODTH 3L9RA 3ZTJH 3DRTB 2P5EA 3E3QE 3ULUF 1PQZB 2H2SC 2Q6WB 5K9KB 4F7MB 4CN1A 2NXZB 1V3JA 4LKXA 1KB5L 2CRYA 2NTFB 1C5DB 4JJ5A 5CILH 1J8KA 5C0GB 4X4XA 1EK3A 1U8LB 3C08L 3QIWB 2VZUA 3GMPA 4XBEL 4MAUH 1R3HA 1CF8H 5D6DC 3K81A 5GS2D 1ZOXA 3Q6FA 1Z9LA 4GRWH 3FN9A 3G9VA 3OPZL 3OAYK 5F9OH 2IFFL 1WFUA 4HJ0D 4IJ3C 4ONGH 1MVUA 2BNRE 1FFNA 3LB6C 4TNWF 4PJBB 4UI2A 2C1OB 4OSUL 4Q9BA 4NQUA 2EXYC 5FO8A 5IMKA 1W72A 4YDVA 1P5VA 2YSSA 3MXVH 1AY1L 4OZHA 2ADJA 3HZMB 3U30B 4V2BA 2FHFA 3GNML 3FQRB 1BD2D 1N6VA 2EEAA 4XI5C 1MSPA 3DUSA 3JTTA 3FO9A 5C0DA 4C4KO 1AGBA 1KB9K 4YHML 3S98A 4G80B 4GS7C 1N8ZB 2R56L 3HZVA 3ETBF 1XH3A 1Q9LB 5IFHH 3ME0A 5ACZB 4G9FB 1AGDB 1JUFA 2IPKA 4ODSL 2WANA 1XAUA 1U92A 3EYUH 4WVRA 5IW6B 5HGGS 4JKPH 4HQQH 3G04A 1AP2B 1E4JA 1KLFA 2HTKC 2R39A 1ZEAH 5KS9F 3DGGA 4FN0A 1YUHA 1Y18A 1M05A 4D9RD 5I74C 1A7OH 2BFVL 5D2LE 1LO0H 3GSNA 5BS0B 1M71B 5MI0C 1MJUH 2EDBA 1MFDL 5D70L 4JFFB 3DETC 4E5XB 2BMKB 1VSCA 4FZ8L 4NHUA 4S1SL 1KLGB 2HJFB 4LNRB 1MUJB 2IANA 4C57C 3RDTC 3W9EB 3WFDL 5T1KA 1ED3A 2NY4D 2O26U 1HQ4B 3ALPA 4XCCH 1NLBL 3V79C 4NN5C 4PRHD 3K2UH 3LHPH 4PUBL 2X9YA 4JO4H 1EO5A 2ADJB 3QFDA 4PJ7B 4KI1A 2EE2A 1GZPB 4H0HB 3VD7A 5AEAA 4UINL 2YSSB 1DLHA 1YMHB 4YBQD 4YHZH 4U2YA 3AY4C 4XP9H 1E6OH 5D2LB 1OTUD 4QHKI 3VFRA 1E6JL 1E4XL 3PV6A 4IIQC 1T89C 2YWYA 2IH3B 4WTWA 2IAMC 3HA0A 2MCPL 4WU7A 3D0LA 1KNOB 4PJGA 4OLZH 5HDBF 3MCLH 3FTGA 4I0KA 1Q72H 4ERSH 1JNLH 1ZSDB 5TPWH 3PGCB 4JO3H 2X1QA 1AXIB 2ADFL 5CGYC 5BS0A 2R8SH 3EGSA 2O61A 3GO1H 5A2FA 1BX2B 3EYQC 2H45A 3C60C 4AM0A 5L8KB 4QTIL 3EOBB 3NPSB 4NKOA 3DVGA 1YPZF 1CLZL 3MRNB 3QDHA 4WW2F 1V3KA 3INUL 5EIVA 1X4XA 5KJRL 5C0IB 4ODBD 4TTDD 4TUOB 3BPNC 3T0EC 4YFDB 4XZUB 4ZPVA 4UQ3A 2G60H 3ARTA 1U3HB 1KJ3H 2PO6B 4EUPA 2DD8H 1DN0B 5GGUB 4JKKA 4U05A 3TH2T 5L0QC 3NACL 3ARRA 5C0ND 4G5ZL 2W9EH 4TULH 5HVWA 3ZTJG 1VEMA 3O6FC 3Q1SL 4X6DE 5I16B 3BH9A 4OQ1A 2DN7A 1HEZB 1FVDA 3MROA 1LP9F 2NY5H 3WDIA 3IDNA 1FL6B 2XQBL 2D7QA 1WWCA 1RULL 3NCJH 2AQ2A 1MFEL 5FCUL 2XT1B 1EVUA 5CD5D 3TZVC 3VFSA 3B9VA 2ADIB 5F7HA 2QQKH 3O9WD 3RPIB 5IV2A 5FV2A 2IMMA 3ARED 3EO0A 2V6HA 1KELL 4OCWH 3MRMB 4Y16A 3R1GL 4HGWA 4J1UA 3ZLQC 2KUTA 4WWKA 2N7BA 3B2UC 4G8IA 1BEYL 5LCVL 3SOBL 1PBYA 1YEFH 3EOAA 3BDXA 3QDMD 4R96B 3HNTH 2W65B 4H1LH 1MCEA 5FYLH 4AEHL 1LEGA 4U6VL 2R9HD 3RJQB 5CCKH 4RMSA 4I48B 1QUNA 1IEBB 3U46A 4IIQA 3E6HB 3VXRA 5DC0A 4JN1L 3GKWL 4X8XA 4XWOC 1WK0A 4C59B 1JHKH 1FH5L 2GTZA 3BN9D 4YBLC 4LLMA 4PJXA 3O3DB 3U0WL 1XF4A 2GCYB 3H0TA 3JWDL 4EQ2A 1QFWM 2Y07H 1VKXA 2HKFL 1BFOA 4TSCL 1Q0XH 5DURB 1QQDA 4NQTA 3LS4H 1U8JB 1EUTA 5HD8D 3JWDC 3IRZA 4EI5C 5ABDE 4YX2L 4N0FB 5EIIA 5CJXA 3WFZA 3ZYZA 3FFDA 4PRHA 2CLRB 4J8RA 4WU5A 4MSWA 1FORL 3X13A 4V1DA 4EI6B 3LN4A 4NNPH 2HFFB 1UVQA 4YE4L 3AB0B 2IBGA 1SEBA 4RGNE 2ZKHH 1DE4A 4NNYB 3PWLB 1T6WA 5CINH 2E6PA 3SOBH 3LEXA 1EEYB 4OSUH 1LO3H 4UILH 3VXTB 3D0VA 4U0RB 3RUGB 2VJXA 5CKAA 1X5JA 1YQVL 4RX4D 2QSTA 1AQDB 1MCQA 1VFBB 2XA3A 3KPRA 3BOVA 4BQ9A 4N90D 1UGNA 2F53B 3WUWG 4PV9B 3QDJD 5F3BB 3UBXI 4OAWB 1EO7A 3NCYP 3OGCA 4OZFB 4QRRD 2GK0B 2ICWA 1IZJA 2ZCHH 3CFJA 4ONFH 1T2QL 5JW5B 2ZG2A 4WI9A 4QGTA 4GG6A 3VGAB 1S5HA 1U2CA 5IW1A 3TNMB 5CUSH 4TTDC 2A1WH 3SCMD 1BFOB 1MI5A 3RZCC 1U6AL 1IEHA 5H94A 4YC2B 1J88A 2E27H 4HKBA 1I1AA 1KIPB 5F9WB 2DF3A 4DFIA 3OKEA 2IG2L 1IAOB 1KXTB 3LSOB 5T1KD 3LKPB 1R5IA 1A6TB 1PYWB 2HRPL 2ZKHL 4HX1B 2DICA 5KANI 4N1EA 4JPVL 2GY7B 4KKLC 5E8EA 2UZXB 2D2OA 4IOFD 2DQUL 3VJ6A 4M7LH 2DLEA 1HHIB 1NCCH 1YY9D 3B3IA 5AZ2H 3JTSA 3OKKA 3AUVA 1KCVH 3QFJE 1RZIA 2R1XB 3T1WA 3MFGB 5J56B 2M2DA 4YDLB 3FB8B 5KVGL 3MRKA 4YDKL 3LKQA 5EOCJ 3QWQB 2VLRD 4MS8D 3VXMB 4P5KB 4YBQC 3AREC 3EDKA 4Z7VE 1CK0L 3O6KL 1HXMB 3RGVC 1OD9A 4U1NA 4XP1H 4PJDB 2X1XR 4G6AD 3MUY1 1G1YA 1OTUC 2EH7L 5BCAA 4DGVH 5E8DH 5GIRA 3VXPB 3ZSSA 5IVXB 5ILTL 4WW2C 2OZ4A 2ZJSH 4O5LH 5J12C 3WS3A 1NCTA 3QIBA 2W38A 3RWDB 4MXQC 3UJIL 3P9WB 5ID1B 4S1QL 1UH3A 1NGPL 2F9BT 2H26B 2P5EB 4J4PC 2Z9TA 1QSEE 1JBJA 4IS6B 1RHHB 3OKNB 1JI2A 5GS1A 1ORQA 1GOHA 1GRWA 3O2VL 4NRZB 2HFEB 3OXSA 3U9UA 1MRDH 2HFGH 1JPTH 3R1GH 3AS1A 4NRYA 5CEYA 4PJDF 5T1LB 2H32B 2VL5A 4LCYA 1EV2E 1EO8L 1D5ZB 3WNPA 3EOYG 3SDXE 1B6DA 3M8OH 4G43B 2KKQA 5E2WL 3U0PB 3ULSB 1FFNB 2AI0H 1XF4B 3QI9A 4Z7UB 1A4KA 4XAKE 3RY6A 3VMNA 4BK5A 5GS1C 1ZS8B 1N5YL 5FYJD 3MRLB 4HIJB 1NFIB 1RZJL 3O3BB 3SPVB 5D2LF 5KBNC 1LO2H 4KKBD 1ZE3C 3OKMA 2DM4A 4FQJL 4PRDA 1JGEA 2NY1B 3GI9L 4RGMB 1S7VB 2W9EL 4F3FB 1KNOA 1R3KB 2F54A 1PJ9A 4OGXH 1TETH 3RVUC 1NCAL 3ARQA 3P4MA 1NBZA 3DUHA 2NXYB 3NIFF 2AJVL 1CFNB 3CX5K 3HLAA 4FQXA 4LGRB 5KJRH 3IJYB 2AQ3A 3U9PL 3ZE1F 1RFDH 4XPHH 4F80A 1ORSB 3NH7H 1I7RA 1NCCL 3CLFL 1KPUB 4JZNA 2DJUA 2BSSB 2B5IC 4AIOA 3QFDB 5IKCB 3KPRB 2QR0B 2AKRA 3NPZB 4XCFL 3SE4C 5C0RL 4NCC2 4OZFG 1NSNL 1QTYT 1YMHA 1EEUA 3LPGA 4OM0H 5ALBH 1J1XH 4M9OA 3VXSB 4DUXA 5C7XH 1G7JA 4ZFFB 3HR5A 2EYRA 4HS3A 3OZ9H 4KZEL 3RU8H 1J8HD 2DS4A 1UCTA 5FO8B 5EU6B 2R2EB 1E4XH 3CXHJ 1BM3H 3OAUH 4JANB 1IMHC 4MD5A 3W5NA 2VQTA 1DQTA 4XNZB 2A6KA 3CDGA 2ZNXA 3RX5A 4JFFD 4YDIH 3VGDA 5IB3B 4M8QA 3RI5F 2N4IA 4YPJA 5C70A 1A4JB 3SKMB 2ZUTA 1T1YB 2CDGB 1FFQA 2A2QT 4XC1H 3E6FA 3BMWA 4M6NH 5D9SA 2MKWA 4F3FA 4HIHB 5EBWB 5JW4Q 3W2DH 3O81A 3WNOA 1JGEB 4UV4L 3WYRA 4H1LB 4XNMA 2FO1A 1A3LH 1A8JH 5IEKB 3O0RL 5GRZA 2J4WL 2X1PA 3NIDF 1FYTE 4NZRL 4BQ8A 4RAVA 1QLEL 2P1YA 4HG4J 2IH3A 2R0ZH 4LQFH 2WV3A 1N0LA 1AGBB 3DPBA 4FQIL 2W9DL 1C12B 4PJ9A 1QO3B 3HHRB 2C3GA 3MV9A 3BYYA 1YC8A 1ZHKB 5DWUH 1UKQA 4XAWH 2VR9A 3MRQA 2H3NB 5INCB 5BVJB 5LWYH 5DSCA 4Y4HB 4JDTH 3PABB 4H0IA 5FV1L 4H20H 1EAJA 2FZ3A 5DZLA 1WZ1H 3ARDD 5DS8A 4BELD 4ERSL 4XPFH 3ZZ1A 2V17L 2J88L 1J8HA 2DRUA 4GKNB 4MLIA 3TVMD 1HWHB 4D9RE 5BOZG 2APBA 4HT1L 3D5OF 1QYGH 2AAVA 4W6XB 1C5CH 1CLYL 4KI5C 4ONHA 5I16A 4DGYH 1RVFL 2V7HA 3VFOB 2XTJD 3VG0H 4TQEH 1I7ZB 4K3HA 3ILQD 3KWWB 5EC2B 5HYJD 4HHAB 1DL7L 4XPGL 4CVUA 2G2RA 3C5JB 3CSYA 5E6YA 3QAZB 4APQC 1WC7A 3NCFB 4X9FA 4JDZB 1HDMA 2XA8L 5MP6H 3ZHLA 1FC2D 2YMXH 3LKOB 4HJJH 4ELMB 2OMBA 4LSQH 5DMGD 3CFEA 3CSPA 3GEWB 2BVYA 4X6FB 5C9KA 2Z31C 3FT4A 3TBSA 1R3JA 4OCWL 1NFIA 1IEAB 2LU3A 1YEEL 1BBDL 5EG6C 4K3GA 1N59A 5IJKC 2FSEA 2DQGL 2X4PB 2FYYB 2QQLH 2HAZA 4L4JA 1LK2A 3JV6A 4ELMA 3WKML 1JUFB 2IPKB 4WHYH 3PWNA 3LKSA 5GS3A 3EOBA 3MLVL 4LSDA 5BVPL 1TVHA 4DW2H 4GXUN 3Q0HA 3NIGE 1NMCB 4M03A 4S1QH 1U41A 4LDEB 4NZDA 4WEMB 5JHDA 1AXTL 1I3UA 2WIIB 5D1XB 4I0PD 2WW8A 1KUMA 4TVPD 4J3XA 1W2KT 3ARZA 1JNNH 3MLTB 2EH7H 4M48H 3WIHL 2ZUYA 1I3RB 3QXTA 4KUZH 2CUHA 5DJ2A 4CW1B 1UJ3B 3QULA 2FWOB 3EYVB 4I9WE 2VIRB 5I15L 3EO1B 4Q6IA 2ZWLT 2MSPA 2YPKA 3VFMA 1ZAGA 1FG2A 4OKDA 4EEEA 4R7DA 1BJMA 5FUOH 5ID0B 1JWSA 3DVIA 4XNUL 5I71B 1MWAB 3CJJA 4M7LL 4MJIE 3V6BR 1U3HA 4YUEH 1YMMB 3G6DL 4G42B 2QHRH 2ZNWA 3HMXA 5MENB 1NGXA 15C8L 2UZYB 5T3XE 4HKXB 1A64A 3HN3A 1J86A 2H41A 1DP0A 3FCTA 1MCKA 3RNKB 3ZL4H 1NCBH 4ONGL 1OQXA 4JGUA 3N1MC 1OP3H 3IU3B 2B7DT 5LWYL 3MLRL 4JFQB 2PYFB 5GSVA 1PVHA 1CWVA 3W0WE 3U2SA 4JM2F 3HC3L 4E42B 3S36X 5DJ8A 1MVFA 1QR1B 5JDSA 3REWA 3UTSB 3WLWD 1VEOA 2W9DH 3VGGA 2L0DA 5GISL 1CL7H 4OLUH 3UYRH 4WFEE 2WINB 4HPYL 4RNRA 3K1KC 3QUKB 4ZQKB 1SJHA 1FCCA 1HH9A 3T0EE 4KK9D 4KHTH 3KYNA 3BP5B 4DQOH 1FLRL 2YPVH 1CIDA 5FDWB 3BDBA 2I60H 4FQ1H 3EYOB 3B8YA 4O2FB 5HBBA 3O2DL 2J8HA 5HI3D 4PBXA 1A14L 5HYSA 3H9ZA 3ARYA 3IF1B 4WW1B 4PJEB 1MFEH 3S36H 5LGJA 2VXTL 4XNQB 3BI9X 3CIQA 3G5XB 5TF1L 5TFSL 4CL7A 2EO1A 4LAQL 1FNEA 2Z8RA 2DMBA 1RIUL 2VAAB 3MODL 4CN6A 4XPHL 1RFDL 5DRXA 5LGJB 4Y4FC 1A6ZA 3DUUB 1PZUB 4S1RH 1G7QB 5D1ZD 4P2QE 2AV7A 2CUMA 4DTGH 4RGND 1AXSA 1FSKC 2AJ3A 1BZQK 4MSWB 4LEOA 3CSYB 3LVEA 2AJXL 4I0CC 4QYOB 4M7JH 4S2SA 5KVMC 4JO1H 3EDEA 1UYWL 2DDQH 2E8ZA 4XMLL 4BQBA 4NN6C 2EC8A 1D6VH 5IK3A 3GKWH 1H3TA 1AQKH 3UP1A 2IQ9L 2DIJA 4M62L 2VDNL 3IGAA 4JO2H 3SKUD 1CVRA 4DGIH 1YYLH 2CR6A 4ZNEA 3AU1B 3GJFK 3ROOA 4UOW0 2BX5A 3MQIA 5LG1A 3FHAA 4Y4KD 2GTZB 1NDMB 3WN5A 1Z9OA 4NQVA 4EJ1C 3EJZC 5I8OH 3ARFA 4U3CA 3HTLX 4P2CG 1C16A 5F9OL 3RL2B 4AM0B 4D0DA 1MLBA 1RIUH 3W2DL 5DLML 4UTBL 5HVGB 5EBLB 2VR4A 1OGAE 4HUNB 4QXUL 3VD4A 2NY2C 2YWZA 3MJ7B 1ZLUH 3T2QA 1TCMA 1XZ0B 1N6UA 2EIEA 3RKDD 3WS6C 4S0TD 2F8VA 1RQ5A 3KYMA 4DAGH 1I1YB 3P30H 4XX1E 3QISA 1LILA 4N0CD 4ZUWB 3P11L 3CXHK 2XPGB 3Q6GH 4HUKB 4CU7A 4EVNA 3FQTA 4D9QE 3VA2C 5HHMD 1J87A 5F3HB 4Y16D 1EX0A 4PJDA 1SJVA 3LMJH 5HDBE 5CAYB 4JJ5B 4E41E 3NTCL 3TPUB 3O3EB 4PJ9D 2EYTB 4XVJH 3B3IB 1MJ7L 3PWJA 4HSQA 3MNWA 3SEPA 1VADB 4M8VA 4U1SB 1KTDA 4M1CD 3HC3H 3T3PE 2VTFA 1HHGB 1QFUL 4DOHB 3GJFH 4GRLD 5TGBB 3AAZA 3IDGB 4L5FH 4LHUA 4RFOH 4ODHL 3ROOB 3MV8A 3ZL4L 4YAQB 3TN0C 2YBRA 3P40A 2OL3L 3VW3L 5I15H 2ARWA 2G5RA 2DQFA 1KTDB 3F12A 5BV7L 3MJ6A 5ADPH 2A73A 2FNBA 3CH1B 1HYSC 4UIMB 2NYYC 4XC3L 4AG4L 1ADQA 2DM7A 4LCUA 5DMJB 1KPRA 4JAMA 2JCCF 3QQ9D 3CDFA 1P7KA 2AK4A 3DI3B 2UY7A 2DYPB 3L3HA 4HD9A 4XNMB 1PG7W 2NY5C 1E6JH 5L2KB 4FMKA 4HF5L 4FQQB 5JOEA 5JTWA 1SJXA 4YHIB 4UNVA 2B4CC 1KCLA 1T1XA 4G8GE 2YEZB 3REVB 4OLVL 2VXTH 5JUEH 4W6WB 1AO7A 2CIIB 1BF8A 1Y0LA 2OI9B 5F88A 4L3ED 5JZ7C 5CJQL 2PTUA 3CMOH 3DVNB 5INDB 1JGVH 4KVCH 2GITA 4KHTL 1RZIB 1ZA3B 1YEEH 2JCCB 3D1MC 5DJCA 3T2NL 3TCLB 3P9MB 1BIIA 1CXEA 4PJAB 2WBKA 1RU9L 3O3BA 4XVUC 4G80A 2CLZA 1TXKA 3FB8A 4OI9A 2JF1A 1T5WB 2GAZB 3EFFA 5HXMA 4HS6A 4Z7WA 4JM2A 3JWOL 3NCBB 4QLRA 1QZ1A 5EZLB 3PQYA 2VLJA 1DE4B 3I50L 4ODUA 1M6OB 4U6YB 4DW2L 5J7CC 1I8MA 2VISB 5D7IF 3MRPB 2QR0A 1SQ2N 3BVNB 2V2TA 4NYLA 4I9WD 3QEQD 4WW2A 1ED3B 1H5BA 1FO0B 1LE5A 5IOPA 1NFKA 2XTJE 3FB7B 3PJSA 4RRPG 4U1MA 1F2XK 4G7VL 4PJHB 5LQBH 1EGJH 1MREL 4EOWL 1HWGB 4PRAB 3ZKXC 4ZXBD 2HWZH 5DC9B 5E9DA 2IAND 2X41A 3MRIB 3JWDH 4LVHC 5FUCE 1XIWB 3SDYL 1FDLL 1VGEH 4NNPL 3PG2A 4LASL 3WJLA 3ABZA 2AABL 4FTVD 2O5YH 4OCSH 1J0KA 2V7HB 4RFNC 3GHEH 3UPRB 5CBAB 3D39B 1AGFA 1FL3A 1G6RL 3TYGH 1ZS8A 3MLSH 4HT1H 1Q72L 4MJ6A 3LY6A 3QI9B 1FFRA 1KG0A 1JGUH 1MCHA 1KTLA 4ZUVA 5F88B 4HC1H 5D72L 3QWRA 5E08L 2XI9A 3QXAB 4LLDA 3F65A 2BSED 3UTTA 5F1IA 3WL9A 1JNNL 4ORGA 5K33A 1NMCC 5SWSA 2DQIH 2CLZB 1RZFL 2HT3C 4JQIH 5IB1B 1E6OL 4IMLA 5SV4A 3SDXF 3KPSE 3P30L 1BD2A 3VXUB 3UTQA 4QHKJ 3JWOH 4APQA 3DV6B 4BK4A 4FQXB 1ND0B 3ZT5A 2Z31B 3LRSA 3UJJH 3EJZD 3H3KA 1HKFA 4WI3A 4PJ8C 3DYOA 3IDJB 4PJHA 4OJFH 4A6YA 2OR9L 3HE6D 2J6EH 1WCBA 5I8CA 3QXDA 3SQOL 2NTFA 1CU4L 3QH3B 2AP2A 1YECH 2XWBB 1SM3L 3ULUL 2QQKL 3VXOB 4BQ6A 4PRPB 3F58H 1VEPA 5IB4A 3ZT6A 5E9DD 3SGJC 2V2WA 2QQNH 3G5ZA 3VFWB 3QIWD 2YD4A 4K94C 5IT2L 3QRGH 4XNXH 1S7SA 1WFNA 2GJ6D 3BE1L 1A6ZB 2P44B 1XIWD 1Y6NR 1UM5H 3DUUA 4TSAL 3UPRA 4GRWE 2P5ED 4G8EB 2XTJC 4GT7A 2DDQL 4XMLH 4HUMB 3RWCA 2RJMA 2CLVB 4HV8B 3O6KH 4GBXB 3S4SA 1C5BH 3BD5A 3MMEA 4P9HH 1I9IH 2J8UE 3I9GL 2Y5TA 1UZ8A 2WWKT 2C4XA 4KGLA 1JGUL 3BKML 5CSGA 1BAFH 3CMGA 4JM2D 4OF3A 3BT2L 4L3AA 3TBTA 4W70A 5ADOL 1FYTA 4L5FL 4RFOL 3GMOB 3DMMB 4G9DB 5F9DC 4P2QA 1A7PL 5ERWB 5I1EL 1LO4H 4N8PA 3MODH 1IE5A 1G7HB 1G7IB 5HHOD 1ZKAA 4QRTA 1LGVA 5J1AA 5IIEA 1WBZA 2A77H 2D4FA 5C3LD 1EFQA 2ENYA 3DHJA 2HWZL 3VXSA 1A21A 1ES0B 3P4MB 1J0IA 3C6SB 5B21A 1MJ8H 4BKLA 3MBEA 4OGXL 3HZYA 4XCYB 4KU1A 3DIFA 5D1ZB 2W60B 4XZUA 1ZHKA 3J8F7 1RMFL 3B2VL 1WBYA 5DD0H 3RTQB 3U4EB 3BQUA 2P7TA 4PJ5A 3DRQA 4G3YL 1I9RH 2D7MA 3CVHH 1T03L 5KTEL 2A0LD 1VGKB 4ZXBC 1RY7B 4WDIB 4ESKA 2XFXB 1QEWB 4FXGB 2ADGB 3OJMB 1CL7L 4OFYD 3VFWA 3T3ME 5D6DA 1QSFD 1MAML 2OTWB 2KDGA 1P4LB 1A1MA 3QCUL 3S5LB 4S2SB 2MOVA 3KGRA 1S9WA 5F7DA 3I02B 3A67H 4JG1L 4OV6F 5DMIL 2C5DC 4PLKC 1OAQL 4PLKD 1SEQL 5E56A 1RZFH 2A38A 4XPTL 3TO4D 3HFML 4TOYH 4JFHE 1WAAF 1JGVL 2E9WA 4U31A 4K7FB 5IB2A 5HPOA 3DV4A 3IKCB 5I1GH 4JHWH 5HHXH 5JW5A 4U1IB 3GJFA 5IMMB 1H8OA 5SWZE 3TYGL 3VFRB 4JN2B 5KVFL 4MNGE 3WS3B 3HE7A 4MX7A 3B9KA 1EJOH 2PTVA 1RVFH 1S7UB 1JL8A 3GSUA 3WL9B 4ETQB 2BNQB 5DR5H 3H9YA