5DB9A

Structure of human dna polymerase beta host-guest complex with the n7mg base paired with a dg
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 108
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5db9A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5db9A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5db9A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5db9A03
4PHEA 1ZQJA 3WFRE 5J0QA 5CHGA 4EZ9A 3C1ZA 4ELUA 2PI5A 9ICIA 4NLKA 4O0IA 4MEXA 2W8KA 2F1IA 1KNYA 4E80A 1T3NA 8ICBA 4Z6FA 1NKCA 1N56A 3IM1A 4M47A 3GV8B 1B22A 3C2MA 4JK1A 2H5XA 5TZVA 4O3OA 5KFKA 4RNOA 4R8UB 2BCVA 4YMOA 2W9BB 2C2RA 4J9LA 2BPFA 4E8FA 2Q0ZX 5KFSA 4FO6A 4RQ1A 4JV1A 1NK9A 4LZDA 4NLGA 5KG4A 3TANA 4M0AA 2UVRA 5F9NA 3M8RA 2A1JA 5KG3A 4ECZA 4I29A 3L9DA 3M8SA 3MR2A 4MF8A 4F91B 4QWBA 3JPSA 3T5LA 5KFTA 4ECWA 5J2FA 4YQWA 3RR8A 4JV2A 3V6HA 1BPXA 2HHWA 1R89A 2B21A 3MFIA 1KTQA 3RRGA 4QZDA 8ICGA 4F4XA 1A77A 3HT3A 4BDPA 3LWMA 2JZBA 2RDJA 1LB2B 1KRPA 1WOTA 4ECSA 4KLOA 4JWMA 7ICSA 4ECYA 1TFYA 4UB1A 3GQCA 1MSWD 7ICKA 3EPGA 3AUOA 3N4MB 3C21A 7ICJA 4QZHA 4WC3A 4WC1A 2AJQA 7ICVA 4RWPA 4NM1A 1XSPA 1ZYQA 4YD1A 1S0MA 3GILA 3H40A 4IRKA 2P6RA 2HHQA 3QZ8A 3T5KA 1S0OA 4FHVA 4I2DA 5J0SA 5J2JA 5DECA 3AQKA 3V7JA 5J0PA 4X4OA 3TAQA 2OWOA 4KLTA 3C18A 4EBKA 4X4RA 2ZH1A 2C2DA 4UB4A 3RAXA 1X9WA 4BGDA 4WC0A 1S0VA 1NJWA 4NY8A 3GV7B 1S76D 9ICGA 2IHMA 4B9VA 4E0DA 4XUSA 3T3FA 1Y88A 3RAQA 1U48A 2BQUA 2ZTDA 3KHHA 5KG5A 3PV8A 5DBAA 4NLZA 2ASLA 4J9MA 1ZQBA 5L9XA 4F4WA 2O5AA 3PNCA 4ECTA 4JV0A 1ZJNA 4X4PA 2W9BA 4R64A 2FLLA 4I28A 1S0NA 4KLSA 4M9JA 1S9FA 4RNNA 4XA5A 9ICTA 2M2VA 4RWQA 4YD2A 2KN7A 5IIKA 4F93B 4KLUA 4NM2A 3UXOA 2FMPA 5KFPA 1XSLA 7ICRA 4DFKA 1UT8A 1LV5A 3KHLA 1QSYA 2ZHBA 3Q8LA 4RPXA 9ICJA 3TFRA 3BQTA 3OSPA 3H3AA 4FS2A 3RJHA 4UAZA 3RJKA 5D49A 5DQIA 5DB6A 1OU5A 4F4ZA 5J2BA 4DFMA 2AGOA 2O1PA 3ISCA 1SKSA 4UB3A 3C66A 3RJIA 3HJ4A 1ZQMA 1QSLA 5DBCA 2ZH9A 4X4TA 2ASDA 3PX4A 3H7IA 3OUYA 5DDYA 5J2CA 4WBYA 2ZUBA 1ZQEA 5KT7A 5DLFA 5KFFA 4K4HA 1QLNA 4C8NA 4AT8B 2ISOA 4XQ7A 1BPZA 3OV7A 4EBEA 2W9CA 2ATLA 5IINA 9ICQA 5HRDA 1PX5A 2UVWA 1KFTA 4ECVA 2C22A 4FS1A 3PVXA 1D8YA 4X4QA 5KFDA 4YXMA 5DB7A 4S3NA 3JPRA 2VA2A 3V6JA 3PO4A 4NKTA 3JPTA 4QZ9A 3TARA 4TUPA 1VFGA 4P4MA 4YMNA 4X4VA 4IRDA 1XSNA 5KFOA 5KT3A 1ZQNA 4O5KA 4B9NA 2ZTCA 4DS5A 4M9NA 3C5GA 2NRZA 2AGQA 2ASJA 2ZJ5A 5F9LA 4DSEA 2GWSA 3ZD9A 3MDAA 5J0OA 4DSIA 8ICQA 5KFAA 1KFDA 1TVAA 4O5CA 2R8GA 3V6KA 8ICNA 3AQNA 2R8JA 4KN7A 8ICZA 1Z00A 4IG8A 4NKUA 2V4QA 3AU2A 1L3VA 4X0AA 2Y1JA 1ZETA 1ZQLA 3JZ0A 4WC2A 3UXNA 4YG2A 8ICMA 5J0YA 2DR9A 4FH3A 3M9NB 3EYZA 4YP3A 8ICWA 4TUSA 1MQ3A 2BCUA 4BXOA 4PPXA 4QZCA 2XGQA 4J9PA 2XY6A 4M2YA 1BPYA 5L1KA 2ZH7A 3WFQE 4R66A 5J2KA 3WFSC 4GXIA 5KG2A 1XS9D 4C8KA 4AT7B 3V7LA 1SKRA 4YCXA 1SL1A 1ZQGA 2W8LA 3ZDCA 1IXRA 4EBCA 2AQ4A 4RQ7A 1Q78A 3EZ5A 3OUYB 2ZH5A 1TAQA 2ZH4A 4LT6A 2ALZA 8ICXA 4MFAA 2F1HA 5D46A 2V4RA 2VA8A 4FHYA 4DQPA 4QZBA 4P4OA 1NO5A 4RQ8A 4GXKA 3H4BA 2BPGA 2R8IA 4I2AA 4PGYA 1NKBA 3Q8RB 2W9CB 2XCPA 4EEYA 4KLGA 4Z6EA 3KTQA 5HRBA 2KZ3A 5KFHA 3PX0A 3GIJA 4F4YA 4RT3A 4DFPA 4DL3A 4F3OA 4KLMA 8ICKA 3PO5A 2JEGA 4UQGA 4DLGA 9ICVA 3B0XA 4EBDA 2BCQA 4B9MA 4DSKA 5CP2A 9ICPA 4DQSA 1ZQDA 4F2RA 4UB2A 5HRLA 2R8KA 2M9NA 2ZH8A 4QWAA 3JPPA 3N97B 2C2EA 5HHIA 3PX6A 1MIYA 4QZ8A 8ICAA 4YN4A 4X5VA 5CR0A 4J9QA 4KLQA 4EYHB 9ICCA 2PFQA 4I2GA 2PFNA 5KFUA 3ETLA 2PXIA 4DL7A 2KZZA 1V4AA 4E7XA 5KTQA 1TAUA 3SYZA 2DPIA 4K4GA 4F5RA 2JZBB 4R8UA 4P2HA 3M9MB 3AQMA 1QTMA 2P66A 1L3UA 2PI4A 3NGDA 3MR6A 2HHTA 2C28A 8ICTA 3PMLA 3QEBZ 1NK4A 4LVSA 1NJZA 2XCAA 4Q8EA 2XGPA 4XRHA 5EWFA 1ZQFA 1JIHA 1BGXT 8ICIA 3Q8QB 3NTUA 2UVUA 1ZQCA 5KFZA 2BQRA 2DR8A 5DB9A 1TK8A 1D9FA 3H39A 3BQ0A 4RUAA 1K1SA 1SZPA 1KSPA 4TURA 5J0XA 3HWTA 4F5QA 3PMNA 7ICQA 1YLQA 4PGXA 1D8LA 3RB6A 5KFYA 5KG6A 4BWMA 4QZIA 4F4KA 8ICEA 9ICMA 3GDXA 1NK7A 2AQ0A 2F1JA 2RDIA 4DO9A 5JUMA 1ZJMA 1L3SA 4WC5A 5DG8A 4I2CA 2J6UA 5KFBA 9ICBA 3GIMA 5IIMA 5DG7A 1C7YA 4FH5A 1VJ7A 4RQ6A 4WC7A 1NKEA 5J0UA 2BQ3A 4C8LA 5DEDA 4MF2A 4DF8A 1JX4A 5HREA 8ICOA 1XU4A 4DSFA 3PW0A 1NJXA 5CWRA 3ZDBA 3OHBA 4KLHA 5J0WA 9ICNA 4MEYA 4B9SA 4AT9A 2W9MA 5BOLA 5KFJA 1JXLA 1U9LA 2BHNA 2DFLA 2XC9A 5L1JA 5J0TA 3UQ2A 4O3RA 4KN4A 4JUZA 4ED2A 2JEIA 5KT2A 7ICNA 1UETA 9ICUA 4DL2A 3H37A 5KFLA 5KT4A 5KFNA 3C2KA 5HHHA 4M6WA 2HHXA 5J2HA 2NRTA 3LWLA 2HVHA 2M2TA 5HR9A 3Q8SB 4DSLA 1DGSA 9ICEA 2W9AA 7ICGA 4QZGA 4QW9A 5J2DA 1JN3A 3WFOA 1IM4A 4EBJA 3SV3A 1MIVA 2JEJA 4AT8A 1HJPA 1B43A 1H38A 4B9TA 1S77D 4Q8FA 3HP6A 3LQCB 4MFCA 4RU9A 2BE3A 4GC7A 1HUZA 5KFWA 1NOMA 4ED6A 1RZTA 1DK2A 5DBBA 2DRAA 1JXEA 8ICVA 7ICPA 3ISDA 3EPIA 2PFOA 9ICAA 4ATBB 4AT9B 4I27A 3HW8A 4DOCA 1JMSA 5EWEA 5J29A 7ICTA 1A76A 3H8JA 5EOZA 4J9RA 3PR5B 4KLDA 4RUCA 2P6UA 4ECQA 3RH6A 3Q8PB 3ZD8A 4WC6A 5J2IA 9ICRA 5J2EA 3GV5B 3UXPA 4Q44A 4DL6A 4QWEA 5KFIA 4X4UA 4DSJA 3B0YA 2HVIA 3OJSA 5HRFA 4QW8A 4F92B 4X0BA 2VANA 3V72A 1WCLA 4ELTA 4Z6DA 4UAWA 4RQ0A 4F8RA 1ZQYA 4O9MA 2BDPA 1ZQWA 4YFKA 4ECUA 8ICPA 4QZEA 7ICIA 1ZQXA 4UB5A 2V9WA 3ZDDA 5KFRA 4WCWA 2KFZA 1ZQOA 3LK9A 1DK3A 3H8WA 4Q45A 3KHGA 4EZ6A 4FHWA 4DF4A 1FA0A 4DQIA 3ORYA 2ZJ8A 4Q43A 1ZQKA 4RQ5A 3RB0A 4FHPA 5HRIA 2ZJAA 5DQHA 1L5UA 3RJGA 1EXNA 4DLEA 1Z00B 2MAXA 4PHAA 2UVVA 4RWOA 1UEUA 4YXJA 4YR3A 4F5OA 3UPQA 1HUOA 1CUKA 3JPQA 4UD5A 4AT7A 4HYKA 1ZQHA 2M2WA 3TAPA 3G6YA 1SKWA 1RYSA 4UD4A 5IIIA 4M5DA 4IQWA 1WCNA 1XWLA 4BXOB 4MFFA 2BPCA 4M9GA 1X2IA 2KTQA 1UT5A 1BNOA 2FPLA 4DQQA 1NK5A 1NZPA 1BPEA 1SL0A 2AGPA 4KITB 1F5AA 5IILA 2ZH6A 4B9LA 2HHPA 5EWGA 4ECRA 1ZQIA 3RR7A 2FPKA 8ICHA 9ICXA 4M6WB 1RXWA 2FLNA 4WC4A 3IHQB 2ZUCA 4J9NA 8ICUA 3E2EA 4O3PA 5KFXA 7ICOA 3RBDA 4I2HA 3Q8MA 2KZMA 1CEZA 4IQVA 5D4BA 4KLJA 2HHSA 4P4PA 2A1JB 3MABA 4TQSA 3SI8A 4KLEA 2RFFA 2J6TA 4XQ8A 3KHRA 9ICSA 1MIWA 5KFMA 7ICFA 1UA0A 3G6VA 1UA1A 5KG0A 7ICLA 1JQRA 4RPYA 4Z6CA 3OGUA 3GIIA 4EYIB 4PHDA 3T5JA 5KT5A 2BR0A 1TKDA 1NK6A 1U47A 1T7PA 2HHVA 4ED7A 4GXJA 2ZTEA 3H8SA 3UPSA 4DOBA 4FBUA 2I1QA 4ED8A 1S10A 3RJFA 4UBCA 4RZRA 1DOQA 4RQ3A 1KFSA 4IR1A 1N48A 5L1LA 2J6SA 2DR5A 5KFEA 1D9DA 4JWNA 9ICWA 3AQLA 2I9GA 4NXZA 4ATBA 4DQRA 1U45A 3LDAA 3RB4A 3TI0A 1MQ2A 2LYHA 5BOMA 4QWDA 2XY5A 4DL4A 5HRGA 4DFJA 5IIOA 4GC6A 2ID1A 3QZ7A 5HC9A 1ZQPA 3SV4A 9ICHA 5HMLA 2KP7A 3HJ1A 1R8BA 1BVSA 3EW9A 2BCSA 4O3SA 4X4SA 1U49A 2BKEA 4F50A 3HX0A 3RB3A 5J2GA 3MGHA 8ICSA 3THVA 4R65A 2Q66A 1R8AA 4ZH4A 4QZFA 2AU0A 4RNMA 1T8EA 4ECXA 2ISPA 2FPMA 3RJEA 4DWIA 5DQGA 4KTQA 3RRHA 1X9SA 1Z3EB 1BNPA 3OVAA 4BWJA 5CA7A 5DDMA 2HHUA 1NK0A 5KFCA 4B9UA 4TUQA 3RTVA 1R8CA 2DVIA 4ELVA 3QEAZ 3K4GA 5C5JA 8ICRA 3WFPA 3RBEA 8ICFA 3HIYA 3BJYA 1ZQQA 5CB1A 3GIKA 3UQ0A 3PY8A 5DKWA 5IIJA 3Q8KA 7ICHA 1NK8A 2ZH3A 4F2SA 4M04A 4CCHA 1ZQUA 1ZQZA 5CJ7A 4YMMA 3MR3A 4ED3A 4YR0A 5DLGA 4FBTA 5KFVA 3OSNA 4DS4A 4KLLA 4K4IA 3ZDAA 4DOAA 3MFHA 1U4BA 3V7KA 1ZQSA 4I2FA 2IA6A 2MUTA 1S97A 4TQRA 4C8MA 1K1QA 2DRBA 4IQTA 4O3NA 3C2LA 4F5NA 2Y1IA 3BQ1A 2BCRA 4ED1A 1AROP 1ZQTA 1KLNA 4O5EA 4DEZA 3H38A 5HRHA 3FDSA 4IR9A 2IMWP 1BPBA 9ICFA 3SZ2A 3T5HA 3TFSA 3ZDEA 4F5PA 2IHNA 3GFKB 3MR5A 8ICJA 1TK0A 4YR2A 5L1IA 2BGWA 9ICKA 1L3TA 3NYBA 1ZQAA 4PHPA 1Q79A 4J9OA 3M9OB 2NRVA 5DB8A 3JYYA 4LZGA 4R63A 8ICCA 3MGIA 5J2AA 1RPLA 1XO1A 5HNKA 2R8HA 5DG9A 4J9KA 2FMQA 4M9LA 2DR7A 9ICOA 2IBKA 4IRCA 3MBYA 3PW5A 3JPOA 4RPZA 1MC8A 5HP4A 5KFGA 1PZNA 4I2IA 3HPOA 3RJJA 1BPDA 3C23A 4I2BA 4RQ2A 4DL5A 1RYRA 5DGAA 1X9MA 1KEJA 3MDCA 3BDPA 2PBEA 3H4DA 5KG1A 1JAJA 1QSSA 5BPCA 3JPNA 1TFRA 2ZH2A 3OHAA 4FHXA 4KLIA 3OVSA 5KT6A 3OVBA 3RH4A 3PW7A 7ICMA 5J0RA 4I2JA 3G6XA 3PW4A 3BQ2A 3TQ1A 4RWNA 2DPJA 1TK5A 2WTFA 1RXVA 4PH5A 3AU6A 2KFNA 2JEFA 4EP7A 5F2VO 2ZUDA 2M2UA 2FMSA 4KLFA 3QE9Y 4QZAA 1KDHA 2NRXA 2XY7A 1ZQRA 2FLPA 5HRKA 2NRKA 4UBBA 4KMUA 1V9PA 2MUTB 5HMMA 4ED0A 4I2EA 1ZQVA 4O3QA 1XC9A 7ICUA 4GLXA 8ICYA 4M9HA 4QWCA 9ICLA 5DGBA 3PW2A 3RH5A 5KG7A 1TV9A 4G3IA 8ICLA 3ISBA 4IQUA 1UEVA 4WBZA 1TFWA 2XO7A 3OJUA 4J9SA 3FYHA 7ICEA 3C5FA 1COOA 1SL2A 2ZHAA 3C1YA 3EWAA 3K75D 4YVZA 1NJYA 2NRWA 2PFPA 2VA3A 4C8OA 5KFQA 3PR4A 4PGQA 2HW3A 1T4GA 4NLNA 4RT2A 4RQ4A 4UAYA 4X4NA
chains in the Genus database with same CATH superfamily
2O6KA 2OXOA 4US8A 3WFRE 4ELUA 2PI5A 3FAHA 4UASA 2W43A 3ETRA 1N56A 3M6ZA 4JK1A 2H5XA 4EENA 1ZOLA 4O3OA 4E8FA 4J9LA 5KFSA 4NLGA 4NJ8A 3TANA 3WK7A 2UVRA 2A1JA 5ALGA 1UQVA 4F91B 5KFTA 3MFIA 1X66A 2Y0SF 1O03A 1A77A 3HT3A 4BDPA 1WOTA 4KLOA 7ICKA 3QU4A 3EPGA 3AUOA 7ICJA 5ALTA 4WC3A 7ICVA 4RWPA 4NM1A 2LYBA 2MRLA 2HDOA 2K89A 5ALZA 4IRKA 3BS5B 3QZ8A 3T5KA 1S0OA 4FHVA 5DECA 2HOQA 5J0PA 3TAQA 1NI3A 2ZH1A 1X9WA 4WC0A 2ZIXA 2EAMA 3T3FA 2EZXA 1T3QA 2YTUA 3PV8A 1F5SA 4MKPA 5DBAA 4J9MA 2O5AA 4JV0A 2W9BA 1MA7A 2M2VA 4F93B 5HR6A 2FMPA 4DFKA 1JRPA 2ZHBA 3Q8LA 9ICJA 3BQTA 3OSPA 5ALEA 3RJKA 3QU5A 4U6PA 4DFMA 2AGOA 2O1PA 3ISCA 1SKSA 3HJ4A 2HBKA 2ZH9A 2RP5A 4X4TA 3UMBA 3L3FX 2ASDA 5J8YC 4Y2UA 5KT7A 1QLNA 3NVYA 4AT8B 4HX0A 4UW9A 2W9CA 2ATLA 5IINA 5D63A 4CF3A 5CFUA 2E1FA 4FS1A 4X4QA 2GOLA 1VJ5A 4Y2XA 1SGGA 4S3NA 4QZ9A 3TARA 4TUPA 2LPEA 2D3DA 4O5KA 4EEBA 3UMCA 1V85A 5F9LA 4DSEA 3ZD9A 3AMZA 5KFAA 4O5CA 4AYBC 3V6KA 4IG8A 2F3NA 5ALYA 1ZETA 3D6JA 3EYZA 4J9PA 1BPYA 3WFQE 2ZH7A 4R66A 2HN1A 4GXIA 5KG2A 1XS9D 4AT7B 1SKRA 1ZQGA 2W8LA 4EBCA 2W04A 2ALZA 2YQEA 4KM5A 2F1HA 2KVSA 2VA8A 3PSIA 4PGYA 2K8BB 3E58A 4Z6EA 3KTQA 4F3OA 4KLMA 3BQ7A 2BCQA 4B9MA 2W54A 5ALUA 4OCZA 2KICA 4DQSA 4F2RA 5B5EU 5HRLA 2R8KA 2M9NA 3IV6A 2C2EA 3D2SA 4CF5A 1QQ5A 2H3FA 4J9QA 4KLQA 2PFQA 4I2GA 1SB3C 3O0FA 1V4AA 1TAUA 3SYZA 2DPIA 3M9MB 1L3UA 3PZPA 2E8PA 3AL0B 2AXTU 1NJZA 1C20A 4Q8EA 5EWFA 1BGXT 3Q8QB 2WB1F 3H8MA 4LEWA 3BQ0A 1KSPA 3HWTA 4F5QA 4J03A 1L7NA 2JGAA 3RB6A 5KG6A 3GDXA 1NK7A 2F1JA 2NV3A 4DO9A 5JUMA 3BZCA 4WC5A 2H3VA 5DG8A 3GIMA 2ODGA 5IIMA 5DG7A 1C7YA 1VJ7A 4WC7A 2BQ3A 2N1RA 4DF8A 8ICOA 3OHBA 4NV0A 9ICNA 3QYPA 1U9LA 2DFLA 5L1JA 3VC8A 7ICNA 4KN4A 5KT2A 2WB1C 3Q8SB 1IM4A 5AI0A 1S77D 1H38A 3HP6A 3LQCB 4RU9A 4GC7A 1NOMA 4ED6A 1RZTA 3C29A 5DBBA 8ICVA 3SENA 3EPIA 2PFOA 9ICAA 4I27A 4DOCA 1JMSA 7ICTA 4US9A 5EOZA 4RUCA 4BUGA 4G9BA 3F2DA 5J2IA 1KN5A 4DL6A 5CHEA 4X4UA 3CK6A 4QW8A 2F2AB 4O9MA 2BDPA 4YFKA 8ICPA 1ZQXA 4UB5A 4K8VA 3LK9A 2K60A 3KHGA 2BBJA 5AKLA 1FA0A 4DQIA 2ZJ8A 4Q43A 4RQ5A 1L5UA 3RJGA 4NLBA 4YXJA 1GO3F 4UD5A 3SMVA 2IOFA 5JRTA 3TAPA 2CN1A 2GLEA 2KTQA 2BPCA 4FZLA 2MU2A 1UT5A 2F44A 1QCKA 1NK5A 2AGPA 4KITB 3TADA 4B9LA 1ZQIA 3RR7A 2FPKA 2FLNA 3IHQB 2ZUCA 4J9NA 8ICUA 7ICOA 2KZMA 4IQVA 2HHSA 2VIXA 4EELA 2RFFA 3KHRA 2YB4A 3WK6A 3G6VA 1GPJA 1X6JA 3T5JA 3OGUA 5KT5A 2G0AA 3H8SA 3QNMA 4C4TA 3UPSA 2I1QA 4UBCA 4RZRA 4IR1A 5L1LA 2DR5A 2I9GA 4ATBA 2GA9D 3TI0A 4UARA 2GH1A 4C7YA 5ALMA 3QZ7A 9ICHA 1RDFA 1U49A 3RB3A 1ZD2P 2G06A 3MGHA 8ICSA 1R8AA 2ZIUA 4QZFA 4ECXA 1BNPA 5JTIA 1NK0A 5ALIA 5KL8B 2DVIA 4ICAA 5AM2A 1ZQQA 3PY8A 2H3QA 1NK8A 1ZQUA 5AK6A 3WKDA 3KZIU 3MR3A 4FBTA 4KLLA 5G5HA 1U4BA 2B0CA 4TQRA 3SD7A 5CEHA 2Y1IA 4DEZA 5HRHA 1Z1VA 3T5HA 4XJEA 3GFKB 1Q8KA 1L3TA 4J9OA 2HBJA 5AIBA 2NRVA 1MN8A 3MGIA 1VDVA 5DG9A 3FM9A 9ICOA 3MBYA 4UB8U 2KKPA 5KFGA 1PZNA 4I2BA 7ICHA 2JHDA 5DGAA 1X42A 5KG1A 1Z4OA 5BPCA 3JPNA 1WWVA 3OHAA 3RH4A 3KFUF 7ICMA 5AK3A 4RWNA 2DPJA 1TK5A 2KFNA 3AU6A 2ZUDA 2FMSA 2B51A 3QE9Y 3TACB 5HRKA 2XY7A 1ZQRA 2FLPA 4ED0A 1ZQVA 4O3QA 8ICYA 5KG7A 8ICLA 2PKEA 3T79A 5GTHU 2D8CA 4WBZA 4J9SA 4WQLA 1COOA 3K75D 2PFPA 4NLNA 4RQ4A 2ZIVA 4X4NA 9ICIA 1Z4NA 4NLKA 1L6NA 4MEXA 2F1IA 1T3NA 1B22A 1NKCA 3IM1A 2HOFA 3GV8B 4M47A 1ZRNA 2BCVA 2BPFA 2W9BB 2C2RA 3SAFA 3OTQA 4M0AA 3M1YA 2YX8A 3VCBA 1FFUA 4I29A 3M8SA 2ZXIA 4QWBA 3RR8A 4JV2A 4ECWA 2FDRA 3V6HA 2B21A 5ALOA 3F2CA 4F4XA 1N5WA 5ALDA 2LMRA 1LB2B 2OEHA 1X9XA 4UB1A 3GQCA 2DKXA 4QZHA 2AJQA 1XSPA 2F8KA 4O3MA 3H40A 2HHQA 5J2JA 4X4OA 3AQKA 5JU5A 2OWOA 4KLTA 1UCVA 4X4RA 2K8AA 1KW4A 1B0XA 4UB4A 4BGDA 3GV7B 1S76D 2IHMA 1N63A 4E0DA 4XUSA 1Y88A 2BQUA 2ZTDA 2W7PA 1L8OA 4NLZA 3I28A 2ASLA 4I0UA 1PK1B 1ZQBA 2LM1A 4ECTA 2FLLA 1S0NA 1S9FA 4YD2A 2MSNA 5IIKA 4NM2A 1UT8A 1YT3A 1QSYA 4RPXA 3MCRA 3H3AA 1SZHA 1JALA 4FS2A 1OU5A 4UB3A 3C66A 2OYYA 5KL1B 1ZQMA 1COKA 2G5HB 3OUYA 5J2CA 4A8EA 2ZUBA 5DLFA 3SEIA 4C8NA 2ISOA 4EBEA 9ICQA 4K99A 5HRDA 3NRZA 4YXMA 3V6JA 3PO4A 3JPTA 1XSNA 4B9NA 2E5SA 2ZTCA 4DS5A 2NRZA 8ICQA 1TVAA 3WU2U 1ZQ1C 5CRXA 1PVQA 8ICNA 1CRXA 1Z00A 3NWIA 1L3VA 5CFSA 1ZQLA 3JZ0A 5EE0A 1IIPA 8ICMA 2DR9A 4FH3A 4P0PA 8ICWA 5AKXA 4PPXA 4BXOA 4QZCA 4M2YA 3V7LA 4QIWC 1KQQA 2QARB 3LYSA 3EZ5A 2ZH4A 3R9KA 4JB3A 4MFAA 4NWIA 5AICA 2V4RA 2HBMA 4DQPA 4QZBA 2EAOA 3H4BA 4I2AA 2W9CB 2XCPA 2LI6A 4KLGA 4NKTA 5KFHA 4DL3A 2YB1A 4RT3A 4JMUA 3PO5A 2JEGA 4NL9C 9ICVA 2XICA 4EBDA 5CP2A 1J97A 1N2XA 4UB2A 2ZIVB 3MGVA 1XO0A 2K4HA 4QWAA 4F71A 4QZ8A 1N62A 4YN4A 4X5VA 3NKUA 2F76X 5D62A 3ETLA 2PXIA 2YMLA 3H0MB 4E7XA 4F5RA 4P2HA 4R8UA 4KMOB 3AQMA 2QARA 3A0HU 3MR6A 2FI1A 8ICTA 1QH9A 4K9BA 4LVSA 2XGPA 3NRWA 5ALXA 1ZD4A 2BQRA 2DR8A 2HMXA 1SV0A 3SAGA 4RUAA 1K1SA 3H0LB 1TE2A 4EX7A 2QB0A 5KFYA 4BWMA 2E8MA 1ZJMA 5AKYA 3S6JA 5B3PA 2J6UA 5KFBA 9ICBA 4C80A 5J0UA 4IC9A 3EUB2 3PW0A 5CWRA 1VLBA 3F2BA 4AT9A 3QX7A 5KFJA 3C28A 5J0TA 1UETA 3H37A 9ICUA 3ED5A 5KT4A 5HHHA 4M6WA 5J2HA 2NRTA 2M2TA 2ZIWA 4NXXA 3M6KA 5ALLA 4DSLA 9ICEA 2W9AA 2KIWA 7ICGA 3WFOA 3QU7A 1JN3A 1DXSA 3HILA 3HRDD 1HJPA 4B9TA 5J8YA 4PZNA 3D2NA 2DGZA 4CDGA 5KFWA 1JXEA 4AT9B 4OJ6A 3HW8A 1UHUA 4Y2PA 4J9RA 3PR5B 4ECQA 4ACOA 2H3ZA 2HSZA 3GV5B 1RG6A 4Q44A 4QWEA 5KFIA 4DSJA 3OJSA 2IHOA 2JXJA 2VANA 3V72A 3TKAA 4F8RA 1ZQYA 2LYAA 3ZDDA 1X40A 5KFRA 4FO1A 2KFZA 5ALSA 1ZQOA 4Q45A 4DF4A 5AKZA 3ORYA 2WF5A 2ZIWB 3RB0A 3MC1A 1EXNA 3ERCC 1SIJA 2HI0A 4YR3A 3BS7A 2RRDA 5EE3A 1ZQHA 4P0QA 1SKWA 4LEZA 1ECWA 1BNOA 1NZPA 1BPEA 1SL0A 1F5AA 2ZH6A 2H3IA 8ICHA 9ICXA 2VJ4A 3E2EA 5KFXA 3RBDA 3Q8MA 1CEZA 4KLJA 1B4FA 5E79U 3MABA 4TQSA 4KLEA 2J6TA 4XQ8A 9ICSA 3QUCA 7ICFA 3AQEA 1Q3UA 4EYIB 4RPYA 1NK6A 2YY6A 1T7PA 4GXJA 4ED8A 3RJFA 2YN4A 1SWWA 2ZXHA 4WOYA 4K96A 2W3SA 5JTGA 5BOMA 2XY5A 2E3TA 4DFJA 3GZFA 5AKJA 5IIOA 3N7PD 2ID1A 5HC9A 3SV4A 3HJ1A 2L5YA 2EAPA 5AM5A 4OD0A 1BVSA 4X4SA 4O3SA 2BKEA 2KSOB 3HX0A 5J2GA 2DF4B 2Q66A 5AI4A 4RNMA 3RJEA 1X9SA 2A3VA 3DV9A 3OVAA 4BWJA 5CA7A 5FP0A 5KFCA 2QB0B 3RTVA 1V97A 3QEAZ 5C5JA 8ICRA 3WFPA 3HIYA 3BJYA 5EE9A 1S5LU 3UQ0A 5IIJA 3Q8KA 2ZH3A 4M04A 2K8CB 3L5KA 5GTIU 4OJPA 4ED3A 5DLGA 3OSNA 2EZZA 3MFHA 2IA6A 2MUTA 2DRBA 4PZOA 2BCRA 1AROP 1ZQTA 1KLNA 4O5EA 1F44A 3FDSA 3AEVA 4IR9A 1LVHA 3QUQA 3SZ2A 3TFSA 2IHNA 3MR5A 8ICJA 4YR2A 5L1IA 2BGWA 2KSOA 1RQNA 5F3XB 1D8BA 2G07A 8ICCA 5ALRA 4O67A 1RPLA 1XO1A 4U7CA 1WYGA 5HNKA 2R8HA 2FMQA 4M9LA 1MC8A 5HP4A 3RJJA 4I2IA 4NLCA 4RQ2A 2WAQF 3KBBA 3H4DA 1JAJA 1QSSA 5AM4A 3L4PA 4HAIA 4FHXA 5KT6A 4I2JA 5AK5A 3PW4A 4QJFB 2JEFA 4LEYA 1PVRA 5HMMA 4I2EA 7ICUA 5AKHA 4QWCA 5DGBA 4OJLA 3PW2A 4OO1J 4MHVA 1UEVA 1PK1A 1Z19A 3FYHA 7ICEA 5K4LA 2HCFA 1J2NA 2HW3A 1SXDA 5KFQA 4PGQA 1T4GA 1V38A 3WK5A 4UAYA 1ZQJA 5J0QA 1O08A 4EZ9A 3C1ZA 2W8KA 4P0QB 1KNYA 4CNQA 4WJ3B 8ICBA 4Z6FA 3C2MA 5TZVA 3IN5A 1SWVA 4YMOA 4O68A 4FO6A 4RQ1A 4JV1A 3NVWA 4C4RA 1NK9A 2NO4A 5KG3A 4ECZA 3MR2A 4MF8A 3T5LA 2M0NA 4OAGA 1R89A 1BPXA 2HHWA 2WFAA 2G5IB 5AIAA 1KTQA 4QZDA 8ICGA 5ALQA 2KHQA 2I5HA 3CYMA 3LWMA 1KRPA 3CP8A 4ECSA 4JWMA 7ICSA 1Z1BA 1MSWD 3N4MB 3C21A 4OAFA 1L7OA 3UMGA 2KOBA 1ZYQA 3GILA 2QB1A 3DEEA 2P6RA 3V7JA 3LVVA 1SV0C 5L1MA 2K4IA 1NJWA 4NY8A 2JV3A 1XNSA 4NXUA 2OH2A 3RAQA 1U48A 2XIDA 5L9XA 4X4PA 1ZJNA 4I28A 2KJ5A 4KLSA 4RWQA 4RNNA 2KN7A 4WH5A 1SXEA 1XSLA 7ICRA 3CRXA 4BJQA 3A0BU 5AI6A 3I76A 2HOIA 3TFRA 3KKAC 3NVOA 5DQIA 5DB6A 4F4ZA 2Q4TA 5J2BA 1QSLA 3PX4A 3H7IA 4K97A 5DDYA 4K4HA 1X6IA 3OV7A 2KJ9A 2UVWA 1KFTA 2C22A 2WAQC 3PVXA 5KFDA 5DB7A 4IRDA 5KT3A 3C5GA 2ASJA 2ZJ5A 2GWSA 4DSIA 5J0OA 2KE7A 2LM4A 1YZ7A 3AQNA 2R8JA 4KN7A 2ESEA 2E8NA 4WC2A 1P7DA 5J0YA 3M9NB 1MQ3A 4GFJA 2XGQA 2XY6A 4C8KA 1SL1A 2AQ4A 1Q78A 2ZH5A 1TAQA 5AK4A 2KKVA 8ICXA 5D46A 4FHYA 4P4OA 5AHXA 4RQ8A 2F77X 1NKBA 2XVTA 3Q8RB 2LBOA 4EEYA 3HKZC 4DFDA 5HRBA 5HR9A 2KZ3A 3GIJA 4UQGA 3B0XA 5AI5A 2GO7A 4DSKA 9ICPA 1ZQDA 2GAFD 3JPPA 5HHIA 3PX6A 8ICAA 2RHFA 9ICCA 5HR7A 5KFUA 2KZZA 5KTQA 4K4GA 2JZBB 3QUBA 1FO4A 1QTMA 2P66A 3E0FA 3NGDA 2HHTA 4EEDA 1Q3VA 3PMLA 1NNLA 2B6GA 1JIHA 8ICIA 2B4VA 2UVUA 1ZQCA 4JLXA 4UB6U 5AKGA 5KFZA 3K1RB 5DB9A 3H39A 4TURA 5AKEA 1D8LA 4F4KA 4QZIA 3OPXA 9ICMA 1L3SA 2AQ0A 4I2CA 2NYVA 4FH5A 5C0YA 4RQ6A 5T14A 1NKEA 2VKQA 4C8LA 1JX4A 3OWGA 1XU4A 1DGJA 1NJXA 3ZDBA 4MEYA 3IG5A 5ALJA 4B9SA 2W9MA 3D2QA 3UQ2A 2JEIA 4JUZA 4ED2A 3BS5A 3WKBA 3C2KA 1DGSA 2KNJA 3SV3A 3GU3A 2CRXA 1MIVA 2IOHA 4Q8FA 4MFCA 2BE3A 1HUZA 3IRUA 7ICPA 3ISDA 5EWEA 2EDUA 1A76A 3BZKA 3ICXA 3B9JA 2KK0A 2HBLA 2KG5A 4IS7A 3ZD8A 4WC6A 1LKYB 2LKYA 2NO5A 3B0YA 4X0BA 2JH7A 4Z6DA 4RQ0A 1PK3A 4QZEA 7ICIA 2V9WA 2WHEA 1OXJA 2KD1A 3ONNA 1ZQKA 4FHPA 4P0PB 2ZJAA 5DQHA 4DLEA 2MAXA 4PHAA 2UVVA 5AM1A 3UPQA 1HUOA 1FFVA 4HYKA 3KZXA 3QU2A 4UD4A 5IIIA 4IQWA 1WCNA 1XWLA 4MFFA 4NXWA 4M9GA 4OJOA 3WKAA 2FPLA 4DQQA 4B6JA 2HHPA 4M6WB 4USAA 4O3PA 2LHTA 4I2HA 5D4BA 4P4PA 3SI8A 1MIWA 2KHVA 1UA0A 1JROA 1UA1A 5KG0A 7ICLA 1OW5A 2AH5A 1TKDA 3GIIA 4PHDA 2JH1A 2Y9TA 4CGZA 3N7SC 2HHVA 4ED7A 4CRXA 2ZTEA 3J81j 1S10A 1KFSA 1N48A 5A0LA 1D9DA 9ICWA 4NXZA 1U45A 2CXYA 3RB4A 1ZD3A 2LYHA 4QWDA 4WQKA 2FE9A 4DL4A 1JUDA 5HRGA 4NXTA 4GC6A 4Y2QA 1ZQPA 5HMLA 1R8BA 3EW9A 2BBHA 4F50A 1RYUA 4R65A 1T8EA 2FPMA 3N7RC 1Z3EB 2DUYA 1JI7A 5DDMA 1R8CA 2JR5A 4ELVA 3RBEA 3SQIA 5CB1A 3GIKA 2OCEA 4CCHA 5AKKA 5KFVA 4DS4A 4K4IA 3ZDAA 2KMDA 4AP9A 3V7KA 1ZQSA 1S97A 1K1QA 4IQTA 4O3NA 3C2LA 4F5NA 1HIWA 3PHZA 2IOFK 2IMWP 2DWQA 3AM9A 2ZIUB 3ZDEA 2BDUA 4PHPA 1Q79A 3M9OB 4LJXA 4R63A 5J2AA 2K4PA 5ALHA 4J9KA 5B3QA 4Y2VA 5TISU 2DR7A 5KAFU 4RPZA 1T94A 3K1ZA 1HEKA 2JRZA 1BPDA 3C23A 3EF2A 1A6SA 1KEJA 3MDCA 3DDHA 3WKEA 2ZH2A 1K5OA 4N7RA 4KLIA 3OVSA 1J2MA 3PW7A 3G6XA 4NL9A 1Q46A 1RXVA 2WTFA 2MA1A 4EP7A 5F2VO 4KLFA 4KB6A 4QZAA 2NRXA 4KMUA 1V9PA 2MUTB 1WG8A 4UAUA 2PMZF 4GLXA 4M9HA 1TV9A 4PL1A 2I6XA 2XO7A 3OJUA 1LKYA 3AQFA 3ER9B 2KV2A 1SL2A 4KX3A 2ZHAA 4YVZA 2VA3A 2NRWA 4C8OA 2ZIXB 3PR4A 2OM6A 4RT2A 2W55A 4PHEA 2F8LA 5CHGA 3K7DA 4O0IA 4E80A 2ES6A 3ALRA 4RNOA 5KFKA 4WCWA 4R8UB 4F72A 3PSFA 2Q0ZX 4LZDA 5KG4A 4OAHA 5F9NA 3M8RA 1ZD5A 3L9DA 3F5AA 3JPSA 5J2FA 4YQWA 3M7DA 5EE1A 3U26A 3RRGA 2JZBA 2RDJA 4ECYA 1TFYA 5AM3A 3PSTA 5ALKA 4WC1A 3RF9A 4YD1A 1S0MA 4I2DA 5J0SA 4EBKA 3C18A 1ZRMA 2C2DA 3RAXA 1S0VA 2W3RA 9ICGA 4B9VA 3KHHA 5KG5A 5KNIA 4F4WA 3PNCA 2EZYA 3LVWA 4R64A 9ICTA 1IG6A 4M9JA 4XA5A 4UATA 4KLUA 3UXOA 1S8OA 2KEYA 5KFPA 1LV5A 3WK4A 3KHLA 1N60A 4IL6U 1PUZA 3NASA 3RJHA 1L8LA 2DQNB 4UAZA 5D49A 3F5EA 2W7OA 2WF9A 5KAIU 3RJIA 5DBCA 1IV8A 5ALWA 4WBYA 1ZQEA 1QQ6A 5KFFA 3WK9A 2Y9UA 4XQ7A 1BPZA 3QUTA 1PX5A 4LEVA 4ECVA 1D8YA 3JPRA 2VA2A 2W11A 1VFGA 4P4MA 4YMNA 5KFOA 2YMPA 1ZQNA 4M9NA 2AGQA 1A0PA 1FEZA 3MDAA 1KFDA 3UM9A 2R8GA 3ER8C 4NKUA 8ICZA 2V4QA 3AU2A 4X0AA 2WF7A 2Y1JA 2R18A 3UXNA 4YG2A 1DRGA 4YP3A 3HJEA 4TUSA 2BCUA 1M6YA 4DCCA 5L1KA 5J2KA 3WFSC 1N61A 4QIWF 3AN1A 4YCXA 3ZDCA 1IXRA 4RQ7A 3OUYB 2G08A 4LT6A 2DKZA 4KX5A 1OUQA 1NO5A 4GXKA 2BPGA 2R8IA 1L7PA 3PX0A 2EANA 8ICKA 4F4YA 4DFPA 2RQ5A 4DLGA 3PSPA 3NVZA 2DBYA 2ZH8A 1ED1A 1MIYA 3N97B 5CR0A 4EYHB 2PFNA 4DL7A 1NZBA 5ALPA 2EH9A 3IDWA 2PI4A 3KKAA 2C28A 3QEBZ 1NK4A 2HN2A 2XCAA 4XRHA 1ZQFA 2QKQA 3NTUA 1N5XA 1TK8A 1D9FA 1SZPA 5J0XA 4C7ZA 3PMNA 7ICQA 1YLQA 4EGWA 4PGXA 8ICEA 2RDIA 2KVCA 2ZG6A 4Y2YA 1RM6C 4O69A 5AI8A 3JCFA 1F0MA 5DEDA 4MF2A 2E1EA 5HREA 4DSFA 4OJ5A 3SR6A 4KLHA 1KL9A 5J0WA 5BOLA 3NS1A 1JXLA 2BHNA 2KIVA 2XC9A 4O3RA 3KOOA 4DL2A 3KD3A 5KFLA 5KFNA 2G09A 2HHXA 3LWLA 4C0ZA 2HVHA 4EBJA 2EWRA 4Y2SA 4QZGA 5J2DA 4QW9A 2DL0A 2Y0SC 2JEJA 2XI9A 4AT8A 1B43A 3NVVA 4K9AA 1DK2A 4EEKA 2DRAA 4ATBB 2A19A 1SV4A 3QXGA 5J29A 3H8JA 3I1YA 4KLDA 2P6UA 3RH6A 3Q8PB 1YZ6A 1KKXA 9ICRA 5J2EA 4RQNA 3QU9A 3WKCA 3UXPA 2HVIA 5HRFA 4F92B 1WCLA 4ELTA 2BZFA 1TAMA 4UAWA 2CPRA 1ZQWA 4ECUA 2B56A 4JLZA 3TADC 1DK3A 3H8WA 4FHWA 4EZ6A 5CFTA 4K98A 5G5GA 1CI4A 1QQ7A 4OAIZ 4QNLA 3CW2C 1FIQA 1Z00B 4RWOA 1UEUA 4F5OA 1CUKA 3JPQA 2D6FC 1KBUA 4AT7A 2M2WA 3G6YA 1RYSA 4M5DA 4BXOB 1X2IA 4NXVA 5IILA 2A1AA 2PMZC 5EWGA 3ZI4A 4ECRA 1RXWA 4WC4A 1L7MA 4C4SA 2A1JB 4O6AA 2WF6A 5KFMA 1JQRA 4X4VA 1WWUA 5AM0A 4FZMA 4Z6CA 5HRIA 2YMQA 2BR0A 1U47A 3F53A 4DOBA 4FBUA 4Y2JA 5B66U 1DOQA 4RQ3A 2J6SA 5KFEA 4JWNA 3AQLA 5ALNA 4DQRA 3LDAA 1MQ2A 2OHFA 3RFAA 2JMGA 4FE3A 2VJ5A 2KP7A 2RLTA 5D61A 4BX9C 2WF8A 4CE6A 2BCSA 3IP4B 4EX6A 3THVA 4FZNA 4ZH4A 2AU0A 4DWIA 2ISPA 5DQGA 4KTQA 3RRHA 2IUBA 3CNHA 2HHUA 2FJ6A 3H0RB 2QLTA 4B9UA 4TUQA 2Z7JA 4RQMA 3K4GA 4AYBF 8ICFA 2KJ8A 1WUDA 4GIBA 2YMMA 2W03A 5DKWA 1RQLA 4Y2RA 4F2SA 2FCLA 1ZQZA 5CJ7A 4YMMA 4YR0A 4DOAA 4FFDA 4I2FA 4C8MA 3BQ1A 4ED1A 3H38A 1BPBA 9ICFA 4UAVA 4F5PA 2P35A 1TK0A 2EQYA 9ICKA 2E8OA 3NYBA 1ZQAA 4EV6A 3N28A 5DB8A 3JYYA 4LZGA 3FC4A 5H2FU 2IBKA 4IRCA 3PW5A 3JPOA 1PVPA 3HPOA 4DL5A 1RYRA 1AQ6A 1X9MA 2PBEA 3BDPA 3WK8A 1ZXIA 3IG8A 5AI9A 1TFRA 3OVBA 4ZOHC 5J0RA 3HKZF 3BQ2A 5ALVA 3TQ1A 4PH5A 2M2UA 1KDHA 3NUQA 2NRKA 4UBBA 4PJ0U 5AKIA 9ICLA 5ALFA 3SAHA 1XC9A 3RH5A 4G3IA 4PL2A 3ISBA 4CF4A 4IQUA 1TFWA 4Y2TA 3C5FA 3C1YA 3EWAA 1URJA 2AHOB 1NJYA 1UPHA 2K4EA
chains in the Genus database with same CATH topology
4PHEA 1ZQJA 3WFRE 5J0QA 5CHGA 4EZ9A 3C1ZA 4ELUA 2PI5A 9ICIA 4NLKA 4O0IA 4MEXA 2W8KA 2F1IA 1KNYA 4E80A 1T3NA 8ICBA 4Z6FA 1NKCA 1N56A 3IM1A 4M47A 3GV8B 1B22A 3C2MA 4JK1A 2H5XA 5TZVA 4O3OA 5KFKA 4RNOA 4R8UB 2BCVA 4YMOA 2W9BB 2C2RA 4J9LA 2BPFA 4E8FA 2Q0ZX 5KFSA 4FO6A 4RQ1A 4JV1A 1NK9A 4LZDA 4NLGA 5KG4A 3TANA 4M0AA 2UVRA 5F9NA 3M8RA 2A1JA 5KG3A 4ECZA 4I29A 3L9DA 3M8SA 3MR2A 4MF8A 4F91B 4QWBA 3JPSA 3T5LA 5KFTA 4ECWA 5J2FA 4YQWA 3RR8A 4JV2A 3V6HA 1BPXA 2HHWA 1R89A 2B21A 3MFIA 1KTQA 3RRGA 4QZDA 8ICGA 4F4XA 1A77A 3HT3A 4BDPA 3LWMA 2JZBA 2RDJA 1LB2B 1KRPA 1WOTA 4ECSA 4KLOA 4JWMA 7ICSA 4ECYA 1TFYA 4UB1A 3GQCA 1MSWD 7ICKA 3EPGA 3AUOA 3N4MB 3C21A 7ICJA 4QZHA 4WC3A 4WC1A 2AJQA 7ICVA 4RWPA 4NM1A 1XSPA 1ZYQA 4YD1A 1S0MA 3GILA 3H40A 4IRKA 2P6RA 2HHQA 3QZ8A 3T5KA 1S0OA 4FHVA 4I2DA 5J0SA 5J2JA 5DECA 3AQKA 3V7JA 5J0PA 4X4OA 3TAQA 2OWOA 4KLTA 3C18A 4EBKA 4X4RA 2ZH1A 2C2DA 4UB4A 3RAXA 1X9WA 4BGDA 4WC0A 1S0VA 1NJWA 4NY8A 3GV7B 1S76D 9ICGA 2IHMA 4B9VA 4E0DA 4XUSA 3T3FA 1Y88A 3RAQA 1U48A 2BQUA 2ZTDA 3KHHA 5KG5A 3PV8A 5DBAA 4NLZA 2ASLA 4J9MA 1ZQBA 5L9XA 4F4WA 2O5AA 3PNCA 4ECTA 4JV0A 1ZJNA 4X4PA 2W9BA 4R64A 2FLLA 4I28A 1S0NA 4KLSA 4M9JA 1S9FA 4RNNA 4XA5A 9ICTA 2M2VA 4RWQA 4YD2A 2KN7A 5IIKA 4F93B 4KLUA 4NM2A 3UXOA 2FMPA 5KFPA 1XSLA 7ICRA 4DFKA 1UT8A 1LV5A 3KHLA 1QSYA 2ZHBA 3Q8LA 4RPXA 9ICJA 3TFRA 3BQTA 3OSPA 3H3AA 4FS2A 3RJHA 4UAZA 3RJKA 5D49A 5DQIA 5DB6A 1OU5A 4F4ZA 5J2BA 4DFMA 2AGOA 2O1PA 3ISCA 1SKSA 4UB3A 3C66A 3RJIA 3HJ4A 1ZQMA 1QSLA 5DBCA 2ZH9A 4X4TA 2ASDA 3PX4A 3H7IA 3OUYA 5DDYA 5J2CA 4WBYA 2ZUBA 1ZQEA 5KT7A 5DLFA 5KFFA 4K4HA 1QLNA 4C8NA 4AT8B 2ISOA 4XQ7A 1BPZA 3OV7A 4EBEA 2W9CA 2ATLA 5IINA 9ICQA 5HRDA 1PX5A 2UVWA 1KFTA 4ECVA 2C22A 4FS1A 3PVXA 1D8YA 4X4QA 5KFDA 4YXMA 5DB7A 4S3NA 3JPRA 2VA2A 3V6JA 3PO4A 4NKTA 3JPTA 4QZ9A 3TARA 4TUPA 1VFGA 4P4MA 4YMNA 4X4VA 4IRDA 1XSNA 5KFOA 5KT3A 1ZQNA 4O5KA 4B9NA 2ZTCA 4DS5A 4M9NA 3C5GA 2NRZA 2AGQA 2ASJA 2ZJ5A 5F9LA 4DSEA 2GWSA 3ZD9A 3MDAA 5J0OA 4DSIA 8ICQA 5KFAA 1KFDA 1TVAA 4O5CA 2R8GA 3V6KA 8ICNA 3AQNA 2R8JA 4KN7A 8ICZA 1Z00A 4IG8A 4NKUA 2V4QA 3AU2A 1L3VA 4X0AA 2Y1JA 1ZETA 1ZQLA 3JZ0A 4WC2A 3UXNA 4YG2A 8ICMA 5J0YA 2DR9A 4FH3A 3M9NB 3EYZA 4YP3A 8ICWA 4TUSA 1MQ3A 2BCUA 4BXOA 4PPXA 4QZCA 2XGQA 4J9PA 2XY6A 4M2YA 1BPYA 5L1KA 2ZH7A 3WFQE 4R66A 5J2KA 3WFSC 4GXIA 5KG2A 1XS9D 4C8KA 4AT7B 3V7LA 1SKRA 4YCXA 1SL1A 1ZQGA 2W8LA 3ZDCA 1IXRA 4EBCA 2AQ4A 4RQ7A 1Q78A 3EZ5A 3OUYB 2ZH5A 1TAQA 2ZH4A 4LT6A 2ALZA 8ICXA 4MFAA 2F1HA 5D46A 2V4RA 2VA8A 4FHYA 4DQPA 4QZBA 4P4OA 1NO5A 4RQ8A 4GXKA 3H4BA 2BPGA 2R8IA 4I2AA 4PGYA 1NKBA 3Q8RB 2W9CB 2XCPA 4EEYA 4KLGA 4Z6EA 3KTQA 5HRBA 2KZ3A 5KFHA 3PX0A 3GIJA 4F4YA 4RT3A 4DFPA 4DL3A 4F3OA 4KLMA 8ICKA 3PO5A 2JEGA 4UQGA 4DLGA 9ICVA 3B0XA 4EBDA 2BCQA 4B9MA 4DSKA 5CP2A 9ICPA 4DQSA 1ZQDA 4F2RA 4UB2A 5HRLA 2R8KA 2M9NA 2ZH8A 4QWAA 3JPPA 3N97B 2C2EA 5HHIA 3PX6A 1MIYA 4QZ8A 8ICAA 4YN4A 4X5VA 5CR0A 4J9QA 4KLQA 4EYHB 9ICCA 2PFQA 4I2GA 2PFNA 5KFUA 3ETLA 2PXIA 4DL7A 2KZZA 1V4AA 4E7XA 5KTQA 1TAUA 3SYZA 2DPIA 4K4GA 4F5RA 2JZBB 4R8UA 4P2HA 3M9MB 3AQMA 1QTMA 2P66A 1L3UA 2PI4A 3NGDA 3MR6A 2HHTA 2C28A 8ICTA 3PMLA 3QEBZ 1NK4A 4LVSA 1NJZA 2XCAA 4Q8EA 2XGPA 4XRHA 5EWFA 1ZQFA 1JIHA 1BGXT 8ICIA 3Q8QB 3NTUA 2UVUA 1ZQCA 5KFZA 2BQRA 2DR8A 5DB9A 1TK8A 1D9FA 3H39A 3BQ0A 4RUAA 1K1SA 1SZPA 1KSPA 4TURA 5J0XA 3HWTA 4F5QA 3PMNA 7ICQA 1YLQA 4PGXA 1D8LA 3RB6A 5KFYA 5KG6A 4BWMA 4QZIA 4F4KA 8ICEA 9ICMA 3GDXA 1NK7A 2AQ0A 2F1JA 2RDIA 4DO9A 5JUMA 1ZJMA 1L3SA 4WC5A 5DG8A 4I2CA 2J6UA 5KFBA 9ICBA 3GIMA 5IIMA 5DG7A 1C7YA 4FH5A 1VJ7A 4RQ6A 4WC7A 1NKEA 5J0UA 2BQ3A 4C8LA 5DEDA 4MF2A 4DF8A 1JX4A 5HREA 8ICOA 1XU4A 4DSFA 3PW0A 1NJXA 5CWRA 3ZDBA 3OHBA 4KLHA 5J0WA 9ICNA 4MEYA 4B9SA 4AT9A 2W9MA 5BOLA 5KFJA 1JXLA 1U9LA 2BHNA 2DFLA 2XC9A 5L1JA 5J0TA 3UQ2A 4O3RA 4KN4A 4JUZA 4ED2A 2JEIA 5KT2A 7ICNA 1UETA 9ICUA 4DL2A 3H37A 5KFLA 5KT4A 5KFNA 3C2KA 5HHHA 4M6WA 2HHXA 5J2HA 2NRTA 3LWLA 2HVHA 2M2TA 5HR9A 3Q8SB 4DSLA 1DGSA 9ICEA 2W9AA 7ICGA 4QZGA 4QW9A 5J2DA 1JN3A 3WFOA 1IM4A 4EBJA 3SV3A 1MIVA 2JEJA 4AT8A 1HJPA 1B43A 1H38A 4B9TA 1S77D 4Q8FA 3HP6A 3LQCB 4MFCA 4RU9A 2BE3A 4GC7A 1HUZA 5KFWA 1NOMA 4ED6A 1RZTA 1DK2A 5DBBA 2DRAA 1JXEA 8ICVA 7ICPA 3ISDA 3EPIA 2PFOA 9ICAA 4ATBB 4AT9B 4I27A 3HW8A 4DOCA 1JMSA 5EWEA 5J29A 7ICTA 1A76A 3H8JA 5EOZA 4J9RA 3PR5B 4KLDA 4RUCA 2P6UA 4ECQA 3RH6A 3Q8PB 3ZD8A 4WC6A 5J2IA 9ICRA 5J2EA 3GV5B 3UXPA 4Q44A 4DL6A 4QWEA 5KFIA 4X4UA 4DSJA 3B0YA 2HVIA 3OJSA 5HRFA 4QW8A 4F92B 4X0BA 2VANA 3V72A 1WCLA 4ELTA 4Z6DA 4UAWA 4RQ0A 4F8RA 1ZQYA 4O9MA 2BDPA 1ZQWA 4YFKA 4ECUA 8ICPA 4QZEA 7ICIA 1ZQXA 4UB5A 2V9WA 3ZDDA 5KFRA 4WCWA 2KFZA 1ZQOA 3LK9A 1DK3A 3H8WA 4Q45A 3KHGA 4EZ6A 4FHWA 4DF4A 1FA0A 4DQIA 3ORYA 2ZJ8A 4Q43A 1ZQKA 4RQ5A 3RB0A 4FHPA 5HRIA 2ZJAA 5DQHA 1L5UA 3RJGA 1EXNA 4DLEA 1Z00B 2MAXA 4PHAA 2UVVA 4RWOA 1UEUA 4YXJA 4YR3A 4F5OA 3UPQA 1HUOA 1CUKA 3JPQA 4UD5A 4AT7A 4HYKA 1ZQHA 2M2WA 3TAPA 3G6YA 1SKWA 1RYSA 4UD4A 5IIIA 4M5DA 4IQWA 1WCNA 1XWLA 4BXOB 4MFFA 2BPCA 4M9GA 1X2IA 2KTQA 1UT5A 1BNOA 2FPLA 4DQQA 1NK5A 1NZPA 1BPEA 1SL0A 2AGPA 4KITB 1F5AA 5IILA 2ZH6A 4B9LA 2HHPA 5EWGA 4ECRA 1ZQIA 3RR7A 2FPKA 8ICHA 9ICXA 4M6WB 1RXWA 2FLNA 4WC4A 3IHQB 2ZUCA 4J9NA 8ICUA 3E2EA 4O3PA 5KFXA 7ICOA 3RBDA 4I2HA 3Q8MA 2KZMA 1CEZA 4IQVA 5D4BA 4KLJA 2HHSA 4P4PA 2A1JB 3MABA 4TQSA 3SI8A 4KLEA 2RFFA 2J6TA 4XQ8A 3KHRA 9ICSA 1MIWA 5KFMA 7ICFA 1UA0A 3G6VA 1UA1A 5KG0A 7ICLA 1JQRA 4RPYA 4Z6CA 3OGUA 3GIIA 4EYIB 4PHDA 3T5JA 5KT5A 2BR0A 1TKDA 1NK6A 1U47A 1T7PA 2HHVA 4ED7A 4GXJA 2ZTEA 3H8SA 3UPSA 4DOBA 4FBUA 2I1QA 4ED8A 1S10A 3RJFA 4UBCA 4RZRA 1DOQA 4RQ3A 1KFSA 4IR1A 1N48A 5L1LA 2J6SA 2DR5A 5KFEA 1D9DA 4JWNA 9ICWA 3AQLA 2I9GA 4NXZA 4ATBA 4DQRA 1U45A 3LDAA 3RB4A 3TI0A 1MQ2A 2LYHA 5BOMA 4QWDA 2XY5A 4DL4A 5HRGA 4DFJA 5IIOA 4GC6A 2ID1A 3QZ7A 5HC9A 1ZQPA 3SV4A 9ICHA 5HMLA 2KP7A 3HJ1A 1R8BA 1BVSA 3EW9A 2BCSA 4O3SA 4X4SA 1U49A 2BKEA 4F50A 3HX0A 3RB3A 5J2GA 3MGHA 8ICSA 3THVA 4R65A 2Q66A 1R8AA 4ZH4A 4QZFA 2AU0A 4RNMA 1T8EA 4ECXA 2ISPA 2FPMA 3RJEA 4DWIA 5DQGA 4KTQA 3RRHA 1X9SA 1Z3EB 1BNPA 3OVAA 4BWJA 5CA7A 5DDMA 2HHUA 1NK0A 5KFCA 4B9UA 4TUQA 3RTVA 1R8CA 2DVIA 4ELVA 3QEAZ 3K4GA 5C5JA 8ICRA 3WFPA 3RBEA 8ICFA 3HIYA 3BJYA 1ZQQA 5CB1A 3GIKA 3UQ0A 3PY8A 5DKWA 5IIJA 3Q8KA 7ICHA 1NK8A 2ZH3A 4F2SA 4M04A 4CCHA 1ZQUA 1ZQZA 5CJ7A 4YMMA 3MR3A 4ED3A 4YR0A 5DLGA 4FBTA 5KFVA 3OSNA 4DS4A 4KLLA 4K4IA 3ZDAA 4DOAA 3MFHA 1U4BA 3V7KA 1ZQSA 4I2FA 2IA6A 2MUTA 1S97A 4TQRA 4C8MA 1K1QA 2DRBA 4IQTA 4O3NA 3C2LA 4F5NA 2Y1IA 3BQ1A 2BCRA 4ED1A 1AROP 1ZQTA 1KLNA 4O5EA 4DEZA 3H38A 5HRHA 3FDSA 4IR9A 2IMWP 1BPBA 9ICFA 3SZ2A 3T5HA 3TFSA 3ZDEA 4F5PA 2IHNA 3GFKB 3MR5A 8ICJA 1TK0A 4YR2A 5L1IA 2BGWA 9ICKA 1L3TA 3NYBA 1ZQAA 4PHPA 1Q79A 4J9OA 3M9OB 2NRVA 5DB8A 3JYYA 4LZGA 4R63A 8ICCA 3MGIA 5J2AA 1RPLA 1XO1A 5HNKA 2R8HA 5DG9A 4J9KA 2FMQA 4M9LA 2DR7A 9ICOA 2IBKA 4IRCA 3MBYA 3PW5A 3JPOA 4RPZA 1MC8A 5HP4A 5KFGA 1PZNA 4I2IA 3HPOA 3RJJA 1BPDA 3C23A 4I2BA 4RQ2A 4DL5A 1RYRA 5DGAA 1X9MA 1KEJA 3MDCA 3BDPA 2PBEA 3H4DA 5KG1A 1JAJA 1QSSA 5BPCA 3JPNA 1TFRA 2ZH2A 3OHAA 4FHXA 4KLIA 3OVSA 5KT6A 3OVBA 3RH4A 3PW7A 7ICMA 5J0RA 4I2JA 3G6XA 3PW4A 3BQ2A 3TQ1A 4RWNA 2DPJA 1TK5A 2WTFA 1RXVA 4PH5A 3AU6A 2KFNA 2JEFA 4EP7A 5F2VO 2ZUDA 2M2UA 2FMSA 4KLFA 3QE9Y 4QZAA 1KDHA 2NRXA 2XY7A 1ZQRA 2FLPA 5HRKA 2NRKA 4UBBA 4KMUA 1V9PA 2MUTB 5HMMA 4ED0A 4I2EA 1ZQVA 4O3QA 1XC9A 7ICUA 4GLXA 8ICYA 4M9HA 4QWCA 9ICLA 5DGBA 3PW2A 3RH5A 5KG7A 1TV9A 4G3IA 8ICLA 3ISBA 4IQUA 1UEVA 4WBZA 1TFWA 2XO7A 3OJUA 4J9SA 3FYHA 7ICEA 3C5FA 1COOA 1SL2A 2ZHAA 3C1YA 3EWAA 3K75D 4YVZA 1NJYA 2NRWA 2PFPA 2VA3A 4C8OA 5KFQA 3PR4A 4PGQA 2HW3A 1T4GA 4NLNA 4RT2A 4RQ4A 4UAYA 4X4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHE A;  1ZQJ A;  3WFR E;  5J0Q A;  5CHG A;  4EZ9 A;  3C1Z A;  4ELU A;  2PI5 A;  9ICI A;  4NLK A;  4O0I A;  4MEX A;  2W8K A;  2F1I A;  1KNY A;  4E80 A;  1T3N A;  8ICB A;  4Z6F A;  1NKC A;  1N56 A;  3IM1 A;  4M47 A;  3GV8 B;  1B22 A;  3C2M A;  4JK1 A;  2H5X A;  5TZV A;  4O3O A;  5KFK A;  4RNO A;  4R8U B;  2BCV A;  4YMO A;  2W9B B;  2C2R A;  4J9L A;  2BPF A;  4E8F A;  2Q0Z X;  5KFS A;  4FO6 A;  4RQ1 A;  4JV1 A;  1NK9 A;  4LZD A;  4NLG A;  5KG4 A;  3TAN A;  4M0A A;  2UVR A;  5F9N A;  3M8R A;  2A1J A;  5KG3 A;  4ECZ A;  4I29 A;  3L9D A;  3M8S A;  3MR2 A;  4MF8 A;  4F91 B;  4QWB A;  3JPS A;  3T5L A;  5KFT A;  4ECW A;  5J2F A;  4YQW A;  3RR8 A;  4JV2 A;  3V6H A;  1BPX A;  2HHW A;  1R89 A;  2B21 A;  3MFI A;  1KTQ A;  3RRG A;  4QZD A;  8ICG A;  4F4X A;  1A77 A;  3HT3 A;  4BDP A;  3LWM A;  2JZB A;  2RDJ A;  1LB2 B;  1KRP A;  1WOT A;  4ECS A;  4KLO A;  4JWM A;  7ICS A;  4ECY A;  1TFY A;  4UB1 A;  3GQC A;  1MSW D;  7ICK A;  3EPG A;  3AUO A;  3N4M B;  3C21 A;  7ICJ A;  4QZH A;  4WC3 A;  4WC1 A;  2AJQ A;  7ICV A;  4RWP A;  4NM1 A;  1XSP A;  1ZYQ A;  4YD1 A;  1S0M A;  3GIL A;  3H40 A;  4IRK A;  2P6R A;  2HHQ A;  3QZ8 A;  3T5K A;  1S0O A;  4FHV A;  4I2D A;  5J0S A;  5J2J A;  5DEC A;  3AQK A;  3V7J A;  5J0P A;  4X4O A;  3TAQ A;  2OWO A;  4KLT A;  3C18 A;  4EBK A;  4X4R A;  2ZH1 A;  2C2D A;  4UB4 A;  3RAX A;  1X9W A;  4BGD A;  4WC0 A;  1S0V A;  1NJW A;  4NY8 A;  3GV7 B;  1S76 D;  9ICG A;  2IHM A;  4B9V A;  4E0D A;  4XUS A;  3T3F A;  1Y88 A;  3RAQ A;  1U48 A;  2BQU A;  2ZTD A;  3KHH A;  5KG5 A;  3PV8 A;  5DBA A;  4NLZ A;  2ASL A;  4J9M A;  1ZQB A;  5L9X A;  4F4W A;  2O5A A;  3PNC A;  4ECT A;  4JV0 A;  1ZJN A;  4X4P A;  2W9B A;  4R64 A;  2FLL A;  4I28 A;  1S0N A;  4KLS A;  4M9J A;  1S9F A;  4RNN A;  4XA5 A;  9ICT A;  2M2V A;  4RWQ A;  4YD2 A;  2KN7 A;  5IIK A;  4F93 B;  4KLU A;  4NM2 A;  3UXO A;  2FMP A;  5KFP A;  1XSL A;  7ICR A;  4DFK A;  1UT8 A;  1LV5 A;  3KHL A;  1QSY A;  2ZHB A;  3Q8L A;  4RPX A;  9ICJ A;  3TFR A;  3BQT A;  3OSP A;  3H3A A;  4FS2 A;  3RJH A;  4UAZ A;  3RJK A;  5D49 A;  5DQI A;  5DB6 A;  1OU5 A;  4F4Z A;  5J2B A;  4DFM A;  2AGO A;  2O1P A;  3ISC A;  1SKS A;  4UB3 A;  3C66 A;  3RJI A;  3HJ4 A;  1ZQM A;  1QSL A;  5DBC A;  2ZH9 A;  4X4T A;  2ASD A;  3PX4 A;  3H7I A;  3OUY A;  5DDY A;  5J2C A;  4WBY A;  2ZUB A;  1ZQE A;  5KT7 A;  5DLF A;  5KFF A;  4K4H A;  1QLN A;  4C8N A;  4AT8 B;  2ISO A;  4XQ7 A;  1BPZ A;  3OV7 A;  4EBE A;  2W9C A;  2ATL A;  5IIN A;  9ICQ A;  5HRD A;  1PX5 A;  2UVW A;  1KFT A;  4ECV A;  2C22 A;  4FS1 A;  3PVX A;  1D8Y A;  4X4Q A;  5KFD A;  4YXM A;  5DB7 A;  4S3N A;  3JPR A;  2VA2 A;  3V6J A;  3PO4 A;  4NKT A;  3JPT A;  4QZ9 A;  3TAR A;  4TUP A;  1VFG A;  4P4M A;  4YMN A;  4X4V A;  4IRD A;  1XSN A;  5KFO A;  5KT3 A;  1ZQN A;  4O5K A;  4B9N A;  2ZTC A;  4DS5 A;  4M9N A;  3C5G A;  2NRZ A;  2AGQ A;  2ASJ A;  2ZJ5 A;  5F9L A;  4DSE A;  2GWS A;  3ZD9 A;  3MDA A;  5J0O A;  4DSI A;  8ICQ A;  5KFA A;  1KFD A;  1TVA A;  4O5C A;  2R8G A;  3V6K A;  8ICN A;  3AQN A;  2R8J A;  4KN7 A;  8ICZ A;  1Z00 A;  4IG8 A;  4NKU A;  2V4Q A;  3AU2 A;  1L3V A;  4X0A A;  2Y1J A;  1ZET A;  1ZQL A;  3JZ0 A;  4WC2 A;  3UXN A;  4YG2 A;  8ICM A;  5J0Y A;  2DR9 A;  4FH3 A;  3M9N B;  3EYZ A;  4YP3 A;  8ICW A;  4TUS A;  1MQ3 A;  2BCU A;  4BXO A;  4PPX A;  4QZC A;  2XGQ A;  4J9P A;  2XY6 A;  4M2Y A;  1BPY A;  5L1K A;  2ZH7 A;  3WFQ E;  4R66 A;  5J2K A;  3WFS C;  4GXI A;  5KG2 A;  1XS9 D;  4C8K A;  4AT7 B;  3V7L A;  1SKR A;  4YCX A;  1SL1 A;  1ZQG A;  2W8L A;  3ZDC A;  1IXR A;  4EBC A;  2AQ4 A;  4RQ7 A;  1Q78 A;  3EZ5 A;  3OUY B;  2ZH5 A;  1TAQ A;  2ZH4 A;  4LT6 A;  2ALZ A;  8ICX A;  4MFA A;  2F1H A;  5D46 A;  2V4R A;  2VA8 A;  4FHY A;  4DQP A;  4QZB A;  4P4O A;  1NO5 A;  4RQ8 A;  4GXK A;  3H4B A;  2BPG A;  2R8I A;  4I2A A;  4PGY A;  1NKB A;  3Q8R B;  2W9C B;  2XCP A;  4EEY A;  4KLG A;  4Z6E A;  3KTQ A;  5HRB A;  2KZ3 A;  5KFH A;  3PX0 A;  3GIJ A;  4F4Y A;  4RT3 A;  4DFP A;  4DL3 A;  4F3O A;  4KLM A;  8ICK A;  3PO5 A;  2JEG A;  4UQG A;  4DLG A;  9ICV A;  3B0X A;  4EBD A;  2BCQ A;  4B9M A;  4DSK A;  5CP2 A;  9ICP A;  4DQS A;  1ZQD A;  4F2R A;  4UB2 A;  5HRL A;  2R8K A;  2M9N A;  2ZH8 A;  4QWA A;  3JPP A;  3N97 B;  2C2E A;  5HHI A;  3PX6 A;  1MIY A;  4QZ8 A;  8ICA A;  4YN4 A;  4X5V A;  5CR0 A;  4J9Q A;  4KLQ A;  4EYH B;  9ICC A;  2PFQ A;  4I2G A;  2PFN A;  5KFU A;  3ETL A;  2PXI A;  4DL7 A;  2KZZ A;  1V4A A;  4E7X A;  5KTQ A;  1TAU A;  3SYZ A;  2DPI A;  4K4G A;  4F5R A;  2JZB B;  4R8U A;  4P2H A;  3M9M B;  3AQM A;  1QTM A;  2P66 A;  1L3U A;  2PI4 A;  3NGD A;  3MR6 A;  2HHT A;  2C28 A;  8ICT A;  3PML A;  3QEB Z;  1NK4 A;  4LVS A;  1NJZ A;  2XCA A;  4Q8E A;  2XGP A;  4XRH A;  5EWF A;  1ZQF A;  1JIH A;  1BGX T;  8ICI A;  3Q8Q B;  3NTU A;  2UVU A;  1ZQC A;  5KFZ A;  2BQR A;  2DR8 A;  5DB9 A;  1TK8 A;  1D9F A;  3H39 A;  3BQ0 A;  4RUA A;  1K1S A;  1SZP A;  1KSP A;  4TUR A;  5J0X A;  3HWT A;  4F5Q A;  3PMN A;  7ICQ A;  1YLQ A;  4PGX A;  1D8L A;  3RB6 A;  5KFY A;  5KG6 A;  4BWM A;  4QZI A;  4F4K A;  8ICE A;  9ICM A;  3GDX A;  1NK7 A;  2AQ0 A;  2F1J A;  2RDI A;  4DO9 A;  5JUM A;  1ZJM A;  1L3S A;  4WC5 A;  5DG8 A;  4I2C A;  2J6U A;  5KFB A;  9ICB A;  3GIM A;  5IIM A;  5DG7 A;  1C7Y A;  4FH5 A;  1VJ7 A;  4RQ6 A;  4WC7 A;  1NKE A;  5J0U A;  2BQ3 A;  4C8L A;  5DED A;  4MF2 A;  4DF8 A;  1JX4 A;  5HRE A;  8ICO A;  1XU4 A;  4DSF A;  3PW0 A;  1NJX A;  5CWR A;  3ZDB A;  3OHB A;  4KLH A;  5J0W A;  9ICN A;  4MEY A;  4B9S A;  4AT9 A;  2W9M A;  5BOL A;  5KFJ A;  1JXL A;  1U9L A;  2BHN A;  2DFL A;  2XC9 A;  5L1J A;  5J0T A;  3UQ2 A;  4O3R A;  4KN4 A;  4JUZ A;  4ED2 A;  2JEI A;  5KT2 A;  7ICN A;  1UET A;  9ICU A;  4DL2 A;  3H37 A;  5KFL A;  5KT4 A;  5KFN A;  3C2K A;  5HHH A;  4M6W A;  2HHX A;  5J2H A;  2NRT A;  3LWL A;  2HVH A;  2M2T A;  5HR9 A;  3Q8S B;  4DSL A;  1DGS A;  9ICE A;  2W9A A;  7ICG A;  4QZG A;  4QW9 A;  5J2D A;  1JN3 A;  3WFO A;  1IM4 A;  4EBJ A;  3SV3 A;  1MIV A;  2JEJ A;  4AT8 A;  1HJP A;  1B43 A;  1H38 A;  4B9T A;  1S77 D;  4Q8F A;  3HP6 A;  3LQC B;  4MFC A;  4RU9 A;  2BE3 A;  4GC7 A;  1HUZ A;  5KFW A;  1NOM A;  4ED6 A;  1RZT A;  1DK2 A;  5DBB A;  2DRA A;  1JXE A;  8ICV A;  7ICP A;  3ISD A;  3EPI A;  2PFO A;  9ICA A;  4ATB B;  4AT9 B;  4I27 A;  3HW8 A;  4DOC A;  1JMS A;  5EWE A;  5J29 A;  7ICT A;  1A76 A;  3H8J A;  5EOZ A;  4J9R A;  3PR5 B;  4KLD A;  4RUC A;  2P6U A;  4ECQ A;  3RH6 A;  3Q8P B;  3ZD8 A;  4WC6 A;  5J2I A;  9ICR A;  5J2E A;  3GV5 B;  3UXP A;  4Q44 A;  4DL6 A;  4QWE A;  5KFI A;  4X4U A;  4DSJ A;  3B0Y A;  2HVI A;  3OJS A;  5HRF A;  4QW8 A;  4F92 B;  4X0B A;  2VAN A;  3V72 A;  1WCL A;  4ELT A;  4Z6D A;  4UAW A;  4RQ0 A;  4F8R A;  1ZQY A;  4O9M A;  2BDP A;  1ZQW A;  4YFK A;  4ECU A;  8ICP A;  4QZE A;  7ICI A;  1ZQX A;  4UB5 A;  2V9W A;  3ZDD A;  5KFR A;  4WCW A;  2KFZ A;  1ZQO A;  3LK9 A;  1DK3 A;  3H8W A;  4Q45 A;  3KHG A;  4EZ6 A;  4FHW A;  4DF4 A;  1FA0 A;  4DQI A;  3ORY A;  2ZJ8 A;  4Q43 A;  1ZQK A;  4RQ5 A;  3RB0 A;  4FHP A;  5HRI A;  2ZJA A;  5DQH A;  1L5U A;  3RJG A;  1EXN A;  4DLE A;  1Z00 B;  2MAX A;  4PHA A;  2UVV A;  4RWO A;  1UEU A;  4YXJ A;  4YR3 A;  4F5O A;  3UPQ A;  1HUO A;  1CUK A;  3JPQ A;  4UD5 A;  4AT7 A;  4HYK A;  1ZQH A;  2M2W A;  3TAP A;  3G6Y A;  1SKW A;  1RYS A;  4UD4 A;  5III A;  4M5D A;  4IQW A;  1WCN A;  1XWL A;  4BXO B;  4MFF A;  2BPC A;  4M9G A;  1X2I A;  2KTQ A;  1UT5 A;  1BNO A;  2FPL A;  4DQQ A;  1NK5 A;  1NZP A;  1BPE A;  1SL0 A;  2AGP A;  4KIT B;  1F5A A;  5IIL A;  2ZH6 A;  4B9L A;  2HHP A;  5EWG A;  4ECR A;  1ZQI A;  3RR7 A;  2FPK A;  8ICH A;  9ICX A;  4M6W B;  1RXW A;  2FLN A;  4WC4 A;  3IHQ B;  2ZUC A;  4J9N A;  8ICU A;  3E2E A;  4O3P A;  5KFX A;  7ICO A;  3RBD A;  4I2H A;  3Q8M A;  2KZM A;  1CEZ A;  4IQV A;  5D4B A;  4KLJ A;  2HHS A;  4P4P A;  2A1J B;  3MAB A;  4TQS A;  3SI8 A;  4KLE A;  2RFF A;  2J6T A;  4XQ8 A;  3KHR A;  9ICS A;  1MIW A;  5KFM A;  7ICF A;  1UA0 A;  3G6V A;  1UA1 A;  5KG0 A;  7ICL A;  1JQR A;  4RPY A;  4Z6C A;  3OGU A;  3GII A;  4EYI B;  4PHD A;  3T5J A;  5KT5 A;  2BR0 A;  1TKD A;  1NK6 A;  1U47 A;  1T7P A;  2HHV A;  4ED7 A;  4GXJ A;  2ZTE A;  3H8S A;  3UPS A;  4DOB A;  4FBU A;  2I1Q A;  4ED8 A;  1S10 A;  3RJF A;  4UBC A;  4RZR A;  1DOQ A;  4RQ3 A;  1KFS A;  4IR1 A;  1N48 A;  5L1L A;  2J6S A;  2DR5 A;  5KFE A;  1D9D A;  4JWN A;  9ICW A;  3AQL A;  2I9G A;  4NXZ A;  4ATB A;  4DQR A;  1U45 A;  3LDA A;  3RB4 A;  3TI0 A;  1MQ2 A;  2LYH A;  5BOM A;  4QWD A;  2XY5 A;  4DL4 A;  5HRG A;  4DFJ A;  5IIO A;  4GC6 A;  2ID1 A;  3QZ7 A;  5HC9 A;  1ZQP A;  3SV4 A;  9ICH A;  5HML A;  2KP7 A;  3HJ1 A;  1R8B A;  1BVS A;  3EW9 A;  2BCS A;  4O3S A;  4X4S A;  1U49 A;  2BKE A;  4F50 A;  3HX0 A;  3RB3 A;  5J2G A;  3MGH A;  8ICS A;  3THV A;  4R65 A;  2Q66 A;  1R8A A;  4ZH4 A;  4QZF A;  2AU0 A;  4RNM A;  1T8E A;  4ECX A;  2ISP A;  2FPM A;  3RJE A;  4DWI A;  5DQG A;  4KTQ A;  3RRH A;  1X9S A;  1Z3E B;  1BNP A;  3OVA A;  4BWJ A;  5CA7 A;  5DDM A;  2HHU A;  1NK0 A;  5KFC A;  4B9U A;  4TUQ A;  3RTV A;  1R8C A;  2DVI A;  4ELV A;  3QEA Z;  3K4G A;  5C5J A;  8ICR A;  3WFP A;  3RBE A;  8ICF A;  3HIY A;  3BJY A;  1ZQQ A;  5CB1 A;  3GIK A;  3UQ0 A;  3PY8 A;  5DKW A;  5IIJ A;  3Q8K A;  7ICH A;  1NK8 A;  2ZH3 A;  4F2S A;  4M04 A;  4CCH A;  1ZQU A;  1ZQZ A;  5CJ7 A;  4YMM A;  3MR3 A;  4ED3 A;  4YR0 A;  5DLG A;  4FBT A;  5KFV A;  3OSN A;  4DS4 A;  4KLL A;  4K4I A;  3ZDA A;  4DOA A;  3MFH A;  1U4B A;  3V7K A;  1ZQS A;  4I2F A;  2IA6 A;  2MUT A;  1S97 A;  4TQR A;  4C8M A;  1K1Q A;  2DRB A;  4IQT A;  4O3N A;  3C2L A;  4F5N A;  2Y1I A;  3BQ1 A;  2BCR A;  4ED1 A;  1ARO P;  1ZQT A;  1KLN A;  4O5E A;  4DEZ A;  3H38 A;  5HRH A;  3FDS A;  4IR9 A;  2IMW P;  1BPB A;  9ICF A;  3SZ2 A;  3T5H A;  3TFS A;  3ZDE A;  4F5P A;  2IHN A;  3GFK B;  3MR5 A;  8ICJ A;  1TK0 A;  4YR2 A;  5L1I A;  2BGW A;  9ICK A;  1L3T A;  3NYB A;  1ZQA A;  4PHP A;  1Q79 A;  4J9O A;  3M9O B;  2NRV A;  5DB8 A;  3JYY A;  4LZG A;  4R63 A;  8ICC A;  3MGI A;  5J2A A;  1RPL A;  1XO1 A;  5HNK A;  2R8H A;  5DG9 A;  4J9K A;  2FMQ A;  4M9L A;  2DR7 A;  9ICO A;  2IBK A;  4IRC A;  3MBY A;  3PW5 A;  3JPO A;  4RPZ A;  1MC8 A;  5HP4 A;  5KFG A;  1PZN A;  4I2I A;  3HPO A;  3RJJ A;  1BPD A;  3C23 A;  4I2B A;  4RQ2 A;  4DL5 A;  1RYR A;  5DGA A;  1X9M A;  1KEJ A;  3MDC A;  3BDP A;  2PBE A;  3H4D A;  5KG1 A;  1JAJ A;  1QSS A;  5BPC A;  3JPN A;  1TFR A;  2ZH2 A;  3OHA A;  4FHX A;  4KLI A;  3OVS A;  5KT6 A;  3OVB A;  3RH4 A;  3PW7 A;  7ICM A;  5J0R A;  4I2J A;  3G6X A;  3PW4 A;  3BQ2 A;  3TQ1 A;  4RWN A;  2DPJ A;  1TK5 A;  2WTF A;  1RXV A;  4PH5 A;  3AU6 A;  2KFN A;  2JEF A;  4EP7 A;  5F2V O;  2ZUD A;  2M2U A;  2FMS A;  4KLF A;  3QE9 Y;  4QZA A;  1KDH A;  2NRX A;  2XY7 A;  1ZQR A;  2FLP A;  5HRK A;  2NRK A;  4UBB A;  4KMU A;  1V9P A;  2MUT B;  5HMM A;  4ED0 A;  4I2E A;  1ZQV A;  4O3Q A;  1XC9 A;  7ICU A;  4GLX A;  8ICY A;  4M9H A;  4QWC A;  9ICL A;  5DGB A;  3PW2 A;  3RH5 A;  5KG7 A;  1TV9 A;  4G3I A;  8ICL A;  3ISB A;  4IQU A;  1UEV A;  4WBZ A;  1TFW A;  2XO7 A;  3OJU A;  4J9S A;  3FYH A;  7ICE A;  3C5F A;  1COO A;  1SL2 A;  2ZHA A;  3C1Y A;  3EWA A;  3K75 D;  4YVZ A;  1NJY A;  2NRW A;  2PFP A;  2VA3 A;  4C8O A;  5KFQ A;  3PR4 A;  4PGQ A;  2HW3 A;  1T4G A;  4NLN A;  4RT2 A;  4RQ4 A;  4UAY A;  4X4N A; 
#chains in the Genus database with same CATH topology
 2O6K A;  2OXO A;  4US8 A;  3WFR E;  4ELU A;  2PI5 A;  3FAH A;  4UAS A;  2W43 A;  3ETR A;  1N56 A;  3M6Z A;  4JK1 A;  2H5X A;  4EEN A;  1ZOL A;  4O3O A;  4E8F A;  4J9L A;  5KFS A;  4NLG A;  4NJ8 A;  3TAN A;  3WK7 A;  2UVR A;  2A1J A;  5ALG A;  1UQV A;  4F91 B;  5KFT A;  3MFI A;  1X66 A;  2Y0S F;  1O03 A;  1A77 A;  3HT3 A;  4BDP A;  1WOT A;  4KLO A;  7ICK A;  3QU4 A;  3EPG A;  3AUO A;  7ICJ A;  5ALT A;  4WC3 A;  7ICV A;  4RWP A;  4NM1 A;  2LYB A;  2MRL A;  2HDO A;  2K89 A;  5ALZ A;  4IRK A;  3BS5 B;  3QZ8 A;  3T5K A;  1S0O A;  4FHV A;  5DEC A;  2HOQ A;  5J0P A;  3TAQ A;  1NI3 A;  2ZH1 A;  1X9W A;  4WC0 A;  2ZIX A;  2EAM A;  3T3F A;  2EZX A;  1T3Q A;  2YTU A;  3PV8 A;  1F5S A;  4MKP A;  5DBA A;  4J9M A;  2O5A A;  4JV0 A;  2W9B A;  1MA7 A;  2M2V A;  4F93 B;  5HR6 A;  2FMP A;  4DFK A;  1JRP A;  2ZHB A;  3Q8L A;  9ICJ A;  3BQT A;  3OSP A;  5ALE A;  3RJK A;  3QU5 A;  4U6P A;  4DFM A;  2AGO A;  2O1P A;  3ISC A;  1SKS A;  3HJ4 A;  2HBK A;  2ZH9 A;  2RP5 A;  4X4T A;  3UMB A;  3L3F X;  2ASD A;  5J8Y C;  4Y2U A;  5KT7 A;  1QLN A;  3NVY A;  4AT8 B;  4HX0 A;  4UW9 A;  2W9C A;  2ATL A;  5IIN A;  5D63 A;  4CF3 A;  5CFU A;  2E1F A;  4FS1 A;  4X4Q A;  2GOL A;  1VJ5 A;  4Y2X A;  1SGG A;  4S3N A;  4QZ9 A;  3TAR A;  4TUP A;  2LPE A;  2D3D A;  4O5K A;  4EEB A;  3UMC A;  1V85 A;  5F9L A;  4DSE A;  3ZD9 A;  3AMZ A;  5KFA A;  4O5C A;  4AYB C;  3V6K A;  4IG8 A;  2F3N A;  5ALY A;  1ZET A;  3D6J A;  3EYZ A;  4J9P A;  1BPY A;  3WFQ E;  2ZH7 A;  4R66 A;  2HN1 A;  4GXI A;  5KG2 A;  1XS9 D;  4AT7 B;  1SKR A;  1ZQG A;  2W8L A;  4EBC A;  2W04 A;  2ALZ A;  2YQE A;  4KM5 A;  2F1H A;  2KVS A;  2VA8 A;  3PSI A;  4PGY A;  2K8B B;  3E58 A;  4Z6E A;  3KTQ A;  4F3O A;  4KLM A;  3BQ7 A;  2BCQ A;  4B9M A;  2W54 A;  5ALU A;  4OCZ A;  2KIC A;  4DQS A;  4F2R A;  5B5E U;  5HRL A;  2R8K A;  2M9N A;  3IV6 A;  2C2E A;  3D2S A;  4CF5 A;  1QQ5 A;  2H3F A;  4J9Q A;  4KLQ A;  2PFQ A;  4I2G A;  1SB3 C;  3O0F A;  1V4A A;  1TAU A;  3SYZ A;  2DPI A;  3M9M B;  1L3U A;  3PZP A;  2E8P A;  3AL0 B;  2AXT U;  1NJZ A;  1C20 A;  4Q8E A;  5EWF A;  1BGX T;  3Q8Q B;  2WB1 F;  3H8M A;  4LEW A;  3BQ0 A;  1KSP A;  3HWT A;  4F5Q A;  4J03 A;  1L7N A;  2JGA A;  3RB6 A;  5KG6 A;  3GDX A;  1NK7 A;  2F1J A;  2NV3 A;  4DO9 A;  5JUM A;  3BZC A;  4WC5 A;  2H3V A;  5DG8 A;  3GIM A;  2ODG A;  5IIM A;  5DG7 A;  1C7Y A;  1VJ7 A;  4WC7 A;  2BQ3 A;  2N1R A;  4DF8 A;  8ICO A;  3OHB A;  4NV0 A;  9ICN A;  3QYP A;  1U9L A;  2DFL A;  5L1J A;  3VC8 A;  7ICN A;  4KN4 A;  5KT2 A;  2WB1 C;  3Q8S B;  1IM4 A;  5AI0 A;  1S77 D;  1H38 A;  3HP6 A;  3LQC B;  4RU9 A;  4GC7 A;  1NOM A;  4ED6 A;  1RZT A;  3C29 A;  5DBB A;  8ICV A;  3SEN A;  3EPI A;  2PFO A;  9ICA A;  4I27 A;  4DOC A;  1JMS A;  7ICT A;  4US9 A;  5EOZ A;  4RUC A;  4BUG A;  4G9B A;  3F2D A;  5J2I A;  1KN5 A;  4DL6 A;  5CHE A;  4X4U A;  3CK6 A;  4QW8 A;  2F2A B;  4O9M A;  2BDP A;  4YFK A;  8ICP A;  1ZQX A;  4UB5 A;  4K8V A;  3LK9 A;  2K60 A;  3KHG A;  2BBJ A;  5AKL A;  1FA0 A;  4DQI A;  2ZJ8 A;  4Q43 A;  4RQ5 A;  1L5U A;  3RJG A;  4NLB A;  4YXJ A;  1GO3 F;  4UD5 A;  3SMV A;  2IOF A;  5JRT A;  3TAP A;  2CN1 A;  2GLE A;  2KTQ A;  2BPC A;  4FZL A;  2MU2 A;  1UT5 A;  2F44 A;  1QCK A;  1NK5 A;  2AGP A;  4KIT B;  3TAD A;  4B9L A;  1ZQI A;  3RR7 A;  2FPK A;  2FLN A;  3IHQ B;  2ZUC A;  4J9N A;  8ICU A;  7ICO A;  2KZM A;  4IQV A;  2HHS A;  2VIX A;  4EEL A;  2RFF A;  3KHR A;  2YB4 A;  3WK6 A;  3G6V A;  1GPJ A;  1X6J A;  3T5J A;  3OGU A;  5KT5 A;  2G0A A;  3H8S A;  3QNM A;  4C4T A;  3UPS A;  2I1Q A;  4UBC A;  4RZR A;  4IR1 A;  5L1L A;  2DR5 A;  2I9G A;  4ATB A;  2GA9 D;  3TI0 A;  4UAR A;  2GH1 A;  4C7Y A;  5ALM A;  3QZ7 A;  9ICH A;  1RDF A;  1U49 A;  3RB3 A;  1ZD2 P;  2G06 A;  3MGH A;  8ICS A;  1R8A A;  2ZIU A;  4QZF A;  4ECX A;  1BNP A;  5JTI A;  1NK0 A;  5ALI A;  5KL8 B;  2DVI A;  4ICA A;  5AM2 A;  1ZQQ A;  3PY8 A;  2H3Q A;  1NK8 A;  1ZQU A;  5AK6 A;  3WKD A;  3KZI U;  3MR3 A;  4FBT A;  4KLL A;  5G5H A;  1U4B A;  2B0C A;  4TQR A;  3SD7 A;  5CEH A;  2Y1I A;  4DEZ A;  5HRH A;  1Z1V A;  3T5H A;  4XJE A;  3GFK B;  1Q8K A;  1L3T A;  4J9O A;  2HBJ A;  5AIB A;  2NRV A;  1MN8 A;  3MGI A;  1VDV A;  5DG9 A;  3FM9 A;  9ICO A;  3MBY A;  4UB8 U;  2KKP A;  5KFG A;  1PZN A;  4I2B A;  7ICH A;  2JHD A;  5DGA A;  1X42 A;  5KG1 A;  1Z4O A;  5BPC A;  3JPN A;  1WWV A;  3OHA A;  3RH4 A;  3KFU F;  7ICM A;  5AK3 A;  4RWN A;  2DPJ A;  1TK5 A;  2KFN A;  3AU6 A;  2ZUD A;  2FMS A;  2B51 A;  3QE9 Y;  3TAC B;  5HRK A;  2XY7 A;  1ZQR A;  2FLP A;  4ED0 A;  1ZQV A;  4O3Q A;  8ICY A;  5KG7 A;  8ICL A;  2PKE A;  3T79 A;  5GTH U;  2D8C A;  4WBZ A;  4J9S A;  4WQL A;  1COO A;  3K75 D;  2PFP A;  4NLN A;  4RQ4 A;  2ZIV A;  4X4N A;  9ICI A;  1Z4N A;  4NLK A;  1L6N A;  4MEX A;  2F1I A;  1T3N A;  1B22 A;  1NKC A;  3IM1 A;  2HOF A;  3GV8 B;  4M47 A;  1ZRN A;  2BCV A;  2BPF A;  2W9B B;  2C2R A;  3SAF A;  3OTQ A;  4M0A A;  3M1Y A;  2YX8 A;  3VCB A;  1FFU A;  4I29 A;  3M8S A;  2ZXI A;  4QWB A;  3RR8 A;  4JV2 A;  4ECW A;  2FDR A;  3V6H A;  2B21 A;  5ALO A;  3F2C A;  4F4X A;  1N5W A;  5ALD A;  2LMR A;  1LB2 B;  2OEH A;  1X9X A;  4UB1 A;  3GQC A;  2DKX A;  4QZH A;  2AJQ A;  1XSP A;  2F8K A;  4O3M A;  3H40 A;  2HHQ A;  5J2J A;  4X4O A;  3AQK A;  5JU5 A;  2OWO A;  4KLT A;  1UCV A;  4X4R A;  2K8A A;  1KW4 A;  1B0X A;  4UB4 A;  4BGD A;  3GV7 B;  1S76 D;  2IHM A;  1N63 A;  4E0D A;  4XUS A;  1Y88 A;  2BQU A;  2ZTD A;  2W7P A;  1L8O A;  4NLZ A;  3I28 A;  2ASL A;  4I0U A;  1PK1 B;  1ZQB A;  2LM1 A;  4ECT A;  2FLL A;  1S0N A;  1S9F A;  4YD2 A;  2MSN A;  5IIK A;  4NM2 A;  1UT8 A;  1YT3 A;  1QSY A;  4RPX A;  3MCR A;  3H3A A;  1SZH A;  1JAL A;  4FS2 A;  1OU5 A;  4UB3 A;  3C66 A;  2OYY A;  5KL1 B;  1ZQM A;  1COK A;  2G5H B;  3OUY A;  5J2C A;  4A8E A;  2ZUB A;  5DLF A;  3SEI A;  4C8N A;  2ISO A;  4EBE A;  9ICQ A;  4K99 A;  5HRD A;  3NRZ A;  4YXM A;  3V6J A;  3PO4 A;  3JPT A;  1XSN A;  4B9N A;  2E5S A;  2ZTC A;  4DS5 A;  2NRZ A;  8ICQ A;  1TVA A;  3WU2 U;  1ZQ1 C;  5CRX A;  1PVQ A;  8ICN A;  1CRX A;  1Z00 A;  3NWI A;  1L3V A;  5CFS A;  1ZQL A;  3JZ0 A;  5EE0 A;  1IIP A;  8ICM A;  2DR9 A;  4FH3 A;  4P0P A;  8ICW A;  5AKX A;  4PPX A;  4BXO A;  4QZC A;  4M2Y A;  3V7L A;  4QIW C;  1KQQ A;  2QAR B;  3LYS A;  3EZ5 A;  2ZH4 A;  3R9K A;  4JB3 A;  4MFA A;  4NWI A;  5AIC A;  2V4R A;  2HBM A;  4DQP A;  4QZB A;  2EAO A;  3H4B A;  4I2A A;  2W9C B;  2XCP A;  2LI6 A;  4KLG A;  4NKT A;  5KFH A;  4DL3 A;  2YB1 A;  4RT3 A;  4JMU A;  3PO5 A;  2JEG A;  4NL9 C;  9ICV A;  2XIC A;  4EBD A;  5CP2 A;  1J97 A;  1N2X A;  4UB2 A;  2ZIV B;  3MGV A;  1XO0 A;  2K4H A;  4QWA A;  4F71 A;  4QZ8 A;  1N62 A;  4YN4 A;  4X5V A;  3NKU A;  2F76 X;  5D62 A;  3ETL A;  2PXI A;  2YML A;  3H0M B;  4E7X A;  4F5R A;  4P2H A;  4R8U A;  4KMO B;  3AQM A;  2QAR A;  3A0H U;  3MR6 A;  2FI1 A;  8ICT A;  1QH9 A;  4K9B A;  4LVS A;  2XGP A;  3NRW A;  5ALX A;  1ZD4 A;  2BQR A;  2DR8 A;  2HMX A;  1SV0 A;  3SAG A;  4RUA A;  1K1S A;  3H0L B;  1TE2 A;  4EX7 A;  2QB0 A;  5KFY A;  4BWM A;  2E8M A;  1ZJM A;  5AKY A;  3S6J A;  5B3P A;  2J6U A;  5KFB A;  9ICB A;  4C80 A;  5J0U A;  4IC9 A;  3EUB 2;  3PW0 A;  5CWR A;  1VLB A;  3F2B A;  4AT9 A;  3QX7 A;  5KFJ A;  3C28 A;  5J0T A;  1UET A;  3H37 A;  9ICU A;  3ED5 A;  5KT4 A;  5HHH A;  4M6W A;  5J2H A;  2NRT A;  2M2T A;  2ZIW A;  4NXX A;  3M6K A;  5ALL A;  4DSL A;  9ICE A;  2W9A A;  2KIW A;  7ICG A;  3WFO A;  3QU7 A;  1JN3 A;  1DXS A;  3HIL A;  3HRD D;  1HJP A;  4B9T A;  5J8Y A;  4PZN A;  3D2N A;  2DGZ A;  4CDG A;  5KFW A;  1JXE A;  4AT9 B;  4OJ6 A;  3HW8 A;  1UHU A;  4Y2P A;  4J9R A;  3PR5 B;  4ECQ A;  4ACO A;  2H3Z A;  2HSZ A;  3GV5 B;  1RG6 A;  4Q44 A;  4QWE A;  5KFI A;  4DSJ A;  3OJS A;  2IHO A;  2JXJ A;  2VAN A;  3V72 A;  3TKA A;  4F8R A;  1ZQY A;  2LYA A;  3ZDD A;  1X40 A;  5KFR A;  4FO1 A;  2KFZ A;  5ALS A;  1ZQO A;  4Q45 A;  4DF4 A;  5AKZ A;  3ORY A;  2WF5 A;  2ZIW B;  3RB0 A;  3MC1 A;  1EXN A;  3ERC C;  1SIJ A;  2HI0 A;  4YR3 A;  3BS7 A;  2RRD A;  5EE3 A;  1ZQH A;  4P0Q A;  1SKW A;  4LEZ A;  1ECW A;  1BNO A;  1NZP A;  1BPE A;  1SL0 A;  1F5A A;  2ZH6 A;  2H3I A;  8ICH A;  9ICX A;  2VJ4 A;  3E2E A;  5KFX A;  3RBD A;  3Q8M A;  1CEZ A;  4KLJ A;  1B4F A;  5E79 U;  3MAB A;  4TQS A;  4KLE A;  2J6T A;  4XQ8 A;  9ICS A;  3QUC A;  7ICF A;  3AQE A;  1Q3U A;  4EYI B;  4RPY A;  1NK6 A;  2YY6 A;  1T7P A;  4GXJ A;  4ED8 A;  3RJF A;  2YN4 A;  1SWW A;  2ZXH A;  4WOY A;  4K96 A;  2W3S A;  5JTG A;  5BOM A;  2XY5 A;  2E3T A;  4DFJ A;  3GZF A;  5AKJ A;  5IIO A;  3N7P D;  2ID1 A;  5HC9 A;  3SV4 A;  3HJ1 A;  2L5Y A;  2EAP A;  5AM5 A;  4OD0 A;  1BVS A;  4X4S A;  4O3S A;  2BKE A;  2KSO B;  3HX0 A;  5J2G A;  2DF4 B;  2Q66 A;  5AI4 A;  4RNM A;  3RJE A;  1X9S A;  2A3V A;  3DV9 A;  3OVA A;  4BWJ A;  5CA7 A;  5FP0 A;  5KFC A;  2QB0 B;  3RTV A;  1V97 A;  3QEA Z;  5C5J A;  8ICR A;  3WFP A;  3HIY A;  3BJY A;  5EE9 A;  1S5L U;  3UQ0 A;  5IIJ A;  3Q8K A;  2ZH3 A;  4M04 A;  2K8C B;  3L5K A;  5GTI U;  4OJP A;  4ED3 A;  5DLG A;  3OSN A;  2EZZ A;  3MFH A;  2IA6 A;  2MUT A;  2DRB A;  4PZO A;  2BCR A;  1ARO P;  1ZQT A;  1KLN A;  4O5E A;  1F44 A;  3FDS A;  3AEV A;  4IR9 A;  1LVH A;  3QUQ A;  3SZ2 A;  3TFS A;  2IHN A;  3MR5 A;  8ICJ A;  4YR2 A;  5L1I A;  2BGW A;  2KSO A;  1RQN A;  5F3X B;  1D8B A;  2G07 A;  8ICC A;  5ALR A;  4O67 A;  1RPL A;  1XO1 A;  4U7C A;  1WYG A;  5HNK A;  2R8H A;  2FMQ A;  4M9L A;  1MC8 A;  5HP4 A;  3RJJ A;  4I2I A;  4NLC A;  4RQ2 A;  2WAQ F;  3KBB A;  3H4D A;  1JAJ A;  1QSS A;  5AM4 A;  3L4P A;  4HAI A;  4FHX A;  5KT6 A;  4I2J A;  5AK5 A;  3PW4 A;  4QJF B;  2JEF A;  4LEY A;  1PVR A;  5HMM A;  4I2E A;  7ICU A;  5AKH A;  4QWC A;  5DGB A;  4OJL A;  3PW2 A;  4OO1 J;  4MHV A;  1UEV A;  1PK1 A;  1Z19 A;  3FYH A;  7ICE A;  5K4L A;  2HCF A;  1J2N A;  2HW3 A;  1SXD A;  5KFQ A;  4PGQ A;  1T4G A;  1V38 A;  3WK5 A;  4UAY A;  1ZQJ A;  5J0Q A;  1O08 A;  4EZ9 A;  3C1Z A;  2W8K A;  4P0Q B;  1KNY A;  4CNQ A;  4WJ3 B;  8ICB A;  4Z6F A;  3C2M A;  5TZV A;  3IN5 A;  1SWV A;  4YMO A;  4O68 A;  4FO6 A;  4RQ1 A;  4JV1 A;  3NVW A;  4C4R A;  1NK9 A;  2NO4 A;  5KG3 A;  4ECZ A;  3MR2 A;  4MF8 A;  3T5L A;  2M0N A;  4OAG A;  1R89 A;  1BPX A;  2HHW A;  2WFA A;  2G5I B;  5AIA A;  1KTQ A;  4QZD A;  8ICG A;  5ALQ A;  2KHQ A;  2I5H A;  3CYM A;  3LWM A;  1KRP A;  3CP8 A;  4ECS A;  4JWM A;  7ICS A;  1Z1B A;  1MSW D;  3N4M B;  3C21 A;  4OAF A;  1L7O A;  3UMG A;  2KOB A;  1ZYQ A;  3GIL A;  2QB1 A;  3DEE A;  2P6R A;  3V7J A;  3LVV A;  1SV0 C;  5L1M A;  2K4I A;  1NJW A;  4NY8 A;  2JV3 A;  1XNS A;  4NXU A;  2OH2 A;  3RAQ A;  1U48 A;  2XID A;  5L9X A;  4X4P A;  1ZJN A;  4I28 A;  2KJ5 A;  4KLS A;  4RWQ A;  4RNN A;  2KN7 A;  4WH5 A;  1SXE A;  1XSL A;  7ICR A;  3CRX A;  4BJQ A;  3A0B U;  5AI6 A;  3I76 A;  2HOI A;  3TFR A;  3KKA C;  3NVO A;  5DQI A;  5DB6 A;  4F4Z A;  2Q4T A;  5J2B A;  1QSL A;  3PX4 A;  3H7I A;  4K97 A;  5DDY A;  4K4H A;  1X6I A;  3OV7 A;  2KJ9 A;  2UVW A;  1KFT A;  2C22 A;  2WAQ C;  3PVX A;  5KFD A;  5DB7 A;  4IRD A;  5KT3 A;  3C5G A;  2ASJ A;  2ZJ5 A;  2GWS A;  4DSI A;  5J0O A;  2KE7 A;  2LM4 A;  1YZ7 A;  3AQN A;  2R8J A;  4KN7 A;  2ESE A;  2E8N A;  4WC2 A;  1P7D A;  5J0Y A;  3M9N B;  1MQ3 A;  4GFJ A;  2XGQ A;  2XY6 A;  4C8K A;  1SL1 A;  2AQ4 A;  1Q78 A;  2ZH5 A;  1TAQ A;  5AK4 A;  2KKV A;  8ICX A;  5D46 A;  4FHY A;  4P4O A;  5AHX A;  4RQ8 A;  2F77 X;  1NKB A;  2XVT A;  3Q8R B;  2LBO A;  4EEY A;  3HKZ C;  4DFD A;  5HRB A;  5HR9 A;  2KZ3 A;  3GIJ A;  4UQG A;  3B0X A;  5AI5 A;  2GO7 A;  4DSK A;  9ICP A;  1ZQD A;  2GAF D;  3JPP A;  5HHI A;  3PX6 A;  8ICA A;  2RHF A;  9ICC A;  5HR7 A;  5KFU A;  2KZZ A;  5KTQ A;  4K4G A;  2JZB B;  3QUB A;  1FO4 A;  1QTM A;  2P66 A;  3E0F A;  3NGD A;  2HHT A;  4EED A;  1Q3V A;  3PML A;  1NNL A;  2B6G A;  1JIH A;  8ICI A;  2B4V A;  2UVU A;  1ZQC A;  4JLX A;  4UB6 U;  5AKG A;  5KFZ A;  3K1R B;  5DB9 A;  3H39 A;  4TUR A;  5AKE A;  1D8L A;  4F4K A;  4QZI A;  3OPX A;  9ICM A;  1L3S A;  2AQ0 A;  4I2C A;  2NYV A;  4FH5 A;  5C0Y A;  4RQ6 A;  5T14 A;  1NKE A;  2VKQ A;  4C8L A;  1JX4 A;  3OWG A;  1XU4 A;  1DGJ A;  1NJX A;  3ZDB A;  4MEY A;  3IG5 A;  5ALJ A;  4B9S A;  2W9M A;  3D2Q A;  3UQ2 A;  2JEI A;  4JUZ A;  4ED2 A;  3BS5 A;  3WKB A;  3C2K A;  1DGS A;  2KNJ A;  3SV3 A;  3GU3 A;  2CRX A;  1MIV A;  2IOH A;  4Q8F A;  4MFC A;  2BE3 A;  1HUZ A;  3IRU A;  7ICP A;  3ISD A;  5EWE A;  2EDU A;  1A76 A;  3BZK A;  3ICX A;  3B9J A;  2KK0 A;  2HBL A;  2KG5 A;  4IS7 A;  3ZD8 A;  4WC6 A;  1LKY B;  2LKY A;  2NO5 A;  3B0Y A;  4X0B A;  2JH7 A;  4Z6D A;  4RQ0 A;  1PK3 A;  4QZE A;  7ICI A;  2V9W A;  2WHE A;  1OXJ A;  2KD1 A;  3ONN A;  1ZQK A;  4FHP A;  4P0P B;  2ZJA A;  5DQH A;  4DLE A;  2MAX A;  4PHA A;  2UVV A;  5AM1 A;  3UPQ A;  1HUO A;  1FFV A;  4HYK A;  3KZX A;  3QU2 A;  4UD4 A;  5III A;  4IQW A;  1WCN A;  1XWL A;  4MFF A;  4NXW A;  4M9G A;  4OJO A;  3WKA A;  2FPL A;  4DQQ A;  4B6J A;  2HHP A;  4M6W B;  4USA A;  4O3P A;  2LHT A;  4I2H A;  5D4B A;  4P4P A;  3SI8 A;  1MIW A;  2KHV A;  1UA0 A;  1JRO A;  1UA1 A;  5KG0 A;  7ICL A;  1OW5 A;  2AH5 A;  1TKD A;  3GII A;  4PHD A;  2JH1 A;  2Y9T A;  4CGZ A;  3N7S C;  2HHV A;  4ED7 A;  4CRX A;  2ZTE A;  3J81 j;  1S10 A;  1KFS A;  1N48 A;  5A0L A;  1D9D A;  9ICW A;  4NXZ A;  1U45 A;  2CXY A;  3RB4 A;  1ZD3 A;  2LYH A;  4QWD A;  4WQK A;  2FE9 A;  4DL4 A;  1JUD A;  5HRG A;  4NXT A;  4GC6 A;  4Y2Q A;  1ZQP A;  5HML A;  1R8B A;  3EW9 A;  2BBH A;  4F50 A;  1RYU A;  4R65 A;  1T8E A;  2FPM A;  3N7R C;  1Z3E B;  2DUY A;  1JI7 A;  5DDM A;  1R8C A;  2JR5 A;  4ELV A;  3RBE A;  3SQI A;  5CB1 A;  3GIK A;  2OCE A;  4CCH A;  5AKK A;  5KFV A;  4DS4 A;  4K4I A;  3ZDA A;  2KMD A;  4AP9 A;  3V7K A;  1ZQS A;  1S97 A;  1K1Q A;  4IQT A;  4O3N A;  3C2L A;  4F5N A;  1HIW A;  3PHZ A;  2IOF K;  2IMW P;  2DWQ A;  3AM9 A;  2ZIU B;  3ZDE A;  2BDU A;  4PHP A;  1Q79 A;  3M9O B;  4LJX A;  4R63 A;  5J2A A;  2K4P A;  5ALH A;  4J9K A;  5B3Q A;  4Y2V A;  5TIS U;  2DR7 A;  5KAF U;  4RPZ A;  1T94 A;  3K1Z A;  1HEK A;  2JRZ A;  1BPD A;  3C23 A;  3EF2 A;  1A6S A;  1KEJ A;  3MDC A;  3DDH A;  3WKE A;  2ZH2 A;  1K5O A;  4N7R A;  4KLI A;  3OVS A;  1J2M A;  3PW7 A;  3G6X A;  4NL9 A;  1Q46 A;  1RXV A;  2WTF A;  2MA1 A;  4EP7 A;  5F2V O;  4KLF A;  4KB6 A;  4QZA A;  2NRX A;  4KMU A;  1V9P A;  2MUT B;  1WG8 A;  4UAU A;  2PMZ F;  4GLX A;  4M9H A;  1TV9 A;  4PL1 A;  2I6X A;  2XO7 A;  3OJU A;  1LKY A;  3AQF A;  3ER9 B;  2KV2 A;  1SL2 A;  4KX3 A;  2ZHA A;  4YVZ A;  2VA3 A;  2NRW A;  4C8O A;  2ZIX B;  3PR4 A;  2OM6 A;  4RT2 A;  2W55 A;  4PHE A;  2F8L A;  5CHG A;  3K7D A;  4O0I A;  4E80 A;  2ES6 A;  3ALR A;  4RNO A;  5KFK A;  4WCW A;  4R8U B;  4F72 A;  3PSF A;  2Q0Z X;  4LZD A;  5KG4 A;  4OAH A;  5F9N A;  3M8R A;  1ZD5 A;  3L9D A;  3F5A A;  3JPS A;  5J2F A;  4YQW A;  3M7D A;  5EE1 A;  3U26 A;  3RRG A;  2JZB A;  2RDJ A;  4ECY A;  1TFY A;  5AM3 A;  3PST A;  5ALK A;  4WC1 A;  3RF9 A;  4YD1 A;  1S0M A;  4I2D A;  5J0S A;  4EBK A;  3C18 A;  1ZRM A;  2C2D A;  3RAX A;  1S0V A;  2W3R A;  9ICG A;  4B9V A;  3KHH A;  5KG5 A;  5KNI A;  4F4W A;  3PNC A;  2EZY A;  3LVW A;  4R64 A;  9ICT A;  1IG6 A;  4M9J A;  4XA5 A;  4UAT A;  4KLU A;  3UXO A;  1S8O A;  2KEY A;  5KFP A;  1LV5 A;  3WK4 A;  3KHL A;  1N60 A;  4IL6 U;  1PUZ A;  3NAS A;  3RJH A;  1L8L A;  2DQN B;  4UAZ A;  5D49 A;  3F5E A;  2W7O A;  2WF9 A;  5KAI U;  3RJI A;  5DBC A;  1IV8 A;  5ALW A;  4WBY A;  1ZQE A;  1QQ6 A;  5KFF A;  3WK9 A;  2Y9U A;  4XQ7 A;  1BPZ A;  3QUT A;  1PX5 A;  4LEV A;  4ECV A;  1D8Y A;  3JPR A;  2VA2 A;  2W11 A;  1VFG A;  4P4M A;  4YMN A;  5KFO A;  2YMP A;  1ZQN A;  4M9N A;  2AGQ A;  1A0P A;  1FEZ A;  3MDA A;  1KFD A;  3UM9 A;  2R8G A;  3ER8 C;  4NKU A;  8ICZ A;  2V4Q A;  3AU2 A;  4X0A A;  2WF7 A;  2Y1J A;  2R18 A;  3UXN A;  4YG2 A;  1DRG A;  4YP3 A;  3HJE A;  4TUS A;  2BCU A;  1M6Y A;  4DCC A;  5L1K A;  5J2K A;  3WFS C;  1N61 A;  4QIW F;  3AN1 A;  4YCX A;  3ZDC A;  1IXR A;  4RQ7 A;  3OUY B;  2G08 A;  4LT6 A;  2DKZ A;  4KX5 A;  1OUQ A;  1NO5 A;  4GXK A;  2BPG A;  2R8I A;  1L7P A;  3PX0 A;  2EAN A;  8ICK A;  4F4Y A;  4DFP A;  2RQ5 A;  4DLG A;  3PSP A;  3NVZ A;  2DBY A;  2ZH8 A;  1ED1 A;  1MIY A;  3N97 B;  5CR0 A;  4EYH B;  2PFN A;  4DL7 A;  1NZB A;  5ALP A;  2EH9 A;  3IDW A;  2PI4 A;  3KKA A;  2C28 A;  3QEB Z;  1NK4 A;  2HN2 A;  2XCA A;  4XRH A;  1ZQF A;  2QKQ A;  3NTU A;  1N5X A;  1TK8 A;  1D9F A;  1SZP A;  5J0X A;  4C7Z A;  3PMN A;  7ICQ A;  1YLQ A;  4EGW A;  4PGX A;  8ICE A;  2RDI A;  2KVC A;  2ZG6 A;  4Y2Y A;  1RM6 C;  4O69 A;  5AI8 A;  3JCF A;  1F0M A;  5DED A;  4MF2 A;  2E1E A;  5HRE A;  4DSF A;  4OJ5 A;  3SR6 A;  4KLH A;  1KL9 A;  5J0W A;  5BOL A;  3NS1 A;  1JXL A;  2BHN A;  2KIV A;  2XC9 A;  4O3R A;  3KOO A;  4DL2 A;  3KD3 A;  5KFL A;  5KFN A;  2G09 A;  2HHX A;  3LWL A;  4C0Z A;  2HVH A;  4EBJ A;  2EWR A;  4Y2S A;  4QZG A;  5J2D A;  4QW9 A;  2DL0 A;  2Y0S C;  2JEJ A;  2XI9 A;  4AT8 A;  1B43 A;  3NVV A;  4K9A A;  1DK2 A;  4EEK A;  2DRA A;  4ATB B;  2A19 A;  1SV4 A;  3QXG A;  5J29 A;  3H8J A;  3I1Y A;  4KLD A;  2P6U A;  3RH6 A;  3Q8P B;  1YZ6 A;  1KKX A;  9ICR A;  5J2E A;  4RQN A;  3QU9 A;  3WKC A;  3UXP A;  2HVI A;  5HRF A;  4F92 B;  1WCL A;  4ELT A;  2BZF A;  1TAM A;  4UAW A;  2CPR A;  1ZQW A;  4ECU A;  2B56 A;  4JLZ A;  3TAD C;  1DK3 A;  3H8W A;  4FHW A;  4EZ6 A;  5CFT A;  4K98 A;  5G5G A;  1CI4 A;  1QQ7 A;  4OAI Z;  4QNL A;  3CW2 C;  1FIQ A;  1Z00 B;  4RWO A;  1UEU A;  4F5O A;  1CUK A;  3JPQ A;  2D6F C;  1KBU A;  4AT7 A;  2M2W A;  3G6Y A;  1RYS A;  4M5D A;  4BXO B;  1X2I A;  4NXV A;  5IIL A;  2A1A A;  2PMZ C;  5EWG A;  3ZI4 A;  4ECR A;  1RXW A;  4WC4 A;  1L7M A;  4C4S A;  2A1J B;  4O6A A;  2WF6 A;  5KFM A;  1JQR A;  4X4V A;  1WWU A;  5AM0 A;  4FZM A;  4Z6C A;  5HRI A;  2YMQ A;  2BR0 A;  1U47 A;  3F53 A;  4DOB A;  4FBU A;  4Y2J A;  5B66 U;  1DOQ A;  4RQ3 A;  2J6S A;  5KFE A;  4JWN A;  3AQL A;  5ALN A;  4DQR A;  3LDA A;  1MQ2 A;  2OHF A;  3RFA A;  2JMG A;  4FE3 A;  2VJ5 A;  2KP7 A;  2RLT A;  5D61 A;  4BX9 C;  2WF8 A;  4CE6 A;  2BCS A;  3IP4 B;  4EX6 A;  3THV A;  4FZN A;  4ZH4 A;  2AU0 A;  4DWI A;  2ISP A;  5DQG A;  4KTQ A;  3RRH A;  2IUB A;  3CNH A;  2HHU A;  2FJ6 A;  3H0R B;  2QLT A;  4B9U A;  4TUQ A;  2Z7J A;  4RQM A;  3K4G A;  4AYB F;  8ICF A;  2KJ8 A;  1WUD A;  4GIB A;  2YMM A;  2W03 A;  5DKW A;  1RQL A;  4Y2R A;  4F2S A;  2FCL A;  1ZQZ A;  5CJ7 A;  4YMM A;  4YR0 A;  4DOA A;  4FFD A;  4I2F A;  4C8M A;  3BQ1 A;  4ED1 A;  3H38 A;  1BPB A;  9ICF A;  4UAV A;  4F5P A;  2P35 A;  1TK0 A;  2EQY A;  9ICK A;  2E8O A;  3NYB A;  1ZQA A;  4EV6 A;  3N28 A;  5DB8 A;  3JYY A;  4LZG A;  3FC4 A;  5H2F U;  2IBK A;  4IRC A;  3PW5 A;  3JPO A;  1PVP A;  3HPO A;  4DL5 A;  1RYR A;  1AQ6 A;  1X9M A;  2PBE A;  3BDP A;  3WK8 A;  1ZXI A;  3IG8 A;  5AI9 A;  1TFR A;  3OVB A;  4ZOH C;  5J0R A;  3HKZ F;  3BQ2 A;  5ALV A;  3TQ1 A;  4PH5 A;  2M2U A;  1KDH A;  3NUQ A;  2NRK A;  4UBB A;  4PJ0 U;  5AKI A;  9ICL A;  5ALF A;  3SAH A;  1XC9 A;  3RH5 A;  4G3I A;  4PL2 A;  3ISB A;  4CF4 A;  4IQU A;  1TFW A;  4Y2T A;  3C5F A;  3C1Y A;  3EWA A;  1URJ A;  2AHO B;  1NJY A;  1UPH A;  2K4E A; 
#chains in the Genus database with same CATH homology
 4PHE A;  1ZQJ A;  3WFR E;  5J0Q A;  5CHG A;  4EZ9 A;  3C1Z A;  4ELU A;  2PI5 A;  9ICI A;  4NLK A;  4O0I A;  4MEX A;  2W8K A;  2F1I A;  1KNY A;  4E80 A;  1T3N A;  8ICB A;  4Z6F A;  1NKC A;  1N56 A;  3IM1 A;  4M47 A;  3GV8 B;  1B22 A;  3C2M A;  4JK1 A;  2H5X A;  5TZV A;  4O3O A;  5KFK A;  4RNO A;  4R8U B;  2BCV A;  4YMO A;  2W9B B;  2C2R A;  4J9L A;  2BPF A;  4E8F A;  2Q0Z X;  5KFS A;  4FO6 A;  4RQ1 A;  4JV1 A;  1NK9 A;  4LZD A;  4NLG A;  5KG4 A;  3TAN A;  4M0A A;  2UVR A;  5F9N A;  3M8R A;  2A1J A;  5KG3 A;  4ECZ A;  4I29 A;  3L9D A;  3M8S A;  3MR2 A;  4MF8 A;  4F91 B;  4QWB A;  3JPS A;  3T5L A;  5KFT A;  4ECW A;  5J2F A;  4YQW A;  3RR8 A;  4JV2 A;  3V6H A;  1BPX A;  2HHW A;  1R89 A;  2B21 A;  3MFI A;  1KTQ A;  3RRG A;  4QZD A;  8ICG A;  4F4X A;  1A77 A;  3HT3 A;  4BDP A;  3LWM A;  2JZB A;  2RDJ A;  1LB2 B;  1KRP A;  1WOT A;  4ECS A;  4KLO A;  4JWM A;  7ICS A;  4ECY A;  1TFY A;  4UB1 A;  3GQC A;  1MSW D;  7ICK A;  3EPG A;  3AUO A;  3N4M B;  3C21 A;  7ICJ A;  4QZH A;  4WC3 A;  4WC1 A;  2AJQ A;  7ICV A;  4RWP A;  4NM1 A;  1XSP A;  1ZYQ A;  4YD1 A;  1S0M A;  3GIL A;  3H40 A;  4IRK A;  2P6R A;  2HHQ A;  3QZ8 A;  3T5K A;  1S0O A;  4FHV A;  4I2D A;  5J0S A;  5J2J A;  5DEC A;  3AQK A;  3V7J A;  5J0P A;  4X4O A;  3TAQ A;  2OWO A;  4KLT A;  3C18 A;  4EBK A;  4X4R A;  2ZH1 A;  2C2D A;  4UB4 A;  3RAX A;  1X9W A;  4BGD A;  4WC0 A;  1S0V A;  1NJW A;  4NY8 A;  3GV7 B;  1S76 D;  9ICG A;  2IHM A;  4B9V A;  4E0D A;  4XUS A;  3T3F A;  1Y88 A;  3RAQ A;  1U48 A;  2BQU A;  2ZTD A;  3KHH A;  5KG5 A;  3PV8 A;  5DBA A;  4NLZ A;  2ASL A;  4J9M A;  1ZQB A;  5L9X A;  4F4W A;  2O5A A;  3PNC A;  4ECT A;  4JV0 A;  1ZJN A;  4X4P A;  2W9B A;  4R64 A;  2FLL A;  4I28 A;  1S0N A;  4KLS A;  4M9J A;  1S9F A;  4RNN A;  4XA5 A;  9ICT A;  2M2V A;  4RWQ A;  4YD2 A;  2KN7 A;  5IIK A;  4F93 B;  4KLU A;  4NM2 A;  3UXO A;  2FMP A;  5KFP A;  1XSL A;  7ICR A;  4DFK A;  1UT8 A;  1LV5 A;  3KHL A;  1QSY A;  2ZHB A;  3Q8L A;  4RPX A;  9ICJ A;  3TFR A;  3BQT A;  3OSP A;  3H3A A;  4FS2 A;  3RJH A;  4UAZ A;  3RJK A;  5D49 A;  5DQI A;  5DB6 A;  1OU5 A;  4F4Z A;  5J2B A;  4DFM A;  2AGO A;  2O1P A;  3ISC A;  1SKS A;  4UB3 A;  3C66 A;  3RJI A;  3HJ4 A;  1ZQM A;  1QSL A;  5DBC A;  2ZH9 A;  4X4T A;  2ASD A;  3PX4 A;  3H7I A;  3OUY A;  5DDY A;  5J2C A;  4WBY A;  2ZUB A;  1ZQE A;  5KT7 A;  5DLF A;  5KFF A;  4K4H A;  1QLN A;  4C8N A;  4AT8 B;  2ISO A;  4XQ7 A;  1BPZ A;  3OV7 A;  4EBE A;  2W9C A;  2ATL A;  5IIN A;  9ICQ A;  5HRD A;  1PX5 A;  2UVW A;  1KFT A;  4ECV A;  2C22 A;  4FS1 A;  3PVX A;  1D8Y A;  4X4Q A;  5KFD A;  4YXM A;  5DB7 A;  4S3N A;  3JPR A;  2VA2 A;  3V6J A;  3PO4 A;  4NKT A;  3JPT A;  4QZ9 A;  3TAR A;  4TUP A;  1VFG A;  4P4M A;  4YMN A;  4X4V A;  4IRD A;  1XSN A;  5KFO A;  5KT3 A;  1ZQN A;  4O5K A;  4B9N A;  2ZTC A;  4DS5 A;  4M9N A;  3C5G A;  2NRZ A;  2AGQ A;  2ASJ A;  2ZJ5 A;  5F9L A;  4DSE A;  2GWS A;  3ZD9 A;  3MDA A;  5J0O A;  4DSI A;  8ICQ A;  5KFA A;  1KFD A;  1TVA A;  4O5C A;  2R8G A;  3V6K A;  8ICN A;  3AQN A;  2R8J A;  4KN7 A;  8ICZ A;  1Z00 A;  4IG8 A;  4NKU A;  2V4Q A;  3AU2 A;  1L3V A;  4X0A A;  2Y1J A;  1ZET A;  1ZQL A;  3JZ0 A;  4WC2 A;  3UXN A;  4YG2 A;  8ICM A;  5J0Y A;  2DR9 A;  4FH3 A;  3M9N B;  3EYZ A;  4YP3 A;  8ICW A;  4TUS A;  1MQ3 A;  2BCU A;  4BXO A;  4PPX A;  4QZC A;  2XGQ A;  4J9P A;  2XY6 A;  4M2Y A;  1BPY A;  5L1K A;  2ZH7 A;  3WFQ E;  4R66 A;  5J2K A;  3WFS C;  4GXI A;  5KG2 A;  1XS9 D;  4C8K A;  4AT7 B;  3V7L A;  1SKR A;  4YCX A;  1SL1 A;  1ZQG A;  2W8L A;  3ZDC A;  1IXR A;  4EBC A;  2AQ4 A;  4RQ7 A;  1Q78 A;  3EZ5 A;  3OUY B;  2ZH5 A;  1TAQ A;  2ZH4 A;  4LT6 A;  2ALZ A;  8ICX A;  4MFA A;  2F1H A;  5D46 A;  2V4R A;  2VA8 A;  4FHY A;  4DQP A;  4QZB A;  4P4O A;  1NO5 A;  4RQ8 A;  4GXK A;  3H4B A;  2BPG A;  2R8I A;  4I2A A;  4PGY A;  1NKB A;  3Q8R B;  2W9C B;  2XCP A;  4EEY A;  4KLG A;  4Z6E A;  3KTQ A;  5HRB A;  2KZ3 A;  5KFH A;  3PX0 A;  3GIJ A;  4F4Y A;  4RT3 A;  4DFP A;  4DL3 A;  4F3O A;  4KLM A;  8ICK A;  3PO5 A;  2JEG A;  4UQG A;  4DLG A;  9ICV A;  3B0X A;  4EBD A;  2BCQ A;  4B9M A;  4DSK A;  5CP2 A;  9ICP A;  4DQS A;  1ZQD A;  4F2R A;  4UB2 A;  5HRL A;  2R8K A;  2M9N A;  2ZH8 A;  4QWA A;  3JPP A;  3N97 B;  2C2E A;  5HHI A;  3PX6 A;  1MIY A;  4QZ8 A;  8ICA A;  4YN4 A;  4X5V A;  5CR0 A;  4J9Q A;  4KLQ A;  4EYH B;  9ICC A;  2PFQ A;  4I2G A;  2PFN A;  5KFU A;  3ETL A;  2PXI A;  4DL7 A;  2KZZ A;  1V4A A;  4E7X A;  5KTQ A;  1TAU A;  3SYZ A;  2DPI A;  4K4G A;  4F5R A;  2JZB B;  4R8U A;  4P2H A;  3M9M B;  3AQM A;  1QTM A;  2P66 A;  1L3U A;  2PI4 A;  3NGD A;  3MR6 A;  2HHT A;  2C28 A;  8ICT A;  3PML A;  3QEB Z;  1NK4 A;  4LVS A;  1NJZ A;  2XCA A;  4Q8E A;  2XGP A;  4XRH A;  5EWF A;  1ZQF A;  1JIH A;  1BGX T;  8ICI A;  3Q8Q B;  3NTU A;  2UVU A;  1ZQC A;  5KFZ A;  2BQR A;  2DR8 A;  5DB9 A;  1TK8 A;  1D9F A;  3H39 A;  3BQ0 A;  4RUA A;  1K1S A;  1SZP A;  1KSP A;  4TUR A;  5J0X A;  3HWT A;  4F5Q A;  3PMN A;  7ICQ A;  1YLQ A;  4PGX A;  1D8L A;  3RB6 A;  5KFY A;  5KG6 A;  4BWM A;  4QZI A;  4F4K A;  8ICE A;  9ICM A;  3GDX A;  1NK7 A;  2AQ0 A;  2F1J A;  2RDI A;  4DO9 A;  5JUM A;  1ZJM A;  1L3S A;  4WC5 A;  5DG8 A;  4I2C A;  2J6U A;  5KFB A;  9ICB A;  3GIM A;  5IIM A;  5DG7 A;  1C7Y A;  4FH5 A;  1VJ7 A;  4RQ6 A;  4WC7 A;  1NKE A;  5J0U A;  2BQ3 A;  4C8L A;  5DED A;  4MF2 A;  4DF8 A;  1JX4 A;  5HRE A;  8ICO A;  1XU4 A;  4DSF A;  3PW0 A;  1NJX A;  5CWR A;  3ZDB A;  3OHB A;  4KLH A;  5J0W A;  9ICN A;  4MEY A;  4B9S A;  4AT9 A;  2W9M A;  5BOL A;  5KFJ A;  1JXL A;  1U9L A;  2BHN A;  2DFL A;  2XC9 A;  5L1J A;  5J0T A;  3UQ2 A;  4O3R A;  4KN4 A;  4JUZ A;  4ED2 A;  2JEI A;  5KT2 A;  7ICN A;  1UET A;  9ICU A;  4DL2 A;  3H37 A;  5KFL A;  5KT4 A;  5KFN A;  3C2K A;  5HHH A;  4M6W A;  2HHX A;  5J2H A;  2NRT A;  3LWL A;  2HVH A;  2M2T A;  5HR9 A;  3Q8S B;  4DSL A;  1DGS A;  9ICE A;  2W9A A;  7ICG A;  4QZG A;  4QW9 A;  5J2D A;  1JN3 A;  3WFO A;  1IM4 A;  4EBJ A;  3SV3 A;  1MIV A;  2JEJ A;  4AT8 A;  1HJP A;  1B43 A;  1H38 A;  4B9T A;  1S77 D;  4Q8F A;  3HP6 A;  3LQC B;  4MFC A;  4RU9 A;  2BE3 A;  4GC7 A;  1HUZ A;  5KFW A;  1NOM A;  4ED6 A;  1RZT A;  1DK2 A;  5DBB A;  2DRA A;  1JXE A;  8ICV A;  7ICP A;  3ISD A;  3EPI A;  2PFO A;  9ICA A;  4ATB B;  4AT9 B;  4I27 A;  3HW8 A;  4DOC A;  1JMS A;  5EWE A;  5J29 A;  7ICT A;  1A76 A;  3H8J A;  5EOZ A;  4J9R A;  3PR5 B;  4KLD A;  4RUC A;  2P6U A;  4ECQ A;  3RH6 A;  3Q8P B;  3ZD8 A;  4WC6 A;  5J2I A;  9ICR A;  5J2E A;  3GV5 B;  3UXP A;  4Q44 A;  4DL6 A;  4QWE A;  5KFI A;  4X4U A;  4DSJ A;  3B0Y A;  2HVI A;  3OJS A;  5HRF A;  4QW8 A;  4F92 B;  4X0B A;  2VAN A;  3V72 A;  1WCL A;  4ELT A;  4Z6D A;  4UAW A;  4RQ0 A;  4F8R A;  1ZQY A;  4O9M A;  2BDP A;  1ZQW A;  4YFK A;  4ECU A;  8ICP A;  4QZE A;  7ICI A;  1ZQX A;  4UB5 A;  2V9W A;  3ZDD A;  5KFR A;  4WCW A;  2KFZ A;  1ZQO A;  3LK9 A;  1DK3 A;  3H8W A;  4Q45 A;  3KHG A;  4EZ6 A;  4FHW A;  4DF4 A;  1FA0 A;  4DQI A;  3ORY A;  2ZJ8 A;  4Q43 A;  1ZQK A;  4RQ5 A;  3RB0 A;  4FHP A;  5HRI A;  2ZJA A;  5DQH A;  1L5U A;  3RJG A;  1EXN A;  4DLE A;  1Z00 B;  2MAX A;  4PHA A;  2UVV A;  4RWO A;  1UEU A;  4YXJ A;  4YR3 A;  4F5O A;  3UPQ A;  1HUO A;  1CUK A;  3JPQ A;  4UD5 A;  4AT7 A;  4HYK A;  1ZQH A;  2M2W A;  3TAP A;  3G6Y A;  1SKW A;  1RYS A;  4UD4 A;  5III A;  4M5D A;  4IQW A;  1WCN A;  1XWL A;  4BXO B;  4MFF A;  2BPC A;  4M9G A;  1X2I A;  2KTQ A;  1UT5 A;  1BNO A;  2FPL A;  4DQQ A;  1NK5 A;  1NZP A;  1BPE A;  1SL0 A;  2AGP A;  4KIT B;  1F5A A;  5IIL A;  2ZH6 A;  4B9L A;  2HHP A;  5EWG A;  4ECR A;  1ZQI A;  3RR7 A;  2FPK A;  8ICH A;  9ICX A;  4M6W B;  1RXW A;  2FLN A;  4WC4 A;  3IHQ B;  2ZUC A;  4J9N A;  8ICU A;  3E2E A;  4O3P A;  5KFX A;  7ICO A;  3RBD A;  4I2H A;  3Q8M A;  2KZM A;  1CEZ A;  4IQV A;  5D4B A;  4KLJ A;  2HHS A;  4P4P A;  2A1J B;  3MAB A;  4TQS A;  3SI8 A;  4KLE A;  2RFF A;  2J6T A;  4XQ8 A;  3KHR A;  9ICS A;  1MIW A;  5KFM A;  7ICF A;  1UA0 A;  3G6V A;  1UA1 A;  5KG0 A;  7ICL A;  1JQR A;  4RPY A;  4Z6C A;  3OGU A;  3GII A;  4EYI B;  4PHD A;  3T5J A;  5KT5 A;  2BR0 A;  1TKD A;  1NK6 A;  1U47 A;  1T7P A;  2HHV A;  4ED7 A;  4GXJ A;  2ZTE A;  3H8S A;  3UPS A;  4DOB A;  4FBU A;  2I1Q A;  4ED8 A;  1S10 A;  3RJF A;  4UBC A;  4RZR A;  1DOQ A;  4RQ3 A;  1KFS A;  4IR1 A;  1N48 A;  5L1L A;  2J6S A;  2DR5 A;  5KFE A;  1D9D A;  4JWN A;  9ICW A;  3AQL A;  2I9G A;  4NXZ A;  4ATB A;  4DQR A;  1U45 A;  3LDA A;  3RB4 A;  3TI0 A;  1MQ2 A;  2LYH A;  5BOM A;  4QWD A;  2XY5 A;  4DL4 A;  5HRG A;  4DFJ A;  5IIO A;  4GC6 A;  2ID1 A;  3QZ7 A;  5HC9 A;  1ZQP A;  3SV4 A;  9ICH A;  5HML A;  2KP7 A;  3HJ1 A;  1R8B A;  1BVS A;  3EW9 A;  2BCS A;  4O3S A;  4X4S A;  1U49 A;  2BKE A;  4F50 A;  3HX0 A;  3RB3 A;  5J2G A;  3MGH A;  8ICS A;  3THV A;  4R65 A;  2Q66 A;  1R8A A;  4ZH4 A;  4QZF A;  2AU0 A;  4RNM A;  1T8E A;  4ECX A;  2ISP A;  2FPM A;  3RJE A;  4DWI A;  5DQG A;  4KTQ A;  3RRH A;  1X9S A;  1Z3E B;  1BNP A;  3OVA A;  4BWJ A;  5CA7 A;  5DDM A;  2HHU A;  1NK0 A;  5KFC A;  4B9U A;  4TUQ A;  3RTV A;  1R8C A;  2DVI A;  4ELV A;  3QEA Z;  3K4G A;  5C5J A;  8ICR A;  3WFP A;  3RBE A;  8ICF A;  3HIY A;  3BJY A;  1ZQQ A;  5CB1 A;  3GIK A;  3UQ0 A;  3PY8 A;  5DKW A;  5IIJ A;  3Q8K A;  7ICH A;  1NK8 A;  2ZH3 A;  4F2S A;  4M04 A;  4CCH A;  1ZQU A;  1ZQZ A;  5CJ7 A;  4YMM A;  3MR3 A;  4ED3 A;  4YR0 A;  5DLG A;  4FBT A;  5KFV A;  3OSN A;  4DS4 A;  4KLL A;  4K4I A;  3ZDA A;  4DOA A;  3MFH A;  1U4B A;  3V7K A;  1ZQS A;  4I2F A;  2IA6 A;  2MUT A;  1S97 A;  4TQR A;  4C8M A;  1K1Q A;  2DRB A;  4IQT A;  4O3N A;  3C2L A;  4F5N A;  2Y1I A;  3BQ1 A;  2BCR A;  4ED1 A;  1ARO P;  1ZQT A;  1KLN A;  4O5E A;  4DEZ A;  3H38 A;  5HRH A;  3FDS A;  4IR9 A;  2IMW P;  1BPB A;  9ICF A;  3SZ2 A;  3T5H A;  3TFS A;  3ZDE A;  4F5P A;  2IHN A;  3GFK B;  3MR5 A;  8ICJ A;  1TK0 A;  4YR2 A;  5L1I A;  2BGW A;  9ICK A;  1L3T A;  3NYB A;  1ZQA A;  4PHP A;  1Q79 A;  4J9O A;  3M9O B;  2NRV A;  5DB8 A;  3JYY A;  4LZG A;  4R63 A;  8ICC A;  3MGI A;  5J2A A;  1RPL A;  1XO1 A;  5HNK A;  2R8H A;  5DG9 A;  4J9K A;  2FMQ A;  4M9L A;  2DR7 A;  9ICO A;  2IBK A;  4IRC A;  3MBY A;  3PW5 A;  3JPO A;  4RPZ A;  1MC8 A;  5HP4 A;  5KFG A;  1PZN A;  4I2I A;  3HPO A;  3RJJ A;  1BPD A;  3C23 A;  4I2B A;  4RQ2 A;  4DL5 A;  1RYR A;  5DGA A;  1X9M A;  1KEJ A;  3MDC A;  3BDP A;  2PBE A;  3H4D A;  5KG1 A;  1JAJ A;  1QSS A;  5BPC A;  3JPN A;  1TFR A;  2ZH2 A;  3OHA A;  4FHX A;  4KLI A;  3OVS A;  5KT6 A;  3OVB A;  3RH4 A;  3PW7 A;  7ICM A;  5J0R A;  4I2J A;  3G6X A;  3PW4 A;  3BQ2 A;  3TQ1 A;  4RWN A;  2DPJ A;  1TK5 A;  2WTF A;  1RXV A;  4PH5 A;  3AU6 A;  2KFN A;  2JEF A;  4EP7 A;  5F2V O;  2ZUD A;  2M2U A;  2FMS A;  4KLF A;  3QE9 Y;  4QZA A;  1KDH A;  2NRX A;  2XY7 A;  1ZQR A;  2FLP A;  5HRK A;  2NRK A;  4UBB A;  4KMU A;  1V9P A;  2MUT B;  5HMM A;  4ED0 A;  4I2E A;  1ZQV A;  4O3Q A;  1XC9 A;  7ICU A;  4GLX A;  8ICY A;  4M9H A;  4QWC A;  9ICL A;  5DGB A;  3PW2 A;  3RH5 A;  5KG7 A;  1TV9 A;  4G3I A;  8ICL A;  3ISB A;  4IQU A;  1UEV A;  4WBZ A;  1TFW A;  2XO7 A;  3OJU A;  4J9S A;  3FYH A;  7ICE A;  3C5F A;  1COO A;  1SL2 A;  2ZHA A;  3C1Y A;  3EWA A;  3K75 D;  4YVZ A;  1NJY A;  2NRW A;  2PFP A;  2VA3 A;  4C8O A;  5KFQ A;  3PR4 A;  4PGQ A;  2HW3 A;  1T4G A;  4NLN A;  4RT2 A;  4RQ4 A;  4UAY A;  4X4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...