5DAYA

The structure of nap1-related protein(nrp1) in arabidopsis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
207
structure length
172
Chain Sequence
SNLEQIDAELVLSIEKLQEIQDDLEKINEKASDEVLEVEQKYNVIRKPVYDKRNEVIQSIPGFWMTAFLSHPALGDLLTEEDQKIFKYLNSLEVEDAKDVKSGYSITFHFTSNPFFEDAKLTKTFTFLEGTTKITATPIKWKEGSFFTWFTHDEVADIIKEDLWSNPLTYFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAP1-related protein 1
publication title The structure of NAP1-Related Protein(NRP1) in Arabidopsis
rcsb
source organism Arabidopsis thaliana
molecule tags Chaperone
total genus 60
structure length 172
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 5dayA02
3HFDA 3GYWA 3GYVA 3FS3A 5DAYA 2E50A
chains in the Genus database with same CATH superfamily
1E33P 4N7ZA 3GYWA 4N7VA 3P36A 3RQ7A 3P35A 2N19A 1E1ZP 4FDIA 4HCOA 1E2TA 3LXQA 1FSUA 4HY2A 2QZUA 5DNJA 4DFWA 4FDJA 4H5XA 3LM3A 4O6WA 3HFDA 3FVHA 3HMJG 5J19A 1A87A 4CXKA 4X9WA 4HABA 4E9CA 2OJXA 4WHKA 2I9ZA 4WHLA 4J7BB 4N9JA 4O9WA 4G7NA 2UV8G 4CYRA 4E67A 4E9DA 4CXUA 4NKBA 1Q4OA 2I9XA 4WHHA 3C5LA 3BZIA 4X9RA 5DMSA 4LKLA 1E2SP 4CXSA 1N2KA 1AUKA 3Q1IA 4RS6A 1F34B 2E50A 1Q4KA 4LKMA 4XB0A 4NK7A 4H71A 1P49A 4YYPA 4O56A 5DAYA 3P2ZA 1HDHA 1N2LA 3P2WA 5AJ9A 4CYSA 3FS3A 3P37A 5LHZA 4X9VA 2OGQA 2VKZG 3P34A 1E3CP 3HIKA 3HIHA 1F32A 5DMVC 3GYVA 2IA9A 4RCPA 1UMWA 3KDRA 3ED4A
chains in the Genus database with same CATH topology
4NKBA 1E33P 4N7ZA 3GYWA 1P49A 4NK7A 4N7VA 4FDJA 5DAYA 3LM3A 3HFDA 1HDHA 1N2LA 5AJ9A 1E1ZP 4CYSA 3FS3A 3HMJG 4CXKA 4FDIA 1E2SP 4CXSA 1N2KA 2VKZG 1AUKA 1E3CP 1E2TA 2E50A 3LXQA 1FSUA 4N9JA 3GYVA 4G7NA 2QZUA 2UV8G 4CYRA 3KDRA 4CXUA 3ED4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HFD A;  3GYW A;  3GYV A;  3FS3 A;  5DAY A;  2E50 A; 
#chains in the Genus database with same CATH topology
 1E33 P;  4N7Z A;  3GYW A;  4N7V A;  3P36 A;  3RQ7 A;  3P35 A;  2N19 A;  1E1Z P;  4FDI A;  4HCO A;  1E2T A;  3LXQ A;  1FSU A;  4HY2 A;  2QZU A;  5DNJ A;  4DFW A;  4FDJ A;  4H5X A;  3LM3 A;  4O6W A;  3HFD A;  3FVH A;  3HMJ G;  5J19 A;  1A87 A;  4CXK A;  4X9W A;  4HAB A;  4E9C A;  2OJX A;  4WHK A;  2I9Z A;  4WHL A;  4J7B B;  4N9J A;  4O9W A;  4G7N A;  2UV8 G;  4CYR A;  4E67 A;  4E9D A;  4CXU A;  4NKB A;  1Q4O A;  2I9X A;  4WHH A;  3C5L A;  3BZI A;  4X9R A;  5DMS A;  4LKL A;  1E2S P;  4CXS A;  1N2K A;  1AUK A;  3Q1I A;  4RS6 A;  1F34 B;  2E50 A;  1Q4K A;  4LKM A;  4XB0 A;  4NK7 A;  4H71 A;  1P49 A;  4YYP A;  4O56 A;  5DAY A;  3P2Z A;  1HDH A;  1N2L A;  3P2W A;  5AJ9 A;  4CYS A;  3FS3 A;  3P37 A;  5LHZ A;  4X9V A;  2OGQ A;  2VKZ G;  3P34 A;  1E3C P;  3HIK A;  3HIH A;  1F32 A;  5DMV C;  3GYV A;  2IA9 A;  4RCP A;  1UMW A;  3KDR A;  3ED4 A; 
#chains in the Genus database with same CATH homology
 4NKB A;  1E33 P;  4N7Z A;  3GYW A;  1P49 A;  4NK7 A;  4N7V A;  4FDJ A;  5DAY A;  3LM3 A;  3HFD A;  1HDH A;  1N2L A;  5AJ9 A;  1E1Z P;  4CYS A;  3FS3 A;  3HMJ G;  4CXK A;  4FDI A;  1E2S P;  4CXS A;  1N2K A;  2VKZ G;  1AUK A;  1E3C P;  1E2T A;  2E50 A;  3LXQ A;  1FSU A;  4N9J A;  3GYV A;  4G7N A;  2QZU A;  2UV8 G;  4CYR A;  3KDR A;  4CXU A;  3ED4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...