5DB4A

Mycobacterium abscessus nadd in complex with mg-atp, space group i41
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
197
structure length
179
Chain Sequence
RRRLGVMGGTFDPIHNGHLVAASEVADRFALDEVIFVPTGQRKVSPAEHRYLMTVIATASNPRFTVSRADIDRGGATYTVDTLTDLRTAHPDADLYFITGADALASILSWENWEQLFTLAKFIGVSRPGYELSGLSLVEVPALAISSTDCRIRAGQARPIWYLVPDGVVQYVAKHRLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium abscessus NadD in complex with Mg-ATP, space group I41
rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
molecule keywords Nicotinate-nucleotide adenylyltransferase
total genus 59
structure length 179
sequence length 197
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5db4A00
4A91A 2A7XA 4MUHA 1KP2A 3UK2A 4G5FA 2J08A 2WQ7A 4ARIA 4H3SA 3TQIA 2BYTA 2Z3VA 3FH0A 4MVWA 3CLRD 1ULHA 3ISJA 5KCMA 3PXUA 4MWCA 1O95D 3OTWA 3IODA 1WY5A 4MUNA 1QRUA 1QRSA 4ZCSA 1Q15A 2CYCA 5FO1A 3CVYA 1IH8A 3FWKA 2CYAA 4K0RA 1JILA 4G6ZA 1HYBA 2R5WA 4ZCPA 1KQNA 4MW7A 3ILVA 3P0IA 4R2MA 1U7DA 4MW4A 4YBRA 1NURA 1S4MA 1NP7A 4ZCQA 1N2JA 1O94C 5DB4A 4PBSA 1N2BA 3M5WA 3RHSA 2DPLA 4PY2A 3H99A 3DV2A 1PFWA 3CLSC 3IVCA 1K4KA 1WJGA 2DERA 1NUSA 3N05A 4MW1A 1H3NA 2PG3A 2D13A 2JANA 3LOQA 1JEDA 1KKUA 3N2YA 3COVA 3U1VA 4QBTA 1M8KA 2PIDA 1T6XA 3AG5A 3PNBA 3KFLA 4XSVA 3UC5A 1GPMA 1TEZA 2GOYA 2NZ2A 4XFDA 1OWOA 1OWLA 3IMGA 4CDNA 2C5SA 1WXHA 2CV0A 1QTQA 4MAFA 1KH3A 1MAUA 1JIIA 1J20A 2A4MA 4U7JA 2D5BA 4ND7A 4TS1A 1TYCA 4EGAA 3ND5A 3TNJA 4YP7A 3HFJA 4DDMA 1OBCA 2ZUFA 1KH1A 1EUQA 4U63A 1YULA 3ZJUA 1YUNA 1OD6A 1WQ4A 1M1ZA 2JAXA 1G8FA 1KAQA 1YIDA 3IMEA 1T6YA 1GTRA 1ILEA 1PFVA 1O0BA 2H2AA 1U3CA 4R0NA 5IHXA 2YXNA 1O97C 4MVCA 4MUKA 4F3RA 3GLVA 1SURA 2Z09A 3H05A 3P52A 2DLCX 3MLAA 2QJOA 4XFJA 2V0CA 2QUIA 5DASA 3QTBA 4JZYA 1NSYA 1EFPA 5J58A 4CT0A 4RUKA 3CLSD 5K0TA 4J75A 1T6ZA 2QTNA 3VU8A 3ND7A 4MULA 2QJFA 1NYLA 1H3EA 3A05A 1XNHA 1WOYA 1I6KA 1JHDA 1JGTA 1F9AA 4NAUA 1I6MA 3LE8A 1YUMA 1P7PA 5TEVA 5EKDA 2DR2A 2VTBB 1N2HA 2WSIA 1MRZA 3G6KA 2YWCA 3IUEA 3FG9A 2A86A 5KWVA 4UZFA 3HV0A 3F3MA 1ZJWA 3SYTA 1LW7A 2PZBA 1U7XA 4KR6A 4DJAA 3SEZA 2PXHA 4F4HA 4BWVA 1A8HA 4HK4A 3HL4A 1R6TA 1F7UA 3X1KA 1Q19A 3BL5A 5DK4A 1B6TA 3D6UA 1I6LA 4JXZA 3P0JA 1M8FA 4QRDA 2Z08A 3QTTA 1D2RA 3HGMA 1QU2A 3CLRC 3OP1A 4MVXA 2CFOA 2O8VA 3A4IA 5LM3A 1N75A 3AG6A 3IOBA 3L92A 1JEEA 3CVXA 1VL2A 5H16A 1WQ3A 3RFFA 4MQ6A 1M8JA 4S1OA 1OWMA 1U3DA 3G59A 3FETA 1H3FA 3CVVA 3MLBA 3E27A 1G59A 3MUEA 4YP6A 1WZ2A 2YWBA 2HGZA 1M8PA 1T9GS 4DLPA 3KT6A 2OQ2A 1PG0A 2I1LA 4UZEA 1H1TA 2QJTA 1O5TA 4CDMA 4EF6A 3I05A 3ZXSA 4MLPA 3S3TA 4WNYA 4RPIA 1N2OA 4KKVA 3VRHA 4MW0A 2BTEA 4GRIA 4I6EA 1GTSA 4L2IA 5FNZA 1N1DA 4I6GA 4DDKA 1MB9A 5H7XA 3Q10A 3AFHA 3PNYA 2X1LA 5DEOA 3FNRA 1O94D 3AL0C 3FIUA 3HZRA 2A1TR 1J70A 3IVGA 2EL7A 1QJCA 3HMQA 4E1AA 3ZXIA 4NX2A 2JA2A 4PBTA 4CQNA 1MJHA 2D54A 3FI0A 5TGTA 5BNZA 3MXTA 2CUZA 4I6JA 3ZGZA 3K32A 1IQRA 1JIJA 1G8GA 2A84A 1ZH6A 4J76A 1GLNA 2ZUEA 3TQOA 1N2EA 4AS1A 4NZPA 1Q11A 4EG5A 3P0HA 3CVUA 4KPUA 1I2DA 3RJZA 4Q93A 4OUDA 3DPIA 1IFXA 4MWEA 1V8FA 3C8ZA 4ARCA 2IELA 1WXFA 3G5AA 3A04A 1Y42X 1PG2A 2PFSA 1XNGA 2VXOA 1QU3A 4JFAA 2NSYA 4EG3A 2WQ6A 1J1ZA 3TZEA 1JIKA 1EFVA 1K92A 4MVYA 1JECA 1O6BA 4MW6A 2E0IA 1K97A 3FOCA 3X1JA 1M8GA 4ZT6A 3K9WA 5HUHA 4P2BA 1VBKA 2J5BA 2DETA 1OBHA 2X3FA 4EG7A 4MW5A 2CSXA 1O95C 1NUPA 1N78A 1TQ8A 3DO8A 1EXDA 1BS2A 1KP3A 2CYBA 3FY4A 2X1MA 2AG6A 2RE8A 5J59A 3IH5A 3RK1A 1O96A 3IOCA 2X0KA 3L93A 2VTBA 1EJ2A 3IUBA 4EG4A 4K03A 1ZH0A 1QQTA 1NUQA 2QUKA 3FHJA 2TS1A 2XRYA 2E21A 2A1TS 3AIIA 3UMVA 3QE4A 5HG0A 2V0GA 3IOEA 2J4DA 3H9BA 1NUTA 5JBNA 2PZ8A 1WXIA 1DNPA 4YMIA 4KR7A 2G36A 1M83A 1QNFA 4ND6A 1N77A 1EUYA 1J09A 2XRZA 4ZT5A 2DEUA 2E18A 3NBKA 1YIAA 1GZUA 2GM3A 3KT8A 3N8HA 3RK0A 4ZCTA 4AQ7A 5J5AA 4ZCRA 2ZP1A 3TZLA 1UFVA 1VLHA 3CLUC 3CA8A 3SZ3A 3JXEA 1IRXA 1KQOA 5AHWA 3ELBA 3COYA 4YP5A 3KT3A 4GU5A 1JZQA 1J21A 1GN8A 1TYDE 4HPWA 2GKSA 4OJMX 1TYAE 1MAWA 1GAXA 4MUJA 1EFVB 3PNVA 1ZUNA 3ZJTA 1JZSA 2QTMA 2PZAA 2CT8A 2B7LA 1KAMA 2QUHA 2QTRA 4EG6A 3CLTC 3CR8A 4NAHA 3TS1A 4JYZA 1JMVA 4PBRA 3SZGA 3AKZA 4OUDB 1FYDA 3IVXA 4Q16A 1RQGA 1KH2A 1G8HA 3X1MA 2HMAA 3MMXA 3ZUGA 1N3LA 3KT0A 4L2IB 2CV2A 2WB2A 2AZXA 3ND6A 1WXEA 2A88A 4HJRA 3VGJA 1J1UA 3COWA 2A1UA 3UY4A 1KQPA 4MUIA 5F23A 4ZT2A 3IDFA 2AKEA 3SP1A 3IMCA 2RD2A 1X8XA 4R2LA 3SEQA 4MUEA 1T9GR 3PRHA 4MW2A 5TEWA 4EG8A 1VBMA 1IVSA 3N9IA 3FDXA 1EFPB 3Q12A 4ZT7A 2J07A 1N2GA 3D6VA 4EFKA 2OV4A 1U0BB 1O96B 1PFUA 1NUUA 1XNJA 1OWNA 1VBNA 3H9CA 1EE1A 2IP1A 4G5YA 3DLAA 3INNA 4QREA 1LI5A 4MUGA 4DNXA 3NBAA 3GUZA 4FZJA 2HZ7A 1KORA 3ZJVA 2IJGX 1OWPA 4NATA 4EG1A 1O0CA 1YI8A 2O5RA 1R6UA 1K4MA 1O97D 5KHAA 5K0SA 3COZA 1MB2A 2J09A 1PFYA 1NI5A 4X0EA 5TS2A 4MW9A 2E89A 2H29A 2CV1A 4U8HA 1COZA 1IHOA 1QRTA 1MOPA 4ZT4A 4DDHA 3CLTD 1NZJA 1X6VA 2DUMA 4HJXA 4JXXA 5HUJA 1MC1A 4WSOA 4MUFA 1XJQA 1CT9A 3GMIA 1IQUA 2EJCA 2A1UB 1TYBE 5LLTA 2DXIA 3CLUD 4NDAA 4ZT3A 3A2KA 3H97A 3NV7A 3UOWA 1FFYA 1WXGA 1Q77A 3RBAA 5FO0A 5LFAA 1TFUA 1V47A 3CVWA 1N2IA 1IQ0A 1MBZA 3Q4GA 2YY5A 1KR2A 4MWDA 4MWBA 1R6XA 1F4LA 5IJXA 4KR9A 3ZIUA 3LCJA 1WKBA 1F7VA 2QUJA 4KPUB 3SDBA 4DE5A 1LI7A
chains in the Genus database with same CATH superfamily
2VAMA 4W1QA 3UJDA 4RLQA 1E9AA 2W8ZA 3OFND 5C8VA 2C7PA 1OB2A 1P45A 2R4TA 4IZOA 3OZEA 1HOTA 3ML1A 3KZCA 1KZYC 1ZIXA 4N9QA 1U8FO 4OJKA 4GPZA 1WUIS 3NO4A 4KQ1A 2PAAA 4ZAGA 4AC9A 1B3BA 3CLRD 3O1LA 4AF8A 4C7BA 2VXYA 3Q3IA 3PXUA 2R2AA 3KYCA 3MLEA 1TJ5A 2B5OA 2AXEA 2YMMA 1SD2A 3OEWA 7REQB 3DEIA 2ZE5A 4IGKA 4MUAA 4GPIB 3UFBA 3ZWNA 1BS1A 3GJ3A 3T7CA 3B36A 1WKCA 3PXAA 1V48A 3ZHYA 1Z5GA 5H68A 5TJ9A 3VR2A 3JQCA 4YAJA 1A7UA 2LV8A 3CVYA 4KSCA 4B0OA 3JYLA 2CYAA 3LGSA 3I37X 1RZRD 4IDCA 2AJBA 2YXEA 3OZSA 4TQGA 3QKUA 3GP5A 4G8JA 5FXMA 1MQ9A 4B4OA 1KEKA 1Z6TA 3O73A 4S04A 4C0XA 1RS0A 5JI3E 1VE1A 3GAFA 1PGQA 2HHLA 1KY2A 3FI9A 1L8QA 3KR2A 5F12A 4EABA 4KP7A 1NJ6A 1VJ0A 3AM4A 1V11A 4IQ4A 2WWGA 1UBOS 1A9OA 1JALA 1JVNA 3O2NA 3RHSA 5CB6A 3U6KA 4K26A 1K4KA 3QRWA 4EJ6A 1FDSA 2DJ5A 2BGIA 5F4BA 5AVWA 1SIBE 1NRIA 4KJZA 4DABA 3STHA 2FEKA 1J0DA 3F49S 5JNLA 1DC3A 2P9FA 3LXUX 3RFVA 1PZXA 2O8BA 3IAM6 3K0CC 3RFXA 3OOHA 4YYEA 2IODA 4WD3A 5T4FA 4ZI2A 5I51A 1ZJZA 1FP4A 5HBGA 2VK4A 3BHNA 1EDDA 4IIDA 4DIKA 1U1IA 3A2MA 2YFYA 1L4EA 3JS5A 4BRUA 3FOZA 1JFRA 1RZUA 3DCNA 3ZWQA 1D6MA 4TV9A 1DT3A 1LLUA 3PUWA 4JB2A 1RHKA 1JDZA 1X86B 3JRWA 5D6OA 1JFTA 3ZZ1A 1WP9A 1LNZA 1QIIA 1XDUA 4JGBA 1NU6A 5IU6A 1L5WA 4YCMA 1FZQA 2I3AA 4UHDA 1QB8A 4FIZA 2AE2A 3M49A 3Q6IA 3PHIA 3KM0A 3PKIA 1XRPA 5A3QA 1HO3A 3VZCA 4G67A 1XOIA 4R9NA 3ZOZA 5LOVF 5C80A 2W6CX 1Z4QA 1T8WA 1WQ4A 2J3IA 3C24A 3DBIA 3THXA 3KS9A 1UFQA 4I9GA 3E35A 1QBGA 1X1AA 4M88A 2WIKA 1FMLA 4XI9A 1WMDA 3GCDA 3SZLA 4CYMA 1O0BA 2Z5VA 1SQGA 1O97C 1X3LA 2OVBA 2AUMA 4MLCA 5AVOA 2FRDA 2BCGY 4QDJA 3WKAA 4INPA 2O7NA 2X5KO 3NHBA 2CNNA 3I6BA 4V3BA 5KNBD 1YQ9A 1QDUA 1VRWA 1EFDN 1XCLA 2HOQA 3HYSA 1RLMA 2V0CA 3ABZA 3NEYA 4Y2XA 3SK0A 1DFGA 1MHTA 3ZDRA 3RABA 4P7KA 4QELA 3I34X 5BQPA 3O4FA 5IJ9A 2VPXA 3H2IA 4NPCA 4RUKA 1WQ1R 2HFJA 4Q47A 5K8CA 4O4IA 1XL1A 1T6BY 3K8ZA 3ZBUA 1MH9A 3U4DA 2REXB 3PT9A 3KZMA 4D02A 3CZ9A 5T6BA 1U7OA 1RLIA 1XQVA 3WBKA 2H52A 1ZXXA 1VYHA 1GV1A 2PUVA 4PZYA 3AGPA 4Q7EA 3R23A 4FCCA 4BRWA 1JE0A 1OZHA 3KLPX 1D1SA 1LPOA 4UBMA 5E8RA 4EHLA 4WZAE 1Y7LA 3H4IA 1CPYA 2TMDA 1RVDA 5TEVA 1MEOA 3CUSA 5EE1A 3S1AB 3WNDA 2WIDA 3I0ZA 3G6KA 1FFDA 1VIYA 4YH1A 3JQGA 2C4UA 4HFNA 4RVFA 4FZ3A 3VGPA 5KWVA 2IH2A 1KE1A 1G5TA 2FDXA 3CX4A 5T67A 2OSBA 3BZBA 1P0PA 1CYDA 2LRHA 2WILA 1FDWA 2IWHA 4M83A 4TZ6A 3K9HA 3F3MA 1R16A 4MEJA 1T8RA 1ZITA 2GF0A 2JGAA 1F3LA 4RF4A 1LW7A 1LPMA 4RAQA 2O5VA 1SCJA 4UZSA 4RPKA 4F9GA 4HUTA 3KYCB 4JR1A 1EWVA 4IQFA 1NHWA 3LCUA 2PKQO 1XJ0A 2RAPA 4HOYA 2DQYA 3DSRA 4X3CA 1IG3A 4CQMD 3P7MA 2EP5A 4E4TA 5IJ0A 4RDHA 4R05A 3DDOA 1F7UA 5KNCA 1J49A 2ZAYA 3ZNNA 4WKOA 1JFVA 3FCCA 3D02A 4HH4A 3DLBA 2VIIA 2XUIA 2HNAA 4D8XA 5K0LA 1AKWA 1T2VA 4OK6A 3RO7A 1QIMA 5ECDA 2Q0SA 2XNDA 1Y6ZA 1XE3A 2VJQA 4JEHA 1OASA 2WNHA 3G5LA 1WPQA 3LXXA 4QRDA 2KPOA 5DNUA 4X64B 5K8IA 4Y9UA 1GFSA 3L1VA 3RRXA 1OUMA 2X58A 2XMCA 3DTVB 5K1ZA 5CCDA 3WNZA 5LM3A 4L6AA 3IRVA 3NVDA 4UPDA 2B2XA 4HWKA 3EMDA 1U0OC 2AR9A 5H70A 1WUKS 2HWWA 2BFDB 2QD4A 3GXOA 2QG4A 4PGFA 3PPWA 4RZ2A 4W1RA 3H3FA 4XDHA 5A7GA 3WZMA 3PUXA 4L73A 4F46A 2G0TA 3DCIA 1U3DA 2BCEA 4PANA 1QYVA 2ZS8A 3OAAA 4FYWA 5FP0A 2WYHA 3L7IA 5GGYA 1E79A 2P6RA 3FM9A 4RIIA 1XG5A 2CD7A 3L7BA 1FFCA 3WV5A 4DLVA 4HEA1 3CV3A 4NRDA 4RH1A 4D9KA 1G5FA 3LHKA 1Q0HA 2C7GA 3HVIA 1QZXA 5DH9A 3VI3B 5AHOA 1FC0A 4DR5B 4A0RA 3JPYA 4HX2A 1I9GA 2EKLA 4HSEA 3VR3D 3T15A 5BVHA 1NF3A 5C1BA 1FQJA 1PK7A 4YQFA 1TT5B 3EG9A 4QL3A 2I2XB 4AJNA 3I6ZA 1RM5A 2PX8A 1TCBA 4WVLA 3B1XA 4F4UA 1OXXK 2HPZA 1DZ3A 2CY0A 1XUOA 4W6ZA 2VDRB 3I5MA 1SULA 1YDWA 1KWGA 1BU8A 3EXEB 1AKNA 2PL5A 3D4IA 1YR2A 4D8YA 1O5IA 1ZK0A 3M4YA 4D56A 3PNYA 2OAP1 3V7YA 1SBNE 3I83A 2OOKA 2PXAA 2E7ZA 4AJ9A 1Z0DA 5B2ZA 2PH1A 1FUEA 4YYZA 1XTKA 1TZKA 4E1AA 2DPMA 3ZXIA 3U7JA 3AIOA 2XMPA 2CDNA 2NYRA 4M7RA 2OB1A 2HXYA 2OUKA 5A5VA 4LJ9A 5BNZA 4TRRA 1JDVA 2OYSA 2X15A 4CLHA 4W8GA 2J9RA 1R9MA 5F21A 1U5BA 2VDQB 1IQRA 3HBNA 3JASB 1SZPA 2A84A 3WTCA 3ROMA 4EK9A 1NNUA 4H0CA 4TOIA 3LW7A 4KNYA 5DEIA 3RLIA 3HSYA 3TO5A 1IXKA 4Q9AA 2LTAA 4HNRA 1VJ1A 4CMBA 4NZPA 5I8WA 3BORA 2G40A 1H6AA 2OXTA 5EJ9A 4PLPA 4PNZA 4R84A 5IJ9B 4B3RB 4DR2B 4P34A 2NUPB 1Q7TA 1R9JA 2PKQP 3L1JA 4PLCA 1XDZA 3V1MA 2RI6A 1I2DA 4P2GA 5COAA 4Q93A 3OCXA 5H9VA 1G3QA 2EGHA 4I55B 4RY2A 1NW6A 2QTZA 5HILA 2GZ2A 1Q6ZA 3T0IA 5IANA 5FA6A 4EUFA 3V1KA 1QYRA 2E1PA 3W6UA 4PXSA 3E53A 4MH0R 3FIJA 4CIBA 2Q3HA 2QE6A 4LOHA 4X20A 1E2LA 3IUQA 2RGDA 4QBKA 3ZZMA 4DMHA 7GPBA 1D9ZA 1MAHA 1T9AA 3LNCA 2R86A 4HQKA 2K87A 3ZJ4A 4FWIB 2VH2A 5HK8A 2VF7A 3UJ7A 1EFVA 4TQ9A 1IUKA 4OXXA 3RFCA 1ICEA 3SAJA 3DL7A 2R1VA 2GN2A 2YXBA 4C4PA 5AVZA 1DBQA 4GW3A 4C88A 4YJ3A 5EHGA 1RIFA 5IC5A 4A0HA 4BP9A 1SKYE 3KSAC 4WY5A 1OH6A 3ZWYA 3QVUA 4BU1A 1KY3A 4BGUA 1UBFA 3GH1A 5CVVA 5AKLA 4KG7A 3GPCA 1OBHA 4MLDA 1RJ9A 2JC3A 4X6YA 4CKEA 1DWQA 2G6BA 4MWOA 4GUAA 1NAHA 4L16A 1TQ8A 4LHSA 5CH8A 2AN9A 2ERCA 2I3GA 4YRPA 4AJPA 2X5XA 2VATA 4HVLA 3AUFA 3DOUA 3QXHA 2W8BA 2X0KA 3L93A 5KYGA 4JI7B 2BGGA 4C2TA 2AYYA 1G5IA 1MFZA 5JFGA 3QFHA 2EZTA 2Q1XA 3GW8A 1DP4A 1ZH0A 1PZGA 3GEGA 1PTKA 4LJ4A 3M83A 2OHVA 2XRYA 3SLGA 4BLQA 4AQDA 3AK4A 1WX1A 1T5LA 1AU9A 2EDCA 3IOEA 1PJRA 3KDSE 2LP4Y 3QE4A 4HDAA 2FGKA 3ELYA 1E62A 4QLAA 1H1DA 2Y1CA 1UC9A 1YB1A 2V7VA 1SOMA 2VLBA 2DKFA 1RJGA 3P9YA 5B58C 3U81A 3AR9A 4J4TA 4DY6A 2D62A 3HU5A 3B60A 1K98A 4IV0A 1EZ1A 1USGA 1G5RA 1NVAA 4IS2A 2NSJA 1BWPA 1LRKA 4CF3A 3QEMA 4K9RA 4E88A 3IHKA 4QHTA 3RK0A 1EINA 1CD5A 3SZOA 1B73A 3M7IA 5DM1A 3HEMA 4Y6PA 4WLNA 2Q5HA 4RPJA 4MRRA 1ABBA 1CVRA 5B3JA 2FVXA 2NV0A 3N0TA 4G1CA 4JB8A 5IVPA 4D9CA 5I6DA 3PE6A 2ZE8A 4GE0A 2J67A 3GMDA 3AHHA 3FZEA 4REMA 1XCGB 2ZJ8A 5FIUA 4CMKA 4H7FA 5IRCD 2GSWA 4FK8A 1ATZA 1Z39A 3E23A 3FSGD 3KHSA 3M3HA 3AM3A 2WZQA 2R751 2VYVD 4MICA 2WIJA 4N65A 5L3SB 4XCVA 3K16A 1YVUA 3SBEA 4EZIA 2GT1A 4TMYA 2GTIA 2QTRA 3D5TA 3EXHC 3RUHA 3WDKA 3BAZA 1Z75A 3HUUA 4B3JA 2QYHA 4HN9A 1EI9A 4REQA 1RWPA 3O93A 3EGWA 4JENA 1KQ3A 2R4QA 2PA3A 2Y71A 3OEYA 3B7GA 4FCWA 3R7NA 2P6NA 4F6CA 4KACA 4L5CA 1DAKA 4LJLA 1RAGA 1W52X 3F1LA 4IJMA 5JEDA 2HW8A 1TKRA 1YJ8A 1SVNA 4CPDA 1SC1A 2EP8A 1MQSA 5HKOA 1IJBA 2XB6A 3AB8A 4EPYA 1P1KA 3G2IA 1L3BA 3PRKE 4RD6A 5AVKA 2Y92A 5AW6A 2GXUA 4PAQA 1CZUA 1P39A 1DAPA 1W36B 3COWA 4GF5A 4MUIA 1NOKA 2VVTA 3HR8A 2BMVA 1P9WA 5LYJF 2GPJA 4PXAA 1AUQA 3LK7A 4YCNA 4DJFC 3B5EA 5JXJA 3FTFA 2GEBA 4GLLA 2BMDA 1BE0A 5CB0A 5AVVA 2EX1A 3PRHA 3U26A 2E5LB 3STTA 1BA2A 3SQNA 4B43A 4FMDF 3EDRA 5AJVB 2YJZA 1U65A 2CBGA 1ZK1A 2OOSA 2AW3A 2YRFA 1IY9A 2RGNC 3FVWA 4H7JA 5HQ3A 5D3QA 1RABA 1KZ9A 5AESA 3SHOA 3H1PA 4M0KA 4QXOA 1N7GA 2WZBA 3LPNA 2QN8A 4GC5A 3DLIA 1IYZA 4QYWA 3JWGA 2ZYIA 2VNHA 3EGXB 3MJ4A 3U48A 5JV5A 1KQFA 1NUUA 2DFLA 1XNJA 4DEVA 1B6RA 3QOFA 3IEXA 2EZ9A 2OD9A 3LQRA 3DFKA 4HAUA 3KHTA 3ITNA 1A04A 2F62A 2ZJBA 3V55A 1DJQA 3A6FA 3L8ZA 4ZGBA 2JIDA 2ST1A 1NONA 3HFRA 3KZ1E 5JC1A 2H06A 1RI5A 2QXUA 3W34A 2ZU0C 2DB3A 3M4JA 3GNLA 2AQIA 3BRWD 1O0CA 3UC9A 3F3KA 2ZUDA 2FQQA 3DC2A 3ISVA 3FOAA 3WE7A 2ES4A 4AL4A 4DZTA 4QM6A 5IJAA 10MHA 3UGKA 2BUCA 2I8LA 3LHDA 4YS6A 3DBVO 1FX0B 1I36A 4MO2A 5FEMA 5J9FA 4K6MA 3KUXA 1S2LA 4XTCS 4JLMA 1XZGA 2E37A 2UXBB 5MHTA 1ZUHA 4I1PA 4QULA 4CXMA 1AE1A 4X6UA 2E87A 3NRBA 3CUEF 3DD5A 1I01A 4OJYA 4Q4AA 5FWYB 1ZN9A 2DUMA 3C1OA 4IPTA 3TDMA 3PI7A 3OU6A 5KTSA 5DN9A 2XVXA 5IW8A 4KGVA 1KBQA 3V1LA 1EUDA 4QX6A 1HWYA 4INOA 2FU5C 3RS9A 1W1IA 1QGOA 2EJCA 4C5CA 5JXGA 4R7ZA 1VP9A 3P71T 1PK9A 3RKRA 1TYBE 3SQOA 3ORQA 3CF0A 4NDAA 1KDYA 1XVVA 2HTEA 3ZYZA 1AUVA 1MC8A 1Q44A 3LHFA 4UARA 3UOWA 2C57A 2QYSA 1PV2A 1CFJA 3AJ9A 2J3EA 4AZVA 3I9LA 4A8JB 1TFUA 3QLUC 1VJ5A 3P0FA 1SD1A 5ELLA 5K3EA 4K6OA 3DVRX 2WJ4A 2YY5A 5E3HA 2B69A 1EP2B 2C2KA 4TTSA 3DFIA 4DG5A 1M3SA 3AUSA 2AOVA 3H1FA 4G26A 1H5QA 5FORA 3WIDA 4A2QA 3OLQA 2A7XA 4ARSA 4FMPA 1JHZA 3LUAA 3LXMA 2JCVA 1RCUA 5I9IA 3GJ0A 1SM4A 4MMZB 2MMCA 4U3JA 1S3IA 1NYQA 3ANSA 1ST2A 3P2KA 4TKUB 5HHTA 3W04A 4C6HA 1GCUA 3ZWMA 3A6EA 3G0BA 3KTAA 1QO0A 5KU7A 3ADCA 3LCVB 4WNAB 3UG6A 3FH0A 3V34A 4AB1A 2PSFA 4E5DA 6PFKA 4Z9BA 3T9BA 2PRKA 2B9VA 1IZYA 1YCGA 3D1JA 4WN9A 4JBXA 3M0EA 5K2MA 4MINA 1F48A 5JD3A 1ZNZA 2BKXA 1XO1A 4QGSA 1WY5A 1SCUB 1VE3A 2OBXA 2XLCA 3BK1A 2V6GA 3L2OB 2A9OA 4GGOA 4GYKA 3ZWXA 3ZCPA 1LLQA 4F8EA 1XNQB 5CG2A 1Q50A 1B0ZA 1XZCA 3AFMA 3BD9A 2W6MA 4K0RA 5A1TA 2Q1WA 1JILA 5E4YA 2PHZA 1YA4A 4BKOA 1KNXA 2P3OA 3I5XA 1NTOA 3F5FA 3UAVA 2P0EA 4ACBA 2YWDA 5GINE 3H4MA 2BT4A 3O03A 3ONNA 4G5SA 3JWHA 4OJTA 4R2MA 1JUDA 5DSXA 1C2TA 2R60A 1NIPA 1EDOA 3UAXA 3UN1A 4ARUA 1JDJA 1NIJA 2ZRPA 1MC4A 5G4LA 5IUKC 3AOEA 2X0FA 1N0UA 5JSFA 3SVLA 3RU3A 3B2EA 2XNCA 1EP3B 4IQ8A 2X3YA 3G0IA 4OSPA 1BOOA 5LLSA 2B3DA 2OG1A 1I4EB 1HK7A 4WCFB 3MTJA 1BKSB 4EJFA 4CL2A 3VBEA 1KAEA 1SQ6A 2RHTA 2W5UA 2MIIA 1U31A 4F12A 3QVWA 2GPBA 3EF3A 4PWZA 1P5RA 3AVTA 2QPLA 1DIGA 1M5UA 4OHCA 3GDWA 1DQYA 2OB2A 2CXPA 2XPCA 4QHSA 5ECGC 1KRWA 3N76A 1BXRB 4ZN6A 4KQIA 1PZNA 1YH3A 4IJ6A 1L6IA 1U8XX 1YBAA 4KQCA 4Z9AA 2VPTA 1G8MA 3IMGA 5HX7A 1KJQA 3JTEA 4GOMD 3RUFA 4EPXA 3OKPA 2EJVA 2O2XA 3WJ1A 1XZFA 5HJ5A 5AYVA 2KM1A 5HVNA 1TCUA 3REGA 2Y1WA 4RANA 2ZUSA 4WXRA 5DTIA 2D5BA 1DIAA 3SBXA 4F8YA 4Q3CA 2RGRA 1DTEA 4NFHA 4F60A 2H2FA 2Z5GA 4BGEA 4D43A 1L5NA 1L5KA 1JG7A 4WXHA 3IQZA 3HB0A 1RAFA 2H3HA 5L4NA 1GAWA 4WKCA 1G0NA 1Z0FA 2CGEA 2EG9A 1SIOA 1FDUA 3A2LA 4UHHA 3HRHA 1HFJA 1T0BA 3WZ2A 4YPFA 5AHXA 2QL9A 4MUKA 4C29A 2GEVA 2GPNA 1V1JA 2REQB 2BBOA 4IWXA 1V5EA 1U3TA 1SURA 2ZG6A 3LO5A 4JUDX 3PEYA 1CEEA 3MLAA 1GNTA 4CGZA 3NBUA 2JEOA 1A4RA 2JJ1A 2PPVA 2XTJA 3L6UA 4JZYA 1NSYA 1D0IA 3AIMA 1PS9A 5C5IA 2BEJA 2HJRA 3IVAA 1WCIB 4FGWA 3VAYA 3W5UA 4HCJA 4KUHA 1I7NA 3LD9A 1MH1A 4YRLA 4E6EA 2CCJA 4MULA 4RULA 3WGVA 2RJ3A 1NYLA 4Y2JA 2FN8A 4GGMX 5IT4A 3URKA 2V74B 5C4GB 1MB3A 2IHKA 3TBKA 3O8BA 2D1RA 3OAAD 2XJ4A 5ARCA 2OP0A 3FZNA 5JROA 1K0FA 1EWKA 1D2MA 1JSZA 1PJ8A 5DNVA 5ITZB 5IAGA 1QFMA 2DR2A 4EUEA 4UU0A 5IUNC 3K3PA 4U3JB 2KI5A 1PIWA 2VYCA 2GN0A 2A86A 4JI8B 1M6VB 3F47A 1V96A 4N0MA 4JU8A 1DDIA 3B78A 1GIAA 3CZAA 3NMUF 1CEYA 5A71A 4EFLA 2X4IA 2JKZA 2QX6A 1XP8A 2IXGA 1KJNA 1K88A 1NMEA 3NHLA 1Z22A 4EYOA 1BROA 1NR7A 3NHJA 4DL9A 4IV5A 1FJGB 5AW2A 1MDBA 1LW6E 3EAFA 2AS0A 4B85A 5A2QA 4BWVA 4L85A 1VIDA 1QSGA 3DVSX 5M3BA 1Y4AE 1KOGA 4CMGA 2QT1A 3KXLA 2OZLA 3M1YA 1BWSA 5ALTA 4Y3UA 3AF4A 1A7JA 1B6TA 1GFZA 1Z2CA 4KXUA 3D6UA 2IDKA 4Q6BA 1CF2O 2EJBA 1K7YA 5GV8A 3LIPA 3HABA 3TIXB 2OY0A 1Q92A 2Z1MA 3OQOA 3WLPA 1Z34A 3FB1A 4TMWA 3QA9A 1WV1A 2OHIA 4KN6A 3TUJC 3V9AA 3ZYCA 5K6RA 1J56A 1Q3KA 5ER9A 4LBVA 1J2TA 1XZEA 1XZNA 4Q4LA 1VKZA 1JEEA 2GCGA 2JFOA 3L8MA 4LXHA 2X0DA 5JDIA 3CZ4A 1GRNA 1JJAA 3R6DA 2ODEA 3VZDA 4PHCA 4D45A 4EZBA 4RCVA 4IOMA 1GA1A 4JOQA 4IBOA 4KXVA 2JLSA 2VHXA 3ICPA 1NDQA 4GRAA 3V6LA 1SA0A 4ZDWA 3TR0A 5J40A 4RVNA 3ECAA 1QZZA 5H1YA 2QZZA 3A36A 3QOXA 5AUQA 4W99A 5IKOA 2OCXA 5CBKA 5LQUA 2MMGA 2IDMA 2GM4A 3KZOA 1IU9A 2F1HA 3QW4B 3HBAA 4Q4HB 3OM8A 2GFHA 4MGHA 5EVJA 3GEIA 3ZVMA 3GWZA 1NOJA 1XX6A 2X5OA 3GJRA 4B6SA 1AMUA 2LPMA 1AK1A 3RTBA 3PFGA 1KOJA 3MTGA 2QLTA 3KB6A 4ZDJA 1WPGA 1GPYA 4CTJA 4ZK2A 1K9SA 2BTEA 3A3YA 4K9MA 3SJAA 4CIDA 1NASA 2WE8A 1GUFA 1EA7A 4UAGA 4Y9RA 4R51A 1XNRB 3V00A 3SFTA 2CZQA 3ESRA 1MB9A 5DBFA 4DCUA 2GZ3A 1Y1KE 2EV9A 3FGOA 3WQRA 3FNRA 3U31A 1E3MA 3FIUA 9ABPA 5TQ0A 4ETWA 5SY6A 1A7AA 2BFFA 3S81A 2WZDA 1QS0B 5J2TF 1Z0UA 2G25A 1V41E 1Y8RB 5EQTA 2VDWB 3WXBA 4C0LA 5KNDD 1CXZA 1HF3A 4B3GA 2RHRA 3CW9A 3R9XA 3N86A 4LSMA 4P4NA 4RE6A 1XRJA 2JPDA 4G63A 2C4TA 5SYMA 3RSGA 4FFBB 2O59A 3SE7A 1VHLA 3F3YA 1A9QA 3H5AA 2VHYA 2DQZA 2P62A 3LCRA 3OZBA 4PR3A 5BSKA 5DHPA 5FUMA 4EX6A 1CULC 2CVHA 1JQ3A 5AKEA 2HCBA 4LHXA 3WIUA 1N34B 4Z7QB 2AF3C 4GNRA 2AYXA 3BHIA 4AS1A 4J1QA 5JAHA 1KSFX 4FT4A 4HYQA 2P2CA 1Y3BE 1Q22A 1NW8A 1T5BA 2JAWA 2VWPA 4F5WA 1ZI9A 1E5TA 3T3IA 3VO1A 3WJAA 1ABFA 5TQ2B 1GNVA 4D6YA 4EJSA 1QBKC 1V1RA 2XTAA 3DBRA 4ER3A 1GYPA 5I7WA 1BW9B 2BGJA 3W5AA 1XRSB 1KYZA 2MINA 2O1XA 3LFTA 2BFBB 2G71A 1HDEA 1R4ZA 1Y42X 1CHDA 3BG5A 4LV8B 1KAGA 4RTPA 2QORA 4LJSA 4O3MA 1D5CA 1T5DX 1PV1A 4BYMA 1UC5B 4CNBA 1H0RA 4RTQA 3HY4A 4AKTA 3V32A 2PH5A 4IIGA 1QQ6A 4X93A 5KNBH 3MT9A 2H4HA 4GMKA 5I4BA 1F8XA 5JQGB 4CL8A 5CJPA 4EA9A 1M8GA 1Q12A 5T64A 4AY5A 1Q14A 5GGXA 2IGTA 5I7EA 1DDGA 5BYAA 4J0KA 4LDNA 3KQHA 2GCOA 3W9BA 3GLQA 1FMTA 1B2RA 3GFVA 2VZ9A 1ZEJA 1QHNA 5BWNA 2EJUA 1R00A 3C43A 2XNSA 4ENVA 4KFSA 3DO8A 1R5OA 1BS2A 1N6IA 1QF7A 3PR1A 4YLGA 1QG6A 1MORA 1VPLA 2PUWA 3DBHB 4LYDA 1LQUA 4HQFA 5KAPA 4K3VA 3TTUA 2C20A 1OC2A 1ORIA 1DUSA 1J0BA 1X0XA 5AJXA 5K05A 1S9DA 4C7VA 2RHJA 4EZEA 5JWHA 2FK8A 5AM4A 4ZVPA 1H2RS 1G7TA 2F00A 2KHZA 2R6HA 4GQIA 4B32A 4CETA 5CFLA 2WG1A 4K7JA 1BTOA 4KC0A 5IKEA 2GPAA 3PFKA 5L3RA 2B3TA 3GRZA 3N70A 4R1UA 2XYRA 3LVBA 2X0RA 2QLNA 4KR7A 2G36A 1M83A 3UKJA 1PYOA 1CJMA 2VBFA 3N2EA 2GD6A 4JOCA 2OQRA 3H1BA 2B20A 4UM9D 4DQUA 4ENSA 4LBZA 4E1BA 2FSFA 3P8ZA 4XQ9A 3WWOA 1FYXA 1PEYA 2JCBA 2GPTA 1SHJA 3NBKA 4IOJA 3U3RA 4A10A 2ERXA 3S44A 3VKWA 2XMZA 3THWB 1YNOA 1ONSA 4ZCTA 4BWFB 4OK3A 2WJIA 3KJEA 4IL5A 3CSSA 1ONBA 2B8TA 4JUCA 3R1IA 1QF9A 4L75A 1E2QA 3MGBA 5CFMA 4WACA 5MGBA 5IASA 4Q39A 4DJ5X 4YAFA 2XT9A 4UOEA 4BVHA 2J6HA 3B7WA 3OPNA 3JASA 1J21A 1NXOA 4DPKA 4C4SA 4I1UA 3WKBA 3C3XA 2YJ5A 1SD5A 1MF7A 1ZRSA 3NORA 4HDMB 5JFTA 1IRIA 5JH7B 3D4BA 5ICCA 2EVWX 5AKHA 1YL7A 1Z8FA 4Z2AA 3QKIA 1N92A 2BFFB 4O02B 3KL2A 1QS0A 5KQLA 1TF2A 3LVFO 1EHYA 1X42A 3M6MD 1UEXC 1DX6A 3SFVA 4RA6A 3FZGA 4OF4A 1NP6A 2YWXA 2AXNA 3OZCA 1L5YA 3QLUA 1UAAA 1X1TA 3QQPA 2JLRA 2WE7A 3DZCA 5AXAA 4KO4S 2AEJA 2P5SA 1GM5A 2EJWA 3LPCA 5CFZA 3DKRA 1G8YA 3NC1C 4G0VA 4AUEA 2ENWA 2DQSA 4BVJA 4FFDA 1GR0A 1Q2UA 1HG0A 1EE2A 2IBMA 2QSZA 4NCJA 4COKA 1A96A 1U7UA 1SIUA 2FWRA 2WHPA 1VKRA 4IUCS 3ZW8A 3SJBA 2EKDA 4ZAZA 2V7XA 3SR4A 3GFTA 2ATEA 3O0TA 4TWBA 2PKCA 2OM6A 2GRAA 3DT8A 4MYSA 3S68A 3OFSA 1BN6A 1E8DA 2A78A 4P7JA 4DXDA 1NHGA 4PG4A 1K86A 3CR3C 4S1VA 3WB0A 2H00A 1XRQA 3N7TA 4MW2A 3BF8A 4XYGA 4OLFA 5D3ZA 2V54A 2B8NA 1KRXA 2G1AA 3CIOA 5AK6A 2VO1A 4ZT7A 4I8IA 2X86A 1EGMB 1HFEL 1P4AA 5E1BA 3TW8B 3LRPA 3G8YA 2C78A 1GGNA 4K5QA 5D8DA 4YV1A 4DV6B 1C7QA 1KSHA 2ISCA 1NG9A 1M7HA 5G0TA 1E0DA 4KYIB 3TTVA 4E51A 2XGSA 1ODKA 2QUZA 1KIMA 4MPJA 3EWAA 5CGQB 5FFFA 3TSOA 4CKWB 4MPDA 5JISA 4MUGA 4AYXA 1T35A 3BDIA 4DAEA 2FHSA 2H8GA 3BIWA 3U44B 3X2EA 5AI5A 1UM9A 5A62A 4Q7KA 1TLFA 1VLLA 2F1RA 5DN6D 2O1EA 3R3XA 4ARBA 5AICA 1OPRA 1FY2A 2ONZA 3ED1A 3G0OA 3BMCB 3UK7A 2YIJA 1JLKA 1WCWA 4ZCLA 1CUHA 5GIOE 2PY6A 3P96A 3IEKA 3EX7C 4ZXFA 4X0EA 1TU4A 4H6XA 1R15A 2VF2A 3ME5A 3ZD7A 3T4XA 2ZS7A 1DUIA 1RHMA 2OK7A 2L82A 3AEQB 3LY5A 1R0YA 4ZDKA 2YV1A 4JU9A 4BNTA 2XCQA 4KPFC 2J85A 2PS3A 4BP3A 3PPYA 3S2EA 1RQ2A 1MO2A 3ILHA 4U0JA 2HQ1A 3ENVA 4GZ5A 4EF5A 1SH7A 2R6R1 1H0SA 1H2ZA 4WXMA 3GLIE 4B2YA 1HQYE 4OBBA 2IU0A 3EG5A 5JMTA 3RAJA 3IFSA 4NH4A 4KE6A 4G4JA 2Y67A 3KZXA 2BONA 5L95A 3IBFA 2E4AA 3JQAA 4IJVA 3HB9A 1XLUA 4EQZA 1JIVA 2BUAA 2B30A 1HY3A 2N1MA 3CBGA 3HEAA 3G82C 2OMKA 3K2BA 3Q41A 4JH0A 1SG6A 1DWUA 5DW0A 1XZQA 3U49A 1LDYA 3VZQA 1AZTA 2Z6AA 1WETA 2FPKA 4CWAA 4M0LA 3BIFA 3D8BA 2B4KA 3MUNA 4B7CA 2CF6A 3GGCA 3OY2A 3OOJA 3CVWA 1K66A 2G7ZA 3Q8KA 2NU7B 2XTMA 4OP1A 4KR9A 4I99A 3K0CA 1F7VA 4QPCA 3HCOA 3KCQA 1RHQA 3PSHA 4QDKA 3FNFA 3C98A 2BR4A 3QP9A 1HQKA 4L3OA 5LA6F 3N0XA 1Y8QA 1YS2X 3DHYA 2WJJA 3UM9A 4MI6A 3VR1A 5JJIA 2DUNA 3D6AA 2X2OA 1QFYA 4QYIB 4Y2HA 4L95C 3ZDYB 4KO3S 1GG9A 2O0LA 5DXJA 4F1WA 1RWKA 1AOXA 2N1BA 2OBFA 4KK4A 3EBOA 1E1KA 1U1CA 1U0TA 2PNJA 4MVWA 1VHJA 4AUKA 4AW9A 4HEJA 1NQUA 3KTDA 4NXMB 4Z0TA 1XFAA 1CRWG 3ZGXA 2FRXA 5FCDA 4WKGA 2GHQA 3BTSA 2G88A 3S2YA 1KBOA 1G8JA 4LDJA 1JLMA 4LXTA 4R2IA 3OTWA 1DAFA 4YP9A 1KMMA 2IEAA 5EINA 5C46F 1QNLA 1TJPB 4EGJA 5C9ZA 4X97A 1KYXA 1C29B 4MRVA 5ADWA 2XUOA 1UF9A 3IQGX 4DNFA 1BGWA 1WLSA 4DRZA 1H85A 2H48A 3E84A 4RZSA 3F74A 3JQGB 2B0JA 4JC5A 1QRAA 3I9FA 2Q4TA 3W2GA 1Z5VA 2XYQA 4CKZA 4DR4B 4H7HA 2NUBA 3E9ZA 4I1YA 3BM5A 1KYIA 1UFRA 3VISA 1CDZA 2WLSA 2DFVA 1O94C 2WD9A 5DGTA 3SIRA 1VLQA 4FHCA 1HYEA 3IURA 3M5WA 3W7BA 4WCFC 4CV1A 2QB5A 4WKPA 2H11A 1M75A 1RZRA 2AN5A 2CFIA 2DPLA 2I87A 4Q34A 4M9QA 3BX1A 2Y1EA 1TAHA 3GQBA 5AW3A 1QX3A 1WJGA 1T9BA 3D6MA 3E9YA 2I1VB 4IUBS 4W5HA 3HVRA 3OCWA 1QP7A 2NVWA 1RXYA 1GCIA 1HLFA 1M6WA 5EMNA 3WGZA 3ZWDA 3IR7A 3VA7A 3NPMA 2HMSA 2WP0A 3AHEA 4JXKA 4RZXA 2WEKA 4QBTA 1CEXA 2PPLA 3VDRA 4Y9SA 3G0HA 5BNIA 1DGQA 1ZWKA 1E2UA 3AR6A 1TEZA 3A1FA 3CMCO 4XCXA 1NVVR 2ZJ2A 3DDZX 3IXLA 3QTLA 1E2EA 3E4CA 4B4VA 2VS1A 4Y2GA 3TJRA 2PZEA 3GRPA 3SVZA 4C6RA 1I2CA 5E38A 4RTSA 2FMIA 3LKZA 1RXVA 4HWTA 1NVTA 4MKIA 3O9VA 4R40A 2OMEA 3AWDA 1W88A 3RBXA 1TYCA 1USIA 3UJ6A 3FHTA 3WP0A 3A3PA 3ND5A 2Q21A 2JDID 1W0CA 2OGZA 3GEMA 1PZMA 4QYMA 4YP7A 1Z63A 4RHYA 1OBCA 4D92A 3Q11A 3CPHA 2P69A 3SLKA 5CHYA 1YULA 4LF9B 4YRIA 4B47A 2GBFA 5FNVF 1U2ZA 3WY9A 1YIDA 3HLTA 4FE3A 4JJ6A 1MZVA 1VDZA 1ZKMA 2QT0A 3KSDO 3KU1A 4QOSA 3WBBA 3BSFA 5DCYA 5G40A 4HAWA 4R0NA 2LGJA 5KEIA 3PEEA 4G9GA 1O6FA 4GWKA 1NM5C 4N41A 2UYHA 1N0IA 4JY7A 5H5JA 1Q20A 2MOKA 2X22A 2DLDA 4RM2A 2V59A 4PIVA 1DIBA 1U0LA 1WMSA 1EFPA 3SKVA 1GTG1 2HLNA 2V6BA 5D5QA 3WWDA 2FNAA 3T7SA 1H93A 3AONB 1VGQA 3X1YA 2ZTUA 2JIPA 3KAPA 4IY1A 1QXSA 3CF6R 1E6KA 2AV6A 3NGMA 1YS9A 2JH9A 2RHWA 2JLYA 1I6KA 4CIVA 5K2OA 2IYNA 2PMBA 1ZM4A 4ZTUB 2IZ7A 2EW8A 3B6IA 3LE8A 1XPUA 3U4MA 2DSNA 2GWHA 2FUG6 1YRYE 1LD3A 3PFWO 4LGMA 1ISFA 3ZWCA 1Q91A 2H9YA 2P2ZA 2W2QA 4PGHA 5EJ7A 2FPPA 3ROGA 1NKVA 3MQ4A 1GUBA 3NTXA 4N3GA 1E3WA 3R5FA 4V0NA 2BMJA 4DLRA 4DZZA 4MP3A 3ZHSA 2VG8A 2BFCB 3X1DA 5BN4A 3U61B 5JRJA 4XEHA 2L18A 1Z4OA 3HBJA 1UADA 2JI6A 3LC7O 4J2HA 4FGLA 1T25A 2WY2D 3T3EA 1UP7A 1MJ5A 1XF9A 2JI9A 2QENA 3I64A 1JR3A 4FHZA 5BUZA 3QUSA 8MHTA 3DYBA 4H4CA 5BSTA 4BV2A 2AT1A 2Q2WA 1T36B 3IT1A 5GZ6A 3OUZA 2NQTA 2G9NA 1I6LA 1UMCA 4P4GA 3TLJA 4X5OA 3EOZA 2ZJ1A 1EK0A 3K20A 3TXYA 3W6PA 3ZUPA 4WZZA 2WPDA 1B1CA 3B51X 4MUXA 3W8RA 1CE8A 3NDRA 2CDBA 2DULA 4FSHA 1C14A 2YWEA 5AD1A 5ESDA 4Z9FA 1M1NB 4EMUA 3EZLA 1N5OX 1I1OA 1E7WA 1FNDA 1R0BA 1ZOPA 2I03A 4HNGA 1DTWA 2JCXA 2P9JA 4MNTA 4QWWA 4X60A 5H16A 2YJNA 4EO4A 3F9RA 4F9EA 5ADHA 4FBMA 1YL5A 5J43A 1Z2EA 2IQ5A 1G98A 3ORSA 3A6JA 3HCEA 4ZOLA 2HYIC 1YQUA 3ONWA 5GJWC 1FU8A 1CR0A 4EB6B 5D5PA 4E1VA 3C3MA 3PIIA 1TO6A 3OTHA 4GH5A 2N47A 1NATA 1P4JA 4RQBA 4K8RB 3E7DA 1BU5A 2XIJA 4DARA 5BQXA 4EUSA 1E6EA 1PG0A 3DMDA 1HYGA 1Q17A 1NBMA 2ADMA 2GILA 3GLGE 1WW8A 4G0WA 2CXNA 2AMYA 2FQXA 3G9QA 4MLPA 1L7MA 1UODA 2B1GA 2VRCD 3K70D 5HCUA 2C4NA 5LMZA 2HU2A 2WAYA 4WUVA 2IA5A 4GRIA 4OBEA 1G8AA 3ADKA 3O3MB 4ZO7A 3TCNA 3WLJA 5JYEA 2OAEA 2D7JA 4CKCA 4I4CA 3GFRA 2JD1A 3O4RA 3N8DA 3TTXA 4DQKA 1JLLB 2X1LA 4ZHSA 2EBHX 3T8YA 1K27A 1CUSA 1Y37A 4KQ2A 2JFWA 1SXJB 2OBLA 4IIYA 1EFKA 4L7QA 1E5VA 5IMSA 4MAAA 4ERNA 3IKTA 1QJCA 2ZIXA 4GSKA 5ERGB 1Z6YA 3ODGA 1SB9A 2H31A 4RW0A 2JA2A 2QNBA 3QFTA 3R3JA 5JAIA 2EYQA 4YRKA 4S12A 3WWEA 1RMQA 1JXMA 4Y30A 2QLFA 5EE5B 1RKBA 3AHFA 3BH6A 1MVLA 4DV2B 3OJCA 2IL1A 3KEQA 1RKXA 1UCFA 2IEIA 2R8PA 2ZYVX 2BPOA 3EIFA 3KQOA 3DT9A 4MIYA 4J03A 3E9DA 1C4OA 1GLNA 4LRTB 5L3QA 3EPPA 2CLSA 2Z8ZA 1NLYA 1NUHA 1B74A 3CX8A 4R1MA 3WFJA 2BOVA 3RVOA 5JZVA 4G8CA 1L4HA 4MKFA 1MX5A 2Y2VA 1AK9A 2QN2A 2K6GA 4GP9A 3I1IA 4OIMA 4J0FA 5JPIA 3RS7A 3CWQA 3GA7A 4QOIA 3TLMA 3UWDA 3BGIA 1XAGA 4MQMA 4QICA 4ARCA 1IBCA 3IEVA 2O2GA 4DQVA 1PJ2A 4MRAA 4P3OA 1WXFA 3K8YA 1JWLA 4CLOA 2FWAA 1MW8X 3SHFA 3TMKA 2DX7A 1BWRA 2IYYA 2P3QA 4ZAXA 2NSYA 4YONB 5IK2A 2PU5A 3P9SA 4PZUA 2ZTMA 2F3TA 1DEAA 3SS8A 2G1PA 5AOVA 1JECA 4NZYA 3MS7A 2O7RA 3EW9A 4TTRA 2DFKB 3HCCA 2FPMA 1BH2A 1FX1A 2IK8A 2FWNA 1YQWA 2GJAA 2IYAA 4CM7A 1UZAA 1QV7A 3CZQA 3VH3A 3OZFA 4EY7A 4MDFA 1O58A 2ZIGA 5BXYA 1WCIA 4FN5A 4LF4B 1QK5A 3UWOA 4DRXA 2LNDA 1ZJ6A 1W2GA 3E18A 3MIZA 3ODPA 4IM7A 1I32A 4Q3OA 1OT5A 5SZKB 1QB7A 4NI5A 3VTKA 2HJWA 4JASB 4AM8A 1O95C 2ORIA 3FGNA 3Q7SA 4AF6A 4TKMA 1IZ7A 1D7OA 4IJWA 5P8WA 2R9VA 4KVFA 3QXGA 2PUBA 5KB3A 1RP7A 1UBRS 1QQ5A 2DUJA 3PZBA 5EIBC 2H2GA 3IX7A 3L46A 1UKVY 3IH5A 1H4TA 4YTEA 4NFLA 2O1SA 2GVZC 1NMZA 1LH0A 4HADA 3STUA 3QVSA 3OMXA 3ZD8A 4QUKA 4AI6A 3SY8A 3ZGNA 1YS6A 4H1WA 2XGMA 1UH5A 4ZV4A 2JFPA 5JNWA 1AF4A 4AMYA 5I7FA 3DDCA 3PFBA 4N0QA 2DBZA 5AJTA 1ZYUA 4RV4A 1QQAA 3IQHX 3CWCA 1RZ3A 3UMVA 4WLUA 1YFJA 4E32A 4E70A 3TCKA 4HRAA 2FOIA 3VV3A 3CF4G 3HKBA 2PZ8A 3ABIA 3PFHA 4ND6A 1G66A 1LFAA 2IDJA 4QC2A 2FMTA 1ELOA 3KHUA 3FKQA 4DSNA 2X3UA 2C61A 3EA5A 4EB6A 1MX1A 1GZ4A 5KJEA 3WDSA 3CPJB 2F3RA 4JCCA 3C5HA 5ARDA 4BJ5A 1F60A 1U7TA 3LYLA 1GTVA 5AH0A 5AK0A 1DLJA 1ZD3A 2W98A 4BO6A 1RNLA 2GKOA 4DSAA 2H1OA 5IBRA 4IDGA 1IUOA 3PL1A 4Q4CA 1AQLA 2VFAA 5K09A 2CUKA 1V8BA 3LUDA 2VWGA 2IE0A 1H6CA 3CEAA 5IAJA 3RVNA 3WB2A 2WYUA 5EHIA 1HE4A 5AJZA 4MDHA 4QEDA 2WSYB 4TYMA 4M1YA 1I13A 2WKRA 4QTXA 5AHWA 1NWCA 3I6QA 1KFBB 4H27A 4QFCA 3ZI4A 2IZZA 4JLBA 1TYAE 3HN7A 4MUJA 5EE3A 3QU4A 3WADA 1A71A 4AT1A 2V96A 4Q1BA 1TQ4A 1MRNA 3BWXA 3L6DA 4OUKX 2I4TA 5CXSA 3R7DA 4QM7A 1SQSA 1YK0A 2A9PA 4LW8A 2QUHA 1JFFB 4D3XA 1OYOA 1N9KA 4DUZB 4DWJA 2DG2A 3KSRA 1B8PA 4MS4B 3FPSA 3DKKA 4OVKA 1NFQA 3TUIC 4OQ4A 2IEZA 4AZ0A 3AKZA 3ZLUA 2XVYA 3WLRA 4X7RA 1NXTA 2AB0A 2JKVA 3BQNB 2Q2NA 1W6UA 3CX7A 3D5QA 3UA4A 2EDAA 1NI4B 3WK6A 3EZNA 1ZH8A 8ADHA 2UZIR 1FYFA 2XCUA 1JH8A 2VI5A 4U2CA 1FVHA 2IV7A 3RT7A 4BNLA 1RACA 1QOZA 3HA3A 3MMXA 1U90A 3O1JC 3GJXC 1X8KA 3LBIA 4CODB 5SY4A 1WXEA 5LZ9A 3L84A 1N2CE 3BGVA 2Y9PB 3W9YA 2MR5A 4D26A 2H4JA 3FPKA 1T0JB 2MYPA 5D01A 4YI5A 2WFZA 2FX5A 3ETLA 5E95A 5BYJA 1LK7A 3CEHA 3FMOB 2PJDA 1Q1GA 3RWBA 1GZ3A 3CONA 5IAEA 3RGGA 5F2KA 4HLUC 4TUYA 2PJZA 4CM9A 3SYMA 1NW9B 1FYWA 5TEWA 1LPPA 4TWZA 3TRJA 3AQ4A 3N9IA 4MS3A 1E4YA 2BCJQ 1MW9X 2QX7A 2AK3A 4WV3A 5AVJA 3TOZA 3A2NA 3DE7X 2OV1A 3GLHA 4C4OA 2X1HA 1Z3CA 5IK2D 5IMBA 1IUNA 1N2GA 2X0NA 4HC4A 1VHWA 3B1WA 3N2KB 5T3YA 3NRCA 1L5RA 4ISBA 3EPRA 3WA7A 1JDNA 4WA7A 1D1TA 3WK9A 3GYBA 3I9MA 4WDRA 2L69A 2ZBFA 1T1JA 1JEAA 1RQNA 3RVRA 3M1LA 4C0AC 5JANA 5KQRA 2R8RA 4DRXB 4JT9A 5KIAA 1ADYA 3T94A 1UKAA 5TT1A 1E0JA 1OWPA 3LKVA 4M2LA 3VR2D 4EG1A 3HJHA 3WL7A 1FS4A 3HXLA 3LLSA 4NMLA 3AM5A 5K0SA 4F7WA 4HEA6 3LP5A 4N18A 3H1AA 5CPBA 4XWTA 2IW1A 2BR3A 5KSPA 1BDMA 1F2VA 1IXSB 3A1SA 1OHHD 4XD2A 2CJFA 1NTRA 2E89A 2YXLA 3PWKA 2POQX 3A25A 4C3OB 3DHNA 3U7GA 3EEBA 2GAOA 3ROXA 1QRTA 3QFCA 4HWSA 16PKA 1MOPA 5F73A 5BYBA 2C95A 2G0AA 4IX9A 3EQ9A 1OC4A 3NVKI 4TYYA 1H0HA 1DKMA 4ZIRB 4RY9A 3RRFA 2WSMA 3UKOA 3S99A 3CGWA 4AF7A 2PVCA 4XWOA 2NXJA 4R81A 4GM4A 5LQRA 3IJEB 4MUFA 3GDOA 4JN6B 4UM8B 4Y2SA 2Z6QA 1PWXA 3MTIA 4WE3A 1DKQA 3V2UA 2YW2A 5BV2P 2VHZA 4PLFA 2QD3A 3CSDA 1CR4A 2UZ1A 3CINA 4LYEA 4E5KA 1EZZA 1OPXA 3IP3A 3LCCA 1H5UA 1QH1A 5GWXA 621PA 5FOXA 5LXTA 2C3YA 2V5UA 3W7AA 3K9LA 3CUTA 3EXFA 1C9KA 1IBKB 4BO3A 2HMYB 2Q7XA 2V1XA 3DDHA 4DLXA 1CZNA 1U63A 5A7FA 1ULTA 5KINB 5LFAA 3BMNA 5F9MA 4QXQA 4RKEA 4II7A 4PZZA 2L19A 1FU7A 2WOJA 2FFAA 1P44A 4YRFA 4KODA 5F3DA 2DFDA 1ZL2A 4NG4A 1K7SN 1L8LA 1YXMA 2I7DA 3OQ1A 4M87A 4BMVA 2PANA 1TEHA 4MR8A 4RACA 5GZ1A 4UEKA 1G9XA 3R5TA 1RP1A 3RASA 4H7EA 3CZCA 5SYNA 1KP2A 1JAXA 1YQDA 4QDUA 4Z4HA 3V8VA 5HKAA 3VMMA 3N8GA 4QKQA 2HRRA 2Z3VA 1BAPA 4XVUA 1J22A 1XMVA 4M0FA 4OPMA 2C2HA 4YAWA 5KMGB 1RYFA 4I0WB 3D0KA 5HM8A 2FW9A 3DMTA 2FR8A 1NJGA 5CBPA 1IDOA 2XQKA 1RRVA 2DQ4A 2IXBA 2WU0A 2Z2ZA 3OE5A 3LUPA 3LYUA 1T8TA 4RLFA 3EQ7A 1QRSA 1ETUA 1LWNA 2VBIA 1QTIA 4JEUA 2Q3EA 1P7VA 4ZCSA 3W9SA 1Q15A 3FOEC 1T1SA 5FO1A 3T1HB 1JG2A 1XCPA 2XUZA 3MUOA 2R11A 1FTNA 1UFOA 1MDFA 2LZ0A 2IUFA 4KYTA 1WP4A 2DBVO 4W8HA 3U3JA 5TLSA 1XFDA 2R7KA 4RWEA 3Q5GA 2K2QB 4KPYA 1ZOSA 2IZ5A 3DDNA 4MB2A 4DAOA 3N07A 2KQUA 2EOAA 4MW4A 2PGJA 2FEWB 1B8NA 2JLAA 3K0HA 5AVQA 2PCJA 3HJUA 1AVTA 1ABEA 1T10A 2NWQA 4R41A 1RLTA 1PQ4A 3N0VA 1MHPA 3IUNA 3MPUA 4PY2A 1PKEA 3QVOA 1LBTA 4I8DA 4DY4A 1QFXA 2KE5A 2H4WA 5JT1A 1P0CA 4LXUA 4BNWA 3UJ8A 2NSHA 2H17A 4D25A 3HLYA 2A9QA 1LPBB 5L53A 4TTIA 2ZSIA 4IIBA 1U8ZA 4GVXA 4I9UA 5CTAA 3OJEA 4YIKA 1JEDA 1KKUA 3TSYA 4FW9A 1YZNA 3NUQA 3GVHA 1XB2A 5EE0A 2PSHA 3UTDA 1XAHA 2W2KA 2YN4A 3AG5A 1T6XA 3MCVA 5E2BA 5EUQB 7MDHA 1QV9A 1IZ0A 4G65A 5A5EA 3UMSA 3WHIA 3FRJA 2A0XA 1UXHA 1YHNA 2GOYA 5TS3A 4FR0A 3TMYA 4PFJA 1BVUA 1TW2A 1U2RA 2JNWA 521PA 1GPDG 1P2VA 1SRQA 4G4SO 5EZ5A 4WHMA 3TEJA 1V8DA 4OH7A 4MJ3A 3MF4A 3HACA 3PEFA 3E82A 3OBBA 3AYZB 1SAYA 4Q03A 1KVSA 2J9FB 3C6ZA 1CUWA 1PHRA 3OMLA 4FE4A 4LQDA 4RGQA 4YWJA 3ZI0A 4CI0B 4G5HA 5CD9A 4V1CA 4EGAA 1O6GA 5I7SA 2O2YA 2QAGB 3OCUA 1VYVA 5SYAA 4NJOA 2NO4A 2VJNA 1OBOA 2WKSA 4PG7A 3ICQB 2IFTA 1E6MA 4LX0A 2HV9A 2G4VA 1NULA 3N2ZB 3RVKA 1YUNA 1K63A 3H13A 4GX1A 5DTJA 5KNDA 2JAXA 3ZJUA 4HDCA 2FXIA 4DUYB 5DP2A 1XHFA 3LCMA 4UFNA 3IPCA 1DCTA 4MP6A 3U44A 1X9IA 2SCUA 1XA3A 4G4GA 3ZIAD 3WKEA 5C32A 3SYNA 1T2NA 4Z53A 4JBWA 4P7GA 1KI4A 4RQUA 4E6PA 2QTTA 3P52A 2CVQA 2VUUA 3CCFA 3NCTA 4ZU6X 1XAJA 1OJ7A 1DC5A 3JYOA 4JT8A 5D3MB 2ZJYA 3C4JA 3WX0A 1ZXLA 4DUGA 2B9EA 2BLLA 3EE6A 4H18A 4ITVA 2P4HX 5KYYA 2IH4A 2DCMA 2XUQA 4DWOA 5C8XA 2XMRA 3MIIA 1SWWA 3AKDA 4JT2A 3MGAA 3BL6A 5HF8A 4R9UC 4J75A 2VJYA 4AG3A 3OTQA 2KJQA 2BMEA 1E3EA 1PDWA 5FOTA 1PSDA 1JYFA 4CCSA 4XW2A 1R0XA 1NGSA 3TDNA 3HCAA 3INTA 1TQHA 4E2FA 2CXXA 4WECA 3A1TA 3A05A 1QONA 2RARA 4XWWA 2ODQA 1BKYA 1WOYA 1W87A 5EP1A 3THRA 2BH2A 1ORVA 4OM8A 1WA5A 4YHBA 3SZMA 1TK9A 3WI7A 1I6MA 5I9LA 1M33A 2GZRA 2HBQA 4Z86A 3MCWA 1HR0B 1FFSA 1XK7A 4FFSA 5GJVC 4HUQA 3IUEA 1IMOA 1F0YA 2I8CA 1RPTA 4WLVA 3RS8A 1L8OA 1FDRA 4S1WA 4UULA 2TRSB 4QFBA 2H1RA 2EBWA 2NZ8A 2QV7A 2YL2A 4NEGA 3WLMA 1E60A 1XCMA 2J31A 4UEWA 1OFIA 1OLXB 2QTBA 5TMBA 3SMVA 1W85B 1ST3A 1YTUA 5FOSA 2XOKA 3T61A 1QHEA 5BRNA 4B6FA 2XMGA 3VH4A 4EL5A 2G9QA 1VI2A 4QU8A 2RGNA 3N8NA 1Z0AA 1KPGA 3R2JA 1H69A 2AR7A 2QZJA 1N5KA 3C1UA 1B0UA 4F06A 4QYIA 1FSFA 2YWGA 3D7SA 3E70C 2GAIA 1XP5A 2XHEA 3HGMA 5AKYA 4QZVA 5DU2A 3M81A 4U4AA 3TXXA 5H3LA 3HO1A 2AMVA 2G9VA 2V97A 2OBYA 1VL2A 3E5MA 3LFHA 2AI1A 3NBMA 1KI6B 1JEJA 1V2HE 1NKSA 1YB5A 2GJKA 3KQMA 4J7XA 4MKHA 1OZ0A 1YE5A 4ID9A 1AY0A 3KEOA 4YT2A 1YC5A 1Y3CE 2JCYA 1RFGE 5EMKA 1CRZA 1HFKA 3HB1A 3QOWA 4NHEA 4CM5A 2QKYA 6CHYA 2ZRJA 3GEDA 4L72A 4CL0A 1ZL0A 2WAMA 4YP6A 3IQIX 3WA6A 3EGDB 5K3FB 5JNSA 1T9GS 2I99A 2RG1A 3PQ6A 4TTQA 5JNUA 4B6QA 2XKKA 2CNOA 2GSDA 4M55A 3CU5A 1O5TA 3FPAA 4KQEA 5FNVA 4D1YA 1Y3IA 2CJWB 2Z04A 1W0KD 3PQ5A 2BP7A 5L7YA 1A76A 5MF6A 3W5DA 3EGIA 1EKXA 1H2EA 1Z9BA 3NATA 2WMOB 4A7PA 4PSUA 1AQNA 3IB6A 3GGJA 2OO5C 2Z9DA 2YYSA 4CCYB 1N6NA 5CNMA 1J00A 2B4RO 5CM8B 4MK4A 3QEAZ 2IUSA 1T5HX 1I7PA 5MFZA 4MQ5A 4OGLA 1MX3A 5AXBA 2XXBA 2FWPA 5JD6A 3GCGA 2BZ0A 4I1OA 1QRDA 1A9RA 3NDIA 5JARA 2XXAB 3TVYA 3KKPA 4IICA 1YR3A 3H8JA 3IAUA 4WFIA 4AK9A 4CF4A 4MYHA 3HH8A 3ZCTA 3JQ6A 3C16C 1TB4A 3TKAA 1WL8A 1B4DA 1UT8A 5KAMA 3W8FA 1WXWA 3ZK7A 2CHQA 1R2QA 2C83A 2W0MA 4U0KA 2J6CA 1UDWA 4KDCA 3ROZA 4DSOA 4QVIA 1JAZA 3C70A 4PEVA 1SBHA 4WWHA 3OIYA 2R3SA 3QJYA 3W9UA 3J81k 3CBQA 1UPCA 3LW8A 3MS4A 5EJIA 2FZ5A 3GJZA 4GUDA 3TZ6A 2O05A 1A9SA 4JWTA 3G6WA 1PBTA 2NZWA 3HY3A 2DFNA 4M0UA 4TVOA 1JX6A 2F1KA 2KX7A 1EK2A 3K09C 5HFAA 3WC4A 4RIEA 1E2JA 1WM1A 4EHKA 4O4IB 3UGJA 2XBMA 3EPHA 5BN4B 4N5NA 4RH0A 5B4UA 2IYFA 4PLYA 1REQB 2F64A 2I2BA 3ZDDA 3PC6A 1PZHA 1HTWA 3GLFE 4JP3A 4IJUA 2OFXA 2YV3A 3JTMA 1RDFA 3FUWA 5EZYB 3O8CA 3TX6A 2BRUA 4IIEA 2JGNA 1W7AA 4ANFA 1NFFA 1O4WA 4PZEA 4Q3EA 1BE1A 2V7TA 1KK3A 3I9OA 1AKUA 1JLSA 3DA8A 5HCIA 3ROEA 3CLKA 3AR2A 3S1AA 1YOBA 1G16A 1K92A 3ZE0B 3CKYA 4C0BA 4Q3DA 4DPLA 5C37A 2FPUA 2QNRA 1BC5A 1LV7A 3I8XA 3OT5A 1TLTA 2XT6A 4FHDA 5AIAA 5GM2A 1JYSA 1FQKA 4CM8B 5IDWA 3GZJA 3GRKA 4QYTA 4DCCA 5MFPA 1U2DA 1TM4E 3VV2A 1C9NA 1NVMB 1RYZA 1HSZA 1U99A 4IUDS 1UK9A 4MCHA 4MA4A 5HUHA 3FOFC 1QGED 2IYPA 4JA2A 3TLCA 2DETA 4PONA 2FDCA 2PD3A 1S2DA 3OU2A 1U5CA 5HUQA 2HTFA 2XOKD 1V4NA 4M8SA 1KP3A 5FQOA 3TW8A 3VYTB 1MB0A 4Y1RA 5BV7A 3KSMA 1KYTA 1KU0A 4FM9A 3NUZA 3KU4A 4WN3A 1NN1A 4XB1A 5JG7A 1ZN7A 4IZHA 3G2KA 1RJEA 2ADOA 2JLUA 2R25B 2ETVA 2Q2VA 3CC8A 3M6XA 5H83A 4L5IA 1I94B 3PR3A 2SNIE 3DFFA 2EZ4A 1QQTA 3RS5A 4DCGA 3E1SA 2W42A 2VZ8A 4EUHA 3HJCA 1APBA 1NPYA 2FGJA 3J80A 1N78A 4IMRA 1KYQA 4QFDA 3OH8A 2WF7A 1FB5A 3N3AC 5TXGA 4BO4A 5K4AA 5J2UA 2XYVA 3FOBA 2OTCA 4ASUA 2ETXA 1KC1A 1LS1A 1RXSA 4CLXA 4V2UA 3Q9NA 3FFTA 3LT2A 4PO9A 5KOYA 1NW4A 3DWGA 2D5IA 3IALA 2DMRA 4NCAA 3SXUA 4ZJPA 3QWBA 2IY9A 1RD4A 4XDYA 4DMUB 4BZPA 4K6KA 1OFUX 2GBIA 4YAGA 4NYJQ 2QDXA 1F5NA 3NM5A 4MCIA 1KMIY 1P74A 2NTJA 3GG2A 4B45A 1QGZA 1TZ2A 2JAQA 1UOOA 5HWSA 1TQDA 5EZ6B 3TZLA 2GZHA 3AC0A 3W8NA 1UP4A 3O31A 2RJOA 4RDXA 3NAQA 1OAAA 2CZCA 5L9AA 4IHJA 2VJLA 2LCFA 4V0MA 4C0KA 2RC6A 2OG2A 1YMUA 4D0GA 1W30A 1WXDA 2HDHA 1MAWA 1RYNA 3ZGLA 2X0IA 1ZIOA 3BRCA 2OGUA 4JV5B 3HNPA 1ZUNA 2VP5A 3DKIA 1C41A 1JG1A 2BC9A 2LBPA 2QQ5A 3DDWA 3EB9A 2HWYA 2CXUA 3GFQA 1Z36A 3HA7A 3ESXA 4IDQA 1F0PA 2JFBA 3WK8A 1Z08A 1CF9A 1TC1A 1VGRA 1J9ZA 2O14A 4A73A 3U9TA 1NNEA 4XUCA 1SVUA 1CJVC 5ICFA 2C58A 1WZUA 3MAAC 5EFOA 5E7IA 5DM70 4R9RA 2GXQA 3H5WA 4Z1OA 4XPZA 3QVJA 3KZKA 4HQOA 2O52A 4FLEA 5EWMA 3CB4A 3TLGA 4F4FA 3BQMB 4OXKA 1JDPA 1AUOA 2ZSBA 2RIPA 1XF1A 4ZVUA 2NACA 3H3XA 2R6CA 1VSVA 4G1EB 4I4NA 4N5IX 4AZWA 2YYZA 4OHVA 2B82A 2VJMA 5A4FS 5E3JA 1N36B 3O7MA 4BNZA 5I4KA 3VJRA 2KB0A 2V7QD 4ABYA 1WWKA 5K0NA 5JRDS 1Z7EA 1G7CA 2CLFB 4J29A 5BN3B 1IPEA 1JHYA 1FFXA 5AI8A 4G9BA 2O2CA 5SY9A 4C03A 1I10A 4JJEA 1S6YA 1BGVA 4TN1A 4DUPA 3L40A 4TMVA 4QXMA 5E6RB 2AVNA 3E6AA 2HCJB 3U3MA 5FV4A 2W6PA 2FUEA 3PQFA 4GXTA 4FZVA 5ALRA 1IVSA 4X20B 1YHZA 2BISA 3OZ7A 1DC4A 4W7HA 1WXXA 2YYYA 2PUGA 4YT4A 3SDSA 1E96A 4UOQA 1GL9B 2ZQZA 1F14A 3D6VA 5D1NA 3SC2A 5LJLA 2HA0A 4RNCA 3D0QA 3HUFA 4KRXA 1EVKA 1PFUA 2AZMA 1IULA 1M34B 1I6WA 3H7AA 1C9DB 1P0QA 1G2OA 1HE2A 2C03A 3FYDA 5F4ZA 4S3MA 3ZGYA 3KQNA 3ZHQA 3LBHA 4CTOA 5AW4A 4AJ1A 1QHYA 2UUOA 4JC8A 4MZXA 4DMMA 4ZVQA 3G49A 4JLNA 5AK3A 5DYYA 3N87A 5FHRA 3K70C 3GIDA 5HZKA 3EODA 3BEOA 4N0PA 1K4MA 4Y1FA 2JD2A 4NE9A 3SHWA 1G5QA 2J09A 4RK4A 2O8DB 2G72A 1JR3E 1QAOA 3ETCA 5KQGA 3A6PC 1CUUA 1R50A 2Y2UA 3P94A 1KL7A 4GO1A 3ZH9B 4D0RA 3W0LB 5KTOA 2EWVA 5J63A 1ONNA 3N5CA 2QL7A 1V5IA 3NOOA 3DCJA 4C7XA 4UUAA 3QH4A 2CJYA 1LTKA 1P7YA 3QHPA 1GGHA 3V1YA 1R6AA 1NZJA 1VJDA 5KJ6A 4HJXA 3IS3A 5LMUB 4PPNA 5A1JA 1A2BA 2QQEA 2AMLA 3IVMA 4E46A 1CW2B 4X6LA 4QATA 3SMQA 1IONA 4GI5A 4DMRA 3EQ8A 1DOZA 1VPDA 1MPTA 4Y0VA 3KE9A 1NR1A 5IEJA 2PD6A 2F3SA 4D7AA 5JJ5A 3BA1A 5D3KA 1ZVJA 3P2OA 1SKYB 3GVXA 1NQWA 2D00A 1SBIA 3EH1A 5G2OA 5KNCH 2IYTA 1D2NA 1J25A 3VHXA 1IHPA 2O3RA 5HOEA 4EMBA 5U9CA 4P0QB 2HCRA 4Q1DA 3FD8A 1SXHA 2NV6A 3Q5DA 2REOA 1O54A 1SJ9A 2WLTA 3OWOA 4FQ5A 1QWOA 4IGAA 2AFHA 3SDBA 3U2QA 4EKNB 4X8LA 1NXQA 4XIGS 5C18A 3VYSB 5L3SA 4H1VA 4U2BA 1L7OA 1P1CA 2TMGA 5EKXA 4C87A 4AS2A 1DLIA 2VF8A 1XZAA 4NONA 4ZZ2A 4B2IA 1A9PA 5CHEA 4HXYA 3BVPA 1KBZA 5CW2A 3UJAA 1UKEA 3GNQA 4DQLA 2P9BA 2XB4A 3TIFA 4X8OA 2JI4A 4BO5A 3TR6A 1BSVA 1CCWA 3KKOA 4R1QA 4ALJA 1FXWA 1O95D 2WM8A 1XCBA 4BMPB 4QEZA 5GVRA 3EEYA 4G86A 4O4HF 1NVWQ 4M1OA 3MK31 3FSJX 1ORDA 2JHGA 2Y68A 1IH8A 1MG5A 3MAJA 4IWYA 4QAQA 1LC3A 3ZWBA 2HPHA 4IRXA 1Y89A 4MYDA 2EC5A 4LHVA 3G2NA 4LYAA 1FFAA 4EQ6A 1KY5A 2A3RA 5BVGB 5B58T 1NURA 3RIHA 4ZCQA 2BF7A 1WLYA 3FFWA 5HTKA 4B84A 3FCAA 3OECA 4L4ZA 3UENA 4PBSA 1Z4LA 2AJDA 1Q57A 1W4RA 4QQKA 4DC0A 5H8WA 1NF8A 1NQVA 4GDFA 2QMOA 4FINA 4L6CA 4X8MA 3MJEA 3U17A 4IHKA 3N74A 3QA3E 3PXBA 3VNQA 5T7BA 5KBYA 1ZGBA 3T3HA 2G1KA 3JD1A 5JSQA 1JTEA 5AVUA 1Z4JA 4PTLA 4ZOBA 4FGUA 5EPEA 2V98A 4O4JF 4KXXA 5G02A 5TF4A 1GXSB 2OGTA 3H2GA 1KZ1A 4E21A 5JYBA 2COKA 3IV9A 2XEXA 2V4MA 3FAZA 1S2IA 2W22A 3LOQA 3LTEA 1SCAA 1PJ4A 2QZ9A 3EF0A 2XNKA 3UC5A 3CUVA 5K3DA 1T8PA 1A0OA 3ROKA 4XFDA 5BW4A 3GJSA 4YWHA 4RSGA 3ESYA 3GLGB 2ZWPA 2OO3A 1A4XA 4DS3A 5JWRA 2HA3A 1NI3A 3RDPA 3JVDA 2JGRA 2Z5FA 3CRZA 3F9CA 4HN2A 4B3CA 1GZSA 1BMQA 2VNJA 3ASUA 3WRYC 1F6WA 1VKHA 1JVSA 1BCRA 3RBVA 2OKCA 1H42A 1EUCB 4MR9A 4RK5A 1CUXA 3I30X 2OHOA 5FT9A 3W5SA 3ZE8A 1IZ8A 5CDFE 3G5UA 3GUVA 4Z8XA 3KV3O 1NYRA 3C45A 2KLHA 3UMFA 3EXIA 4GOOD 4FBGA 1PLLA 2BW0A 4O2AF 1KAQA 2GJ8A 4Q4AB 4NZOA 1DWPA 1G5HA 1JXQA 2AH5A 2ORED 1PFVA 4A82A 2CMHA 3CMMA 4MCAA 2BFMA 3O4IA 4IDEA 2C2GA 4BXOA 4CKCB 1YIOA 3GRYA 1ILWA 2JFXA 4INJA 5CVCA 4YR9A 1G6Q1 3KIPA 2OLEA 2IS6A 1CLUA 1P8JA 1VLMA 2HWUA 1E2HA 3QK7A 2VL7A 3W78A 4BX2A 3AVXA 3QTBA 2WT9A 3DO5A 2GJ9A 1CTQA 1WMEA 3E7FA 5JS8A 2D0IA 3WLAA 2P90A 4BEWA 5HKLA 1EM8B 1SMKA 1AKYA 2AD1A 2YX1A 2O1WA 3TRFA 2UYCA 1QR2A 2Q4DA 5E9AA 3B6KA 3SU8A 3PNSA 3QPVA 1PNVA 1PAUA 2CXTA 3DO6A 3LT1A 1Y3HA 5IDXA 2DECA 3PHGA 4GWLA 3DBOB 5LA6B 1USKA 5J23A 3ERCA 2OECA 2XGOA 3A9UA 3HP1A 3NNSA 2FW7A 1U7WA 3H11A 2O2IA 3BXHA 2OCBA 3B12A 1TZCA 2YN2A 3NW9A 2WSIA 2VPWA 2XQVA 3PUKA 1KGDA 1TPZA 3ICCA 2WKPA 1X19A 2JFGA 3NBYC 4K46A 4KGZA 1AHPA 3V33A 4C08A 3JARB 3IP8A 4FDAA 2GBGA 3NGLA 2AG1A 4K9DA 5H59A 5IARA 4D3ZA 5JJBA 1V7CA 1T13A 1Z0IA 2ZSAA 4UZFA 4D4KA 4MTCA 3EDMA 3UG7A 4PQGA 4NYIR 4RVOA 3H2KA 4JDPA 3N53A 4KQFA 1HOXA 4PQEA 9ATCA 3DZKA 5JO9A 2FQ1A 1P0IA 1A8HA 1OGYA 1RYMA 3NASA 4TKVA 2WWYA 1YZ3A 1F6BA 2R85A 4OHMA 4D2IA 3AVYA 2AGVA 4KN5A 4AY2A 1J0XO 3P1JA 4OHRA 2IEBA 2JBAB 3I2HA 3ZZNA 1PDOA 4J43A 1XJWA 4RVCA 3PR2B 4YRRA 2D1TA 4E11A 1P4HA 3AWIA 5B7QA 4R0MA 1JDBC 1D2RA 5REQB 3VZPA 3E3MA 4RD0A 3CRMA 4B4DA 1YQEA 3A4IA 5EAIA 4FONA 3BTOA 3SNHA 3TM5A 3IOBA 2IOFA 4H15A 2D2EA 3NPAA 2Q3LA 3M6AA 3D6TB 3RFFA 1TIPA 1XXHB 2B34A 2NT4A 4I1IA 4V0ME 4MXDA 1NQ5A 3EUFA 1XK6A 3L0IB 3LX6A 4G0PA 1WNFA 2CLMB 4GPAA 1KERA 2XWSA 4P81A 1PX0A 2NZJA 5LQJA 2QW0X 821PA 2QP4A 1VC2A 2R79A 4IGEA 3TIGA 4B3SB 3HUDA 2ZYHA 1W4ZA 3E1GA 2XECA 4FFBA 4NAVA 3K0EA 3S2IA 4R9VA 1AO3A 4G0MA 3BFKA 1WDKA 2WJHA 3K15A 2R8OA 1CQIB 3JATA 2Y77A 3DP9A 3I01M 2WF5A 2ODTX 2BMWA 3O84A 5D7NA 5HS4A 4FR2A 4O2RA 3KKZA 4ZI5A 2UUBB 1NJ5A 1ZD2P 1X7YB 2W58A 3E9RA 4W8OA 5LUBA 5DYTA 3I05A 4FHGA 1D6SA 2VR1A 3T9FA 1RMTA 3SSOA 5BMVB 1LDMA 1NY6A 1ZR2A 2JIZA 4H4DA 3TSZA 2X76A 3UT6A 3O2QB 1YA6A 1DC6A 1QP8A 3GBSA 4FEAA 5CYFA 1AIPA 4BB6A 4QG3A 3PX7A 4G0OA 4ZQGA 4M9CA 2YS7A 2P9GA 4R9SA 1N1DA 3NUGA 5HQTA 4AURA 1PBNA 2BI7A 4HGQA 2BE7A 2IY8A 3MINB 3NONA 2YIDA 3Q10A 3QG5A 3M3DA 3VYVA 4ZYVA 4C0WA 1X7GA 1HE1C 2RKBA 2P11A 2Q50A 1E89A 5I7RA 4HAYA 3KFXA 4FXOA 4TSFD 5FFMA 2P3SA 3T52A 3KETA 4LXGA 4H3KB 3JWJA 2WWTA 4Z3KA 3N75A 4F4JA 1B23P 4BMOB 5B1HA 1ZS9A 2Z95A 4RABA 3T9EA 2FJPA 1BVYF 2W6OA 5BT9A 1SCBA 4D41A 2AJTA 2NUTB 3OEED 7MHTA 1L5SA 1M9NA 1PT8A 2RGYA 2QRQA 2BHLA 5JCOC 1GYRA 2Z4RA 3AY0A 5C4IA 3ROFA 3OIDA 3IKJA 3Q3CA 1IHYA 1Z7WA 3TE6A 4LV5B 1LDGA 3D54D 2RH4A 4K1XA 4KOAA 1N0HA 1Q0QA 4G23A 4LHWA 3ZY4A 3GFPA 2ZWMA 4V3CA 5EJ2A 3KUDA 1X8LA 4BV9A 3C48A 2X9LA 1QYIA 1ENYA 1TVEA 4OQLA 3T5DA 4B09A 2W6ID 1V7QA 1ZAKA 2JLBA 3O8OB 3PENA 3DPIA 1EVQA 1IFXA 2HJSA 3V7WA 3BE4A 1MGPA 4DXHA 1O6ZA 1GQRA 3ELUA 4WY2A 1YSCA 3CUYA 2EWMA 2AVDA 3WRVA 3Q0IA 4RXMA 5DBHX 3FYCA 4YXWD 3A04A 1XTVA 3ZWPA 5KHLB 2JJMA 4OD0A 3W3AD 4QPZA 2IXDA 3RSFA 4D5EA 3QX9A 4M49A 2WTAA 1FVFA 4HBZA 4BZQA 3EPLA 2F67A 4LNAA 1WMAA 4U6NA 5LVAA 1AHHA 2E3JA 2FE4A 4HVCA 3IXMA 1G9TA 3OEHD 4E5PA 1QG4A 2VK1A 1NUAA 2A0FA 6NULA 2C7RA 4D4HA 3M3PA 3AI3A 1NBOA 4TYNA 1PTJC 2VPZA 2EP7A 4J7AA 4XRRA 5G41A 4E94A 5HF5A 3E5NA 1Z6PA 2YJ6A 3MW8A 1R4MB 1DSSG 2PX4A 3IIEA 4DDUA 1G20E 2PWBA 2VDMB 2C8VA 2WDPA 3FTQA 5BR7A 5C81A 1NDHA 3AY7A 4OFBA 1OI7A 4JB3A 4GLBA 1U4OA 3NANA 4KL8S 4B81A 1DX9A 2M9MA 4RF2A 2RE8A 3IOCA 4WESB 2NV2B 5DM60 2YXPX 1YQTA 3LBAA 3OETA 4DSZA 4Q7QA 4B3BA 4MKRA 5BUCA 1LS6A 4I5IA 2QF7A 1V71A 4CN9A 3BT7A 4BB5A 4XZ3A 4BPRA 5ECWA 4ZAVA 2TS1A 3AHDA 2DYKA 3HEBA 3QKRB 4LUCA 5FEUA 3IPYA 1JA0A 1TUIA 3AIIA 1OZGA 1X7ZA 4QDXA 4Q1VA 4WOKA 3WDLA 3L49A 4H3HB 3U3DA 4AJEA 4DLNA 1AO0A 1SHZA 3VKVA 1AMOA 2HUNA 4DBLE 2OCAA 4LJ7A 2JGEA 1CY0A 3ZQJA 3VU9A 3UAWA 1VLJA 3UZUA 5FDFA 1FDIA 3R7LA 3PJGA 5C8ZA 5HJEA 2W93A 1EIZA 1GJRA 1VXOA 3C3CA 3MWDB 5EKUA 5F51A 1YIAA 1FSSA 1OR8A 2PT7A 4L50A 1RWWA 5IJWA 4ETMA 5IYZF 5FBZA 2K2WA 2O0KA 3TL3A 5L51A 2ZP1A 3OT1B 3DP7A 1YU9A 1VLHA 1YVRA 1UQRA 3DOIA 2RHCA 1P1RA 3L7YA 1YOVA 2YWHA 2M6KA 4DSUA 1LFDB 1TYDE 1GP2A 1GN8A 3ES9A 4JITA 3ABOB 3CSUA 3H65A 1RYEA 2YHIB 2X9VA 1A5BB 5HJ2A 2CT8A 3F6PA 3IHLA 1QLHA 3ONFA 4PCLA