5DB9A

Structure of human dna polymerase beta host-guest complex with the n7mg base paired with a dg
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 108
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5db9A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5db9A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5db9A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5db9A03
5C5JA 2KFZA 3TQ1A 1S97A 3HJ1A 4O3QA 7ICVA 7ICQA 9ICVA 3IHQB 1C7YA 4DQSA 1UA1A 7ICLA 4RWOA 5J0OA 5KFKA 5DKWA 2DR5A 2LYHA 8ICEA 1ZQZA 3BQTA 3FDSA 4M6WA 1UA0A 3KHRA 3ORYA 3PNCA 3PX4A 5CA7A 1ZQTA 4DSIA 2C2DA 5IIIA 9ICNA 3RTVA 4UD5A 4C8LA 4RWPA 3H8WA 1U9LA 3G6VA 4YR3A 4M9JA 3T5LA 1KLNA 4PHEA 4KLDA 4NLNA 1JIHA 4Q8FA 5HMLA 5KG7A 3C2LA 3UXPA 4DLEA 3PX6A 5KFOA 1ZQKA 1WCNA 3LK9A 5J2IA 4EZ6A 4KTQA 4DFKA 1XO1A 5EWGA 2ATLA 1H38A 3ZDBA 4QWEA 4WC5A 2M2WA 5DLFA 3ZDCA 4I2HA 3BDPA 4WC3A 2PFNA 4PHDA 2HVHA 4I2DA 5IIJA 5KT4A 4DL6A 5DQGA 4I2AA 1XSPA 1QSLA 4I2JA 3SV3A 3PO4A 5IILA 5D4BA 3L9DA 4Z6DA 1NK8A 8ICPA 4LT6A 4P2HA 5KG2A 2IMWP 3C21A 4YFKA 5TZVA 3G6XA 4EEYA 3UXNA 2FLLA 3NGDA 1KSPA 4YVZA 4DSFA 4B9TA 4EZ9A 3RJEA 3B0YA 2XY5A 3ZDDA 1KTQA 4ED2A 4XQ7A 1ZQCA 3OUYB 5HC9A 2BR0A 5DGAA 9ICUA 4RQ8A 1KFTA 5DBAA 1L3TA 1ZQVA 4DFPA 1VFGA 5EOZA 5J0UA 5J2BA 2UVVA 4M5DA 5J0QA 4AT8B 2FPKA 5BOLA 4YR0A 4QZDA 1NJWA 4DL4A 8ICJA 2PI5A 4PGXA 4O9MA 4F4YA 3ISCA 5HRKA 1NJZA 5KFTA 3MR6A 3EPGA 3RH6A 1V4AA 3KHLA 3C23A 4QW9A 3SV4A 2BKEA 4DLGA 1SL0A 5KT6A 3Q8RB 5IINA 1MIYA 8ICFA 2NRXA 2VANA 5F2VO 5HRIA 1KNYA 5KFYA 1Z00A 5DBBA 2W9BA 1B43A 4EBEA 4K4HA 4I2GA 4GLXA 3G6YA 5CJ7A 2KZZA 8ICRA 5DQHA 9ICEA 2RFFA 2MAXA 4QW8A 5L1LA 1JXLA 2KZ3A 2R8HA 3N4MB 8ICSA 4CCHA 3BQ2A 1HUZA 3ETLA 3JPSA 7ICRA 1PX5A 4ECXA 4DF4A 1NK0A 2IHMA 1X9WA 3K75D 4RWQA 4BXOB 4NLKA 7ICTA 4IQTA 5IIKA 4FS2A 5J0PA 4YXMA 5KFBA 4F93B 1WOTA 4FH3A 4LVSA 4UBBA 1OU5A 4RQ0A 4QWDA 5DG9A 1TFRA 5KFAA 5KFUA 3PMLA 1TAQA 3RBEA 3OHBA 3C1ZA 1NK4A 1U47A 2XGPA 4ECQA 4IRCA 1X2IA 3AU2A 2VA8A 4KMUA 4RQ7A 4GXIA 3TI0A 5KFFA 2BCVA 5DQIA 5BOMA 1TK0A 5F9NA 2W9AA 2BCSA 2PFPA 5L1JA 4LZDA 1UEVA 4X4UA 5KG0A 5DB6A 4IQVA 3GIKA 3JPNA 3PY8A 2BQ3A 2UVUA 4EBKA 4KITB 2FPMA 4AT8A 4G3IA 4RNNA 3V7LA 4PGQA 3IM1A 4MEXA 4IQWA 2F1IA 4QZHA 4DS4A 7ICHA 5KFHA 4J9PA 1TAUA 4RT3A 3TFRA 4ATBA 1RZTA 1ZQJA 1ZJNA 5KFIA 8ICUA 2A1JB 4RPYA 3JPQA 1BPZA 8ICBA 4YD2A 2ZUBA 4F5RA 4FHWA 4ED6A 3LQCB 4O3PA 4DS5A 3PW7A 4XA5A 4DSEA 3UQ2A 4ZH4A 2WTFA 2DVIA 4P4PA 3MR3A 1D8YA 4FHXA 4RQ6A 4TUSA 3RB0A 9ICHA 2F1JA 2P66A 2HHWA 5DB9A 8ICIA 1B22A 5HRDA 2MUTB 4RQ2A 3GILA 2R8IA 1SKRA 1ZQOA 8ICGA 2H5XA 1BNOA 1MIWA 4B9UA 3K4GA 5KFRA 3ISBA 1BGXT 2BQUA 7ICJA 1MQ2A 1R8AA 1TFWA 1DK3A 4X4VA 1ZQXA 3N97B 4MFCA 3GV7B 3TAPA 4PHAA 3KHGA 2ISPA 1TVAA 1UT5A 2FMPA 5J0RA 4Q8EA 4ED3A 4UAWA 4DL7A 3RAXA 4J9NA 7ICKA 3UPQA 8ICTA 9ICKA 4I28A 2ZH7A 5KFLA 2BPGA 3OJUA 4C8NA 4KN4A 4M0AA 3H39A 3KHHA 5KFPA 4M2YA 2FLNA 4AT9A 1NK5A 4J9QA 4DL2A 9ICLA 2ZTCA 4UB3A 9ICMA 4QZ8A 4EYHB 3QEBZ 2ZH6A 3WFSC 1L3VA 4X4NA 3JPTA 2C2EA 3GFKB 2F1HA 5EWFA 1TK5A 1NKEA 7ICMA 3OV7A 4KLFA 4J9MA 4DFMA 1SKWA 5KFXA 5J0WA 4HYKA 5HRHA 9ICPA 1N48A 4YN4A 4DO9A 9ICCA 1AROP 3OJSA 5KFNA 4ECWA 2KTQA 7ICGA 4MFAA 5KT7A 3TFSA 4X0BA 4RWNA 5HP4A 3AUOA 2DR8A 4QWBA 1JMSA 3T5JA 4I2EA 4FHVA 5J29A 3RB4A 4JUZA 3WFQE 8ICMA 5KFEA 1RYSA 5HHHA 3Q8KA 4F4XA 3RAQA 2FMQA 2XY7A 4Z6CA 4IG8A 4WBZA 3MDCA 4WC1A 4YCXA 4RUCA 3ISDA 5KG3A 4RNMA 3OSNA 1RXVA 4Z6EA 4WBYA 1S9FA 3JPRA 5HRGA 2JEIA 7ICSA 5J2KA 3RJHA 4R8UB 3WFPA 2ZUDA 4DQRA 4PGYA 3TAQA 4YG2A 5KFZA 2GWSA 1BPBA 4DWIA 1FA0A 5EWEA 4F2SA 2DRAA 2BCUA 1U4BA 3TANA 2NRWA 5F9LA 4KLOA 3HW8A 5KT2A 1ZQHA 4ELTA 3SZ2A 7ICUA 1Q79A 4E7XA 3C66A 1ZQNA 3AQLA 3H8JA 3HIYA 2ZJ5A 3QZ7A 1NK6A 4GC6A 3GIJA 1TKDA 1ZQDA 4R66A 9ICBA 8ICAA 4ED0A 1ZJMA 3MABA 4QWAA 4DQPA 3M9OB 9ICFA 8ICZA 1RXWA 1PZNA 2V9WA 5KG1A 8ICQA 4QWCA 3LWMA 3EZ5A 1N56A 2PXIA 4ECVA 2IBKA 4AT7A 5KFGA 5BPCA 3GV8B 3BQ1A 5KG4A 3BQ0A 4F4WA 3THVA 5J0SA 4O0IA 3MR2A 3RJFA 4B9LA 2FMSA 9ICXA 5HREA 1SL1A 4O3RA 1K1SA 1K1QA 4DL3A 1QTMA 4YP3A 1ZQUA 2Q0ZX 3PV8A 1NZPA 4ED8A 4PH5A 1XSLA 2P6RA 1X9SA 5DDMA 4ECTA 1ZETA 4P4MA 1ZYQA 3PR4A 4J9LA 4EBDA 1X9MA 4JV0A 2BDPA 3RJGA 4ED1A 7ICIA 1NK9A 1S0MA 4NY8A 4AT9B 3C1YA 1S0NA 2R8GA 1LB2B 8ICOA 2ZJ8A 1DOQA 2AGQA 5DDYA 1LV5A 3HP6A 3GIIA 2AGPA 2BPFA 3M9MB 2ASDA 2C2RA 3PO5A 1S76D 3ZD9A 1VJ7A 4UAZA 4R64A 2W9CB 5DB8A 9ICAA 3NYBA 4KLMA 2I9GA 4KN7A 1ZQAA 4K4GA 4X4TA 2I1QA 1EXNA 3GDXA 4ECYA 3AQKA 1JX4A 5KG6A 4TUPA 1ZQLA 1U49A 2V4QA 1WCLA 3C18A 2ZHAA 1ZQPA 4RPXA 1BPEA 2KN7A 2C22A 2BCRA 4FBUA 4FBTA 4B9MA 2PFQA 3C5FA 4F3OA 3SI8A 1CEZA 9ICSA 4I2IA 2ASLA 2KP7A 4X4SA 4P4OA 9ICOA 3EYZA 2DR9A 1RPLA 5IIOA 2JEGA 3H4DA 5HRFA 4F4KA 4RQ4A 3V72A 1TV9A 2R8JA 3RB3A 5DG7A 4KLGA 4MF2A 4RT2A 3RRGA 3V7KA 2AQ4A 4YMOA 1DK2A 5J2AA 3M9NB 3PR5B 2ZH1A 8ICWA 1NOMA 1U45A 3KTQA 1S10A 4F8RA 1BVSA 5J2JA 3H38A 1UT8A 3B0XA 4JK1A 1IM4A 3MGHA 3HPOA 1NKBA 3MBYA 3UXOA 3ZDEA 5JUMA 5J0XA 3MDAA 2KZMA 7ICPA 9ICGA 2R8KA 8ICXA 5J0YA 4QZGA 5HMMA 3H40A 4F2RA 2PFOA 1L5UA 3HWTA 4DFJA 3GIMA 4ATBB 2BE3A 1S0VA 5KFCA 3HT3A 2A1JA 1SKSA 2J6SA 3OUYA 1T4GA 3C5GA 3PVXA 3ZDAA 3SYZA 1SZPA 2ALZA 5KTQA 1V9PA 1XU4A 3ZD8A 4EBJA 3WFRE 3OVBA 4O3NA 4WC4A 4RQ3A 3C2KA 4ECSA 3RH4A 3RR7A 4QZAA 4IRKA 4KLHA 4WC2A 8ICKA 4X0AA 4M9LA 2NRKA 4M47A 3PW0A 2ZHBA 4BWMA 4DF8A 3GQCA 4I2CA 4RPZA 4JWNA 2VA3A 3EPIA 1MIVA 3JPOA 5CB1A 3EW9A 4F5PA 2ZH4A 3PW2A 4TQSA 4E80A 4UBCA 4XRHA 3OGUA 3H4BA 4O5CA 4KLEA 9ICTA 4UB2A 3JZ0A 1ZQGA 2M2UA 3OHAA 1QSYA 3M8RA 4MFFA 2PBEA 2ID1A 3RB6A 2JZBA 7ICOA 2W8KA 5D49A 2NRTA 8ICNA 2HHSA 4DL5A 5DECA 4DSJA 1D8LA 4I27A 2J6UA 3RJJA 1UETA 4E8FA 4F91B 4NKTA 1R8CA 3MGIA 4NLZA 2ZH8A 1IXRA 5L1IA 4NM1A 8ICYA 2ZH2A 2XO7A 1BPYA 3UQ0A 4ECZA 1D9FA 4QZ9A 4M9HA 1JAJA 4J9OA 1JQRA 2Y1JA 4UAYA 4IR1A 5J2HA 2AJQA 4IQUA 4Q44A 3PX0A 1T3NA 4X4OA 3OVAA 4FO6A 3EWAA 5IIMA 1XS9D 2RDJA 3JPPA 1RYRA 4JV1A 2M2TA 5DG8A 1D9DA 1ZQSA 4B9SA 5HHIA 4KLUA 2IA6A 1ZQRA 4PPXA 2HVIA 5J2DA 3RR8A 4YMNA 1ZQFA 1A77A 3H7IA 2HHVA 4NKUA 3T5HA 4R8UA 1ZQIA 3LWLA 3V6HA 2DPIA 4M04A 9ICJA 2ISOA 2ZH3A 2DFLA 2M2VA 3V6KA 1XSNA 2DR7A 2ZJAA 4TUQA 2ASJA 2ZUCA 4GXJA 1A76A 1CUKA 5KT5A 2BPCA 5J2FA 4C8KA 4DSLA 4F5OA 2XCAA 2Y1IA 4I2FA 3OVSA 1NJYA 4IRDA 2BHNA 1BPDA 3NTUA 4F92B 5DGBA 4UB4A 4O5KA 4RUAA 3WFOA 4FHYA 4RQ1A 3JYYA 1MC8A 4BGDA 4F5QA 4ELVA 4GXKA 4DOAA 4J9KA 1NJXA 4BWJA 5KFVA 4RU9A 2XCPA 3RJIA 1MSWD 4Q43A 3RH5A 4QZFA 4UB5A 4M9NA 4AT7B 4WC6A 4X5VA 2ZH5A 1ZQBA 3AU6A 4XQ8A 2JEFA 1R89A 4EP7A 2MUTA 4J9SA 4F5NA 2ZTDA 5CWRA 5HRLA 2HHPA 2Q66A 5J2GA 5D46A 4QZIA 4F4ZA 4BDPA 8ICVA 9ICWA 2O5AA 5KFQA 3PMNA 3QEAZ 3OSPA 4RZRA 2BQRA 2AQ0A 1S0OA 4KLLA 1QLNA 7ICNA 9ICIA 3H3AA 3UPSA 3PW4A 5KFSA 2IHNA 4O3OA 4XUSA 5L9XA 4DOCA 5DB7A 4TURA 3TARA 5L1KA 3QE9Y 2FPLA 1DGSA 4YMMA 3PW5A 2W8LA 3H37A 4X4QA 5KFWA 8ICCA 5KG5A 7ICFA 1Z3EB 5CHGA 1KRPA 4BXOA 4O5EA 1KFSA 5DEDA 4S3NA 4WC0A 2W9CA 4RNOA 2ZTEA 2JZBB 4GC7A 2C28A 4B9VA 1YLQA 4QZCA 4Z6FA 2XY6A 4JV2A 4KLQA 8ICLA 1JXEA 5CP2A 4FH5A 1F5AA 2M9NA 4M6WB 3C2MA 4F50A 4RQ5A 4DQQA 3Q8LA 2VA2A 4KLSA 2HHUA 1ZQEA 4DEZA 5J2CA 3HJ4A 1NK7A 1UEUA 2P6UA 1NKCA 3BJYA 2BCQA 2J6TA 2PI4A 1QSSA 2HHQA 1Q78A 4NLGA 1KFDA 1KDHA 2KFNA 5HNKA 2HHTA 1XC9A 1COOA 3Q8SB 9ICRA 1TFYA 5HRBA 4X4RA 5DBCA 3HX0A 4WCWA 3MFHA 4YR2A 1NO5A 2HHXA 4KLIA 5KFMA 4R65A 2W9MA 4YD1A 3M8SA 4ECUA 4UQGA 2JEJA 4K4IA 4WC7A 4I29A 9ICQA 4DQIA 4DSKA 4Q45A 1ZQQA 3V6JA 1XWLA 1ZQYA 4JWMA 4QZBA 2XC9A 2DRBA 1MQ3A 4KLJA 1JN3A 4ED7A 3H8SA 4C8MA 1L3SA 2UVWA 4EYIB 1ZQWA 1KEJA 5J0TA 1S77D 4UD4A 5J2EA 2RDIA 4PHPA 4O3SA 7ICEA 4R63A 2NRZA 2NRVA 4MEYA 4UB1A 4C8OA 4KLTA 3RJKA 2HW3A 1R8BA 2O1PA 2UVRA 1L3UA 4NM2A 4FHPA 4B9NA 2XGQA 1Y88A 3MFIA 4ECRA 1SL2A 2ZH9A 5KFDA 4QZEA 5CR0A 4YQWA 3Q8QB 3T3FA 2OWOA 4E0DA 3RRHA 3LDAA 3AQMA 5DLGA 4TQRA 4IR9A 5HR9A 1TK8A 1ZQMA 1BNPA 3T5KA 1BPXA 4X4PA 1Z00B 5KT3A 1HUOA 4DOBA 2BGWA 2W9BB 2DPJA 4ELUA 3GV5B 3AQNA 4YXJA 2V4RA 2AGOA 3E2EA 4FS1A 3V7JA 4M9GA 3FYHA 1U48A 4MF8A 3Q8PB 3Q8MA 1HJPA 3MR5A 4NXZA 2FLPA 3QZ8A 4EBCA 2AU0A 4J9RA 1T8EA 4LZGA 3RBDA 2B21A 1T7PA 5KFJA 8ICHA 4I2BA
chains in the Genus database with same CATH superfamily
4NJ8A 2KFZA 5ALJA 3QUQA 3HJ1A 7ICQA 5B3QA 3IHQB 1ZOLA 4RWOA 1ZD5A 5J0OA 2DR5A 1ZQZA 3NWIA 4N7RA 5CA7A 4UD5A 4YR3A 3NRWA 5HMLA 2PMZF 3UXPA 1ZQKA 1L7MA 2ATLA 5ALGA 1QQ5A 2M2WA 3FC4A 1WUDA 1F5SA 4I2DA 5KT4A 3BZKA 1PVQA 8ICPA 2A1AA 4BUGA 5KG2A 1PK1B 2YMLA 3M7DA 4EZ9A 4YVZA 4X4SA 3B0YA 3DDHA 3BQ7A 2BR0A 1Q3VA 1ZQVA 3D2NA 4M5DA 2UVVA 1Z4OA 5ALMA 4LEVA 5AI4A 2PI5A 4F4YA 1ED1A 1V4AA 3SV4A 4MKPA 4OD0A 2F8KA 2OH2A 5AKXA 3Q8RB 5KFYA 3C28A 4I2GA 3G6YA 5EE3A 5DQHA 1JXLA 8ICSA 4JB3A 3BQ2A 3ETLA 5KNIA 1ZXIA 3F2BA 4BXOB 2HCFA 4NLKA 2BBJA 4F93B 3LVWA 1FFVA 5KFAA 3PMLA 5ALHA 1TAQA 3C1ZA 4CF5A 2XGPA 2QARA 1X2IA 5HR6A 4K97A 2BCSA 1UEVA 3SENA 3OPXA 3JPNA 2UVUA 3V7LA 4MEXA 3UMCA 1TAUA 4ATBA 3QU5A 2A1JB 1ECWA 4YD2A 4O68A 1J2MA 4DS5A 5CHEA 2DKZA 2WTFA 4FHXA 3PSFA 5K4LA 1B22A 2MUTB 4RQ2A 1BGXT 4AP9A 4X4VA 1VJ5A 3N97B 1WYGA 4PHAA 3KHGA 5JRTA 1TVAA 4P0QA 5L1MA 4NXUA 3RAXA 4DL7A 3UPQA 9ICKA 4I28A 4Y2VA 1NNLA 3H39A 1IIPA 9ICLA 2ZTCA 4EYHB 2C2EA 2HBLA 1TK5A 4DFMA 1SKWA 2DWQA 4HYKA 4PL2A 4YN4A 1UHUA 1AROP 2M0NA 3OJSA 2KTQA 5KT7A 3AUOA 2DR8A 2LYBA 5J29A 2LBOA 5KFEA 1RYSA 5HHHA 3Q8KA 4F72A 4IG8A 3MDCA 4WC1A 4RUCA 5KG3A 2EAOA 1RXVA 4IS7A 5AM2A 7ICSA 2F44A 3WFPA 4GFJA 2GA9D 3S6JA 3TAQA 5KFZA 5EE1A 2DRAA 1PUZA 3ERCC 1U4BA 3AQLA 3H8JA 2VIXA 2ZJ5A 4GC6A 1PVRA 8ICAA 1ZJMA 1IG6A 3M9OB 4FO1A 2V9WA 5ALSA 3LWMA 1N56A 2IBKA 3GV8B 3THVA 5KG4A 3BQ0A 3BS5A 4DL3A 2Q0ZX 5AKZA 4PH5A 1XSLA 3ER9B 2KVCA 5DDMA 4ECTA 4IC9A 1ZYQA 5KAIU 2DBYA 4ED1A 1NK9A 1S0MA 2JR5A 5DDYA 3GIIA 2C2RA 2W9CB 2BBHA 2I9GA 4ECYA 2NO5A 1WCLA 1ZQPA 2W3SA 2KSOB 2C22A 4FBUA 2PFQA 3C5FA 9ICSA 2DUYA 2KP7A 5AKGA 9ICOA 1WWUA 3EYZA 1RPLA 5HRFA 3V72A 3WK4A 1TV9A 4MF2A 1X6JA 2YX8A 3V7KA 2W54A 1DK2A 5J2AA 1NOMA 4F8RA 4LEYA 3WKAA 3H38A 3FM9A 2IOFA 3HIYA 5AKJA 3MDAA 3H40A 2PFOA 5AKYA 4DFJA 2IUBA 3OUYA 5ALUA 5AIAA 2K4PA 3ZD8A 4RQ3A 4ECSA 3RR7A 1L7PA 4WC2A 2B4VA 2NRKA 5AKHA 2G09A 1HEKA 2VA3A 5CB1A 1Z4NA 1JI7A 4UBCA 5ALQA 3JZ0A 3F5AA 2PBEA 7ICOA 5AKIA 1RYUA 2D8CA 2WF8A 1L7NA 4E8FA 4F91B 4NKTA 5L1IA 4NM1A 1BPYA 4QZ9A 1JAJA 3SQIA 2QB1A 4IR1A 3OVAA 3EWAA 1XS9D 3MGVA 1YZ6A 2KSOA 5JTIA 1D9DA 1ZQSA 3WK5A 2IA6A 2ZIVA 1ZQFA 4R8UA 1ZQIA 2ZH3A 3V6HA 1A0PA 1XSNA 2YN4A 1V38A 3IN5A 2E8OA 4GXJA 5TISU 4C8KA 4DSLA 3IP4B 2XCAA 4I2FA 3OVSA 2WF6A 4UB4A 1MC8A 2PKEA 1S8OA 4ELVA 3WK9A 5KFVA 1MSWD 2OXOA 4WC6A 2ZH5A 3N7SC 4FZMA 4NXTA 3QU9A 1R89A 2KVSA 2BDUA 5CWRA 5HRLA 2HHPA 3PSTA 2O5AA 3ER8C 7ICNA 1SB3C 4XUSA 2I6XA 5L1KA 4YMMA 1Z1VA 5KG5A 3F53A 4Y2QA 5CHGA 4BXOA 1O03A 4OCZA 4GC7A 4RNOA 3WKDA 2JZBB 4EGWA 4QZCA 2XY6A 4KLQA 3AM9A 1DXSA 5CP2A 2W03A 5J2CA 2L5YA 2PI4A 4JLXA 1QSSA 2KJ9A 2YB4A 1X66A 2W43A 3Q8SB 3CYMA 3NVYA 2JEJA 2H3QA 3N7PD 9ICQA 4DSKA 1XWLA 2DRBA 2UVWA 1S77D 3HILA 4PHPA 2FCLA 3KBBA 5T14A 4KLTA 2HW3A 4OJ6A 4C8OA 3RJKA 3U26A 1SL2A 2ZH9A 5KFDA 4QZEA 4YQWA 3L3FX 1X6IA 3T3FA 4E0DA 2E8NA 3LDAA 5DLGA 2HMXA 1BPXA 2MU2A 3AQNA 2NV3A 2HBJA 3V7JA 3Q8PB 3Q8MA 3MR5A 2FLPA 2KJ5A 5KFJA 3TQ1A 7ICVA 4DQSA 1UA1A 7ICLA 3NASA 2LYHA 3BQTA 4M6WA 3KHRA 3PX4A 4DSIA 9ICNA 3H8WA 5G5HA 1U9LA 4M9JA 3T5LA 4NLNA 4AT8B 1JIHA 1UEUA 3PX6A 5AI6A 4KTQA 5J2IA 5D63A 5EWGA 1H38A 2RHFA 2JH1A 3BDPA 5CRXA 4Y2TA 4I2AA 3H0MB 1PK3A 4I2JA 3SV3A 1XSPA 5IILA 3L9DA 2KIVA 3SAHA 2IMWP 5TZVA 3G6XA 3M6ZA 4WC3A 3UXNA 4B9TA 3NGDA 1KSPA 2F8LA 4XQ7A 2XY5A 3ZDDA 1KTQA 4PZNA 5DGAA 9ICUA 1KFTA 5BOLA 4QZDA 4O9MA 5HRKA 3ISCA 4AYBF 2A19A 3MR6A 4NL9A 3EPGA 4RQNA 3KHLA 2BKEA 2EZZA 2W3RA 1SL0A 5F2VO 5HRIA 4EEDA 5L1LA 2KZ3A 2R8HA 2GLEA 3N4MB 1LKYB 1HUZA 1SXEA 3PZPA 4LVSA 1TFRA 2GO7A 2XVTA 1U47A 4IRCA 3TI0A 4KMUA 3IV6A 5BOMA 1TK0A 2BCVA 2W9AA 2QB0B 5L1JA 4LZDA 5B3PA 5KG0A 2W55A 2KNJA 2BQ3A 2Y9TA 4EBKA 2FPMA 4RNNA 4PGQA 7ICHA 4QZHA 4DS4A 5KFHA 3CP8A 1RZTA 5KFIA 8ICUA 1UQVA 3JPQA 1BPZA 5ALFA 4F5RA 4CRXA 4FHWA 3LQCB 3NVZA 2W7PA 4F71A 3HRDD 3QUBA 3UQ2A 4P4PA 3MR3A 5ALWA 4QNLA 4TUSA 2F1JA 2HHWA 4UD4A 3GILA 1BNOA 3WK6A 4B9UA 3QUCA 3ISBA 1MQ2A 1DK3A 4WJ3B 1ZQXA 3ZI4A 2ISPA 1UT5A 2W7OA 3L5KA 2ZH7A 5KFLA 2LHTA 4C8NA 4KN4A 4DFDA 2FLNA 1NK5A 2ZH6A 4QZ8A 3QYPA 3N7RC 1L3VA 1CRXA 4LEZA 7ICMA 1ZQ1C 2ESEA 5KFXA 5HRHA 4NXWA 1JALA 3NS1A 1N48A 5KFNA 7ICGA 4MFAA 3TFSA 1N60A 4I2EA 4FHVA 3WFQE 4EENA 4F4XA 1RG6A 4WBZA 4C7YA 3OSNA 4UW9A 2JEIA 2ZIVB 5J2KA 4R8UB 3AEVA 4DWIA 5EWEA 1Q3UA 5KL1B 2NRWA 4KLOA 4FH5A 1QH9A 2EWRA 3SZ2A 1WG8A 3NKUA 1ZQNA 4FFDA 1NK6A 1TKDA 5KL8B 4ED0A 1RXWA 2KIWA 4EELA 4LEWA 1S5LU 8ICQA 4QWCA 5GTHU 4K8VA 4PL1A 5AHXA 5BPCA 3BQ1A 4F4WA 3NRZA 5J0SA 5HREA 5ALEA 3F2CA 9ICXA 5ALZA 1QTMA 4Y2JA 4YP3A 2LM1A 3PV8A 4US8A 4UB8U 4NXVA 4EBDA 1X9MA 4JV0A 7ICIA 4NY8A 3C1YA 2R8GA 2ZG6A 8ICOA 1DOQA 2KG5A 1LV5A 2ZIUA 3PO5A 1XNSA 4UARA 5DB8A 4KLMA 4KN7A 1ZQAA 4K4GA 4X4TA 1EXNA 2KKPA 1JRPA 1DRGA 2YTUA 4TUPA 1ZQLA 3C18A 4RPXA 2KN7A 1CEZA 2ASLA 1N2XA 2DR9A 5IIOA 1F0MA 1VLBA 5AI8A 5D61A 2AQ4A 4O67A 3M9NB 8ICWA 1U45A 3KTQA 5J2JA 3H8MA 4Y2UA 1ZD3A 4X4PA 5JUMA 7ICPA 3KZIU 5J0YA 2K4HA 3E0FA 4WQKA 3GIMA 2QKQA 2DQNB 1SKSA 3IG8A 1T4GA 3C5GA 1TAMA 2E8PA 3ZDAA 1V9PA 4EBJA 4O3NA 3RH4A 4M9LA 1J2NA 3QU4A 3EF2A 1ZD4A 3C29A 2LI6A 4I2CA 3GQCA 2G5IB 1MIVA 4QJFB 3EW9A 2ZH4A 5ALIA 4KLEA 3E58A 4UB2A 1ZQGA 3OHAA 1GPJA 3RB6A 2ID1A 3TKAA 5D49A 8ICNA 2HHSA 5DECA 4UB6U 4G9BA 3RJJA 4NLZA 2ZH2A 4J9OA 1JQRA 2YQEA 2AJQA 1T3NA 4C4SA 4X4OA 2O6KA 4P0PB 1L6NA 4OO1J 1A77A 4NKUA 3V6KA 2DR7A 2ZJAA 3N28A 4Y2PA 1WWVA 2YMQA 2BHNA 3NTUA 4F92B 3WFOA 5C0YA 4RUAA 1OW5A 4RQ1A 4BGDA 4F5QA 1NJXA 4BWJA 4GIBA 4RU9A 3RJIA 4UB5A 1M6YA 2VKQA 2XI9A 3AU6A 4XQ8A 2JEFA 1D8BA 1RQNA 3WKBA 5D46A 4BDPA 5KFQA 1N5XA 5AK5A 2JHDA 9ICIA 4KLLA 2AQ0A 3UPSA 2ZXHA 5DB7A 2CPRA 1DGSA 3T79A 2ES6A 3PW5A 4X4QA 2W8LA 1YT3A 4S3NA 3KOOA 4K99A 3M6KA 1O08A 4WC0A 2W9CA 4B9VA 1MA7A 8ICLA 4JV2A 4C80A 2HHUA 4RQ5A 4KLSA 4QIWF 2HHQA 1KFDA 2OHFA 4JLZA 2HHTA 2QB0A 3QUTA 5HR7A 1TFYA 1COKA 3HX0A 4WCWA 2B51A 4KLIA 4R65A 2EZXA 4WC7A 4Q45A 1ZQQA 4C7ZA 4JWMA 4QZBA 2N1RA 4ED7A 1L3SA 1KBUA 1KEJA 3QU7A 4NLBA 2W11A 4UB1A 2NRZA 4P0QB 1R8BA 4OJLA 1Q46A 1Y88A 2JRZA 2HOIA 5CR0A 2OWOA 4B6JA 5HR9A 3T5KA 4MHVA 5ALNA 1Z00B 5AM3A 2W9BB 2K89A 2AGOA 4Y2RA 1SWWA 2D6FC 4RQMA 4UASA 1SIJA 2H3ZA 3HKZC 2LKYA 4KX3A 4J9RA 1YZ7A 2KMDA 1T7PA 4KB6A 8ICHA 4I2BA 5C5JA 2LYAA 2AXTU 2ZIWB 1S97A 4O3QA 4CE6A 2E5SA 2QARB 5KFKA 3FDSA 1NZBA 2ZXIA 4C8LA 3SMVA 2MA1A 4PHEA 1KLNA 4Q8FA 5KG7A 4DLEA 5KFOA 4EZ6A 3AQFA 3KKAA 1XO1A 2PMZC 3SEIA 5DLFA 4XJEA 2HVHA 3UM9A 5ALPA 4OJ5A 1QSLA 5D4BA 4Z6DA 1NK8A 4LT6A 4P2HA 1JROA 4ICAA 2FLLA 4EEYA 9ICGA 4DSFA 2YMMA 4ED2A 5HC9A 1ZQCA 1FIQA 2WB1F 4NV0A 1VDVA 4DFPA 5EOZA 5J0UA 5J0QA 3KZXA 1NJWA 4DL4A 8ICJA 5F3XB 1NJZA 5KFTA 3RH6A 4QW9A 2E3TA 4DLGA 5IINA 1MIYA 1UCVA 8ICFA 2JH7A 2VANA 3KFUF 1Z00A 2W9BA 1B43A 4EBEA 2B6GA 4KM5A 5AK4A 5CJ7A 2KZZA 1KW4A 8ICRA 9ICEA 2RFFA 2MAXA 4QW8A 4CCHA 5B5EU 2NO4A 4DF4A 2IHMA 7ICTA 4OJPA 5IIKA 5EE9A 4YXMA 5KFBA 1WOTA 2ZIUB 2A3VA 1OU5A 4RQ0A 2ZIWA 5KFUA 1NK4A 2G06A 1B4FA 2VA8A 4RQ7A 4GXIA 5KFFA 4M0AA 4X4UA 5ALOA 4IQVA 3GIKA 4EV6A 4KITB 2E8MA 3IM1A 1ZQJA 4Y2XA 2H3IA 5AKKA 4RPYA 8ICBA 2ZUBA 4O6AA 1F44A 4XA5A 4OAGA 2DVIA 2FDRA 1D8YA 2G5HB 2Y0SF 2EDUA 3RB0A 9ICHA 2P66A 5DB9A 3I28A 3H0LB 1ZQOA 2R8IA 1MIWA 3K4GA 2BQUA 1R8AA 3BS5B 3GV7B 4PJ0U 3TAPA 2XICA 2DKXA 2FMPA 5ALXA 5J0RA 4Q8EA 4UAWA 3WKCA 7ICKA 4J9NA 4FZLA 1N5WA 4QIWC 2BPGA 1Z1BA 5KFPA 4M2YA 4AT9A 5JU5A 4DL2A 4UB3A 9ICMA 4X4NA 3QEBZ 2OM6A 3QXGA 3NVVA 3JPTA 2MRLA 3OV7A 4KLFA 4J9MA 1T3QA 2RLTA 1KQQA 9ICPA 4IL6U 1ZD2P 9ICCA 2EAPA 5ALDA 4ECWA 2RQ5A 4QWBA 1JMSA 3RAQA 2XY7A 4Z6CA 3A0HU 1L7OA 4RNMA 2JXJA 4WBYA 1S9FA 3JPRA 2IOHA 4DQRA 3TACB 1FA0A 4F2SA 2G08A 3TANA 7ICUA 5KT2A 1ZQHA 4ELTA 3C66A 1TE2A 4WOYA 2VJ5A 3QZ7A 2Z7JA 1KKXA 4DQPA 8ICZA 1PZNA 3CNHA 3EZ5A 2PXIA 3QNMA 4EX7A 4AT7A 2OCEA 4O0IA 2FMSA 4O3RA 1X40A 1XO0A 1ZQUA 3MC1A 1NZPA 2ZIXB 1X9SA 3PR4A 4J9LA 2BDPA 3NVOA 4AT9B 1QQ7A 2ZJ8A 4J03A 2AGQA 2BPFA 1AQ6A 5CFTA 3M9MB 3AMZA 3ZD9A 4UAZA 2I5HA 2I1QA 2H3VA 2B0CA 3GDXA 2FI1A 1JX4A 1QQ6A 5KG6A 1BPEA 4FBTA 4DCCA 2BCRA 2YB1A 4B9MA 3SI8A 4CF4A 4I2IA 2K4IA 2JEGA 4F4KA 5B66U 2R8JA 3RB3A 4KLGA 5CFSA 4RT2A 4USAA 2LMRA 3PR5B 2WF9A 1S10A 1BVSA 1ZRMA 1UT8A 2CN1A 3MGHA 1IM4A 1NKBA 3MBYA 3UXOA 3ZDEA 4NLCA 5J0XA 2R8KA 4OAFA 3QU2A 1L5UA 3HWTA 2BZFA 4ATBB 5KFCA 2A1JA 2J6SA 3SD7A 2WHEA 3PVXA 2ALZA 2F77X 3FAHA 4LJXA 5EE0A 3OVBA 4WC4A 4IRKA 3C2KA 4X0AA 4KLHA 1SWVA 3B9JA 3PW0A 4JMUA 5AM1A 2ZHBA 4DF8A 4RPZA 4JWNA 3EPIA 3JPOA 4F5PA 4TQSA 3H4BA 4XRHA 3OGUA 2DL0A 4MFFA 2JZBA 3I76A 2W8KA 1HIWA 2NRTA 2KJ8A 4DSJA 4I27A 2J6UA 1UETA 3HJEA 2WB1C 3TADA 1R8CA 2ZH8A 8ICYA 1D9FA 3UQ0A 4ECZA 4M9HA 5J2HA 4O3MA 4IQUA 3PX0A 1C20A 4FO6A 3CRXA 5IIMA 1N61A 3JPPA 1RYRA 4JV1A 2M2TA 4B9SA 5HHIA 4KLUA 2HVIA 5J2DA 3H7IA 2HHVA 5AK3A 3T5HA 2DPIA 2DFLA 2M2VA 4K9AA 4TUQA 3A0BU 2AHOB 1CUKA 2BPCA 1PK1A 5J2FA 2OEHA 4F5OA 2Y1IA 4IRDA 4K96A 5DGBA 4GXKA 2HOQA 4J9KA 3M1YA 4C4TA 4QZFA 3UMBA 4X5VA 1ZQBA 2Q66A 5J2GA 4QZIA 1UPHA 3WU2U 4RZRA 2BQRA 1S0OA 1QLNA 3PHZA 3PW4A 5JTGA 3TARA 4TURA 5GTIU 3H37A 5AKLA 2EQYA 4O5EA 3CW2C 4I0UA 2C28A 4Z6FA 5AM5A 5AM0A 1JXEA 2M9NA 4M6WB 3C2MA 4F50A 3Q8LA 2VA2A 1ZQEA 2KICA 1NK7A 2P6UA 2J6TA 1FEZA 1KDHA 2WF7A 3QX7A 1COOA 3GZFA 4C4RA 4YR2A 2EANA 4K9BA 5KFMA 4YD1A 4Y2SA 4ECUA 4UQGA 3AL0B 3V6JA 1ZQYA 2XC9A 3I1YA 4KLJA 2HOFA 2JMGA 3H8SA 4EYIB 1ZQWA 5J0TA 5J2EA 3VC8A 4O3SA 4FZNA 4MEYA 5H2FU 4B9NA 1NI3A 3KD3A 4ECRA 1T94A 5E79U 1TK8A 2F76X 3AN1A 2Y9UA 4DOBA 2BGWA 2DPJA 4YXJA 4BX9C 4M9GA 1U48A 1X42A 2IOFK 2EAMA 4FE3A 4EBCA 1T8EA 4OJOA 2K8BB 2GOLA 9ICVA 3ICXA 1C7YA 5DKWA 8ICEA 1UA0A 3ORYA 3PNCA 1ZQTA 2C2DA 5IIIA 3RTVA 1X9XA 4RWPA 4NWIA 3NUQA 3G6VA 4KLDA 3F5EA 3C2LA 4P0PA 1WCNA 3LK9A 4DFKA 4WC5A 3ZDBA 4QWEA 1Q8KA 3ZDCA 4I2HA 2PFNA 4PHDA 5IIJA 4DL6A 5AI0A 5AI9A 5DQGA 4CGZA 3ETRA 3PO4A 3KKAC 3SR6A 3C21A 4YFKA 4K98A 3RJEA 3OUYB 3TADC 4RQ8A 5DBAA 1L3TA 1VFGA 5J2BA 2FPKA 4YR0A 2XIDA 2H3FA 4KMOB 4PGXA 2K60A 4NXXA 4US9A 3C23A 1A6SA 2YMPA 3MCRA 2WF5A 5KT6A 2NRXA 1KNYA 2FJ6A 5DBBA 3OTQA 3D6JA 4K4HA 4GLXA 2AH5A 2P35A 2HN1A 2B56A 3JPSA 7ICRA 1PX5A 4ECXA 1NK0A 4RWQA 3GU3A 1X9WA 3K75D 2DGZA 4IQTA 5KAFU 4FS2A 5J0PA 4EX6A 4WH5A 3ALRA 4FH3A 3EUB2 4UBBA 4BJQA 4QWDA 5DG9A 1FO4A 3RBEA 3OHBA 4ECQA 3AU2A 5DQIA 2PFPA 5F9NA 4WQLA 1SV4A 5DB6A 3PY8A 3AQEA 1V85A 3L4PA 2DF4B 4AT8A 3WKEA 4G3IA 2G07A 4IQWA 2F1IA 4UAVA 4J9PA 4KX5A 4RT3A 3TFRA 1V97A 3IG5A 1ZJNA 4C0ZA 4ED6A 3IRUA 4O3PA 3D2SA 3PW7A 2EH9A 4DSEA 4ZH4A 3F2DA 4RQ6A 2LM4A 8ICIA 2BE3A 5HRDA 5DEDA 1SKRA 8ICGA 2H5XA 5KFRA 3DEEA 1TFWA 7ICJA 2QLTA 4MFCA 5ALYA 2HI0A 2OYYA 4ED3A 8ICTA 5AICA 3OJUA 3RFAA 3KHHA 1N63A 2JV3A 4J9QA 2KHQA 3WFSC 1DGJA 4OAHA 3ONNA 3GFKB 2F1HA 5EWFA 1NKEA 1LKYA 2YY6A 5CEHA 2JGAA 3WK7A 5J0WA 2RRDA 4DO9A 5FP0A 5AI5A 1SV0C 4RWNA 4X0BA 5HP4A 2R18A 3T5JA 3RB4A 1SV0A 2Y0SC 4JUZA 8ICMA 1GO3F 2FMQA 2GH1A 5AM4A 4YCXA 3ISDA 4HX0A 4Z6EA 5ALTA 5HRGA 3RJHA 2ZUDA 5AIBA 4PGYA 2GWSA 4YG2A 1MN8A 1BPBA 2VJ4A 4OAIZ 2BCUA 4O69A 3LVVA 5F9LA 4CDGA 3HW8A 4E7XA 2E1FA 1Q79A 3K7DA 2KOBA 3GIJA 1ZQDA 4R66A 9ICBA 3K1RB 3MABA 2WAQF 4QWAA 1N62A 9ICFA 5J8YA 5KG1A 2G0AA 2HBMA 4ECVA 5KFGA 4B9LA 3MR2A 3RJFA 1SL1A 1K1SA 1K1QA 1K5OA 4ED8A 2CRXA 2P6RA 4U6PA 1ZETA 4P4MA 1OXJA 4CF3A 3RJGA 1S0NA 1LB2B 2K4EA 3K1ZA 2K8AA 3HP6A 2AGPA 2ASDA 1S76D 1VJ7A 4R64A 9ICAA 3NYBA 4EEBA 1SGGA 1KN5A 3AQKA 3NVWA 1U49A 2V4QA 4A8EA 2ZHAA 2RP5A 4F3OA 4HAIA 5ALVA 3JCFA 4P4OA 2F3NA 3H4DA 2HDOA 4RQ4A 1OUQA 2D3DA 5DG7A 5AKEA 4EEKA 3RRGA 4YMOA 2ZH1A 2NYVA 5ALRA 3B0XA 4JK1A 1PVPA 1RM6C 3HPOA 2CXYA 2KZMA 8ICXA 1URJA 4QZGA 5HMMA 4F2RA 2F2AB 1S0VA 3HT3A 1ZRNA 2KE7A 1SZHA 3SYZA 1SZPA 5KTQA 1XU4A 3WFRE 2FE9A 2ODGA 4QZAA 5A0LA 8ICKA 2MSNA 4M47A 3HKZF 3VCBA 4BWMA 1SXDA 3SAFA 3PW2A 4E80A 4O5CA 5ALLA 9ICTA 2M2UA 1QSYA 3M8RA 2HBKA 3O0FA 5D62A 4DL5A 2GAFD 1D8LA 3MGIA 1IXRA 2KEYA 2XO7A 1JUDA 3WK8A 1L8OA 2Y1JA 4UAYA 3CK6A 3DV9A 4Q44A 4UATA 2Q4TA 2RDJA 2WFAA 5DG8A 1ZQRA 4PPXA 3RR8A 4YMNA 3PSIA 4UAUA 3LWLA 1QCKA 4M04A 9ICJA 2ISOA 2ASJA 2ZUCA 1A76A 5KT5A 1RQLA 2W04A 1FFUA 1L8LA 2HSZA 1NJYA 1BPDA 4O5KA 4AYBC 2KK0A 4FHYA 3JYYA 1P7DA 4DOAA 2XCPA 3SAGA 4AT7B 4Q43A 3RH5A 4M9NA 1IV8A 3RF9A 5G5GA 3BS7A 4EP7A 2MUTA 4J9SA 4F5NA 3IDWA 2ZTDA 4F4ZA 9ICWA 8ICVA 2ZIXA 5CFUA 3D2QA 2KHVA 3PMNA 3OWGA 3QEAZ 3OSPA 3H3AA 1CI4A 2K8CB 4ZOHC 5KFSA 2IHNA 4O3OA 5L9XA 4DOCA 3QE9Y 2FPLA 5KFWA 8ICCA 7ICFA 1Z3EB 1KRPA 1KFSA 4ACOA 2ZTEA 3LYSA 1YLQA 1F5AA 1KL9A 4DQQA 3ED5A 3UMGA 4DEZA 2IHOA 2KV2A 3HJ4A 1NKCA 3BJYA 2BCQA 1Q78A 1RDFA 4NLGA 3PSPA 2KFNA 5HNKA 1Z19A 1XC9A 3R9KA 2E1EA 9ICRA 1B0XA 5HRBA 4X4RA 5DBCA 3MFHA 1NO5A 2HHXA 2W9MA 3M8SA 4K4IA 2KD1A 4I29A 4DQIA 1J97A 1MQ3A 1JN3A 4C8MA 2RDIA 3H0RB 7ICEA 4R63A 2NRVA 3J81j 2O1PA 5AK6A 2UVRA 1L3UA 4NM2A 4FHPA 2XGQA 3MFIA 5ALKA 3BZCA 3Q8QB 3RRHA 3AQMA 4TQRA 4IR9A 4U7CA 1ZQMA 4NL9C 4Y2YA 1BNPA 2KKVA 5KT3A 1HUOA 2EZYA 4ELUA 3GV5B 2V4RA 4CNQA 3E2EA 4FS1A 2WAQC 3FYHA 4MF8A 1HJPA 2HN2A 4NXZA 5J8YC 3QZ8A 2AU0A 4LZGA 4PZOA 3RBDA 2B21A 2LPEA 1LVHA
chains in the Genus database with same CATH topology
5C5JA 2KFZA 3TQ1A 1S97A 3HJ1A 4O3QA 7ICVA 7ICQA 9ICVA 3IHQB 1C7YA 4DQSA 1UA1A 7ICLA 4RWOA 5J0OA 5KFKA 5DKWA 2DR5A 2LYHA 8ICEA 1ZQZA 3BQTA 3FDSA 4M6WA 1UA0A 3KHRA 3ORYA 3PNCA 3PX4A 5CA7A 1ZQTA 4DSIA 2C2DA 5IIIA 9ICNA 3RTVA 4UD5A 4C8LA 4RWPA 3H8WA 1U9LA 3G6VA 4YR3A 4M9JA 3T5LA 1KLNA 4PHEA 4KLDA 4NLNA 1JIHA 4Q8FA 5HMLA 5KG7A 3C2LA 3UXPA 4DLEA 3PX6A 5KFOA 1ZQKA 1WCNA 3LK9A 5J2IA 4EZ6A 4KTQA 4DFKA 1XO1A 5EWGA 2ATLA 1H38A 3ZDBA 4QWEA 4WC5A 2M2WA 5DLFA 3ZDCA 4I2HA 3BDPA 4WC3A 2PFNA 4PHDA 2HVHA 4I2DA 5IIJA 5KT4A 4DL6A 5DQGA 4I2AA 1XSPA 1QSLA 4I2JA 3SV3A 3PO4A 5IILA 5D4BA 3L9DA 4Z6DA 1NK8A 8ICPA 4LT6A 4P2HA 5KG2A 2IMWP 3C21A 4YFKA 5TZVA 3G6XA 4EEYA 3UXNA 2FLLA 3NGDA 1KSPA 4YVZA 4DSFA 4B9TA 4EZ9A 3RJEA 3B0YA 2XY5A 3ZDDA 1KTQA 4ED2A 4XQ7A 1ZQCA 3OUYB 5HC9A 2BR0A 5DGAA 9ICUA 4RQ8A 1KFTA 5DBAA 1L3TA 1ZQVA 4DFPA 1VFGA 5EOZA 5J0UA 5J2BA 2UVVA 4M5DA 5J0QA 4AT8B 2FPKA 5BOLA 4YR0A 4QZDA 1NJWA 4DL4A 8ICJA 2PI5A 4PGXA 4O9MA 4F4YA 3ISCA 5HRKA 1NJZA 5KFTA 3MR6A 3EPGA 3RH6A 1V4AA 3KHLA 3C23A 4QW9A 3SV4A 2BKEA 4DLGA 1SL0A 5KT6A 3Q8RB 5IINA 1MIYA 8ICFA 2NRXA 2VANA 5F2VO 5HRIA 1KNYA 5KFYA 1Z00A 5DBBA 2W9BA 1B43A 4EBEA 4K4HA 4I2GA 4GLXA 3G6YA 5CJ7A 2KZZA 8ICRA 5DQHA 9ICEA 2RFFA 2MAXA 4QW8A 5L1LA 1JXLA 2KZ3A 2R8HA 3N4MB 8ICSA 4CCHA 3BQ2A 1HUZA 3ETLA 3JPSA 7ICRA 1PX5A 4ECXA 4DF4A 1NK0A 2IHMA 1X9WA 3K75D 4RWQA 4BXOB 4NLKA 7ICTA 4IQTA 5IIKA 4FS2A 5J0PA 4YXMA 5KFBA 4F93B 1WOTA 4FH3A 4LVSA 4UBBA 1OU5A 4RQ0A 4QWDA 5DG9A 1TFRA 5KFAA 5KFUA 3PMLA 1TAQA 3RBEA 3OHBA 3C1ZA 1NK4A 1U47A 2XGPA 4ECQA 4IRCA 1X2IA 3AU2A 2VA8A 4KMUA 4RQ7A 4GXIA 3TI0A 5KFFA 2BCVA 5DQIA 5BOMA 1TK0A 5F9NA 2W9AA 2BCSA 2PFPA 5L1JA 4LZDA 1UEVA 4X4UA 5KG0A 5DB6A 4IQVA 3GIKA 3JPNA 3PY8A 2BQ3A 2UVUA 4EBKA 4KITB 2FPMA 4AT8A 4G3IA 4RNNA 3V7LA 4PGQA 3IM1A 4MEXA 4IQWA 2F1IA 4QZHA 4DS4A 7ICHA 5KFHA 4J9PA 1TAUA 4RT3A 3TFRA 4ATBA 1RZTA 1ZQJA 1ZJNA 5KFIA 8ICUA 2A1JB 4RPYA 3JPQA 1BPZA 8ICBA 4YD2A 2ZUBA 4F5RA 4FHWA 4ED6A 3LQCB 4O3PA 4DS5A 3PW7A 4XA5A 4DSEA 3UQ2A 4ZH4A 2WTFA 2DVIA 4P4PA 3MR3A 1D8YA 4FHXA 4RQ6A 4TUSA 3RB0A 9ICHA 2F1JA 2P66A 2HHWA 5DB9A 8ICIA 1B22A 5HRDA 2MUTB 4RQ2A 3GILA 2R8IA 1SKRA 1ZQOA 8ICGA 2H5XA 1BNOA 1MIWA 4B9UA 3K4GA 5KFRA 3ISBA 1BGXT 2BQUA 7ICJA 1MQ2A 1R8AA 1TFWA 1DK3A 4X4VA 1ZQXA 3N97B 4MFCA 3GV7B 3TAPA 4PHAA 3KHGA 2ISPA 1TVAA 1UT5A 2FMPA 5J0RA 4Q8EA 4ED3A 4UAWA 4DL7A 3RAXA 4J9NA 7ICKA 3UPQA 8ICTA 9ICKA 4I28A 2ZH7A 5KFLA 2BPGA 3OJUA 4C8NA 4KN4A 4M0AA 3H39A 3KHHA 5KFPA 4M2YA 2FLNA 4AT9A 1NK5A 4J9QA 4DL2A 9ICLA 2ZTCA 4UB3A 9ICMA 4QZ8A 4EYHB 3QEBZ 2ZH6A 3WFSC 1L3VA 4X4NA 3JPTA 2C2EA 3GFKB 2F1HA 5EWFA 1TK5A 1NKEA 7ICMA 3OV7A 4KLFA 4J9MA 4DFMA 1SKWA 5KFXA 5J0WA 4HYKA 5HRHA 9ICPA 1N48A 4YN4A 4DO9A 9ICCA 1AROP 3OJSA 5KFNA 4ECWA 2KTQA 7ICGA 4MFAA 5KT7A 3TFSA 4X0BA 4RWNA 5HP4A 3AUOA 2DR8A 4QWBA 1JMSA 3T5JA 4I2EA 4FHVA 5J29A 3RB4A 4JUZA 3WFQE 8ICMA 5KFEA 1RYSA 5HHHA 3Q8KA 4F4XA 3RAQA 2FMQA 2XY7A 4Z6CA 4IG8A 4WBZA 3MDCA 4WC1A 4YCXA 4RUCA 3ISDA 5KG3A 4RNMA 3OSNA 1RXVA 4Z6EA 4WBYA 1S9FA 3JPRA 5HRGA 2JEIA 7ICSA 5J2KA 3RJHA 4R8UB 3WFPA 2ZUDA 4DQRA 4PGYA 3TAQA 4YG2A 5KFZA 2GWSA 1BPBA 4DWIA 1FA0A 5EWEA 4F2SA 2DRAA 2BCUA 1U4BA 3TANA 2NRWA 5F9LA 4KLOA 3HW8A 5KT2A 1ZQHA 4ELTA 3SZ2A 7ICUA 1Q79A 4E7XA 3C66A 1ZQNA 3AQLA 3H8JA 3HIYA 2ZJ5A 3QZ7A 1NK6A 4GC6A 3GIJA 1TKDA 1ZQDA 4R66A 9ICBA 8ICAA 4ED0A 1ZJMA 3MABA 4QWAA 4DQPA 3M9OB 9ICFA 8ICZA 1RXWA 1PZNA 2V9WA 5KG1A 8ICQA 4QWCA 3LWMA 3EZ5A 1N56A 2PXIA 4ECVA 2IBKA 4AT7A 5KFGA 5BPCA 3GV8B 3BQ1A 5KG4A 3BQ0A 4F4WA 3THVA 5J0SA 4O0IA 3MR2A 3RJFA 4B9LA 2FMSA 9ICXA 5HREA 1SL1A 4O3RA 1K1SA 1K1QA 4DL3A 1QTMA 4YP3A 1ZQUA 2Q0ZX 3PV8A 1NZPA 4ED8A 4PH5A 1XSLA 2P6RA 1X9SA 5DDMA 4ECTA 1ZETA 4P4MA 1ZYQA 3PR4A 4J9LA 4EBDA 1X9MA 4JV0A 2BDPA 3RJGA 4ED1A 7ICIA 1NK9A 1S0MA 4NY8A 4AT9B 3C1YA 1S0NA 2R8GA 1LB2B 8ICOA 2ZJ8A 1DOQA 2AGQA 5DDYA 1LV5A 3HP6A 3GIIA 2AGPA 2BPFA 3M9MB 2ASDA 2C2RA 3PO5A 1S76D 3ZD9A 1VJ7A 4UAZA 4R64A 2W9CB 5DB8A 9ICAA 3NYBA 4KLMA 2I9GA 4KN7A 1ZQAA 4K4GA 4X4TA 2I1QA 1EXNA 3GDXA 4ECYA 3AQKA 1JX4A 5KG6A 4TUPA 1ZQLA 1U49A 2V4QA 1WCLA 3C18A 2ZHAA 1ZQPA 4RPXA 1BPEA 2KN7A 2C22A 2BCRA 4FBUA 4FBTA 4B9MA 2PFQA 3C5FA 4F3OA 3SI8A 1CEZA 9ICSA 4I2IA 2ASLA 2KP7A 4X4SA 4P4OA 9ICOA 3EYZA 2DR9A 1RPLA 5IIOA 2JEGA 3H4DA 5HRFA 4F4KA 4RQ4A 3V72A 1TV9A 2R8JA 3RB3A 5DG7A 4KLGA 4MF2A 4RT2A 3RRGA 3V7KA 2AQ4A 4YMOA 1DK2A 5J2AA 3M9NB 3PR5B 2ZH1A 8ICWA 1NOMA 1U45A 3KTQA 1S10A 4F8RA 1BVSA 5J2JA 3H38A 1UT8A 3B0XA 4JK1A 1IM4A 3MGHA 3HPOA 1NKBA 3MBYA 3UXOA 3ZDEA 5JUMA 5J0XA 3MDAA 2KZMA 7ICPA 9ICGA 2R8KA 8ICXA 5J0YA 4QZGA 5HMMA 3H40A 4F2RA 2PFOA 1L5UA 3HWTA 4DFJA 3GIMA 4ATBB 2BE3A 1S0VA 5KFCA 3HT3A 2A1JA 1SKSA 2J6SA 3OUYA 1T4GA 3C5GA 3PVXA 3ZDAA 3SYZA 1SZPA 2ALZA 5KTQA 1V9PA 1XU4A 3ZD8A 4EBJA 3WFRE 3OVBA 4O3NA 4WC4A 4RQ3A 3C2KA 4ECSA 3RH4A 3RR7A 4QZAA 4IRKA 4KLHA 4WC2A 8ICKA 4X0AA 4M9LA 2NRKA 4M47A 3PW0A 2ZHBA 4BWMA 4DF8A 3GQCA 4I2CA 4RPZA 4JWNA 2VA3A 3EPIA 1MIVA 3JPOA 5CB1A 3EW9A 4F5PA 2ZH4A 3PW2A 4TQSA 4E80A 4UBCA 4XRHA 3OGUA 3H4BA 4O5CA 4KLEA 9ICTA 4UB2A 3JZ0A 1ZQGA 2M2UA 3OHAA 1QSYA 3M8RA 4MFFA 2PBEA 2ID1A 3RB6A 2JZBA 7ICOA 2W8KA 5D49A 2NRTA 8ICNA 2HHSA 4DL5A 5DECA 4DSJA 1D8LA 4I27A 2J6UA 3RJJA 1UETA 4E8FA 4F91B 4NKTA 1R8CA 3MGIA 4NLZA 2ZH8A 1IXRA 5L1IA 4NM1A 8ICYA 2ZH2A 2XO7A 1BPYA 3UQ0A 4ECZA 1D9FA 4QZ9A 4M9HA 1JAJA 4J9OA 1JQRA 2Y1JA 4UAYA 4IR1A 5J2HA 2AJQA 4IQUA 4Q44A 3PX0A 1T3NA 4X4OA 3OVAA 4FO6A 3EWAA 5IIMA 1XS9D 2RDJA 3JPPA 1RYRA 4JV1A 2M2TA 5DG8A 1D9DA 1ZQSA 4B9SA 5HHIA 4KLUA 2IA6A 1ZQRA 4PPXA 2HVIA 5J2DA 3RR8A 4YMNA 1ZQFA 1A77A 3H7IA 2HHVA 4NKUA 3T5HA 4R8UA 1ZQIA 3LWLA 3V6HA 2DPIA 4M04A 9ICJA 2ISOA 2ZH3A 2DFLA 2M2VA 3V6KA 1XSNA 2DR7A 2ZJAA 4TUQA 2ASJA 2ZUCA 4GXJA 1A76A 1CUKA 5KT5A 2BPCA 5J2FA 4C8KA 4DSLA 4F5OA 2XCAA 2Y1IA 4I2FA 3OVSA 1NJYA 4IRDA 2BHNA 1BPDA 3NTUA 4F92B 5DGBA 4UB4A 4O5KA 4RUAA 3WFOA 4FHYA 4RQ1A 3JYYA 1MC8A 4BGDA 4F5QA 4ELVA 4GXKA 4DOAA 4J9KA 1NJXA 4BWJA 5KFVA 4RU9A 2XCPA 3RJIA 1MSWD 4Q43A 3RH5A 4QZFA 4UB5A 4M9NA 4AT7B 4WC6A 4X5VA 2ZH5A 1ZQBA 3AU6A 4XQ8A 2JEFA 1R89A 4EP7A 2MUTA 4J9SA 4F5NA 2ZTDA 5CWRA 5HRLA 2HHPA 2Q66A 5J2GA 5D46A 4QZIA 4F4ZA 4BDPA 8ICVA 9ICWA 2O5AA 5KFQA 3PMNA 3QEAZ 3OSPA 4RZRA 2BQRA 2AQ0A 1S0OA 4KLLA 1QLNA 7ICNA 9ICIA 3H3AA 3UPSA 3PW4A 5KFSA 2IHNA 4O3OA 4XUSA 5L9XA 4DOCA 5DB7A 4TURA 3TARA 5L1KA 3QE9Y 2FPLA 1DGSA 4YMMA 3PW5A 2W8LA 3H37A 4X4QA 5KFWA 8ICCA 5KG5A 7ICFA 1Z3EB 5CHGA 1KRPA 4BXOA 4O5EA 1KFSA 5DEDA 4S3NA 4WC0A 2W9CA 4RNOA 2ZTEA 2JZBB 4GC7A 2C28A 4B9VA 1YLQA 4QZCA 4Z6FA 2XY6A 4JV2A 4KLQA 8ICLA 1JXEA 5CP2A 4FH5A 1F5AA 2M9NA 4M6WB 3C2MA 4F50A 4RQ5A 4DQQA 3Q8LA 2VA2A 4KLSA 2HHUA 1ZQEA 4DEZA 5J2CA 3HJ4A 1NK7A 1UEUA 2P6UA 1NKCA 3BJYA 2BCQA 2J6TA 2PI4A 1QSSA 2HHQA 1Q78A 4NLGA 1KFDA 1KDHA 2KFNA 5HNKA 2HHTA 1XC9A 1COOA 3Q8SB 9ICRA 1TFYA 5HRBA 4X4RA 5DBCA 3HX0A 4WCWA 3MFHA 4YR2A 1NO5A 2HHXA 4KLIA 5KFMA 4R65A 2W9MA 4YD1A 3M8SA 4ECUA 4UQGA 2JEJA 4K4IA 4WC7A 4I29A 9ICQA 4DQIA 4DSKA 4Q45A 1ZQQA 3V6JA 1XWLA 1ZQYA 4JWMA 4QZBA 2XC9A 2DRBA 1MQ3A 4KLJA 1JN3A 4ED7A 3H8SA 4C8MA 1L3SA 2UVWA 4EYIB 1ZQWA 1KEJA 5J0TA 1S77D 4UD4A 5J2EA 2RDIA 4PHPA 4O3SA 7ICEA 4R63A 2NRZA 2NRVA 4MEYA 4UB1A 4C8OA 4KLTA 3RJKA 2HW3A 1R8BA 2O1PA 2UVRA 1L3UA 4NM2A 4FHPA 4B9NA 2XGQA 1Y88A 3MFIA 4ECRA 1SL2A 2ZH9A 5KFDA 4QZEA 5CR0A 4YQWA 3Q8QB 3T3FA 2OWOA 4E0DA 3RRHA 3LDAA 3AQMA 5DLGA 4TQRA 4IR9A 5HR9A 1TK8A 1ZQMA 1BNPA 3T5KA 1BPXA 4X4PA 1Z00B 5KT3A 1HUOA 4DOBA 2BGWA 2W9BB 2DPJA 4ELUA 3GV5B 3AQNA 4YXJA 2V4RA 2AGOA 3E2EA 4FS1A 3V7JA 4M9GA 3FYHA 1U48A 4MF8A 3Q8PB 3Q8MA 1HJPA 3MR5A 4NXZA 2FLPA 3QZ8A 4EBCA 2AU0A 4J9RA 1T8EA 4LZGA 3RBDA 2B21A 1T7PA 5KFJA 8ICHA 4I2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C5J A;  2KFZ A;  3TQ1 A;  1S97 A;  3HJ1 A;  4O3Q A;  7ICV A;  7ICQ A;  9ICV A;  3IHQ B;  1C7Y A;  4DQS A;  1UA1 A;  7ICL A;  4RWO A;  5J0O A;  5KFK A;  5DKW A;  2DR5 A;  2LYH A;  8ICE A;  1ZQZ A;  3BQT A;  3FDS A;  4M6W A;  1UA0 A;  3KHR A;  3ORY A;  3PNC A;  3PX4 A;  5CA7 A;  1ZQT A;  4DSI A;  2C2D A;  5III A;  9ICN A;  3RTV A;  4UD5 A;  4C8L A;  4RWP A;  3H8W A;  1U9L A;  3G6V A;  4YR3 A;  4M9J A;  3T5L A;  1KLN A;  4PHE A;  4KLD A;  4NLN A;  1JIH A;  4Q8F A;  5HML A;  5KG7 A;  3C2L A;  3UXP A;  4DLE A;  3PX6 A;  5KFO A;  1ZQK A;  1WCN A;  3LK9 A;  5J2I A;  4EZ6 A;  4KTQ A;  4DFK A;  1XO1 A;  5EWG A;  2ATL A;  1H38 A;  3ZDB A;  4QWE A;  4WC5 A;  2M2W A;  5DLF A;  3ZDC A;  4I2H A;  3BDP A;  4WC3 A;  2PFN A;  4PHD A;  2HVH A;  4I2D A;  5IIJ A;  5KT4 A;  4DL6 A;  5DQG A;  4I2A A;  1XSP A;  1QSL A;  4I2J A;  3SV3 A;  3PO4 A;  5IIL A;  5D4B A;  3L9D A;  4Z6D A;  1NK8 A;  8ICP A;  4LT6 A;  4P2H A;  5KG2 A;  2IMW P;  3C21 A;  4YFK A;  5TZV A;  3G6X A;  4EEY A;  3UXN A;  2FLL A;  3NGD A;  1KSP A;  4YVZ A;  4DSF A;  4B9T A;  4EZ9 A;  3RJE A;  3B0Y A;  2XY5 A;  3ZDD A;  1KTQ A;  4ED2 A;  4XQ7 A;  1ZQC A;  3OUY B;  5HC9 A;  2BR0 A;  5DGA A;  9ICU A;  4RQ8 A;  1KFT A;  5DBA A;  1L3T A;  1ZQV A;  4DFP A;  1VFG A;  5EOZ A;  5J0U A;  5J2B A;  2UVV A;  4M5D A;  5J0Q A;  4AT8 B;  2FPK A;  5BOL A;  4YR0 A;  4QZD A;  1NJW A;  4DL4 A;  8ICJ A;  2PI5 A;  4PGX A;  4O9M A;  4F4Y A;  3ISC A;  5HRK A;  1NJZ A;  5KFT A;  3MR6 A;  3EPG A;  3RH6 A;  1V4A A;  3KHL A;  3C23 A;  4QW9 A;  3SV4 A;  2BKE A;  4DLG A;  1SL0 A;  5KT6 A;  3Q8R B;  5IIN A;  1MIY A;  8ICF A;  2NRX A;  2VAN A;  5F2V O;  5HRI A;  1KNY A;  5KFY A;  1Z00 A;  5DBB A;  2W9B A;  1B43 A;  4EBE A;  4K4H A;  4I2G A;  4GLX A;  3G6Y A;  5CJ7 A;  2KZZ A;  8ICR A;  5DQH A;  9ICE A;  2RFF A;  2MAX A;  4QW8 A;  5L1L A;  1JXL A;  2KZ3 A;  2R8H A;  3N4M B;  8ICS A;  4CCH A;  3BQ2 A;  1HUZ A;  3ETL A;  3JPS A;  7ICR A;  1PX5 A;  4ECX A;  4DF4 A;  1NK0 A;  2IHM A;  1X9W A;  3K75 D;  4RWQ A;  4BXO B;  4NLK A;  7ICT A;  4IQT A;  5IIK A;  4FS2 A;  5J0P A;  4YXM A;  5KFB A;  4F93 B;  1WOT A;  4FH3 A;  4LVS A;  4UBB A;  1OU5 A;  4RQ0 A;  4QWD A;  5DG9 A;  1TFR A;  5KFA A;  5KFU A;  3PML A;  1TAQ A;  3RBE A;  3OHB A;  3C1Z A;  1NK4 A;  1U47 A;  2XGP A;  4ECQ A;  4IRC A;  1X2I A;  3AU2 A;  2VA8 A;  4KMU A;  4RQ7 A;  4GXI A;  3TI0 A;  5KFF A;  2BCV A;  5DQI A;  5BOM A;  1TK0 A;  5F9N A;  2W9A A;  2BCS A;  2PFP A;  5L1J A;  4LZD A;  1UEV A;  4X4U A;  5KG0 A;  5DB6 A;  4IQV A;  3GIK A;  3JPN A;  3PY8 A;  2BQ3 A;  2UVU A;  4EBK A;  4KIT B;  2FPM A;  4AT8 A;  4G3I A;  4RNN A;  3V7L A;  4PGQ A;  3IM1 A;  4MEX A;  4IQW A;  2F1I A;  4QZH A;  4DS4 A;  7ICH A;  5KFH A;  4J9P A;  1TAU A;  4RT3 A;  3TFR A;  4ATB A;  1RZT A;  1ZQJ A;  1ZJN A;  5KFI A;  8ICU A;  2A1J B;  4RPY A;  3JPQ A;  1BPZ A;  8ICB A;  4YD2 A;  2ZUB A;  4F5R A;  4FHW A;  4ED6 A;  3LQC B;  4O3P A;  4DS5 A;  3PW7 A;  4XA5 A;  4DSE A;  3UQ2 A;  4ZH4 A;  2WTF A;  2DVI A;  4P4P A;  3MR3 A;  1D8Y A;  4FHX A;  4RQ6 A;  4TUS A;  3RB0 A;  9ICH A;  2F1J A;  2P66 A;  2HHW A;  5DB9 A;  8ICI A;  1B22 A;  5HRD A;  2MUT B;  4RQ2 A;  3GIL A;  2R8I A;  1SKR A;  1ZQO A;  8ICG A;  2H5X A;  1BNO A;  1MIW A;  4B9U A;  3K4G A;  5KFR A;  3ISB A;  1BGX T;  2BQU A;  7ICJ A;  1MQ2 A;  1R8A A;  1TFW A;  1DK3 A;  4X4V A;  1ZQX A;  3N97 B;  4MFC A;  3GV7 B;  3TAP A;  4PHA A;  3KHG A;  2ISP A;  1TVA A;  1UT5 A;  2FMP A;  5J0R A;  4Q8E A;  4ED3 A;  4UAW A;  4DL7 A;  3RAX A;  4J9N A;  7ICK A;  3UPQ A;  8ICT A;  9ICK A;  4I28 A;  2ZH7 A;  5KFL A;  2BPG A;  3OJU A;  4C8N A;  4KN4 A;  4M0A A;  3H39 A;  3KHH A;  5KFP A;  4M2Y A;  2FLN A;  4AT9 A;  1NK5 A;  4J9Q A;  4DL2 A;  9ICL A;  2ZTC A;  4UB3 A;  9ICM A;  4QZ8 A;  4EYH B;  3QEB Z;  2ZH6 A;  3WFS C;  1L3V A;  4X4N A;  3JPT A;  2C2E A;  3GFK B;  2F1H A;  5EWF A;  1TK5 A;  1NKE A;  7ICM A;  3OV7 A;  4KLF A;  4J9M A;  4DFM A;  1SKW A;  5KFX A;  5J0W A;  4HYK A;  5HRH A;  9ICP A;  1N48 A;  4YN4 A;  4DO9 A;  9ICC A;  1ARO P;  3OJS A;  5KFN A;  4ECW A;  2KTQ A;  7ICG A;  4MFA A;  5KT7 A;  3TFS A;  4X0B A;  4RWN A;  5HP4 A;  3AUO A;  2DR8 A;  4QWB A;  1JMS A;  3T5J A;  4I2E A;  4FHV A;  5J29 A;  3RB4 A;  4JUZ A;  3WFQ E;  8ICM A;  5KFE A;  1RYS A;  5HHH A;  3Q8K A;  4F4X A;  3RAQ A;  2FMQ A;  2XY7 A;  4Z6C A;  4IG8 A;  4WBZ A;  3MDC A;  4WC1 A;  4YCX A;  4RUC A;  3ISD A;  5KG3 A;  4RNM A;  3OSN A;  1RXV A;  4Z6E A;  4WBY A;  1S9F A;  3JPR A;  5HRG A;  2JEI A;  7ICS A;  5J2K A;  3RJH A;  4R8U B;  3WFP A;  2ZUD A;  4DQR A;  4PGY A;  3TAQ A;  4YG2 A;  5KFZ A;  2GWS A;  1BPB A;  4DWI A;  1FA0 A;  5EWE A;  4F2S A;  2DRA A;  2BCU A;  1U4B A;  3TAN A;  2NRW A;  5F9L A;  4KLO A;  3HW8 A;  5KT2 A;  1ZQH A;  4ELT A;  3SZ2 A;  7ICU A;  1Q79 A;  4E7X A;  3C66 A;  1ZQN A;  3AQL A;  3H8J A;  3HIY A;  2ZJ5 A;  3QZ7 A;  1NK6 A;  4GC6 A;  3GIJ A;  1TKD A;  1ZQD A;  4R66 A;  9ICB A;  8ICA A;  4ED0 A;  1ZJM A;  3MAB A;  4QWA A;  4DQP A;  3M9O B;  9ICF A;  8ICZ A;  1RXW A;  1PZN A;  2V9W A;  5KG1 A;  8ICQ A;  4QWC A;  3LWM A;  3EZ5 A;  1N56 A;  2PXI A;  4ECV A;  2IBK A;  4AT7 A;  5KFG A;  5BPC A;  3GV8 B;  3BQ1 A;  5KG4 A;  3BQ0 A;  4F4W A;  3THV A;  5J0S A;  4O0I A;  3MR2 A;  3RJF A;  4B9L A;  2FMS A;  9ICX A;  5HRE A;  1SL1 A;  4O3R A;  1K1S A;  1K1Q A;  4DL3 A;  1QTM A;  4YP3 A;  1ZQU A;  2Q0Z X;  3PV8 A;  1NZP A;  4ED8 A;  4PH5 A;  1XSL A;  2P6R A;  1X9S A;  5DDM A;  4ECT A;  1ZET A;  4P4M A;  1ZYQ A;  3PR4 A;  4J9L A;  4EBD A;  1X9M A;  4JV0 A;  2BDP A;  3RJG A;  4ED1 A;  7ICI A;  1NK9 A;  1S0M A;  4NY8 A;  4AT9 B;  3C1Y A;  1S0N A;  2R8G A;  1LB2 B;  8ICO A;  2ZJ8 A;  1DOQ A;  2AGQ A;  5DDY A;  1LV5 A;  3HP6 A;  3GII A;  2AGP A;  2BPF A;  3M9M B;  2ASD A;  2C2R A;  3PO5 A;  1S76 D;  3ZD9 A;  1VJ7 A;  4UAZ A;  4R64 A;  2W9C B;  5DB8 A;  9ICA A;  3NYB A;  4KLM A;  2I9G A;  4KN7 A;  1ZQA A;  4K4G A;  4X4T A;  2I1Q A;  1EXN A;  3GDX A;  4ECY A;  3AQK A;  1JX4 A;  5KG6 A;  4TUP A;  1ZQL A;  1U49 A;  2V4Q A;  1WCL A;  3C18 A;  2ZHA A;  1ZQP A;  4RPX A;  1BPE A;  2KN7 A;  2C22 A;  2BCR A;  4FBU A;  4FBT A;  4B9M A;  2PFQ A;  3C5F A;  4F3O A;  3SI8 A;  1CEZ A;  9ICS A;  4I2I A;  2ASL A;  2KP7 A;  4X4S A;  4P4O A;  9ICO A;  3EYZ A;  2DR9 A;  1RPL A;  5IIO A;  2JEG A;  3H4D A;  5HRF A;  4F4K A;  4RQ4 A;  3V72 A;  1TV9 A;  2R8J A;  3RB3 A;  5DG7 A;  4KLG A;  4MF2 A;  4RT2 A;  3RRG A;  3V7K A;  2AQ4 A;  4YMO A;  1DK2 A;  5J2A A;  3M9N B;  3PR5 B;  2ZH1 A;  8ICW A;  1NOM A;  1U45 A;  3KTQ A;  1S10 A;  4F8R A;  1BVS A;  5J2J A;  3H38 A;  1UT8 A;  3B0X A;  4JK1 A;  1IM4 A;  3MGH A;  3HPO A;  1NKB A;  3MBY A;  3UXO A;  3ZDE A;  5JUM A;  5J0X A;  3MDA A;  2KZM A;  7ICP A;  9ICG A;  2R8K A;  8ICX A;  5J0Y A;  4QZG A;  5HMM A;  3H40 A;  4F2R A;  2PFO A;  1L5U A;  3HWT A;  4DFJ A;  3GIM A;  4ATB B;  2BE3 A;  1S0V A;  5KFC A;  3HT3 A;  2A1J A;  1SKS A;  2J6S A;  3OUY A;  1T4G A;  3C5G A;  3PVX A;  3ZDA A;  3SYZ A;  1SZP A;  2ALZ A;  5KTQ A;  1V9P A;  1XU4 A;  3ZD8 A;  4EBJ A;  3WFR E;  3OVB A;  4O3N A;  4WC4 A;  4RQ3 A;  3C2K A;  4ECS A;  3RH4 A;  3RR7 A;  4QZA A;  4IRK A;  4KLH A;  4WC2 A;  8ICK A;  4X0A A;  4M9L A;  2NRK A;  4M47 A;  3PW0 A;  2ZHB A;  4BWM A;  4DF8 A;  3GQC A;  4I2C A;  4RPZ A;  4JWN A;  2VA3 A;  3EPI A;  1MIV A;  3JPO A;  5CB1 A;  3EW9 A;  4F5P A;  2ZH4 A;  3PW2 A;  4TQS A;  4E80 A;  4UBC A;  4XRH A;  3OGU A;  3H4B A;  4O5C A;  4KLE A;  9ICT A;  4UB2 A;  3JZ0 A;  1ZQG A;  2M2U A;  3OHA A;  1QSY A;  3M8R A;  4MFF A;  2PBE A;  2ID1 A;  3RB6 A;  2JZB A;  7ICO A;  2W8K A;  5D49 A;  2NRT A;  8ICN A;  2HHS A;  4DL5 A;  5DEC A;  4DSJ A;  1D8L A;  4I27 A;  2J6U A;  3RJJ A;  1UET A;  4E8F A;  4F91 B;  4NKT A;  1R8C A;  3MGI A;  4NLZ A;  2ZH8 A;  1IXR A;  5L1I A;  4NM1 A;  8ICY A;  2ZH2 A;  2XO7 A;  1BPY A;  3UQ0 A;  4ECZ A;  1D9F A;  4QZ9 A;  4M9H A;  1JAJ A;  4J9O A;  1JQR A;  2Y1J A;  4UAY A;  4IR1 A;  5J2H A;  2AJQ A;  4IQU A;  4Q44 A;  3PX0 A;  1T3N A;  4X4O A;  3OVA A;  4FO6 A;  3EWA A;  5IIM A;  1XS9 D;  2RDJ A;  3JPP A;  1RYR A;  4JV1 A;  2M2T A;  5DG8 A;  1D9D A;  1ZQS A;  4B9S A;  5HHI A;  4KLU A;  2IA6 A;  1ZQR A;  4PPX A;  2HVI A;  5J2D A;  3RR8 A;  4YMN A;  1ZQF A;  1A77 A;  3H7I A;  2HHV A;  4NKU A;  3T5H A;  4R8U A;  1ZQI A;  3LWL A;  3V6H A;  2DPI A;  4M04 A;  9ICJ A;  2ISO A;  2ZH3 A;  2DFL A;  2M2V A;  3V6K A;  1XSN A;  2DR7 A;  2ZJA A;  4TUQ A;  2ASJ A;  2ZUC A;  4GXJ A;  1A76 A;  1CUK A;  5KT5 A;  2BPC A;  5J2F A;  4C8K A;  4DSL A;  4F5O A;  2XCA A;  2Y1I A;  4I2F A;  3OVS A;  1NJY A;  4IRD A;  2BHN A;  1BPD A;  3NTU A;  4F92 B;  5DGB A;  4UB4 A;  4O5K A;  4RUA A;  3WFO A;  4FHY A;  4RQ1 A;  3JYY A;  1MC8 A;  4BGD A;  4F5Q A;  4ELV A;  4GXK A;  4DOA A;  4J9K A;  1NJX A;  4BWJ A;  5KFV A;  4RU9 A;  2XCP A;  3RJI A;  1MSW D;  4Q43 A;  3RH5 A;  4QZF A;  4UB5 A;  4M9N A;  4AT7 B;  4WC6 A;  4X5V A;  2ZH5 A;  1ZQB A;  3AU6 A;  4XQ8 A;  2JEF A;  1R89 A;  4EP7 A;  2MUT A;  4J9S A;  4F5N A;  2ZTD A;  5CWR A;  5HRL A;  2HHP A;  2Q66 A;  5J2G A;  5D46 A;  4QZI A;  4F4Z A;  4BDP A;  8ICV A;  9ICW A;  2O5A A;  5KFQ A;  3PMN A;  3QEA Z;  3OSP A;  4RZR A;  2BQR A;  2AQ0 A;  1S0O A;  4KLL A;  1QLN A;  7ICN A;  9ICI A;  3H3A A;  3UPS A;  3PW4 A;  5KFS A;  2IHN A;  4O3O A;  4XUS A;  5L9X A;  4DOC A;  5DB7 A;  4TUR A;  3TAR A;  5L1K A;  3QE9 Y;  2FPL A;  1DGS A;  4YMM A;  3PW5 A;  2W8L A;  3H37 A;  4X4Q A;  5KFW A;  8ICC A;  5KG5 A;  7ICF A;  1Z3E B;  5CHG A;  1KRP A;  4BXO A;  4O5E A;  1KFS A;  5DED A;  4S3N A;  4WC0 A;  2W9C A;  4RNO A;  2ZTE A;  2JZB B;  4GC7 A;  2C28 A;  4B9V A;  1YLQ A;  4QZC A;  4Z6F A;  2XY6 A;  4JV2 A;  4KLQ A;  8ICL A;  1JXE A;  5CP2 A;  4FH5 A;  1F5A A;  2M9N A;  4M6W B;  3C2M A;  4F50 A;  4RQ5 A;  4DQQ A;  3Q8L A;  2VA2 A;  4KLS A;  2HHU A;  1ZQE A;  4DEZ A;  5J2C A;  3HJ4 A;  1NK7 A;  1UEU A;  2P6U A;  1NKC A;  3BJY A;  2BCQ A;  2J6T A;  2PI4 A;  1QSS A;  2HHQ A;  1Q78 A;  4NLG A;  1KFD A;  1KDH A;  2KFN A;  5HNK A;  2HHT A;  1XC9 A;  1COO A;  3Q8S B;  9ICR A;  1TFY A;  5HRB A;  4X4R A;  5DBC A;  3HX0 A;  4WCW A;  3MFH A;  4YR2 A;  1NO5 A;  2HHX A;  4KLI A;  5KFM A;  4R65 A;  2W9M A;  4YD1 A;  3M8S A;  4ECU A;  4UQG A;  2JEJ A;  4K4I A;  4WC7 A;  4I29 A;  9ICQ A;  4DQI A;  4DSK A;  4Q45 A;  1ZQQ A;  3V6J A;  1XWL A;  1ZQY A;  4JWM A;  4QZB A;  2XC9 A;  2DRB A;  1MQ3 A;  4KLJ A;  1JN3 A;  4ED7 A;  3H8S A;  4C8M A;  1L3S A;  2UVW A;  4EYI B;  1ZQW A;  1KEJ A;  5J0T A;  1S77 D;  4UD4 A;  5J2E A;  2RDI A;  4PHP A;  4O3S A;  7ICE A;  4R63 A;  2NRZ A;  2NRV A;  4MEY A;  4UB1 A;  4C8O A;  4KLT A;  3RJK A;  2HW3 A;  1R8B A;  2O1P A;  2UVR A;  1L3U A;  4NM2 A;  4FHP A;  4B9N A;  2XGQ A;  1Y88 A;  3MFI A;  4ECR A;  1SL2 A;  2ZH9 A;  5KFD A;  4QZE A;  5CR0 A;  4YQW A;  3Q8Q B;  3T3F A;  2OWO A;  4E0D A;  3RRH A;  3LDA A;  3AQM A;  5DLG A;  4TQR A;  4IR9 A;  5HR9 A;  1TK8 A;  1ZQM A;  1BNP A;  3T5K A;  1BPX A;  4X4P A;  1Z00 B;  5KT3 A;  1HUO A;  4DOB A;  2BGW A;  2W9B B;  2DPJ A;  4ELU A;  3GV5 B;  3AQN A;  4YXJ A;  2V4R A;  2AGO A;  3E2E A;  4FS1 A;  3V7J A;  4M9G A;  3FYH A;  1U48 A;  4MF8 A;  3Q8P B;  3Q8M A;  1HJP A;  3MR5 A;  4NXZ A;  2FLP A;  3QZ8 A;  4EBC A;  2AU0 A;  4J9R A;  1T8E A;  4LZG A;  3RBD A;  2B21 A;  1T7P A;  5KFJ A;  8ICH A;  4I2B A; 
#chains in the Genus database with same CATH topology
 4NJ8 A;  2KFZ A;  5ALJ A;  3QUQ A;  3HJ1 A;  7ICQ A;  5B3Q A;  3IHQ B;  1ZOL A;  4RWO A;  1ZD5 A;  5J0O A;  2DR5 A;  1ZQZ A;  3NWI A;  4N7R A;  5CA7 A;  4UD5 A;  4YR3 A;  3NRW A;  5HML A;  2PMZ F;  3UXP A;  1ZQK A;  1L7M A;  2ATL A;  5ALG A;  1QQ5 A;  2M2W A;  3FC4 A;  1WUD A;  1F5S A;  4I2D A;  5KT4 A;  3BZK A;  1PVQ A;  8ICP A;  2A1A A;  4BUG A;  5KG2 A;  1PK1 B;  2YML A;  3M7D A;  4EZ9 A;  4YVZ A;  4X4S A;  3B0Y A;  3DDH A;  3BQ7 A;  2BR0 A;  1Q3V A;  1ZQV A;  3D2N A;  4M5D A;  2UVV A;  1Z4O A;  5ALM A;  4LEV A;  5AI4 A;  2PI5 A;  4F4Y A;  1ED1 A;  1V4A A;  3SV4 A;  4MKP A;  4OD0 A;  2F8K A;  2OH2 A;  5AKX A;  3Q8R B;  5KFY A;  3C28 A;  4I2G A;  3G6Y A;  5EE3 A;  5DQH A;  1JXL A;  8ICS A;  4JB3 A;  3BQ2 A;  3ETL A;  5KNI A;  1ZXI A;  3F2B A;  4BXO B;  2HCF A;  4NLK A;  2BBJ A;  4F93 B;  3LVW A;  1FFV A;  5KFA A;  3PML A;  5ALH A;  1TAQ A;  3C1Z A;  4CF5 A;  2XGP A;  2QAR A;  1X2I A;  5HR6 A;  4K97 A;  2BCS A;  1UEV A;  3SEN A;  3OPX A;  3JPN A;  2UVU A;  3V7L A;  4MEX A;  3UMC A;  1TAU A;  4ATB A;  3QU5 A;  2A1J B;  1ECW A;  4YD2 A;  4O68 A;  1J2M A;  4DS5 A;  5CHE A;  2DKZ A;  2WTF A;  4FHX A;  3PSF A;  5K4L A;  1B22 A;  2MUT B;  4RQ2 A;  1BGX T;  4AP9 A;  4X4V A;  1VJ5 A;  3N97 B;  1WYG A;  4PHA A;  3KHG A;  5JRT A;  1TVA A;  4P0Q A;  5L1M A;  4NXU A;  3RAX A;  4DL7 A;  3UPQ A;  9ICK A;  4I28 A;  4Y2V A;  1NNL A;  3H39 A;  1IIP A;  9ICL A;  2ZTC A;  4EYH B;  2C2E A;  2HBL A;  1TK5 A;  4DFM A;  1SKW A;  2DWQ A;  4HYK A;  4PL2 A;  4YN4 A;  1UHU A;  1ARO P;  2M0N A;  3OJS A;  2KTQ A;  5KT7 A;  3AUO A;  2DR8 A;  2LYB A;  5J29 A;  2LBO A;  5KFE A;  1RYS A;  5HHH A;  3Q8K A;  4F72 A;  4IG8 A;  3MDC A;  4WC1 A;  4RUC A;  5KG3 A;  2EAO A;  1RXV A;  4IS7 A;  5AM2 A;  7ICS A;  2F44 A;  3WFP A;  4GFJ A;  2GA9 D;  3S6J A;  3TAQ A;  5KFZ A;  5EE1 A;  2DRA A;  1PUZ A;  3ERC C;  1U4B A;  3AQL A;  3H8J A;  2VIX A;  2ZJ5 A;  4GC6 A;  1PVR A;  8ICA A;  1ZJM A;  1IG6 A;  3M9O B;  4FO1 A;  2V9W A;  5ALS A;  3LWM A;  1N56 A;  2IBK A;  3GV8 B;  3THV A;  5KG4 A;  3BQ0 A;  3BS5 A;  4DL3 A;  2Q0Z X;  5AKZ A;  4PH5 A;  1XSL A;  3ER9 B;  2KVC A;  5DDM A;  4ECT A;  4IC9 A;  1ZYQ A;  5KAI U;  2DBY A;  4ED1 A;  1NK9 A;  1S0M A;  2JR5 A;  5DDY A;  3GII A;  2C2R A;  2W9C B;  2BBH A;  2I9G A;  4ECY A;  2NO5 A;  1WCL A;  1ZQP A;  2W3S A;  2KSO B;  2C22 A;  4FBU A;  2PFQ A;  3C5F A;  9ICS A;  2DUY A;  2KP7 A;  5AKG A;  9ICO A;  1WWU A;  3EYZ A;  1RPL A;  5HRF A;  3V72 A;  3WK4 A;  1TV9 A;  4MF2 A;  1X6J A;  2YX8 A;  3V7K A;  2W54 A;  1DK2 A;  5J2A A;  1NOM A;  4F8R A;  4LEY A;  3WKA A;  3H38 A;  3FM9 A;  2IOF A;  3HIY A;  5AKJ A;  3MDA A;  3H40 A;  2PFO A;  5AKY A;  4DFJ A;  2IUB A;  3OUY A;  5ALU A;  5AIA A;  2K4P A;  3ZD8 A;  4RQ3 A;  4ECS A;  3RR7 A;  1L7P A;  4WC2 A;  2B4V A;  2NRK A;  5AKH A;  2G09 A;  1HEK A;  2VA3 A;  5CB1 A;  1Z4N A;  1JI7 A;  4UBC A;  5ALQ A;  3JZ0 A;  3F5A A;  2PBE A;  7ICO A;  5AKI A;  1RYU A;  2D8C A;  2WF8 A;  1L7N A;  4E8F A;  4F91 B;  4NKT A;  5L1I A;  4NM1 A;  1BPY A;  4QZ9 A;  1JAJ A;  3SQI A;  2QB1 A;  4IR1 A;  3OVA A;  3EWA A;  1XS9 D;  3MGV A;  1YZ6 A;  2KSO A;  5JTI A;  1D9D A;  1ZQS A;  3WK5 A;  2IA6 A;  2ZIV A;  1ZQF A;  4R8U A;  1ZQI A;  2ZH3 A;  3V6H A;  1A0P A;  1XSN A;  2YN4 A;  1V38 A;  3IN5 A;  2E8O A;  4GXJ A;  5TIS U;  4C8K A;  4DSL A;  3IP4 B;  2XCA A;  4I2F A;  3OVS A;  2WF6 A;  4UB4 A;  1MC8 A;  2PKE A;  1S8O A;  4ELV A;  3WK9 A;  5KFV A;  1MSW D;  2OXO A;  4WC6 A;  2ZH5 A;  3N7S C;  4FZM A;  4NXT A;  3QU9 A;  1R89 A;  2KVS A;  2BDU A;  5CWR A;  5HRL A;  2HHP A;  3PST A;  2O5A A;  3ER8 C;  7ICN A;  1SB3 C;  4XUS A;  2I6X A;  5L1K A;  4YMM A;  1Z1V A;  5KG5 A;  3F53 A;  4Y2Q A;  5CHG A;  4BXO A;  1O03 A;  4OCZ A;  4GC7 A;  4RNO A;  3WKD A;  2JZB B;  4EGW A;  4QZC A;  2XY6 A;  4KLQ A;  3AM9 A;  1DXS A;  5CP2 A;  2W03 A;  5J2C A;  2L5Y A;  2PI4 A;  4JLX A;  1QSS A;  2KJ9 A;  2YB4 A;  1X66 A;  2W43 A;  3Q8S B;  3CYM A;  3NVY A;  2JEJ A;  2H3Q A;  3N7P D;  9ICQ A;  4DSK A;  1XWL A;  2DRB A;  2UVW A;  1S77 D;  3HIL A;  4PHP A;  2FCL A;  3KBB A;  5T14 A;  4KLT A;  2HW3 A;  4OJ6 A;  4C8O A;  3RJK A;  3U26 A;  1SL2 A;  2ZH9 A;  5KFD A;  4QZE A;  4YQW A;  3L3F X;  1X6I A;  3T3F A;  4E0D A;  2E8N A;  3LDA A;  5DLG A;  2HMX A;  1BPX A;  2MU2 A;  3AQN A;  2NV3 A;  2HBJ A;  3V7J A;  3Q8P B;  3Q8M A;  3MR5 A;  2FLP A;  2KJ5 A;  5KFJ A;  3TQ1 A;  7ICV A;  4DQS A;  1UA1 A;  7ICL A;  3NAS A;  2LYH A;  3BQT A;  4M6W A;  3KHR A;  3PX4 A;  4DSI A;  9ICN A;  3H8W A;  5G5H A;  1U9L A;  4M9J A;  3T5L A;  4NLN A;  4AT8 B;  1JIH A;  1UEU A;  3PX6 A;  5AI6 A;  4KTQ A;  5J2I A;  5D63 A;  5EWG A;  1H38 A;  2RHF A;  2JH1 A;  3BDP A;  5CRX A;  4Y2T A;  4I2A A;  3H0M B;  1PK3 A;  4I2J A;  3SV3 A;  1XSP A;  5IIL A;  3L9D A;  2KIV A;  3SAH A;  2IMW P;  5TZV A;  3G6X A;  3M6Z A;  4WC3 A;  3UXN A;  4B9T A;  3NGD A;  1KSP A;  2F8L A;  4XQ7 A;  2XY5 A;  3ZDD A;  1KTQ A;  4PZN A;  5DGA A;  9ICU A;  1KFT A;  5BOL A;  4QZD A;  4O9M A;  5HRK A;  3ISC A;  4AYB F;  2A19 A;  3MR6 A;  4NL9 A;  3EPG A;  4RQN A;  3KHL A;  2BKE A;  2EZZ A;  2W3R A;  1SL0 A;  5F2V O;  5HRI A;  4EED A;  5L1L A;  2KZ3 A;  2R8H A;  2GLE A;  3N4M B;  1LKY B;  1HUZ A;  1SXE A;  3PZP A;  4LVS A;  1TFR A;  2GO7 A;  2XVT A;  1U47 A;  4IRC A;  3TI0 A;  4KMU A;  3IV6 A;  5BOM A;  1TK0 A;  2BCV A;  2W9A A;  2QB0 B;  5L1J A;  4LZD A;  5B3P A;  5KG0 A;  2W55 A;  2KNJ A;  2BQ3 A;  2Y9T A;  4EBK A;  2FPM A;  4RNN A;  4PGQ A;  7ICH A;  4QZH A;  4DS4 A;  5KFH A;  3CP8 A;  1RZT A;  5KFI A;  8ICU A;  1UQV A;  3JPQ A;  1BPZ A;  5ALF A;  4F5R A;  4CRX A;  4FHW A;  3LQC B;  3NVZ A;  2W7P A;  4F71 A;  3HRD D;  3QUB A;  3UQ2 A;  4P4P A;  3MR3 A;  5ALW A;  4QNL A;  4TUS A;  2F1J A;  2HHW A;  4UD4 A;  3GIL A;  1BNO A;  3WK6 A;  4B9U A;  3QUC A;  3ISB A;  1MQ2 A;  1DK3 A;  4WJ3 B;  1ZQX A;  3ZI4 A;  2ISP A;  1UT5 A;  2W7O A;  3L5K A;  2ZH7 A;  5KFL A;  2LHT A;  4C8N A;  4KN4 A;  4DFD A;  2FLN A;  1NK5 A;  2ZH6 A;  4QZ8 A;  3QYP A;  3N7R C;  1L3V A;  1CRX A;  4LEZ A;  7ICM A;  1ZQ1 C;  2ESE A;  5KFX A;  5HRH A;  4NXW A;  1JAL A;  3NS1 A;  1N48 A;  5KFN A;  7ICG A;  4MFA A;  3TFS A;  1N60 A;  4I2E A;  4FHV A;  3WFQ E;  4EEN A;  4F4X A;  1RG6 A;  4WBZ A;  4C7Y A;  3OSN A;  4UW9 A;  2JEI A;  2ZIV B;  5J2K A;  4R8U B;  3AEV A;  4DWI A;  5EWE A;  1Q3U A;  5KL1 B;  2NRW A;  4KLO A;  4FH5 A;  1QH9 A;  2EWR A;  3SZ2 A;  1WG8 A;  3NKU A;  1ZQN A;  4FFD A;  1NK6 A;  1TKD A;  5KL8 B;  4ED0 A;  1RXW A;  2KIW A;  4EEL A;  4LEW A;  1S5L U;  8ICQ A;  4QWC A;  5GTH U;  4K8V A;  4PL1 A;  5AHX A;  5BPC A;  3BQ1 A;  4F4W A;  3NRZ A;  5J0S A;  5HRE A;  5ALE A;  3F2C A;  9ICX A;  5ALZ A;  1QTM A;  4Y2J A;  4YP3 A;  2LM1 A;  3PV8 A;  4US8 A;  4UB8 U;  4NXV A;  4EBD A;  1X9M A;  4JV0 A;  7ICI A;  4NY8 A;  3C1Y A;  2R8G A;  2ZG6 A;  8ICO A;  1DOQ A;  2KG5 A;  1LV5 A;  2ZIU A;  3PO5 A;  1XNS A;  4UAR A;  5DB8 A;  4KLM A;  4KN7 A;  1ZQA A;  4K4G A;  4X4T A;  1EXN A;  2KKP A;  1JRP A;  1DRG A;  2YTU A;  4TUP A;  1ZQL A;  3C18 A;  4RPX A;  2KN7 A;  1CEZ A;  2ASL A;  1N2X A;  2DR9 A;  5IIO A;  1F0M A;  1VLB A;  5AI8 A;  5D61 A;  2AQ4 A;  4O67 A;  3M9N B;  8ICW A;  1U45 A;  3KTQ A;  5J2J A;  3H8M A;  4Y2U A;  1ZD3 A;  4X4P A;  5JUM A;  7ICP A;  3KZI U;  5J0Y A;  2K4H A;  3E0F A;  4WQK A;  3GIM A;  2QKQ A;  2DQN B;  1SKS A;  3IG8 A;  1T4G A;  3C5G A;  1TAM A;  2E8P A;  3ZDA A;  1V9P A;  4EBJ A;  4O3N A;  3RH4 A;  4M9L A;  1J2N A;  3QU4 A;  3EF2 A;  1ZD4 A;  3C29 A;  2LI6 A;  4I2C A;  3GQC A;  2G5I B;  1MIV A;  4QJF B;  3EW9 A;  2ZH4 A;  5ALI A;  4KLE A;  3E58 A;  4UB2 A;  1ZQG A;  3OHA A;  1GPJ A;  3RB6 A;  2ID1 A;  3TKA A;  5D49 A;  8ICN A;  2HHS A;  5DEC A;  4UB6 U;  4G9B A;  3RJJ A;  4NLZ A;  2ZH2 A;  4J9O A;  1JQR A;  2YQE A;  2AJQ A;  1T3N A;  4C4S A;  4X4O A;  2O6K A;  4P0P B;  1L6N A;  4OO1 J;  1A77 A;  4NKU A;  3V6K A;  2DR7 A;  2ZJA A;  3N28 A;  4Y2P A;  1WWV A;  2YMQ A;  2BHN A;  3NTU A;  4F92 B;  3WFO A;  5C0Y A;  4RUA A;  1OW5 A;  4RQ1 A;  4BGD A;  4F5Q A;  1NJX A;  4BWJ A;  4GIB A;  4RU9 A;  3RJI A;  4UB5 A;  1M6Y A;  2VKQ A;  2XI9 A;  3AU6 A;  4XQ8 A;  2JEF A;  1D8B A;  1RQN A;  3WKB A;  5D46 A;  4BDP A;  5KFQ A;  1N5X A;  5AK5 A;  2JHD A;  9ICI A;  4KLL A;  2AQ0 A;  3UPS A;  2ZXH A;  5DB7 A;  2CPR A;  1DGS A;  3T79 A;  2ES6 A;  3PW5 A;  4X4Q A;  2W8L A;  1YT3 A;  4S3N A;  3KOO A;  4K99 A;  3M6K A;  1O08 A;  4WC0 A;  2W9C A;  4B9V A;  1MA7 A;  8ICL A;  4JV2 A;  4C80 A;  2HHU A;  4RQ5 A;  4KLS A;  4QIW F;  2HHQ A;  1KFD A;  2OHF A;  4JLZ A;  2HHT A;  2QB0 A;  3QUT A;  5HR7 A;  1TFY A;  1COK A;  3HX0 A;  4WCW A;  2B51 A;  4KLI A;  4R65 A;  2EZX A;  4WC7 A;  4Q45 A;  1ZQQ A;  4C7Z A;  4JWM A;  4QZB A;  2N1R A;  4ED7 A;  1L3S A;  1KBU A;  1KEJ A;  3QU7 A;  4NLB A;  2W11 A;  4UB1 A;  2NRZ A;  4P0Q B;  1R8B A;  4OJL A;  1Q46 A;  1Y88 A;  2JRZ A;  2HOI A;  5CR0 A;  2OWO A;  4B6J A;  5HR9 A;  3T5K A;  4MHV A;  5ALN A;  1Z00 B;  5AM3 A;  2W9B B;  2K89 A;  2AGO A;  4Y2R A;  1SWW A;  2D6F C;  4RQM A;  4UAS A;  1SIJ A;  2H3Z A;  3HKZ C;  2LKY A;  4KX3 A;  4J9R A;  1YZ7 A;  2KMD A;  1T7P A;  4KB6 A;  8ICH A;  4I2B A;  5C5J A;  2LYA A;  2AXT U;  2ZIW B;  1S97 A;  4O3Q A;  4CE6 A;  2E5S A;  2QAR B;  5KFK A;  3FDS A;  1NZB A;  2ZXI A;  4C8L A;  3SMV A;  2MA1 A;  4PHE A;  1KLN A;  4Q8F A;  5KG7 A;  4DLE A;  5KFO A;  4EZ6 A;  3AQF A;  3KKA A;  1XO1 A;  2PMZ C;  3SEI A;  5DLF A;  4XJE A;  2HVH A;  3UM9 A;  5ALP A;  4OJ5 A;  1QSL A;  5D4B A;  4Z6D A;  1NK8 A;  4LT6 A;  4P2H A;  1JRO A;  4ICA A;  2FLL A;  4EEY A;  9ICG A;  4DSF A;  2YMM A;  4ED2 A;  5HC9 A;  1ZQC A;  1FIQ A;  2WB1 F;  4NV0 A;  1VDV A;  4DFP A;  5EOZ A;  5J0U A;  5J0Q A;  3KZX A;  1NJW A;  4DL4 A;  8ICJ A;  5F3X B;  1NJZ A;  5KFT A;  3RH6 A;  4QW9 A;  2E3T A;  4DLG A;  5IIN A;  1MIY A;  1UCV A;  8ICF A;  2JH7 A;  2VAN A;  3KFU F;  1Z00 A;  2W9B A;  1B43 A;  4EBE A;  2B6G A;  4KM5 A;  5AK4 A;  5CJ7 A;  2KZZ A;  1KW4 A;  8ICR A;  9ICE A;  2RFF A;  2MAX A;  4QW8 A;  4CCH A;  5B5E U;  2NO4 A;  4DF4 A;  2IHM A;  7ICT A;  4OJP A;  5IIK A;  5EE9 A;  4YXM A;  5KFB A;  1WOT A;  2ZIU B;  2A3V A;  1OU5 A;  4RQ0 A;  2ZIW A;  5KFU A;  1NK4 A;  2G06 A;  1B4F A;  2VA8 A;  4RQ7 A;  4GXI A;  5KFF A;  4M0A A;  4X4U A;  5ALO A;  4IQV A;  3GIK A;  4EV6 A;  4KIT B;  2E8M A;  3IM1 A;  1ZQJ A;  4Y2X A;  2H3I A;  5AKK A;  4RPY A;  8ICB A;  2ZUB A;  4O6A A;  1F44 A;  4XA5 A;  4OAG A;  2DVI A;  2FDR A;  1D8Y A;  2G5H B;  2Y0S F;  2EDU A;  3RB0 A;  9ICH A;  2P66 A;  5DB9 A;  3I28 A;  3H0L B;  1ZQO A;  2R8I A;  1MIW A;  3K4G A;  2BQU A;  1R8A A;  3BS5 B;  3GV7 B;  4PJ0 U;  3TAP A;  2XIC A;  2DKX A;  2FMP A;  5ALX A;  5J0R A;  4Q8E A;  4UAW A;  3WKC A;  7ICK A;  4J9N A;  4FZL A;  1N5W A;  4QIW C;  2BPG A;  1Z1B A;  5KFP A;  4M2Y A;  4AT9 A;  5JU5 A;  4DL2 A;  4UB3 A;  9ICM A;  4X4N A;  3QEB Z;  2OM6 A;  3QXG A;  3NVV A;  3JPT A;  2MRL A;  3OV7 A;  4KLF A;  4J9M A;  1T3Q A;  2RLT A;  1KQQ A;  9ICP A;  4IL6 U;  1ZD2 P;  9ICC A;  2EAP A;  5ALD A;  4ECW A;  2RQ5 A;  4QWB A;  1JMS A;  3RAQ A;  2XY7 A;  4Z6C A;  3A0H U;  1L7O A;  4RNM A;  2JXJ A;  4WBY A;  1S9F A;  3JPR A;  2IOH A;  4DQR A;  3TAC B;  1FA0 A;  4F2S A;  2G08 A;  3TAN A;  7ICU A;  5KT2 A;  1ZQH A;  4ELT A;  3C66 A;  1TE2 A;  4WOY A;  2VJ5 A;  3QZ7 A;  2Z7J A;  1KKX A;  4DQP A;  8ICZ A;  1PZN A;  3CNH A;  3EZ5 A;  2PXI A;  3QNM A;  4EX7 A;  4AT7 A;  2OCE A;  4O0I A;  2FMS A;  4O3R A;  1X40 A;  1XO0 A;  1ZQU A;  3MC1 A;  1NZP A;  2ZIX B;  1X9S A;  3PR4 A;  4J9L A;  2BDP A;  3NVO A;  4AT9 B;  1QQ7 A;  2ZJ8 A;  4J03 A;  2AGQ A;  2BPF A;  1AQ6 A;  5CFT A;  3M9M B;  3AMZ A;  3ZD9 A;  4UAZ A;  2I5H A;  2I1Q A;  2H3V A;  2B0C A;  3GDX A;  2FI1 A;  1JX4 A;  1QQ6 A;  5KG6 A;  1BPE A;  4FBT A;  4DCC A;  2BCR A;  2YB1 A;  4B9M A;  3SI8 A;  4CF4 A;  4I2I A;  2K4I A;  2JEG A;  4F4K A;  5B66 U;  2R8J A;  3RB3 A;  4KLG A;  5CFS A;  4RT2 A;  4USA A;  2LMR A;  3PR5 B;  2WF9 A;  1S10 A;  1BVS A;  1ZRM A;  1UT8 A;  2CN1 A;  3MGH A;  1IM4 A;  1NKB A;  3MBY A;  3UXO A;  3ZDE A;  4NLC A;  5J0X A;  2R8K A;  4OAF A;  3QU2 A;  1L5U A;  3HWT A;  2BZF A;  4ATB B;  5KFC A;  2A1J A;  2J6S A;  3SD7 A;  2WHE A;  3PVX A;  2ALZ A;  2F77 X;  3FAH A;  4LJX A;  5EE0 A;  3OVB A;  4WC4 A;  4IRK A;  3C2K A;  4X0A A;  4KLH A;  1SWV A;  3B9J A;  3PW0 A;  4JMU A;  5AM1 A;  2ZHB A;  4DF8 A;  4RPZ A;  4JWN A;  3EPI A;  3JPO A;  4F5P A;  4TQS A;  3H4B A;  4XRH A;  3OGU A;  2DL0 A;  4MFF A;  2JZB A;  3I76 A;  2W8K A;  1HIW A;  2NRT A;  2KJ8 A;  4DSJ A;  4I27 A;  2J6U A;  1UET A;  3HJE A;  2WB1 C;  3TAD A;  1R8C A;  2ZH8 A;  8ICY A;  1D9F A;  3UQ0 A;  4ECZ A;  4M9H A;  5J2H A;  4O3M A;  4IQU A;  3PX0 A;  1C20 A;  4FO6 A;  3CRX A;  5IIM A;  1N61 A;  3JPP A;  1RYR A;  4JV1 A;  2M2T A;  4B9S A;  5HHI A;  4KLU A;  2HVI A;  5J2D A;  3H7I A;  2HHV A;  5AK3 A;  3T5H A;  2DPI A;  2DFL A;  2M2V A;  4K9A A;  4TUQ A;  3A0B U;  2AHO B;  1CUK A;  2BPC A;  1PK1 A;  5J2F A;  2OEH A;  4F5O A;  2Y1I A;  4IRD A;  4K96 A;  5DGB A;  4GXK A;  2HOQ A;  4J9K A;  3M1Y A;  4C4T A;  4QZF A;  3UMB A;  4X5V A;  1ZQB A;  2Q66 A;  5J2G A;  4QZI A;  1UPH A;  3WU2 U;  4RZR A;  2BQR A;  1S0O A;  1QLN A;  3PHZ A;  3PW4 A;  5JTG A;  3TAR A;  4TUR A;  5GTI U;  3H37 A;  5AKL A;  2EQY A;  4O5E A;  3CW2 C;  4I0U A;  2C28 A;  4Z6F A;  5AM5 A;  5AM0 A;  1JXE A;  2M9N A;  4M6W B;  3C2M A;  4F50 A;  3Q8L A;  2VA2 A;  1ZQE A;  2KIC A;  1NK7 A;  2P6U A;  2J6T A;  1FEZ A;  1KDH A;  2WF7 A;  3QX7 A;  1COO A;  3GZF A;  4C4R A;  4YR2 A;  2EAN A;  4K9B A;  5KFM A;  4YD1 A;  4Y2S A;  4ECU A;  4UQG A;  3AL0 B;  3V6J A;  1ZQY A;  2XC9 A;  3I1Y A;  4KLJ A;  2HOF A;  2JMG A;  3H8S A;  4EYI B;  1ZQW A;  5J0T A;  5J2E A;  3VC8 A;  4O3S A;  4FZN A;  4MEY A;  5H2F U;  4B9N A;  1NI3 A;  3KD3 A;  4ECR A;  1T94 A;  5E79 U;  1TK8 A;  2F76 X;  3AN1 A;  2Y9U A;  4DOB A;  2BGW A;  2DPJ A;  4YXJ A;  4BX9 C;  4M9G A;  1U48 A;  1X42 A;  2IOF K;  2EAM A;  4FE3 A;  4EBC A;  1T8E A;  4OJO A;  2K8B B;  2GOL A;  9ICV A;  3ICX A;  1C7Y A;  5DKW A;  8ICE A;  1UA0 A;  3ORY A;  3PNC A;  1ZQT A;  2C2D A;  5III A;  3RTV A;  1X9X A;  4RWP A;  4NWI A;  3NUQ A;  3G6V A;  4KLD A;  3F5E A;  3C2L A;  4P0P A;  1WCN A;  3LK9 A;  4DFK A;  4WC5 A;  3ZDB A;  4QWE A;  1Q8K A;  3ZDC A;  4I2H A;  2PFN A;  4PHD A;  5IIJ A;  4DL6 A;  5AI0 A;  5AI9 A;  5DQG A;  4CGZ A;  3ETR A;  3PO4 A;  3KKA C;  3SR6 A;  3C21 A;  4YFK A;  4K98 A;  3RJE A;  3OUY B;  3TAD C;  4RQ8 A;  5DBA A;  1L3T A;  1VFG A;  5J2B A;  2FPK A;  4YR0 A;  2XID A;  2H3F A;  4KMO B;  4PGX A;  2K60 A;  4NXX A;  4US9 A;  3C23 A;  1A6S A;  2YMP A;  3MCR A;  2WF5 A;  5KT6 A;  2NRX A;  1KNY A;  2FJ6 A;  5DBB A;  3OTQ A;  3D6J A;  4K4H A;  4GLX A;  2AH5 A;  2P35 A;  2HN1 A;  2B56 A;  3JPS A;  7ICR A;  1PX5 A;  4ECX A;  1NK0 A;  4RWQ A;  3GU3 A;  1X9W A;  3K75 D;  2DGZ A;  4IQT A;  5KAF U;  4FS2 A;  5J0P A;  4EX6 A;  4WH5 A;  3ALR A;  4FH3 A;  3EUB 2;  4UBB A;  4BJQ A;  4QWD A;  5DG9 A;  1FO4 A;  3RBE A;  3OHB A;  4ECQ A;  3AU2 A;  5DQI A;  2PFP A;  5F9N A;  4WQL A;  1SV4 A;  5DB6 A;  3PY8 A;  3AQE A;  1V85 A;  3L4P A;  2DF4 B;  4AT8 A;  3WKE A;  4G3I A;  2G07 A;  4IQW A;  2F1I A;  4UAV A;  4J9P A;  4KX5 A;  4RT3 A;  3TFR A;  1V97 A;  3IG5 A;  1ZJN A;  4C0Z A;  4ED6 A;  3IRU A;  4O3P A;  3D2S A;  3PW7 A;  2EH9 A;  4DSE A;  4ZH4 A;  3F2D A;  4RQ6 A;  2LM4 A;  8ICI A;  2BE3 A;  5HRD A;  5DED A;  1SKR A;  8ICG A;  2H5X A;  5KFR A;  3DEE A;  1TFW A;  7ICJ A;  2QLT A;  4MFC A;  5ALY A;  2HI0 A;  2OYY A;  4ED3 A;  8ICT A;  5AIC A;  3OJU A;  3RFA A;  3KHH A;  1N63 A;  2JV3 A;  4J9Q A;  2KHQ A;  3WFS C;  1DGJ A;  4OAH A;  3ONN A;  3GFK B;  2F1H A;  5EWF A;  1NKE A;  1LKY A;  2YY6 A;  5CEH A;  2JGA A;  3WK7 A;  5J0W A;  2RRD A;  4DO9 A;  5FP0 A;  5AI5 A;  1SV0 C;  4RWN A;  4X0B A;  5HP4 A;  2R18 A;  3T5J A;  3RB4 A;  1SV0 A;  2Y0S C;  4JUZ A;  8ICM A;  1GO3 F;  2FMQ A;  2GH1 A;  5AM4 A;  4YCX A;  3ISD A;  4HX0 A;  4Z6E A;  5ALT A;  5HRG A;  3RJH A;  2ZUD A;  5AIB A;  4PGY A;  2GWS A;  4YG2 A;  1MN8 A;  1BPB A;  2VJ4 A;  4OAI Z;  2BCU A;  4O69 A;  3LVV A;  5F9L A;  4CDG A;  3HW8 A;  4E7X A;  2E1F A;  1Q79 A;  3K7D A;  2KOB A;  3GIJ A;  1ZQD A;  4R66 A;  9ICB A;  3K1R B;  3MAB A;  2WAQ F;  4QWA A;  1N62 A;  9ICF A;  5J8Y A;  5KG1 A;  2G0A A;  2HBM A;  4ECV A;  5KFG A;  4B9L A;  3MR2 A;  3RJF A;  1SL1 A;  1K1S A;  1K1Q A;  1K5O A;  4ED8 A;  2CRX A;  2P6R A;  4U6P A;  1ZET A;  4P4M A;  1OXJ A;  4CF3 A;  3RJG A;  1S0N A;  1LB2 B;  2K4E A;  3K1Z A;  2K8A A;  3HP6 A;  2AGP A;  2ASD A;  1S76 D;  1VJ7 A;  4R64 A;  9ICA A;  3NYB A;  4EEB A;  1SGG A;  1KN5 A;  3AQK A;  3NVW A;  1U49 A;  2V4Q A;  4A8E A;  2ZHA A;  2RP5 A;  4F3O A;  4HAI A;  5ALV A;  3JCF A;  4P4O A;  2F3N A;  3H4D A;  2HDO A;  4RQ4 A;  1OUQ A;  2D3D A;  5DG7 A;  5AKE A;  4EEK A;  3RRG A;  4YMO A;  2ZH1 A;  2NYV A;  5ALR A;  3B0X A;  4JK1 A;  1PVP A;  1RM6 C;  3HPO A;  2CXY A;  2KZM A;  8ICX A;  1URJ A;  4QZG A;  5HMM A;  4F2R A;  2F2A B;  1S0V A;  3HT3 A;  1ZRN A;  2KE7 A;  1SZH A;  3SYZ A;  1SZP A;  5KTQ A;  1XU4 A;  3WFR E;  2FE9 A;  2ODG A;  4QZA A;  5A0L A;  8ICK A;  2MSN A;  4M47 A;  3HKZ F;  3VCB A;  4BWM A;  1SXD A;  3SAF A;  3PW2 A;  4E80 A;  4O5C A;  5ALL A;  9ICT A;  2M2U A;  1QSY A;  3M8R A;  2HBK A;  3O0F A;  5D62 A;  4DL5 A;  2GAF D;  1D8L A;  3MGI A;  1IXR A;  2KEY A;  2XO7 A;  1JUD A;  3WK8 A;  1L8O A;  2Y1J A;  4UAY A;  3CK6 A;  3DV9 A;  4Q44 A;  4UAT A;  2Q4T A;  2RDJ A;  2WFA A;  5DG8 A;  1ZQR A;  4PPX A;  3RR8 A;  4YMN A;  3PSI A;  4UAU A;  3LWL A;  1QCK A;  4M04 A;  9ICJ A;  2ISO A;  2ASJ A;  2ZUC A;  1A76 A;  5KT5 A;  1RQL A;  2W04 A;  1FFU A;  1L8L A;  2HSZ A;  1NJY A;  1BPD A;  4O5K A;  4AYB C;  2KK0 A;  4FHY A;  3JYY A;  1P7D A;  4DOA A;  2XCP A;  3SAG A;  4AT7 B;  4Q43 A;  3RH5 A;  4M9N A;  1IV8 A;  3RF9 A;  5G5G A;  3BS7 A;  4EP7 A;  2MUT A;  4J9S A;  4F5N A;  3IDW A;  2ZTD A;  4F4Z A;  9ICW A;  8ICV A;  2ZIX A;  5CFU A;  3D2Q A;  2KHV A;  3PMN A;  3OWG A;  3QEA Z;  3OSP A;  3H3A A;  1CI4 A;  2K8C B;  4ZOH C;  5KFS A;  2IHN A;  4O3O A;  5L9X A;  4DOC A;  3QE9 Y;  2FPL A;  5KFW A;  8ICC A;  7ICF A;  1Z3E B;  1KRP A;  1KFS A;  4ACO A;  2ZTE A;  3LYS A;  1YLQ A;  1F5A A;  1KL9 A;  4DQQ A;  3ED5 A;  3UMG A;  4DEZ A;  2IHO A;  2KV2 A;  3HJ4 A;  1NKC A;  3BJY A;  2BCQ A;  1Q78 A;  1RDF A;  4NLG A;  3PSP A;  2KFN A;  5HNK A;  1Z19 A;  1XC9 A;  3R9K A;  2E1E A;  9ICR A;  1B0X A;  5HRB A;  4X4R A;  5DBC A;  3MFH A;  1NO5 A;  2HHX A;  2W9M A;  3M8S A;  4K4I A;  2KD1 A;  4I29 A;  4DQI A;  1J97 A;  1MQ3 A;  1JN3 A;  4C8M A;  2RDI A;  3H0R B;  7ICE A;  4R63 A;  2NRV A;  3J81 j;  2O1P A;  5AK6 A;  2UVR A;  1L3U A;  4NM2 A;  4FHP A;  2XGQ A;  3MFI A;  5ALK A;  3BZC A;  3Q8Q B;  3RRH A;  3AQM A;  4TQR A;  4IR9 A;  4U7C A;  1ZQM A;  4NL9 C;  4Y2Y A;  1BNP A;  2KKV A;  5KT3 A;  1HUO A;  2EZY A;  4ELU A;  3GV5 B;  2V4R A;  4CNQ A;  3E2E A;  4FS1 A;  2WAQ C;  3FYH A;  4MF8 A;  1HJP A;  2HN2 A;  4NXZ A;  5J8Y C;  3QZ8 A;  2AU0 A;  4LZG A;  4PZO A;  3RBD A;  2B21 A;  2LPE A;  1LVH A; 
#chains in the Genus database with same CATH homology
 5C5J A;  2KFZ A;  3TQ1 A;  1S97 A;  3HJ1 A;  4O3Q A;  7ICV A;  7ICQ A;  9ICV A;  3IHQ B;  1C7Y A;  4DQS A;  1UA1 A;  7ICL A;  4RWO A;  5J0O A;  5KFK A;  5DKW A;  2DR5 A;  2LYH A;  8ICE A;  1ZQZ A;  3BQT A;  3FDS A;  4M6W A;  1UA0 A;  3KHR A;  3ORY A;  3PNC A;  3PX4 A;  5CA7 A;  1ZQT A;  4DSI A;  2C2D A;  5III A;  9ICN A;  3RTV A;  4UD5 A;  4C8L A;  4RWP A;  3H8W A;  1U9L A;  3G6V A;  4YR3 A;  4M9J A;  3T5L A;  1KLN A;  4PHE A;  4KLD A;  4NLN A;  1JIH A;  4Q8F A;  5HML A;  5KG7 A;  3C2L A;  3UXP A;  4DLE A;  3PX6 A;  5KFO A;  1ZQK A;  1WCN A;  3LK9 A;  5J2I A;  4EZ6 A;  4KTQ A;  4DFK A;  1XO1 A;  5EWG A;  2ATL A;  1H38 A;  3ZDB A;  4QWE A;  4WC5 A;  2M2W A;  5DLF A;  3ZDC A;  4I2H A;  3BDP A;  4WC3 A;  2PFN A;  4PHD A;  2HVH A;  4I2D A;  5IIJ A;  5KT4 A;  4DL6 A;  5DQG A;  4I2A A;  1XSP A;  1QSL A;  4I2J A;  3SV3 A;  3PO4 A;  5IIL A;  5D4B A;  3L9D A;  4Z6D A;  1NK8 A;  8ICP A;  4LT6 A;  4P2H A;  5KG2 A;  2IMW P;  3C21 A;  4YFK A;  5TZV A;  3G6X A;  4EEY A;  3UXN A;  2FLL A;  3NGD A;  1KSP A;  4YVZ A;  4DSF A;  4B9T A;  4EZ9 A;  3RJE A;  3B0Y A;  2XY5 A;  3ZDD A;  1KTQ A;  4ED2 A;  4XQ7 A;  1ZQC A;  3OUY B;  5HC9 A;  2BR0 A;  5DGA A;  9ICU A;  4RQ8 A;  1KFT A;  5DBA A;  1L3T A;  1ZQV A;  4DFP A;  1VFG A;  5EOZ A;  5J0U A;  5J2B A;  2UVV A;  4M5D A;  5J0Q A;  4AT8 B;  2FPK A;  5BOL A;  4YR0 A;  4QZD A;  1NJW A;  4DL4 A;  8ICJ A;  2PI5 A;  4PGX A;  4O9M A;  4F4Y A;  3ISC A;  5HRK A;  1NJZ A;  5KFT A;  3MR6 A;  3EPG A;  3RH6 A;  1V4A A;  3KHL A;  3C23 A;  4QW9 A;  3SV4 A;  2BKE A;  4DLG A;  1SL0 A;  5KT6 A;  3Q8R B;  5IIN A;  1MIY A;  8ICF A;  2NRX A;  2VAN A;  5F2V O;  5HRI A;  1KNY A;  5KFY A;  1Z00 A;  5DBB A;  2W9B A;  1B43 A;  4EBE A;  4K4H A;  4I2G A;  4GLX A;  3G6Y A;  5CJ7 A;  2KZZ A;  8ICR A;  5DQH A;  9ICE A;  2RFF A;  2MAX A;  4QW8 A;  5L1L A;  1JXL A;  2KZ3 A;  2R8H A;  3N4M B;  8ICS A;  4CCH A;  3BQ2 A;  1HUZ A;  3ETL A;  3JPS A;  7ICR A;  1PX5 A;  4ECX A;  4DF4 A;  1NK0 A;  2IHM A;  1X9W A;  3K75 D;  4RWQ A;  4BXO B;  4NLK A;  7ICT A;  4IQT A;  5IIK A;  4FS2 A;  5J0P A;  4YXM A;  5KFB A;  4F93 B;  1WOT A;  4FH3 A;  4LVS A;  4UBB A;  1OU5 A;  4RQ0 A;  4QWD A;  5DG9 A;  1TFR A;  5KFA A;  5KFU A;  3PML A;  1TAQ A;  3RBE A;  3OHB A;  3C1Z A;  1NK4 A;  1U47 A;  2XGP A;  4ECQ A;  4IRC A;  1X2I A;  3AU2 A;  2VA8 A;  4KMU A;  4RQ7 A;  4GXI A;  3TI0 A;  5KFF A;  2BCV A;  5DQI A;  5BOM A;  1TK0 A;  5F9N A;  2W9A A;  2BCS A;  2PFP A;  5L1J A;  4LZD A;  1UEV A;  4X4U A;  5KG0 A;  5DB6 A;  4IQV A;  3GIK A;  3JPN A;  3PY8 A;  2BQ3 A;  2UVU A;  4EBK A;  4KIT B;  2FPM A;  4AT8 A;  4G3I A;  4RNN A;  3V7L A;  4PGQ A;  3IM1 A;  4MEX A;  4IQW A;  2F1I A;  4QZH A;  4DS4 A;  7ICH A;  5KFH A;  4J9P A;  1TAU A;  4RT3 A;  3TFR A;  4ATB A;  1RZT A;  1ZQJ A;  1ZJN A;  5KFI A;  8ICU A;  2A1J B;  4RPY A;  3JPQ A;  1BPZ A;  8ICB A;  4YD2 A;  2ZUB A;  4F5R A;  4FHW A;  4ED6 A;  3LQC B;  4O3P A;  4DS5 A;  3PW7 A;  4XA5 A;  4DSE A;  3UQ2 A;  4ZH4 A;  2WTF A;  2DVI A;  4P4P A;  3MR3 A;  1D8Y A;  4FHX A;  4RQ6 A;  4TUS A;  3RB0 A;  9ICH A;  2F1J A;  2P66 A;  2HHW A;  5DB9 A;  8ICI A;  1B22 A;  5HRD A;  2MUT B;  4RQ2 A;  3GIL A;  2R8I A;  1SKR A;  1ZQO A;  8ICG A;  2H5X A;  1BNO A;  1MIW A;  4B9U A;  3K4G A;  5KFR A;  3ISB A;  1BGX T;  2BQU A;  7ICJ A;  1MQ2 A;  1R8A A;  1TFW A;  1DK3 A;  4X4V A;  1ZQX A;  3N97 B;  4MFC A;  3GV7 B;  3TAP A;  4PHA A;  3KHG A;  2ISP A;  1TVA A;  1UT5 A;  2FMP A;  5J0R A;  4Q8E A;  4ED3 A;  4UAW A;  4DL7 A;  3RAX A;  4J9N A;  7ICK A;  3UPQ A;  8ICT A;  9ICK A;  4I28 A;  2ZH7 A;  5KFL A;  2BPG A;  3OJU A;  4C8N A;  4KN4 A;  4M0A A;  3H39 A;  3KHH A;  5KFP A;  4M2Y A;  2FLN A;  4AT9 A;  1NK5 A;  4J9Q A;  4DL2 A;  9ICL A;  2ZTC A;  4UB3 A;  9ICM A;  4QZ8 A;  4EYH B;  3QEB Z;  2ZH6 A;  3WFS C;  1L3V A;  4X4N A;  3JPT A;  2C2E A;  3GFK B;  2F1H A;  5EWF A;  1TK5 A;  1NKE A;  7ICM A;  3OV7 A;  4KLF A;  4J9M A;  4DFM A;  1SKW A;  5KFX A;  5J0W A;  4HYK A;  5HRH A;  9ICP A;  1N48 A;  4YN4 A;  4DO9 A;  9ICC A;  1ARO P;  3OJS A;  5KFN A;  4ECW A;  2KTQ A;  7ICG A;  4MFA A;  5KT7 A;  3TFS A;  4X0B A;  4RWN A;  5HP4 A;  3AUO A;  2DR8 A;  4QWB A;  1JMS A;  3T5J A;  4I2E A;  4FHV A;  5J29 A;  3RB4 A;  4JUZ A;  3WFQ E;  8ICM A;  5KFE A;  1RYS A;  5HHH A;  3Q8K A;  4F4X A;  3RAQ A;  2FMQ A;  2XY7 A;  4Z6C A;  4IG8 A;  4WBZ A;  3MDC A;  4WC1 A;  4YCX A;  4RUC A;  3ISD A;  5KG3 A;  4RNM A;  3OSN A;  1RXV A;  4Z6E A;  4WBY A;  1S9F A;  3JPR A;  5HRG A;  2JEI A;  7ICS A;  5J2K A;  3RJH A;  4R8U B;  3WFP A;  2ZUD A;  4DQR A;  4PGY A;  3TAQ A;  4YG2 A;  5KFZ A;  2GWS A;  1BPB A;  4DWI A;  1FA0 A;  5EWE A;  4F2S A;  2DRA A;  2BCU A;  1U4B A;  3TAN A;  2NRW A;  5F9L A;  4KLO A;  3HW8 A;  5KT2 A;  1ZQH A;  4ELT A;  3SZ2 A;  7ICU A;  1Q79 A;  4E7X A;  3C66 A;  1ZQN A;  3AQL A;  3H8J A;  3HIY A;  2ZJ5 A;  3QZ7 A;  1NK6 A;  4GC6 A;  3GIJ A;  1TKD A;  1ZQD A;  4R66 A;  9ICB A;  8ICA A;  4ED0 A;  1ZJM A;  3MAB A;  4QWA A;  4DQP A;  3M9O B;  9ICF A;  8ICZ A;  1RXW A;  1PZN A;  2V9W A;  5KG1 A;  8ICQ A;  4QWC A;  3LWM A;  3EZ5 A;  1N56 A;  2PXI A;  4ECV A;  2IBK A;  4AT7 A;  5KFG A;  5BPC A;  3GV8 B;  3BQ1 A;  5KG4 A;  3BQ0 A;  4F4W A;  3THV A;  5J0S A;  4O0I A;  3MR2 A;  3RJF A;  4B9L A;  2FMS A;  9ICX A;  5HRE A;  1SL1 A;  4O3R A;  1K1S A;  1K1Q A;  4DL3 A;  1QTM A;  4YP3 A;  1ZQU A;  2Q0Z X;  3PV8 A;  1NZP A;  4ED8 A;  4PH5 A;  1XSL A;  2P6R A;  1X9S A;  5DDM A;  4ECT A;  1ZET A;  4P4M A;  1ZYQ A;  3PR4 A;  4J9L A;  4EBD A;  1X9M A;  4JV0 A;  2BDP A;  3RJG A;  4ED1 A;  7ICI A;  1NK9 A;  1S0M A;  4NY8 A;  4AT9 B;  3C1Y A;  1S0N A;  2R8G A;  1LB2 B;  8ICO A;  2ZJ8 A;  1DOQ A;  2AGQ A;  5DDY A;  1LV5 A;  3HP6 A;  3GII A;  2AGP A;  2BPF A;  3M9M B;  2ASD A;  2C2R A;  3PO5 A;  1S76 D;  3ZD9 A;  1VJ7 A;  4UAZ A;  4R64 A;  2W9C B;  5DB8 A;  9ICA A;  3NYB A;  4KLM A;  2I9G A;  4KN7 A;  1ZQA A;  4K4G A;  4X4T A;  2I1Q A;  1EXN A;  3GDX A;  4ECY A;  3AQK A;  1JX4 A;  5KG6 A;  4TUP A;  1ZQL A;  1U49 A;  2V4Q A;  1WCL A;  3C18 A;  2ZHA A;  1ZQP A;  4RPX A;  1BPE A;  2KN7 A;  2C22 A;  2BCR A;  4FBU A;  4FBT A;  4B9M A;  2PFQ A;  3C5F A;  4F3O A;  3SI8 A;  1CEZ A;  9ICS A;  4I2I A;  2ASL A;  2KP7 A;  4X4S A;  4P4O A;  9ICO A;  3EYZ A;  2DR9 A;  1RPL A;  5IIO A;  2JEG A;  3H4D A;  5HRF A;  4F4K A;  4RQ4 A;  3V72 A;  1TV9 A;  2R8J A;  3RB3 A;  5DG7 A;  4KLG A;  4MF2 A;  4RT2 A;  3RRG A;  3V7K A;  2AQ4 A;  4YMO A;  1DK2 A;  5J2A A;  3M9N B;  3PR5 B;  2ZH1 A;  8ICW A;  1NOM A;  1U45 A;  3KTQ A;  1S10 A;  4F8R A;  1BVS A;  5J2J A;  3H38 A;  1UT8 A;  3B0X A;  4JK1 A;  1IM4 A;  3MGH A;  3HPO A;  1NKB A;  3MBY A;  3UXO A;  3ZDE A;  5JUM A;  5J0X A;  3MDA A;  2KZM A;  7ICP A;  9ICG A;  2R8K A;  8ICX A;  5J0Y A;  4QZG A;  5HMM A;  3H40 A;  4F2R A;  2PFO A;  1L5U A;  3HWT A;  4DFJ A;  3GIM A;  4ATB B;  2BE3 A;  1S0V A;  5KFC A;  3HT3 A;  2A1J A;  1SKS A;  2J6S A;  3OUY A;  1T4G A;  3C5G A;  3PVX A;  3ZDA A;  3SYZ A;  1SZP A;  2ALZ A;  5KTQ A;  1V9P A;  1XU4 A;  3ZD8 A;  4EBJ A;  3WFR E;  3OVB A;  4O3N A;  4WC4 A;  4RQ3 A;  3C2K A;  4ECS A;  3RH4 A;  3RR7 A;  4QZA A;  4IRK A;  4KLH A;  4WC2 A;  8ICK A;  4X0A A;  4M9L A;  2NRK A;  4M47 A;  3PW0 A;  2ZHB A;  4BWM A;  4DF8 A;  3GQC A;  4I2C A;  4RPZ A;  4JWN A;  2VA3 A;  3EPI A;  1MIV A;  3JPO A;  5CB1 A;  3EW9 A;  4F5P A;  2ZH4 A;  3PW2 A;  4TQS A;  4E80 A;  4UBC A;  4XRH A;  3OGU A;  3H4B A;  4O5C A;  4KLE A;  9ICT A;  4UB2 A;  3JZ0 A;  1ZQG A;  2M2U A;  3OHA A;  1QSY A;  3M8R A;  4MFF A;  2PBE A;  2ID1 A;  3RB6 A;  2JZB A;  7ICO A;  2W8K A;  5D49 A;  2NRT A;  8ICN A;  2HHS A;  4DL5 A;  5DEC A;  4DSJ A;  1D8L A;  4I27 A;  2J6U A;  3RJJ A;  1UET A;  4E8F A;  4F91 B;  4NKT A;  1R8C A;  3MGI A;  4NLZ A;  2ZH8 A;  1IXR A;  5L1I A;  4NM1 A;  8ICY A;  2ZH2 A;  2XO7 A;  1BPY A;  3UQ0 A;  4ECZ A;  1D9F A;  4QZ9 A;  4M9H A;  1JAJ A;  4J9O A;  1JQR A;  2Y1J A;  4UAY A;  4IR1 A;  5J2H A;  2AJQ A;  4IQU A;  4Q44 A;  3PX0 A;  1T3N A;  4X4O A;  3OVA A;  4FO6 A;  3EWA A;  5IIM A;  1XS9 D;  2RDJ A;  3JPP A;  1RYR A;  4JV1 A;  2M2T A;  5DG8 A;  1D9D A;  1ZQS A;  4B9S A;  5HHI A;  4KLU A;  2IA6 A;  1ZQR A;  4PPX A;  2HVI A;  5J2D A;  3RR8 A;  4YMN A;  1ZQF A;  1A77 A;  3H7I A;  2HHV A;  4NKU A;  3T5H A;  4R8U A;  1ZQI A;  3LWL A;  3V6H A;  2DPI A;  4M04 A;  9ICJ A;  2ISO A;  2ZH3 A;  2DFL A;  2M2V A;  3V6K A;  1XSN A;  2DR7 A;  2ZJA A;  4TUQ A;  2ASJ A;  2ZUC A;  4GXJ A;  1A76 A;  1CUK A;  5KT5 A;  2BPC A;  5J2F A;  4C8K A;  4DSL A;  4F5O A;  2XCA A;  2Y1I A;  4I2F A;  3OVS A;  1NJY A;  4IRD A;  2BHN A;  1BPD A;  3NTU A;  4F92 B;  5DGB A;  4UB4 A;  4O5K A;  4RUA A;  3WFO A;  4FHY A;  4RQ1 A;  3JYY A;  1MC8 A;  4BGD A;  4F5Q A;  4ELV A;  4GXK A;  4DOA A;  4J9K A;  1NJX A;  4BWJ A;  5KFV A;  4RU9 A;  2XCP A;  3RJI A;  1MSW D;  4Q43 A;  3RH5 A;  4QZF A;  4UB5 A;  4M9N A;  4AT7 B;  4WC6 A;  4X5V A;  2ZH5 A;  1ZQB A;  3AU6 A;  4XQ8 A;  2JEF A;  1R89 A;  4EP7 A;  2MUT A;  4J9S A;  4F5N A;  2ZTD A;  5CWR A;  5HRL A;  2HHP A;  2Q66 A;  5J2G A;  5D46 A;  4QZI A;  4F4Z A;  4BDP A;  8ICV A;  9ICW A;  2O5A A;  5KFQ A;  3PMN A;  3QEA Z;  3OSP A;  4RZR A;  2BQR A;  2AQ0 A;  1S0O A;  4KLL A;  1QLN A;  7ICN A;  9ICI A;  3H3A A;  3UPS A;  3PW4 A;  5KFS A;  2IHN A;  4O3O A;  4XUS A;  5L9X A;  4DOC A;  5DB7 A;  4TUR A;  3TAR A;  5L1K A;  3QE9 Y;  2FPL A;  1DGS A;  4YMM A;  3PW5 A;  2W8L A;  3H37 A;  4X4Q A;  5KFW A;  8ICC A;  5KG5 A;  7ICF A;  1Z3E B;  5CHG A;  1KRP A;  4BXO A;  4O5E A;  1KFS A;  5DED A;  4S3N A;  4WC0 A;  2W9C A;  4RNO A;  2ZTE A;  2JZB B;  4GC7 A;  2C28 A;  4B9V A;  1YLQ A;  4QZC A;  4Z6F A;  2XY6 A;  4JV2 A;  4KLQ A;  8ICL A;  1JXE A;  5CP2 A;  4FH5 A;  1F5A A;  2M9N A;  4M6W B;  3C2M A;  4F50 A;  4RQ5 A;  4DQQ A;  3Q8L A;  2VA2 A;  4KLS A;  2HHU A;  1ZQE A;  4DEZ A;  5J2C A;  3HJ4 A;  1NK7 A;  1UEU A;  2P6U A;  1NKC A;  3BJY A;  2BCQ A;  2J6T A;  2PI4 A;  1QSS A;  2HHQ A;  1Q78 A;  4NLG A;  1KFD A;  1KDH A;  2KFN A;  5HNK A;  2HHT A;  1XC9 A;  1COO A;  3Q8S B;  9ICR A;  1TFY A;  5HRB A;  4X4R A;  5DBC A;  3HX0 A;  4WCW A;  3MFH A;  4YR2 A;  1NO5 A;  2HHX A;  4KLI A;  5KFM A;  4R65 A;  2W9M A;  4YD1 A;  3M8S A;  4ECU A;  4UQG A;  2JEJ A;  4K4I A;  4WC7 A;  4I29 A;  9ICQ A;  4DQI A;  4DSK A;  4Q45 A;  1ZQQ A;  3V6J A;  1XWL A;  1ZQY A;  4JWM A;  4QZB A;  2XC9 A;  2DRB A;  1MQ3 A;  4KLJ A;  1JN3 A;  4ED7 A;  3H8S A;  4C8M A;  1L3S A;  2UVW A;  4EYI B;  1ZQW A;  1KEJ A;  5J0T A;  1S77 D;  4UD4 A;  5J2E A;  2RDI A;  4PHP A;  4O3S A;  7ICE A;  4R63 A;  2NRZ A;  2NRV A;  4MEY A;  4UB1 A;  4C8O A;  4KLT A;  3RJK A;  2HW3 A;  1R8B A;  2O1P A;  2UVR A;  1L3U A;  4NM2 A;  4FHP A;  4B9N A;  2XGQ A;  1Y88 A;  3MFI A;  4ECR A;  1SL2 A;  2ZH9 A;  5KFD A;  4QZE A;  5CR0 A;  4YQW A;  3Q8Q B;  3T3F A;  2OWO A;  4E0D A;  3RRH A;  3LDA A;  3AQM A;  5DLG A;  4TQR A;  4IR9 A;  5HR9 A;  1TK8 A;  1ZQM A;  1BNP A;  3T5K A;  1BPX A;  4X4P A;  1Z00 B;  5KT3 A;  1HUO A;  4DOB A;  2BGW A;  2W9B B;  2DPJ A;  4ELU A;  3GV5 B;  3AQN A;  4YXJ A;  2V4R A;  2AGO A;  3E2E A;  4FS1 A;  3V7J A;  4M9G A;  3FYH A;  1U48 A;  4MF8 A;  3Q8P B;  3Q8M A;  1HJP A;  3MR5 A;  4NXZ A;  2FLP A;  3QZ8 A;  4EBC A;  2AU0 A;  4J9R A;  1T8E A;  4LZG A;  3RBD A;  2B21 A;  1T7P A;  5KFJ A;  8ICH A;  4I2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...