5DAYA

The structure of nap1-related protein(nrp1) in arabidopsis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
207
structure length
172
Chain Sequence
b'SNLEQIDAELVLSIEKLQEIQDDLEKINEKASDEVLEVEQKYNVIRKPVYDKRNEVIQSIPGFWMTAFLSHPALGDLLTEEDQKIFKYLNSLEVEDAKDVKSGYSITFHFTSNPFFEDAKLTKTFTFLEGTTKITATPIKWKEGSFFTWFTHDEVADIIKEDLWSNPLTYFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAP1-related protein 1
publication title The structure of NAP1-Related Protein(NRP1) in Arabidopsis
rcsb
source organism Arabidopsis thaliana
molecule tags Chaperone
total genus 60
structure length 172
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 5dayA02
5DAYA 3GYVA 2E50A 3FS3A 3HFDA 3GYWA
chains in the Genus database with same CATH superfamily
4CXUA 3HMJG 4CXKA 3ED4A 1AUKA 1Q4KA 4H5XA 1E33P 4X9WA 4X9RA 3P37A 4HABA 3GYWA 4CXSA 5DMSA 3HIHA 3KDRA 3P36A 4NK7A 5AJ9A 4NKBA 4H71A 2VKZG 2OGQA 4DFWA 4N7ZA 1E2SP 3HIKA 1UMWA 2I9XA 4YYPA 2IA9A 4WHKA 1N2KA 4CYRA 1Q4OA 4O9WA 5J19A 1F32A 1F34B 5DAYA 2E50A 2I9ZA 3GYVA 2UV8G 4N7VA 3FVHA 3Q1IA 1HDHA 3FS3A 3LXQA 1E2TA 4RS6A 5LHZA 4N9JA 1P49A 3P2ZA 4HY2A 2QZUA 1N2LA 4E9DA 2OJXA 3BZIA 4G7NA 3LM3A 5DMVC 3P34A 4CYSA 4X9VA 4O56A 3C5LA 4O6WA 4FDIA 4LKMA 4E9CA 1A87A 1FSUA 3P2WA 4WHHA 1E1ZP 4RCPA 3P35A 4FDJA 3HFDA 4XB0A 4WHLA 4HCOA 4J7BB 4E67A 5DNJA 3RQ7A 2N19A 4LKLA 1E3CP
chains in the Genus database with same CATH topology
4CXUA 1HDHA 4N7ZA 1E2SP 4CYSA 3FS3A 3HMJG 4CXKA 3ED4A 3LXQA 1AUKA 4FDIA 1E2TA 1E33P 4N9JA 1FSUA 1P49A 1N2KA 3GYWA 1E1ZP 4CYRA 2QZUA 1N2LA 4CXSA 4FDJA 3KDRA 3HFDA 4G7NA 5DAYA 2E50A 3GYVA 3LM3A 4NK7A 5AJ9A 2UV8G 4N7VA 4NKBA 2VKZG 1E3CP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAY A;  3GYV A;  2E50 A;  3FS3 A;  3HFD A;  3GYW A; 
#chains in the Genus database with same CATH topology
 4CXU A;  3HMJ G;  4CXK A;  3ED4 A;  1AUK A;  1Q4K A;  4H5X A;  1E33 P;  4X9W A;  4X9R A;  3P37 A;  4HAB A;  3GYW A;  4CXS A;  5DMS A;  3HIH A;  3KDR A;  3P36 A;  4NK7 A;  5AJ9 A;  4NKB A;  4H71 A;  2VKZ G;  2OGQ A;  4DFW A;  4N7Z A;  1E2S P;  3HIK A;  1UMW A;  2I9X A;  4YYP A;  2IA9 A;  4WHK A;  1N2K A;  4CYR A;  1Q4O A;  4O9W A;  5J19 A;  1F32 A;  1F34 B;  5DAY A;  2E50 A;  2I9Z A;  3GYV A;  2UV8 G;  4N7V A;  3FVH A;  3Q1I A;  1HDH A;  3FS3 A;  3LXQ A;  1E2T A;  4RS6 A;  5LHZ A;  4N9J A;  1P49 A;  3P2Z A;  4HY2 A;  2QZU A;  1N2L A;  4E9D A;  2OJX A;  3BZI A;  4G7N A;  3LM3 A;  5DMV C;  3P34 A;  4CYS A;  4X9V A;  4O56 A;  3C5L A;  4O6W A;  4FDI A;  4LKM A;  4E9C A;  1A87 A;  1FSU A;  3P2W A;  4WHH A;  1E1Z P;  4RCP A;  3P35 A;  4FDJ A;  3HFD A;  4XB0 A;  4WHL A;  4HCO A;  4J7B B;  4E67 A;  5DNJ A;  3RQ7 A;  2N19 A;  4LKL A;  1E3C P; 
#chains in the Genus database with same CATH homology
 4CXU A;  1HDH A;  4N7Z A;  1E2S P;  4CYS A;  3FS3 A;  3HMJ G;  4CXK A;  3ED4 A;  3LXQ A;  1AUK A;  4FDI A;  1E2T A;  1E33 P;  4N9J A;  1FSU A;  1P49 A;  1N2K A;  3GYW A;  1E1Z P;  4CYR A;  2QZU A;  1N2L A;  4CXS A;  4FDJ A;  3KDR A;  3HFD A;  4G7N A;  5DAY A;  2E50 A;  3GYV A;  3LM3 A;  4NK7 A;  5AJ9 A;  2UV8 G;  4N7V A;  4NKB A;  2VKZ G;  1E3C P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...