5DB9A

Structure of human dna polymerase beta host-guest complex with the n7mg base paired with a dg
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 108
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5db9A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5db9A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5db9A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5db9A03
1XSNA 3FYHA 5KFUA 4RNMA 5HMMA 5L1LA 5EOZA 4EBDA 9ICMA 1SKSA 4X4VA 4K4HA 4NY8A 4WBYA 5F9NA 2HHUA 4FHXA 4X4OA 4EEYA 8ICAA 5KFLA 1NK0A 9ICPA 3HIYA 2Q0ZX 5KG6A 4I28A 5KFTA 2M2VA 3AQNA 3G6XA 4O0IA 3PW0A 3MR5A 2ZUBA 5J2IA 1S0OA 2ZJAA 4F4WA 3QZ8A 3TANA 4YD2A 5KTQA 1V9PA 4I2AA 1YLQA 4BGDA 1UA0A 1HUOA 3H38A 1XSLA 3RJGA 1Z00A 1PX5A 4WBZA 5KFJA 3WFOA 4UAYA 4Q8EA 1TK5A 8ICGA 4F2RA 2HHQA 4KTQA 4C8OA 1Q78A 1ZQTA 3HWTA 3AU2A 3RR8A 3T5HA 8ICTA 2ZTDA 2J6UA 2ZH9A 1A76A 1T4GA 1TAQA 2H5XA 4Z6FA 2UVWA 2HHVA 2WTFA 4DL5A 4PHPA 3BJYA 5J0SA 1ZQFA 4IR9A 4KLLA 5J2HA 3EPGA 4J9QA 2W9BB 3PX6A 2V4QA 1KFTA 5HRDA 4RPZA 2DRBA 8ICFA 4J9KA 5HMLA 3GFKB 8ICRA 4TQSA 1RYSA 5F2VO 3Q8MA 5L1IA 3T5LA 3MDAA 2BQUA 1X9WA 4F8RA 8ICEA 9ICKA 5KT4A 4NKUA 3QZ7A 2NRVA 1NK8A 2W9CB 1UEUA 1JXLA 4YVZA 3EPIA 2IMWP 3ZDDA 3GV5B 4O5CA 4YFKA 4O3NA 3KHGA 2GWSA 1MIWA 2I1QA 2VA8A 2AQ0A 2BPCA 4DSLA 2ID1A 4YR3A 2M2TA 5IIIA 5EWEA 5KFYA 5D49A 1KLNA 3G6VA 8ICUA 3V6KA 5KG1A 3HPOA 1RXWA 2C22A 2FMPA 7ICFA 4NKTA 3OVSA 3RH6A 8ICOA 5DECA 3SYZA 1R8AA 5KFCA 2ZH7A 2DRAA 1JXEA 1NOMA 4I2IA 4FH3A 1NK9A 3Q8PB 4ECVA 3KHHA 3IHQB 8ICVA 4DS4A 3JPQA 1SL0A 1BNOA 1ZQJA 1ZQYA 9ICSA 4DL3A 2Y1JA 1ZQKA 4ECRA 8ICPA 2M2WA 1JAJA 3H37A 4XUSA 4KLFA 2RFFA 2NRXA 7ICEA 1QSSA 3L9DA 3PVXA 4B9UA 3EW9A 1SZPA 4TUSA 2FLLA 4I2EA 2XO7A 4QWCA 5KFVA 4IRKA 2DVIA 1DOQA 2W9BA 2XGPA 2NRTA 3MGIA 9ICNA 4IQTA 4M2YA 5HC9A 2I9GA 3V7KA 8ICJA 4F50A 2KZZA 4PHEA 4DSEA 2P66A 4UB2A 3PY8A 4DFMA 5DQHA 5CHGA 5J29A 4RT3A 4XA5A 1KRPA 2HHWA 2W9CA 3C5GA 2VA2A 5DB6A 4MF2A 3GV8B 4P2HA 2DR7A 3N97B 4QZEA 2FMSA 4E8FA 2AU0A 4JWMA 4ECTA 2PFNA 4BXOB 4ZH4A 4DL2A 3ZDCA 3ZDBA 1BNPA 1MC8A 1AROP 1NK4A 3OJUA 3BQ2A 2BCVA 4M9JA 1RPLA 1VJ7A 4RQ4A 4UAZA 2BCRA 4R66A 2BCUA 4YXJA 1NK5A 2PFQA 3Q8QB 2AQ4A 1SKRA 5J0QA 9ICBA 8ICHA 9ICQA 5J2BA 4I2HA 3LK9A 1ZQZA 3HT3A 4F2SA 2HHTA 3PW5A 2DPJA 5KFZA 4F5QA 5J2DA 8ICCA 1S9FA 4O3OA 3OUYB 4RNOA 4KLHA 7ICIA 5J2FA 1TAUA 8ICQA 4DF4A 4FHWA 4M5DA 4DS5A 3RJEA 4KLTA 4WC0A 5J0PA 3OSNA 4RU9A 2UVVA 4RNNA 4UAWA 4TURA 4B9VA 4O3SA 2HHPA 4ATBB 4RT2A 3C2MA 1NKCA 2BR0A 2HW3A 4RQ0A 2ASDA 5J2GA 3E2EA 3HX0A 4ECYA 5J0YA 4WC2A 5JUMA 4KLMA 5CJ7A 4F4ZA 3KTQA 4KLOA 4DSFA 5EWGA 3PW4A 1NJXA 4CCHA 3BQ1A 2C2EA 2BKEA 4LVSA 1ZQLA 5HRFA 3Q8SB 5IIKA 4RZRA 1S97A 5KFSA 3GDXA 3RBDA 4S3NA 1CUKA 2XGQA 1ZQCA 4KLDA 3RJHA 1S76D 4BXOA 4BWJA 3K4GA 5EWFA 3MR2A 4KN4A 5KT3A 5IIOA 5BOLA 3MDCA 3MFIA 5L1JA 8ICKA 3WFSC 3MGHA 2R8IA 3UPSA 2Q66A 5J2JA 4DLEA 1IM4A 2JZBB 1MQ2A 3AU6A 1KFSA 5HHIA 4UQGA 4JV0A 3ETLA 3LQCB 5HRKA 1FA0A 5C5JA 4YCXA 5KFPA 4J9PA 4ELUA 3PO4A 3OSPA 2C2RA 2MUTB 1KEJA 7ICKA 1NJWA 2R8GA 3SV4A 5CA7A 3OUYA 3M9NB 4PGYA 1Z3EB 5DG9A 1D8YA 2M2UA 1XU4A 3AQKA 4ELVA 4FO6A 1N48A 2MAXA 2ISPA 2XCAA 8ICWA 4YQWA 4ATBA 3WFRE 3HW8A 2FLPA 2UVUA 4QWAA 1BGXT 3PX0A 3KHRA 2ZH8A 2BHNA 9ICAA 4FS1A 4ECUA 2BCQA 4M04A 4X4QA 5J0WA 2R8KA 4NM2A 2PFPA 4NLNA 9ICLA 1U45A 3Q8RB 4EBKA 4WC3A 7ICUA 4XRHA 4I29A 2NRZA 1XC9A 4FHYA 3RB4A 5KFHA 3AQLA 3TFRA 9ICHA 4O5EA 3HJ4A 3OVBA 4QZHA 3QEBZ 5KFFA 4M9LA 4MEYA 4Q44A 4GC7A 2ZUDA 3ISBA 3PV8A 7ICJA 1KDHA 3G6YA 4FHVA 3TARA 5DB7A 3SV3A 4X4SA 2P6RA 5KG5A 2W9MA 4EP7A 4GLXA 2BDPA 2HHXA 2LYHA 1S0MA 2UVRA 4F5RA 2FPMA 5KFXA 1H38A 8ICZA 4Q8FA 1Q79A 2JZBA 1UEVA 4YG2A 4KLIA 4EYHB 2F1HA 5KT2A 2NRWA 4YN4A 4QZBA 4J9SA 4QWDA 1X2IA 3ZDEA 2J6TA 3M9MB 3RR7A 1TFWA 1U9LA 2C28A 1U48A 3EYZA 1QSYA 2MUTA 2PI4A 3LWMA 4EBEA 4RWOA 3MR3A 2FPLA 4RPYA 2JEIA 3ORYA 5DLGA 4QZDA 2Y1IA 4I2JA 4KITB 1B43A 5HHHA 4UB1A 1TK8A 1L5UA 2PI5A 5TZVA 3JPOA 1UT5A 4ED7A 3V6JA 2BGWA 4YXMA 4ED8A 4B9SA 4I2FA 4DLGA 5CWRA 1TVAA 3RAQA 2ALZA 4F91B 8ICIA 5J2EA 3JPPA 5KFQA 4IQUA 3UXPA 3PMNA 4J9OA 4IG8A 1RZTA 2DPIA 5DKWA 3SI8A 4MFCA 4E7XA 4RUCA 9ICVA 1B22A 3BQ0A 4FH5A 3JYYA 4UB4A 1SKWA 1N56A 3TAPA 4KMUA 5KFGA 1RYRA 4B9LA 4R65A 2C2DA 9ICEA 4IRDA 4J9LA 3HJ1A 5DBBA 5KG0A 2W9AA 4P4MA 1BPDA 2XCPA 1ZJNA 1U49A 1XS9D 1T7PA 4F93B 5J0UA 2ZHAA 4Z6DA 1VFGA 2ZTCA 1BPYA 1S10A 4HYKA 4P4OA 1ZQRA 7ICQA 4DQPA 2AGQA 3TQ1A 2ZH4A 4RQ8A 1T8EA 4EZ9A 3H40A 8ICXA 4TUQA 3ZD9A 3B0YA 4DL6A 2XY7A 2PFOA 8ICBA 3OJSA 4ED2A 4KLEA 7ICRA 1ZQHA 8ICNA 2J6SA 5DB8A 2KN7A 2A1JB 4EYIB 9ICXA 1F5AA 4LZGA 4P4PA 2ZH3A 3PR5B 2M9NA 9ICWA 2AGPA 4QZ9A 1KTQA 4UD5A 2ZH1A 3M8SA 3JPSA 7ICGA 1C7YA 3RJIA 3JZ0A 3Q8LA 4NLGA 2DR8A 5HRBA 5KFOA 4I2GA 4YMNA 5KT6A 2JEGA 4DSIA 4O9MA 3TFSA 4O3PA 1UETA 4O3RA 3THVA 2FMQA 1ZQSA 8ICLA 5DEDA 7ICHA 2FPKA 5HRIA 1D8LA 2F1JA 1DK2A 1ZQVA 4LZDA 4J9RA 4X5VA 3UQ0A 4GXIA 4ECSA 4ED6A 5HRGA 4YR0A 2DR9A 4TUPA 2F1IA 4BWMA 1D9DA 5BOMA 4AT9B 4I2DA 2BE3A 3PNCA 5IINA 5KFWA 1NJZA 1A77A 5DLFA 4C8LA 3NTUA 4DQIA 1ZQNA 2ZJ8A 4GXJA 2KZMA 3JPRA 4RQ5A 4GC6A 3T3FA 3UXOA 5J2CA 2BQRA 3RTVA 2ATLA 1UA1A 1L3SA 4QZ8A 1ZQIA 3EWAA 4DFJA 5DG7A 3PW7A 5HRHA 1NK6A 1UT8A 4ELTA 1SL2A 1JIHA 1L3TA 4E0DA 3N4MB 5L1KA 2RDIA 3NGDA 4F3OA 1JX4A 4NLKA 2W8KA 1KFDA 1OU5A 4C8NA 5HRLA 4YD1A 3GILA 7ICOA 3MABA 2XY5A 1SL1A 1MQ3A 3H8JA 4B9MA 4NLZA 9ICFA 5J2KA 2A1JA 3ZDAA 3OVAA 5KFEA 1ZQOA 4IRCA 4X4PA 2ZTEA 4KN7A 1RXVA 5KFKA 5J0TA 4KLSA 4EBJA 3MBYA 4MEXA 2R8HA 5BPCA 1COOA 3T5JA 3RB3A 3RJJA 4X0AA 1ZQEA 2BQ3A 1QTMA 1K1QA 4RWQA 2ZH6A 1JMSA 4YR2A 4PHDA 7ICPA 4F92B 4F4XA 3H4BA 4UBBA 4DL7A 4RQ6A 9ICUA 9ICRA 2O1PA 4LT6A 4R64A 1T3NA 4FBTA 1KNYA 3PR4A 4Q45A 1WOTA 3V6HA 3C21A 3NYBA 5J0OA 4YP3A 3RB0A 4F5PA 4K4IA 1U4BA 3OHBA 1MSWD 1Y88A 4RUAA 5J0RA 2V4RA 3H4DA 1NKBA 3C18A 5HP4A 9ICJA 4AT9A 3V7LA 1JQRA 3MR6A 1BPZA 1X9MA 5KG7A 4JWNA 5DDMA 4DOAA 3QE9Y 2VANA 3GIKA 3QEAZ 2KTQA 3IM1A 3JPNA 4Z6EA 3C66A 1KSPA 2IBKA 1L3VA 4O5KA 4DL4A 7ICMA 2W8LA 3HP6A 4EZ6A 3T5KA 1ZQBA 2KP7A 1ZQXA 1BPEA 3C1ZA 3RRGA 4B9NA 3EZ5A 4M0AA 1S0VA 2XC9A 2HHSA 4F5OA 2VA3A 2PBEA 3PO5A 3H39A 4WC1A 1XO1A 4X4RA 7ICTA 4GXKA 4ED0A 9ICCA 2BCSA 4X4NA 5DGAA 3M9OB 1ZQPA 1ZQUA 5KG4A 4MFFA 4PGXA 2IA6A 4XQ7A 4WC5A 4R63A 3C5FA 1TKDA 1MIYA 3H7IA 3UPQA 5CB1A 4RPXA 4EBCA 3GIJA 5L9XA 3TI0A 4KLJA 5DQGA 8ICYA 4RWPA 1WCNA 3C2LA 4F4YA 3RRHA 4DF8A 4TQRA 1S77D 4C8MA 3ISDA 1ZQWA 4IR1A 3V7JA 5DQIA 4QW8A 1DK3A 3RH5A 1EXNA 4O3QA 5IIJA 5KT5A 4ECQA 4JV1A 4ED3A 4RQ1A 5KT7A 3JPTA 2BPFA 4NXZA 4NM1A 3H3AA 4WC6A 4X4TA 5DG8A 2FLNA 3K75D 2V9WA 1ZQGA 7ICSA 2R8JA 4M47A 4F4KA 1HJPA 1XSPA 1CEZA 4Z6CA 3MFHA 1L3UA 3OHAA 3LWLA 3Q8KA 3RB6A 5D4BA 4YMOA 4BDPA 1ZQQA 3FDSA 4ECZA 7ICNA 8ICSA 2AGOA 3ISCA 2XY6A 4AT7B 4AT8B 3H8SA 4RQ7A 3B0XA 1NZPA 4M6WB 4DSKA 3PX4A 9ICGA 4DEZA 2KZ3A 3RJFA 5F9LA 7ICVA 4FS2A 3H8WA 2IHMA 4JUZA 5KG3A 1R89A 5IIMA 1ZJMA 4QWBA 4JV2A 3UXNA 4E80A 3OV7A 4WC4A 4ECWA 4C8KA 2ZUCA 5DBAA 3ZD8A 1D9FA 3PMLA 5KFMA 5KFNA 1NKEA 4DQRA 2KFZA 4IQVA 1R8CA 2ASLA 4G3IA 2JEFA 4J9NA 5DDYA 4DFPA 2IHNA 2DFLA 3WFQE 4ECXA 5DGBA 1ZQAA 2KFNA 1PZNA 3RJKA 4I2BA 2DR5A 5KFDA 2RDJA 1XWLA 2OWOA 1U47A 1HUZA 4QZGA 3BQTA 4DO9A 5KFBA 3UQ2A 2ZHBA 4RQ2A 1DGSA 4PHAA 9ICIA 2ASJA 9ICOA 4R8UB 1LV5A 5KFIA 4M9NA 3AUOA 1IXRA 3KHLA 1ZYQA 4YMMA 1QLNA 3OGUA 4J9MA 1TFRA 1BPBA 5CR0A 4JK1A 3BDPA 9ICTA 4MFAA 4DOBA 4QZIA 2P6UA 4PPXA 8ICMA 4Q43A 4MF8A 1NO5A 7ICLA 3GIIA 4QWEA 5J2AA 1NK7A 4UBCA 5J0XA 5DB9A 4WC7A 5KFAA 1NJYA 1ZETA 4DSJA 2HVIA 2HVHA 4X0BA 2ZH2A 4M9HA 1V4AA 4AT7A 3SZ2A 4RQ3A 3AQMA 4AT8A 4IQWA 3GIMA 2AJQA 4M6WA 4DQQA 4DOCA 4FHPA 3WFPA 4KLGA 1JN3A 4F5NA 5HNKA 4QZAA 3GV7B 4DFKA 1MIVA 4ED1A 4RWNA 2ZJ5A 3C2KA 4DWIA 2ISOA 3RBEA 1R8BA 1WCLA 5CP2A 1ZQMA 1QSLA 2JEJA 5IILA 1Z00B 4I27A 5HREA 4XQ8A 3RAXA 4B9TA 4K4GA 2BPGA 4QW9A 3C1YA 3M8RA 4PH5A 4PGQA 2PXIA 3RH4A 4FBUA 4M9GA 4QZFA 1LB2B 1K1SA 1BPXA 4DQSA 3C23A 3TAQA 5DBCA 3PW2A 1BVSA 5HR9A 2B21A 4UB5A 4KLUA 3LDAA 4I2CA 2ZH5A 4WCWA 1TV9A 1TK0A 4UB3A 2O5AA 5KG2A 3V72A 2NRKA 4X4UA 5D46A 4UD4A 4R8UA 4QZCA 1TFYA 1X9SA 5KFRA 4KLQA 1ZQDA 1S0NA 3GQCA
chains in the Genus database with same CATH superfamily
1XSNA 1QCKA 5KFUA 2H3FA 2HBKA 5EOZA 4K4HA 5F3XB 5F9NA 4FHXA 2EH9A 2ZIXA 5KFLA 1NK0A 3HIYA 4KMOB 2QARB 2M2VA 3IDWA 4QNLA 3AQNA 3RFAA 3MR5A 5JTIA 3N7PD 4YD2A 3QUCA 4BGDA 1UA0A 1HUOA 4F71A 1XSLA 4FZNA 3WFOA 1DXSA 3IRUA 2OH2A 4F2RA 2HHQA 1OW5A 3NS1A 2J6UA 2DRBA 1A76A 4DCCA 2WTFA 4PHPA 3BJYA 2K4IA 3PX6A 2V4QA 2KIWA 1RYSA 3Q8MA 4O69A 3VCBA 1ZOLA 8ICEA 3H0LB 9ICKA 3ER9B 1JXLA 4Y2RA 2ESEA 2IMWP 1UCVA 4YFKA 2K8AA 3AQFA 3KHGA 2GWSA 1MIWA 2VA8A 4DSLA 2ID1A 3N28A 2M2TA 2OCEA 5EWEA 5KFYA 5D49A 3OWGA 5KG1A 1JALA 1RXWA 7ICFA 3HRDD 2KSOB 4FH3A 4ICAA 4DS4A 2M2WA 9ICSA 4ECRA 1V97A 2NRXA 3SQIA 2W3RA 7ICEA 3PVXA 2QLTA 3N7SC 4I2EA 2KG5A 2DVIA 3SAFA 5A0LA 2XGPA 8ICJA 4B6JA 4DSEA 2LPEA 1RYUA 3RF9A 5CHGA 4XA5A 3WK8A 3C5GA 4MF2A 3N97B 3LYSA 2AU0A 4JWMA 2PFNA 4ZH4A 5CEHA 4DL2A 1MC8A 3BQ2A 1NK5A 2W7OA 2CXYA 2AQ4A 1SKRA 2K4EA 9ICBA 4F2SA 2DPJA 2G07A 2ZH2A 1AQ6A 1ZD4A 2XICA 4KLHA 5J2FA 4M5DA 3RJEA 4KLTA 3KOOA 4TURA 4O3SA 4ATBB 2W55A 3C2MA 1KW4A 2BR0A 3QU7A 5J2GA 4Y2SA 4WC2A 4OAFA 4F4ZA 2B6GA 4DSFA 2LBOA 5EWGA 5ALSA 3PW4A 2WF6A 2BKEA 3LVVA 4LVSA 1ZQLA 5HRFA 4RZRA 5KFSA 3GDXA 2XGQA 4Y2XA 1LKYA 1ZQCA 5AKZA 4BXOA 5T14A 5EWFA 3K4GA 4XJEA 2Y0SC 2R8IA 5J2JA 2JZBB 3AU6A 5ALOA 1FA0A 3OPXA 4ELUA 1KEJA 7ICKA 1NJWA 3OUYA 2MU2A 5DG9A 4P0PA 4NXWA 1XU4A 1TE2A 1PVRA 4ELVA 1N48A 2ISPA 1SGGA 3WFRE 3HW8A 3PX0A 3KHRA 2ZH8A 9ICAA 2E3TA 2WB1C 4ECUA 1GO3F 1U45A 4XRHA 4FHYA 2OM6A 3TFRA 9ICHA 5HR7A 4NXVA 3JCFA 4QZHA 2LKYA 4LEZA 3G6YA 4FE3A 1ZD5A 3NUQA 4CF5A 2LYHA 4F5RA 4KLIA 3BS7A 4QZBA 2W43A 1UPHA 2K60A 3F2BA 2PI4A 4RWOA 5ALJA 3MR3A 2JEIA 4UB1A 1L5UA 5TZVA 2BDUA 4UB8U 1RQLA 4DLGA 1SXDA 5AK5A 3RAQA 2HSZA 2RRDA 5KFQA 4IQUA 4CDGA 3PMNA 1RZTA 2JRZA 1B22A 1C20A 4FH5A 1MN8A 3JYYA 4UB4A 3TAPA 4KMUA 4B9LA 1FO4A 2XCPA 1T7PA 1BPYA 5CFTA 2LM4A 2R18A 5AK3A 3TQ1A 3H40A 3B0YA 2ZXHA 8ICBA 1ZQHA 8ICNA 1F5AA 9ICXA 5ALVA 3PR5B 2EQYA 2Y0SF 5J8YA 5ALDA 5AI4A 3THVA 1ZQSA 2G0AA 5HRIA 2F1JA 4LZDA 3WK9A 4ECSA 4KM5A 3AM9A 1OXJA 2F1IA 4JB3A 2F76X 5ALPA 1D9DA 5BOMA 2W54A 1WYGA 5AKGA 4NL9A 1NJZA 4C8LA 5ALLA 2L5YA 2KZMA 1L3SA 3RTVA 1HIWA 5DG7A 2WB1F 5L1KA 1JX4A 4NLKA 4NLZA 1B0XA 3OVAA 5KFEA 1ZQOA 4IRCA 1RXVA 4MEXA 1FFUA 2ZH6A 2BQ3A 4F92B 4LT6A 4R64A 3PR4A 4IS7A 3C21A 3NYBA 3V7LA 1JQRA 1X9MA 1VJ5A 3JPNA 4Z6EA 2HCFA 2W8LA 4NWIA 1BPEA 4F5OA 3PO5A 3H39A 4ED0A 4RQMA 5DGAA 4MFFA 4PGXA 2IA6A 4WC5A 1TKDA 3H7IA 3UPQA 4NLBA 4RPXA 4EBCA 3GIJA 3GU3A 1SV0A 2ZG6A 4C8MA 5JU5A 4JV1A 3H3AA 2DF4B 5AM1A 2HN2A 2V9WA 7ICSA 4F4KA 2KJ9A 4MKPA 3RB6A 1ZQQA 3FDSA 2AGOA 4RQ7A 1Q8KA 4M6WB 2HN1A 5C0YA 2YMPA 2BBJA 9ICGA 2KZ3A 2LYBA 3RJFA 5F9LA 1V85A 5KG3A 3QUBA 3UXNA 4E80A 4WC4A 4OJ5A 3PMLA 4G3IA 5DGBA 1WWUA 4PJ0U 2KFNA 1PZNA 3RJKA 2DR5A 5KFDA 1XWLA 1U47A 2EWRA 3BQTA 3ICXA 5JTGA 2ASJA 4YMMA 3OGUA 4J9MA 1TFRA 3IP4B 1ED1A 2HMXA 4MFAA 4MF8A 4I0UA 2WHEA 3GIIA 4QWEA 5J2AA 1QQ7A 3ETRA 5J0XA 5FP0A 1NK7A 1V4AA 4AT7A 4IQWA 2ZIXB 1JN3A 5HNKA 4DFKA 4RWNA 4BX9C 3C2KA 2FJ6A 2VKQA 1ZRNA 3RBEA 1QSLA 2JEJA 3NWIA 4M9GA 4PGQA 4QZFA 1LB2B 3TKAA 4KB6A 3SR6A 5ALIA 1Q46A 4WH5A 3I76A 2LI6A 4KLUA 4I2CA 5D46A 3J81j 1ZQDA 1S0NA 2RLTA 3WKDA 3FYHA 4RNMA 5L1LA 1Z4OA 1J2NA 3AN1A 2HHUA 2AHOB 5KG6A 4I28A 4O0IA 3KFUF 1S0OA 2ZJAA 4CNQA 3QZ8A 1V9PA 1YLQA 3F5AA 4Q8EA 2DKZA 1XNSA 8ICGA 4KTQA 5KL1B 3AU2A 8ICTA 3BZCA 4CE6A 2UVWA 1TAQA 2KJ5A 5J0SA 2ZIWA 1ZQFA 4KLLA 3EPGA 2JHDA 4RPZA 8ICFA 4J9KA 2IOHA 5F2VO 4F8RA 2BQUA 2YB1A 3K1ZA 3QZ7A 4C0ZA 3ZDDA 4EGWA 3PZPA 4O3NA 5L1MA 3L5KA 3SENA 2LYAA 5IIIA 3V6KA 3HPOA 4NKTA 3SAGA 3SYZA 3PSFA 5KFCA 2ZH7A 4Y2JA 3JPQA 5EE0A 2KVCA 1ZQJA 2Y1JA 8ICPA 1QSSA 3L9DA 3EW9A 4TUSA 2XO7A 2W9BA 4JLXA 2NRTA 4IQTA 5HC9A 3MGVA 2E8MA 4F50A 2P66A 4UB2A 5DQHA 1Z4NA 1KRPA 4P2HA 2VA2A 5DB6A 2DR7A 1LKYB 2D6FC 4QZEA 2FMSA 4ECTA 4BXOB 3AQEA 3ZDBA 3WKAA 1AROP 2KHVA 2BCVA 2BCRA 4R66A 2IOFA 5AI6A 4USAA 4F5QA 5J2DA 8ICCA 3OUYB 2G08A 1NI3A 5AKXA 3EF2A 4DF4A 4UAWA 4B9VA 2HHPA 4RT2A 2HW3A 4RQ0A 3HX0A 4ECYA 4U7CA 3C28A 4CRXA 4KLMA 4KLOA 4WOYA 2O6KA 3BQ1A 2EZXA 4AYBF 2E8OA 2W03A 3KBBA 5IIKA 3Q8SB 1S97A 3RBDA 2NV3A 3D2NA 3RJHA 4BWJA 9ICPA 4KN4A 5IIOA 5BOLA 3MFIA 8ICKA 3MGHA 5CFSA 4ZOHC 1MQ2A 1KFSA 5C5JA 2W7PA 3KD3A 3PO4A 4OAGA 3SD7A 5CA7A 3M9NB 4PZOA 5ALMA 1Z3EB 2G5IB 4FO6A 2MAXA 3DDHA 4YQWA 2UVUA 3IG8A 3M1YA 4FS1A 4X4QA 4NM2A 2E8PA 3Q8RB 1YT3A 2NRZA 3RB4A 3PHZA 5K4LA 2Q4TA 4M9LA 2KEYA 4NXTA 3PV8A 7ICJA 4NLCA 3TARA 5DB7A 4FHVA 2AXTU 1ECWA 2H3ZA 2BDPA 4OJOA 8ICZA 2WAQC 2FPMA 5KFXA 1H38A 1Q79A 2NO4A 4EYHB 2F1HA 4YN4A 3ZDEA 2J6TA 3RR7A 1U9LA 1U48A 1QSYA 2FPLA 3ORYA 1IV8A 4QZDA 2KKVA 2PI5A 5AKYA 3ERCC 3V6JA 4I2FA 1WWVA 1TVAA 5CFUA 2ALZA 2AH5A 3MC1A 3JPPA 3IV6A 4K9BA 2DPIA 5DKWA 3SI8A 3BQ0A 1SKWA 1N5WA 5KFGA 1RYRA 9ICEA 5DBBA 2HBMA 1XS9D 4UAVA 1S10A 4DQPA 3O0FA 8ICXA 3WK5A 2KNJA 2PFOA 4KLEA 2J6SA 2KN7A 5CRXA 4EYIB 2ZH3A 4A8EA 2KKPA 5ALRA 3M8SA 1C7YA 3Q8LA 5KFOA 4I2GA 3TFSA 1UETA 1JUDA 2CN1A 4O3RA 2H3VA 2FMQA 8ICLA 7ICHA 1D8LA 4Y2YA 2PMZC 1DK2A 2NYVA 4X5VA 4IC9A 5HRGA 4YR0A 4BWMA 1UQVA 2YTUA 4JLZA 3T3FA 5J2CA 2BQRA 4DFJA 3PW7A 1JIHA 1L3TA 4QIWC 2W8KA 4YD1A 3GILA 2Y9TA 3DV9A 1SL1A 1MQ3A 2A1JA 1DRGA 4X4PA 5BPCA 3RB3A 4X0AA 2OXOA 3WU2U 1JMSA 2WAQF 3H4BA 3UM9A 1SV0C 1L7MA 5J0OA 4PZNA 4EEDA 2KIVA 3L4PA 4F5PA 1U4BA 4K4IA 1Y88A 5B66U 4RUAA 2V4RA 1NKBA 1ZRMA 2ZIVA 2YX8A 4AT9A 3MR6A 5DDMA 3QE9Y 1JROA 2ZXIA 1KSPA 4DL4A 4EZ6A 3T5KA 4EELA 1ZQBA 1ZQXA 4B9NA 2HHSA 2WF9A 2KOBA 1KBUA 4GXKA 3PSIA 1F5SA 2BCSA 1ZQPA 1ZQUA 4R63A 3C5FA 4CF4A 1SWWA 4KLJA 1SIJA 8ICYA 1T94A 2DGZA 1WCNA 3C2LA 5ALZA 1YZ7A 1S77D 3ISDA 3NVVA 4QW8A 3RH5A 4O3QA 4WC6A 4ED3A 4RQ1A 5DG8A 5ALEA 1ZQGA 4OD0A 2F2AB 5KAIU 1XSPA 3D2SA 3MFHA 1L3UA 3OHAA 4BDPA 4K4GA 5D4BA 8ICSA 4AT7B 3ISCA 2XY6A 2QARA 3B0XA 3E0FA 2B0CA 4Y2VA 2JMGA 4DEZA 2ZIUA 7ICVA 4FS2A 4JUZA 2PMZF 1ZJMA 1L8LA 4C8KA 1D9FA 5KFMA 5KFNA 1NKEA 5ALKA 5GTHU 4IQVA 2ASLA 4J9NA 4DFPA 3WFQE 1ZQAA 2D3DA 2W3SA 3WKBA 2JGAA 3IG5A 4MHVA 5KNIA 4DO9A 1L7NA 2I6XA 2B51A 1LV5A 5KFIA 4M9NA 3AUOA 3KHLA 4QIWF 1QLNA 1BPBA 4FFDA 9ICTA 4PPXA 1NO5A 7ICLA 5EE3A 4C4SA 3NASA 4WC7A 3QU2A 5DB9A 3PSTA 3D2QA 1NJYA 3NVWA 4DSJA 2HVHA 2HBJA 4G9BA 3AQMA 4DQQA 5H2FU 2QB0A 4DWIA 4NXUA 4XQ8A 3C1YA 3M8RA 4PH5A 3FAHA 1COKA 2GO7A 2EAPA 5DBCA 1NZBA 4UB5A 2ZIWB 4WCWA 2O5AA 2NRKA 4X4UA 1TFYA 3KKAC 5D63A 4KLQA 2M0NA 2A1AA 1PK1A 2GOLA 3A0HU 2F8LA 4X4VA 4GIBA 4EBDA 2Z7JA 4WBYA 4X4OA 4EEYA 2W04A 2BBHA 2WF5A 2Q0ZX 4Y2QA 5KFTA 3HJEA 3G6XA 3PW0A 5J2IA 1Q3VA 4EV6A 4F4WA 1N2XA 5KTQA 1X6IA 3UMCA 3RJGA 1PX5A 1Z00A 2GA9D 4O6AA 4UAYA 1TK5A 2DL0A 4C8OA 1ZQTA 5AKKA 3RR8A 4Z6FA 1FEZA 1SXEA 2LM1A 5HRDA 5J2HA 4J9QA 2W9BB 3GFKB 3T5LA 5KT4A 4OO1J 4NKUA 4US9A 1SV4A 1L7OA 2NRVA 1NK8A 1UEUA 4YVZA 3EPIA 4O5CA 3GV5B 3M7DA 4LEYA 2AQ0A 2HDOA 4YR3A 2WF8A 2YY6A 1KLNA 8ICUA 2FMPA 3OVSA 3RH6A 1PUZA 1NOMA 1NK9A 5ALTA 8ICVA 1BNOA 5AI8A 1ZQYA 2ODGA 4DL3A 1ZQKA 1JAJA 5D62A 2NO5A 3H37A 4KLFA 1L7PA 2FLLA 4QWCA 4IRKA 9ICNA 4M2YA 4EEBA 1RDFA 3V7KA 2I9GA 4DFMA 2H3QA 1L6NA 1RG6A 4OJPA 1J2MA 4RT3A 2W9CA 3I28A 3GV8B 5ALNA 4K96A 3LVWA 4EEKA 4EENA 4OAHA 1NK4A 1RPLA 1B4FA 4UAZA 4N7RA 4YXJA 2PFQA 4P0QA 4I2HA 1ZQZA 2HHTA 2E1EA 2KV2A 4O3OA 1TAUA 8ICQA 2DKXA 4FHWA 4DS5A 5J0PA 3SEIA 3WKEA 2YQEA 2KMDA 4RU9A 4PL1A 4RNNA 2UVVA 1NKCA 2ASDA 3E2EA 2HI0A 2RHFA 5CJ7A 3KTQA 1NJXA 2QB1A 4S3NA 1CUKA 1GPJA 4UATA 4OAIZ 2EANA 4KLDA 5L1JA 4GFJA 5KT3A 1PVQA 3UPSA 2Q66A 3H0RB 4FZLA 1IM4A 5HHIA 1QQ5A 1ZXIA 3IN5A 5HR6A 4UB6U 3ETLA 4NJ8A 3LQCB 2F44A 4YCXA 5KFPA 3SV4A 4PGYA 5E79U 4FO1A 2M2UA 4AYBC 2XCAA 8ICWA 2KD1A 2WF7A 2FLPA 5AM3A 4QWAA 1ZD3A 1X66A 3NVOA 5AI5A 2BCQA 2R8KA 4NLNA 4WC3A 4EBKA 7ICUA 1XC9A 2KE7A 2EAOA 5KFHA 4HAIA 2KHQA 3HJ4A 3OVBA 3BQ7A 5KFFA 4MEYA 4GC7A 2ZUDA 3ISBA 2XVTA 4C4TA 4EP7A 4GLXA 4C7ZA 1S0MA 2UVRA 4Q8FA 2MRLA 5TISU 5AI0A 5KT2A 2NRWA 3L3FX 4J9SA 1X2IA 1TFWA 3EYZA 2MUTA 4LJXA 4EBEA 5AHXA 8ICMA 1N60A 4I2JA 4KITB 3QNMA 3JPOA 4ED8A 4IL6U 1SWVA 3FC4A 4F91B 8ICIA 3UXPA 5J2EA 4J9OA 4IG8A 1CI4A 1N63A 4K9AA 9ICVA 1QH9A 3GZFA 4F72A 1SZHA 2C2DA 2EDUA 5KG0A 4P4MA 1ZJNA 1U49A 4F93B 2ZHAA 4HYKA 4P4OA 1IIPA 2ZH4A 4RQ8A 1T8EA 4TUQA 4DL6A 7ICRA 2A1JB 2MSNA 2D8CA 2M9NA 5AIBA 2AGPA 4QZ9A 1KTQA 4UD5A 2ZH1A 3JPSA 3JZ0A 2DR8A 4O3MA 1ZD2P 4DSIA 4O9MA 4P0PB 5DEDA 4OJLA 4GXIA 3H8MA 4TUPA 2A19A 2K4PA 1RM6C 4AT9B 4I2DA 5AM2A 4U6PA 1XO0A 5KFWA 5AKEA 1A77A 5DLFA 4DQIA 3NTUA 1ZQNA 2ZJ8A 4GXJA 1L8OA 3CYMA 3JPRA 1X40A 1ZQIA 1VDVA 3N7RC 1UT8A 3TADA 1SL2A 2RDIA 3NGDA 2YMLA 2CRXA 3UMGA 1KFDA 2EZZA 7ICOA 4EX7A 3MABA 2IOFK 9ICFA 3ZDAA 4K97A 3NRZA 5KFKA 5J0TA 3MBYA 1URJA 2QKQA 2R8HA 1COOA 3RJJA 2JH1A 1QTMA 4NXXA 1QQ6A 4PHDA 4RQ6A 9ICUA 9ICRA 1T3NA 4Q45A 3V6HA 4RQNA 3HILA 5AM5A 4BJQA 1MSWD 3H4DA 3C18A 3QYPA 1M6YA 5HP4A 9ICJA 4DOAA 4CGZA 3C66A 2EAMA 2ZIUB 5ALHA 3HP6A 2DBYA 4O67A 5ALYA 1WUDA 3RRGA 3WK6A 1S0VA 2PBEA 3BS5A 4WC1A 1XO1A 3F5EA 2YN4A 1N62A 3DEEA 5KG4A 5L9XA 3TI0A 4F4YA 5AM0A 3WKCA 4IR1A 1DK3A 5DQIA 3QUTA 9ICCA 5IIJA 2BPFA 5KT7A 3JPTA 4NXZA 3K75D 1ZQ1C 4M47A 1HJPA 1CEZA 4Z6CA 4WQLA 3Q8KA 3LWLA 3AQKA 1JI7A 5J8YC 4O68A 3H8SA 5ALGA 4KX3A 4DSKA 3PX4A 2QB0B 2JXJA 1OUQA 3NRWA 4US8A 5IIMA 3QX7A 3ZI4A 4JV2A 3OV7A 4ECWA 5DBAA 3ZD8A 2KFZA 4NL9C 1R8CA 4DQRA 2H3IA 3OTQA 2JEFA 1J97A 3B9JA 3QUQA 4I2BA 2OWOA 1HUZA 4QZGA 1F44A 5KFBA 3UQ2A 1SB3C 2ZHBA 1DGSA 4PHAA 2K4HA 4UW9A 9ICIA 1IXRA 2KJ8A 2K8BB 5CR0A 4JK1A 1P7DA 3BDPA 4DOBA 1PK1B 4Q43A 5KFAA 3FM9A 1ZETA 4X0BA 1F0MA 2YB4A 2G06A 3SZ2A 4AT8A 5CHEA 4KLGA 2OEHA 4QZAA 2EZYA 1MIVA 2ZJ5A 4OCZA 2ISOA 1WCLA 5CP2A 1ZQMA 2JV3A 3NVYA 1Z00B 5HREA 3F53A 2BPGA 2PXIA 3RH4A 2HOFA 1TAMA 5ALUA 2KVSA 3TAQA 5HR9A 2B21A 3LDAA 1TV9A 1TK0A 4UB3A 5KG2A 4UD4A 4R8UA 4QZCA 1X9SA 3VC8A 2F77X 2RP5A 5AI9A 5HMMA 9ICMA 1SKSA 4NY8A 3WK7A 8ICAA 4Y2TA 3QU9A 4Y2PA 1N5XA 2ZUBA 3SMVA 3TANA 3QXGA 4I2AA 3H38A 4WBZA 3EUB2 5KFJA 1Q78A 3HWTA 2KICA 1KQQA 3T5HA 3CW2C 2RQ5A 2ZTDA 2ZH9A 2HHVA 1T4GA 2OYYA 2H5XA 4DL5A 3R9KA 4IR9A 1KFTA 3NVZA 5HMLA 4UARA 5EE9A 3A0BU 8ICRA 4TQSA 5L1IA 3MDAA 1X9WA 4K8VA 2W9CB 2XIDA 1VLBA 3F2CA 2I1QA 2BPCA 3K7DA 4UASA 3G6VA 2C22A 4P0QB 2DQNB 1LVHA 8ICOA 5DECA 1R8AA 2DRAA 1JXEA 4I2IA 3Q8PB 1JRPA 3KHHA 4ECVA 3IHQB 1SL0A 2VIXA 3CNHA 4XUSA 2RFFA 2F8KA 4B9UA 1SZPA 4J03A 5KFVA 1KKXA 1DOQA 3MGIA 3ED5A 4PHEA 2WFAA 3PY8A 5B3PA 5J29A 2HHWA 4DFDA 4E8FA 2FI1A 3ZDCA 1BNPA 3OJUA 1DGJA 4M9JA 1VJ7A 4RQ4A 2BCUA 3Q8QB 2GH1A 5G5HA 5J0QA 4HX0A 8ICHA 2VJ5A 9ICQA 5J2BA 5ALQA 3LK9A 3HT3A 2KSOA 3PW5A 5KFZA 2YMQA 1S9FA 1A6SA 4RNOA 7ICIA 4WC0A 5AKJA 4LEVA 3OSNA 1Q3UA 1N61A 5J0YA 3CP8A 5JUMA 3TACB 2FDRA 4C80A 4CCHA 5KL8B 4EX6A 2C2EA 3AEVA 2LMRA 1S8OA 2YMMA 1FIQA 1S76D 3MR2A 3MDCA 3CK6A 3WFSC 1A0PA 5ALWA 4DLEA 1UHUA 2K89A 3D6JA 4AP9A 4UQGA 4JV0A 2IHOA 5HRKA 4J9PA 3OSPA 2C2RA 2MUTB 2R8GA 2MA1A 2JH7A 1D8YA 5ALFA 5B3QA 4ATBA 1PK3A 3AMZA 1Z1VA 1BGXT 2K8CB 4BUGA 2BHNA 3HKZC 4M04A 4NV0A 5J0WA 9ICLA 2PFPA 3BZKA 4I29A 3AQLA 4O5EA 3QEBZ 2DUYA 4Q44A 1KDHA 3SV3A 2DWQA 4X4SA 2P6RA 5KG5A 2W9MA 3C29A 2HHXA 1MA7A 3K1RB 4CF3A 2JZBA 1UEVA 4YG2A 3U26A 2VJ4A 4QWDA 3M9MB 2C28A 1CRXA 3LWMA 4RPYA 5DLGA 2Y1IA 3M6ZA 1B43A 5HHHA 1TK8A 4ED7A 1UT5A 2BGWA 3H0MB 4YXMA 4B9SA 5CWRA 4C7YA 3ER8C 3E58A 4MFCA 4E7XA 4RUCA 3M6KA 1N56A 4R65A 4IRDA 4J9LA 2HOQA 4OJ6A 3HJ1A 2W9AA 1BPDA 4WQKA 5J0UA 4Z6DA 2JR5A 2ZTCA 1VFGA 4ACOA 1ZQRA 7ICQA 1YZ6A 2AGQA 1O08A 2IUBA 4EZ9A 3ZD9A 2XY7A 5AM4A 3OJSA 4QJFB 4ED2A 4WJ3B 3WK4A 2E1FA 5GTIU 3TADC 5DB8A 4LZGA 4P4PA 9ICWA 7ICGA 3RJIA 4NLGA 2FE9A 5HRBA 4YMNA 5KT6A 2JEGA 4O3PA 5AIAA 3KZXA 2G09A 5G5GA 1FFVA 2FPKA 4KX5A 1ZQVA 4J9RA 1PVPA 3UQ0A 2PKEA 2DR9A 4ED6A 1RQNA 2XI9A 2BE3A 3PNCA 5IINA 5AICA 4RQ5A 4GC6A 3UXOA 2ATLA 1UA1A 2HOIA 4QZ8A 1KN5A 3EWAA 1K5OA 2HBLA 2A3VA 5HRHA 1NK6A 4K98A 4ELTA 3HKZF 4E0DA 3BS5B 3N4MB 5KAFU 2N1RA 1V38A 4F3OA 1X9XA 1OU5A 4C8NA 5HRLA 2XY5A 4B9MA 2E8NA 3H8JA 3UMBA 5J2KA 3KZIU 2ZTEA 4KN7A 4EBJA 4KLSA 3T5JA 5AKHA 1X42A 1ZQEA 4RWQA 1K1QA 4JMUA 3AL0B 1Z19A 4YR2A 7ICPA 5B5EU 4F4XA 4UBBA 4DL7A 1D8BA 2O1PA 4FBTA 1WOTA 1KNYA 2KK0A 4YP3A 3RB0A 3OHBA 5J0RA 4LEWA 1BPZA 4JWNA 4C4RA 5KG7A 2VANA 3GIKA 1HEKA 3QEAZ 3IM1A 2KTQA 2IBKA 1L3VA 4O5KA 2GAFD 7ICMA 2KP7A 3C1ZA 3EZ5A 4M0AA 2XC9A 2VA3A 3QU4A 4X4RA 5D61A 7ICTA 3F2DA 3QU5A 3ONNA 4X4NA 3M9OB 2Y9UA 3KKAA 5ALXA 4XQ7A 5AK4A 1MIYA 5CB1A 4RWPA 5DQGA 3RRHA 1S5LU 4DF8A 4TQRA 2ES6A 1ZQWA 3V7JA 1EXNA 4UAUA 5KT5A 4ECQA 4NM1A 4X4TA 3S6JA 3SAHA 2FLNA 2R8JA 7ICNA 4YMOA 2B56A 4ECZA 2OHFA 2FCLA 4AT8B 1NZPA 1KL9A 2GLEA 3H8WA 2IHMA 1R89A 4QWBA 1O03A 2KZZA 2ZUCA 3PSPA 5DDYA 2IHNA 2DFLA 1WG8A 4ECXA 3I1YA 4K99A 2RDJA 4RQ2A 2CPRA 1Z1BA 5EE1A 9ICOA 2LHTA 4R8UB 1X6JA 1ZYQA 2BZFA 4QZIA 2P6UA 3T79A 5AK6A 4FZMA 4UBCA 5AKIA 2HVIA 4M9HA 4RQ3A 2ZIVB 3GIMA 2AJQA 4M6WA 4FHPA 4DOCA 2G5HB 3WFPA 4F5NA 3GV7B 2B4VA 2I5HA 4ED1A 2W11A 1R8BA 3CRXA 5IILA 4I27A 3ALRA 3RAXA 4B9TA 4QW9A 4FBUA 4Y2UA 1K1SA 2F3NA 1BPXA 4DQSA 3C23A 3PW2A 1BVSA 1NNLA 2ZH5A 2E5SA 4PL2A 2P35A 3V72A 3NKUA 1IG6A 3MCRA 5AKLA 1T3QA 5KFRA 5JRTA 3GQCA
chains in the Genus database with same CATH topology
1XSNA 3FYHA 5KFUA 4RNMA 5HMMA 5L1LA 5EOZA 4EBDA 9ICMA 1SKSA 4X4VA 4K4HA 4NY8A 4WBYA 5F9NA 2HHUA 4FHXA 4X4OA 4EEYA 8ICAA 5KFLA 1NK0A 9ICPA 3HIYA 2Q0ZX 5KG6A 4I28A 5KFTA 2M2VA 3AQNA 3G6XA 4O0IA 3PW0A 3MR5A 2ZUBA 5J2IA 1S0OA 2ZJAA 4F4WA 3QZ8A 3TANA 4YD2A 5KTQA 1V9PA 4I2AA 1YLQA 4BGDA 1UA0A 1HUOA 3H38A 1XSLA 3RJGA 1Z00A 1PX5A 4WBZA 5KFJA 3WFOA 4UAYA 4Q8EA 1TK5A 8ICGA 4F2RA 2HHQA 4KTQA 4C8OA 1Q78A 1ZQTA 3HWTA 3AU2A 3RR8A 3T5HA 8ICTA 2ZTDA 2J6UA 2ZH9A 1A76A 1T4GA 1TAQA 2H5XA 4Z6FA 2UVWA 2HHVA 2WTFA 4DL5A 4PHPA 3BJYA 5J0SA 1ZQFA 4IR9A 4KLLA 5J2HA 3EPGA 4J9QA 2W9BB 3PX6A 2V4QA 1KFTA 5HRDA 4RPZA 2DRBA 8ICFA 4J9KA 5HMLA 3GFKB 8ICRA 4TQSA 1RYSA 5F2VO 3Q8MA 5L1IA 3T5LA 3MDAA 2BQUA 1X9WA 4F8RA 8ICEA 9ICKA 5KT4A 4NKUA 3QZ7A 2NRVA 1NK8A 2W9CB 1UEUA 1JXLA 4YVZA 3EPIA 2IMWP 3ZDDA 3GV5B 4O5CA 4YFKA 4O3NA 3KHGA 2GWSA 1MIWA 2I1QA 2VA8A 2AQ0A 2BPCA 4DSLA 2ID1A 4YR3A 2M2TA 5IIIA 5EWEA 5KFYA 5D49A 1KLNA 3G6VA 8ICUA 3V6KA 5KG1A 3HPOA 1RXWA 2C22A 2FMPA 7ICFA 4NKTA 3OVSA 3RH6A 8ICOA 5DECA 3SYZA 1R8AA 5KFCA 2ZH7A 2DRAA 1JXEA 1NOMA 4I2IA 4FH3A 1NK9A 3Q8PB 4ECVA 3KHHA 3IHQB 8ICVA 4DS4A 3JPQA 1SL0A 1BNOA 1ZQJA 1ZQYA 9ICSA 4DL3A 2Y1JA 1ZQKA 4ECRA 8ICPA 2M2WA 1JAJA 3H37A 4XUSA 4KLFA 2RFFA 2NRXA 7ICEA 1QSSA 3L9DA 3PVXA 4B9UA 3EW9A 1SZPA 4TUSA 2FLLA 4I2EA 2XO7A 4QWCA 5KFVA 4IRKA 2DVIA 1DOQA 2W9BA 2XGPA 2NRTA 3MGIA 9ICNA 4IQTA 4M2YA 5HC9A 2I9GA 3V7KA 8ICJA 4F50A 2KZZA 4PHEA 4DSEA 2P66A 4UB2A 3PY8A 4DFMA 5DQHA 5CHGA 5J29A 4RT3A 4XA5A 1KRPA 2HHWA 2W9CA 3C5GA 2VA2A 5DB6A 4MF2A 3GV8B 4P2HA 2DR7A 3N97B 4QZEA 2FMSA 4E8FA 2AU0A 4JWMA 4ECTA 2PFNA 4BXOB 4ZH4A 4DL2A 3ZDCA 3ZDBA 1BNPA 1MC8A 1AROP 1NK4A 3OJUA 3BQ2A 2BCVA 4M9JA 1RPLA 1VJ7A 4RQ4A 4UAZA 2BCRA 4R66A 2BCUA 4YXJA 1NK5A 2PFQA 3Q8QB 2AQ4A 1SKRA 5J0QA 9ICBA 8ICHA 9ICQA 5J2BA 4I2HA 3LK9A 1ZQZA 3HT3A 4F2SA 2HHTA 3PW5A 2DPJA 5KFZA 4F5QA 5J2DA 8ICCA 1S9FA 4O3OA 3OUYB 4RNOA 4KLHA 7ICIA 5J2FA 1TAUA 8ICQA 4DF4A 4FHWA 4M5DA 4DS5A 3RJEA 4KLTA 4WC0A 5J0PA 3OSNA 4RU9A 2UVVA 4RNNA 4UAWA 4TURA 4B9VA 4O3SA 2HHPA 4ATBB 4RT2A 3C2MA 1NKCA 2BR0A 2HW3A 4RQ0A 2ASDA 5J2GA 3E2EA 3HX0A 4ECYA 5J0YA 4WC2A 5JUMA 4KLMA 5CJ7A 4F4ZA 3KTQA 4KLOA 4DSFA 5EWGA 3PW4A 1NJXA 4CCHA 3BQ1A 2C2EA 2BKEA 4LVSA 1ZQLA 5HRFA 3Q8SB 5IIKA 4RZRA 1S97A 5KFSA 3GDXA 3RBDA 4S3NA 1CUKA 2XGQA 1ZQCA 4KLDA 3RJHA 1S76D 4BXOA 4BWJA 3K4GA 5EWFA 3MR2A 4KN4A 5KT3A 5IIOA 5BOLA 3MDCA 3MFIA 5L1JA 8ICKA 3WFSC 3MGHA 2R8IA 3UPSA 2Q66A 5J2JA 4DLEA 1IM4A 2JZBB 1MQ2A 3AU6A 1KFSA 5HHIA 4UQGA 4JV0A 3ETLA 3LQCB 5HRKA 1FA0A 5C5JA 4YCXA 5KFPA 4J9PA 4ELUA 3PO4A 3OSPA 2C2RA 2MUTB 1KEJA 7ICKA 1NJWA 2R8GA 3SV4A 5CA7A 3OUYA 3M9NB 4PGYA 1Z3EB 5DG9A 1D8YA 2M2UA 1XU4A 3AQKA 4ELVA 4FO6A 1N48A 2MAXA 2ISPA 2XCAA 8ICWA 4YQWA 4ATBA 3WFRE 3HW8A 2FLPA 2UVUA 4QWAA 1BGXT 3PX0A 3KHRA 2ZH8A 2BHNA 9ICAA 4FS1A 4ECUA 2BCQA 4M04A 4X4QA 5J0WA 2R8KA 4NM2A 2PFPA 4NLNA 9ICLA 1U45A 3Q8RB 4EBKA 4WC3A 7ICUA 4XRHA 4I29A 2NRZA 1XC9A 4FHYA 3RB4A 5KFHA 3AQLA 3TFRA 9ICHA 4O5EA 3HJ4A 3OVBA 4QZHA 3QEBZ 5KFFA 4M9LA 4MEYA 4Q44A 4GC7A 2ZUDA 3ISBA 3PV8A 7ICJA 1KDHA 3G6YA 4FHVA 3TARA 5DB7A 3SV3A 4X4SA 2P6RA 5KG5A 2W9MA 4EP7A 4GLXA 2BDPA 2HHXA 2LYHA 1S0MA 2UVRA 4F5RA 2FPMA 5KFXA 1H38A 8ICZA 4Q8FA 1Q79A 2JZBA 1UEVA 4YG2A 4KLIA 4EYHB 2F1HA 5KT2A 2NRWA 4YN4A 4QZBA 4J9SA 4QWDA 1X2IA 3ZDEA 2J6TA 3M9MB 3RR7A 1TFWA 1U9LA 2C28A 1U48A 3EYZA 1QSYA 2MUTA 2PI4A 3LWMA 4EBEA 4RWOA 3MR3A 2FPLA 4RPYA 2JEIA 3ORYA 5DLGA 4QZDA 2Y1IA 4I2JA 4KITB 1B43A 5HHHA 4UB1A 1TK8A 1L5UA 2PI5A 5TZVA 3JPOA 1UT5A 4ED7A 3V6JA 2BGWA 4YXMA 4ED8A 4B9SA 4I2FA 4DLGA 5CWRA 1TVAA 3RAQA 2ALZA 4F91B 8ICIA 5J2EA 3JPPA 5KFQA 4IQUA 3UXPA 3PMNA 4J9OA 4IG8A 1RZTA 2DPIA 5DKWA 3SI8A 4MFCA 4E7XA 4RUCA 9ICVA 1B22A 3BQ0A 4FH5A 3JYYA 4UB4A 1SKWA 1N56A 3TAPA 4KMUA 5KFGA 1RYRA 4B9LA 4R65A 2C2DA 9ICEA 4IRDA 4J9LA 3HJ1A 5DBBA 5KG0A 2W9AA 4P4MA 1BPDA 2XCPA 1ZJNA 1U49A 1XS9D 1T7PA 4F93B 5J0UA 2ZHAA 4Z6DA 1VFGA 2ZTCA 1BPYA 1S10A 4HYKA 4P4OA 1ZQRA 7ICQA 4DQPA 2AGQA 3TQ1A 2ZH4A 4RQ8A 1T8EA 4EZ9A 3H40A 8ICXA 4TUQA 3ZD9A 3B0YA 4DL6A 2XY7A 2PFOA 8ICBA 3OJSA 4ED2A 4KLEA 7ICRA 1ZQHA 8ICNA 2J6SA 5DB8A 2KN7A 2A1JB 4EYIB 9ICXA 1F5AA 4LZGA 4P4PA 2ZH3A 3PR5B 2M9NA 9ICWA 2AGPA 4QZ9A 1KTQA 4UD5A 2ZH1A 3M8SA 3JPSA 7ICGA 1C7YA 3RJIA 3JZ0A 3Q8LA 4NLGA 2DR8A 5HRBA 5KFOA 4I2GA 4YMNA 5KT6A 2JEGA 4DSIA 4O9MA 3TFSA 4O3PA 1UETA 4O3RA 3THVA 2FMQA 1ZQSA 8ICLA 5DEDA 7ICHA 2FPKA 5HRIA 1D8LA 2F1JA 1DK2A 1ZQVA 4LZDA 4J9RA 4X5VA 3UQ0A 4GXIA 4ECSA 4ED6A 5HRGA 4YR0A 2DR9A 4TUPA 2F1IA 4BWMA 1D9DA 5BOMA 4AT9B 4I2DA 2BE3A 3PNCA 5IINA 5KFWA 1NJZA 1A77A 5DLFA 4C8LA 3NTUA 4DQIA 1ZQNA 2ZJ8A 4GXJA 2KZMA 3JPRA 4RQ5A 4GC6A 3T3FA 3UXOA 5J2CA 2BQRA 3RTVA 2ATLA 1UA1A 1L3SA 4QZ8A 1ZQIA 3EWAA 4DFJA 5DG7A 3PW7A 5HRHA 1NK6A 1UT8A 4ELTA 1SL2A 1JIHA 1L3TA 4E0DA 3N4MB 5L1KA 2RDIA 3NGDA 4F3OA 1JX4A 4NLKA 2W8KA 1KFDA 1OU5A 4C8NA 5HRLA 4YD1A 3GILA 7ICOA 3MABA 2XY5A 1SL1A 1MQ3A 3H8JA 4B9MA 4NLZA 9ICFA 5J2KA 2A1JA 3ZDAA 3OVAA 5KFEA 1ZQOA 4IRCA 4X4PA 2ZTEA 4KN7A 1RXVA 5KFKA 5J0TA 4KLSA 4EBJA 3MBYA 4MEXA 2R8HA 5BPCA 1COOA 3T5JA 3RB3A 3RJJA 4X0AA 1ZQEA 2BQ3A 1QTMA 1K1QA 4RWQA 2ZH6A 1JMSA 4YR2A 4PHDA 7ICPA 4F92B 4F4XA 3H4BA 4UBBA 4DL7A 4RQ6A 9ICUA 9ICRA 2O1PA 4LT6A 4R64A 1T3NA 4FBTA 1KNYA 3PR4A 4Q45A 1WOTA 3V6HA 3C21A 3NYBA 5J0OA 4YP3A 3RB0A 4F5PA 4K4IA 1U4BA 3OHBA 1MSWD 1Y88A 4RUAA 5J0RA 2V4RA 3H4DA 1NKBA 3C18A 5HP4A 9ICJA 4AT9A 3V7LA 1JQRA 3MR6A 1BPZA 1X9MA 5KG7A 4JWNA 5DDMA 4DOAA 3QE9Y 2VANA 3GIKA 3QEAZ 2KTQA 3IM1A 3JPNA 4Z6EA 3C66A 1KSPA 2IBKA 1L3VA 4O5KA 4DL4A 7ICMA 2W8LA 3HP6A 4EZ6A 3T5KA 1ZQBA 2KP7A 1ZQXA 1BPEA 3C1ZA 3RRGA 4B9NA 3EZ5A 4M0AA 1S0VA 2XC9A 2HHSA 4F5OA 2VA3A 2PBEA 3PO5A 3H39A 4WC1A 1XO1A 4X4RA 7ICTA 4GXKA 4ED0A 9ICCA 2BCSA 4X4NA 5DGAA 3M9OB 1ZQPA 1ZQUA 5KG4A 4MFFA 4PGXA 2IA6A 4XQ7A 4WC5A 4R63A 3C5FA 1TKDA 1MIYA 3H7IA 3UPQA 5CB1A 4RPXA 4EBCA 3GIJA 5L9XA 3TI0A 4KLJA 5DQGA 8ICYA 4RWPA 1WCNA 3C2LA 4F4YA 3RRHA 4DF8A 4TQRA 1S77D 4C8MA 3ISDA 1ZQWA 4IR1A 3V7JA 5DQIA 4QW8A 1DK3A 3RH5A 1EXNA 4O3QA 5IIJA 5KT5A 4ECQA 4JV1A 4ED3A 4RQ1A 5KT7A 3JPTA 2BPFA 4NXZA 4NM1A 3H3AA 4WC6A 4X4TA 5DG8A 2FLNA 3K75D 2V9WA 1ZQGA 7ICSA 2R8JA 4M47A 4F4KA 1HJPA 1XSPA 1CEZA 4Z6CA 3MFHA 1L3UA 3OHAA 3LWLA 3Q8KA 3RB6A 5D4BA 4YMOA 4BDPA 1ZQQA 3FDSA 4ECZA 7ICNA 8ICSA 2AGOA 3ISCA 2XY6A 4AT7B 4AT8B 3H8SA 4RQ7A 3B0XA 1NZPA 4M6WB 4DSKA 3PX4A 9ICGA 4DEZA 2KZ3A 3RJFA 5F9LA 7ICVA 4FS2A 3H8WA 2IHMA 4JUZA 5KG3A 1R89A 5IIMA 1ZJMA 4QWBA 4JV2A 3UXNA 4E80A 3OV7A 4WC4A 4ECWA 4C8KA 2ZUCA 5DBAA 3ZD8A 1D9FA 3PMLA 5KFMA 5KFNA 1NKEA 4DQRA 2KFZA 4IQVA 1R8CA 2ASLA 4G3IA 2JEFA 4J9NA 5DDYA 4DFPA 2IHNA 2DFLA 3WFQE 4ECXA 5DGBA 1ZQAA 2KFNA 1PZNA 3RJKA 4I2BA 2DR5A 5KFDA 2RDJA 1XWLA 2OWOA 1U47A 1HUZA 4QZGA 3BQTA 4DO9A 5KFBA 3UQ2A 2ZHBA 4RQ2A 1DGSA 4PHAA 9ICIA 2ASJA 9ICOA 4R8UB 1LV5A 5KFIA 4M9NA 3AUOA 1IXRA 3KHLA 1ZYQA 4YMMA 1QLNA 3OGUA 4J9MA 1TFRA 1BPBA 5CR0A 4JK1A 3BDPA 9ICTA 4MFAA 4DOBA 4QZIA 2P6UA 4PPXA 8ICMA 4Q43A 4MF8A 1NO5A 7ICLA 3GIIA 4QWEA 5J2AA 1NK7A 4UBCA 5J0XA 5DB9A 4WC7A 5KFAA 1NJYA 1ZETA 4DSJA 2HVIA 2HVHA 4X0BA 2ZH2A 4M9HA 1V4AA 4AT7A 3SZ2A 4RQ3A 3AQMA 4AT8A 4IQWA 3GIMA 2AJQA 4M6WA 4DQQA 4DOCA 4FHPA 3WFPA 4KLGA 1JN3A 4F5NA 5HNKA 4QZAA 3GV7B 4DFKA 1MIVA 4ED1A 4RWNA 2ZJ5A 3C2KA 4DWIA 2ISOA 3RBEA 1R8BA 1WCLA 5CP2A 1ZQMA 1QSLA 2JEJA 5IILA 1Z00B 4I27A 5HREA 4XQ8A 3RAXA 4B9TA 4K4GA 2BPGA 4QW9A 3C1YA 3M8RA 4PH5A 4PGQA 2PXIA 3RH4A 4FBUA 4M9GA 4QZFA 1LB2B 1K1SA 1BPXA 4DQSA 3C23A 3TAQA 5DBCA 3PW2A 1BVSA 5HR9A 2B21A 4UB5A 4KLUA 3LDAA 4I2CA 2ZH5A 4WCWA 1TV9A 1TK0A 4UB3A 2O5AA 5KG2A 3V72A 2NRKA 4X4UA 5D46A 4UD4A 4R8UA 4QZCA 1TFYA 1X9SA 5KFRA 4KLQA 1ZQDA 1S0NA 3GQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XSN A;  3FYH A;  5KFU A;  4RNM A;  5HMM A;  5L1L A;  5EOZ A;  4EBD A;  9ICM A;  1SKS A;  4X4V A;  4K4H A;  4NY8 A;  4WBY A;  5F9N A;  2HHU A;  4FHX A;  4X4O A;  4EEY A;  8ICA A;  5KFL A;  1NK0 A;  9ICP A;  3HIY A;  2Q0Z X;  5KG6 A;  4I28 A;  5KFT A;  2M2V A;  3AQN A;  3G6X A;  4O0I A;  3PW0 A;  3MR5 A;  2ZUB A;  5J2I A;  1S0O A;  2ZJA A;  4F4W A;  3QZ8 A;  3TAN A;  4YD2 A;  5KTQ A;  1V9P A;  4I2A A;  1YLQ A;  4BGD A;  1UA0 A;  1HUO A;  3H38 A;  1XSL A;  3RJG A;  1Z00 A;  1PX5 A;  4WBZ A;  5KFJ A;  3WFO A;  4UAY A;  4Q8E A;  1TK5 A;  8ICG A;  4F2R A;  2HHQ A;  4KTQ A;  4C8O A;  1Q78 A;  1ZQT A;  3HWT A;  3AU2 A;  3RR8 A;  3T5H A;  8ICT A;  2ZTD A;  2J6U A;  2ZH9 A;  1A76 A;  1T4G A;  1TAQ A;  2H5X A;  4Z6F A;  2UVW A;  2HHV A;  2WTF A;  4DL5 A;  4PHP A;  3BJY A;  5J0S A;  1ZQF A;  4IR9 A;  4KLL A;  5J2H A;  3EPG A;  4J9Q A;  2W9B B;  3PX6 A;  2V4Q A;  1KFT A;  5HRD A;  4RPZ A;  2DRB A;  8ICF A;  4J9K A;  5HML A;  3GFK B;  8ICR A;  4TQS A;  1RYS A;  5F2V O;  3Q8M A;  5L1I A;  3T5L A;  3MDA A;  2BQU A;  1X9W A;  4F8R A;  8ICE A;  9ICK A;  5KT4 A;  4NKU A;  3QZ7 A;  2NRV A;  1NK8 A;  2W9C B;  1UEU A;  1JXL A;  4YVZ A;  3EPI A;  2IMW P;  3ZDD A;  3GV5 B;  4O5C A;  4YFK A;  4O3N A;  3KHG A;  2GWS A;  1MIW A;  2I1Q A;  2VA8 A;  2AQ0 A;  2BPC A;  4DSL A;  2ID1 A;  4YR3 A;  2M2T A;  5III A;  5EWE A;  5KFY A;  5D49 A;  1KLN A;  3G6V A;  8ICU A;  3V6K A;  5KG1 A;  3HPO A;  1RXW A;  2C22 A;  2FMP A;  7ICF A;  4NKT A;  3OVS A;  3RH6 A;  8ICO A;  5DEC A;  3SYZ A;  1R8A A;  5KFC A;  2ZH7 A;  2DRA A;  1JXE A;  1NOM A;  4I2I A;  4FH3 A;  1NK9 A;  3Q8P B;  4ECV A;  3KHH A;  3IHQ B;  8ICV A;  4DS4 A;  3JPQ A;  1SL0 A;  1BNO A;  1ZQJ A;  1ZQY A;  9ICS A;  4DL3 A;  2Y1J A;  1ZQK A;  4ECR A;  8ICP A;  2M2W A;  1JAJ A;  3H37 A;  4XUS A;  4KLF A;  2RFF A;  2NRX A;  7ICE A;  1QSS A;  3L9D A;  3PVX A;  4B9U A;  3EW9 A;  1SZP A;  4TUS A;  2FLL A;  4I2E A;  2XO7 A;  4QWC A;  5KFV A;  4IRK A;  2DVI A;  1DOQ A;  2W9B A;  2XGP A;  2NRT A;  3MGI A;  9ICN A;  4IQT A;  4M2Y A;  5HC9 A;  2I9G A;  3V7K A;  8ICJ A;  4F50 A;  2KZZ A;  4PHE A;  4DSE A;  2P66 A;  4UB2 A;  3PY8 A;  4DFM A;  5DQH A;  5CHG A;  5J29 A;  4RT3 A;  4XA5 A;  1KRP A;  2HHW A;  2W9C A;  3C5G A;  2VA2 A;  5DB6 A;  4MF2 A;  3GV8 B;  4P2H A;  2DR7 A;  3N97 B;  4QZE A;  2FMS A;  4E8F A;  2AU0 A;  4JWM A;  4ECT A;  2PFN A;  4BXO B;  4ZH4 A;  4DL2 A;  3ZDC A;  3ZDB A;  1BNP A;  1MC8 A;  1ARO P;  1NK4 A;  3OJU A;  3BQ2 A;  2BCV A;  4M9J A;  1RPL A;  1VJ7 A;  4RQ4 A;  4UAZ A;  2BCR A;  4R66 A;  2BCU A;  4YXJ A;  1NK5 A;  2PFQ A;  3Q8Q B;  2AQ4 A;  1SKR A;  5J0Q A;  9ICB A;  8ICH A;  9ICQ A;  5J2B A;  4I2H A;  3LK9 A;  1ZQZ A;  3HT3 A;  4F2S A;  2HHT A;  3PW5 A;  2DPJ A;  5KFZ A;  4F5Q A;  5J2D A;  8ICC A;  1S9F A;  4O3O A;  3OUY B;  4RNO A;  4KLH A;  7ICI A;  5J2F A;  1TAU A;  8ICQ A;  4DF4 A;  4FHW A;  4M5D A;  4DS5 A;  3RJE A;  4KLT A;  4WC0 A;  5J0P A;  3OSN A;  4RU9 A;  2UVV A;  4RNN A;  4UAW A;  4TUR A;  4B9V A;  4O3S A;  2HHP A;  4ATB B;  4RT2 A;  3C2M A;  1NKC A;  2BR0 A;  2HW3 A;  4RQ0 A;  2ASD A;  5J2G A;  3E2E A;  3HX0 A;  4ECY A;  5J0Y A;  4WC2 A;  5JUM A;  4KLM A;  5CJ7 A;  4F4Z A;  3KTQ A;  4KLO A;  4DSF A;  5EWG A;  3PW4 A;  1NJX A;  4CCH A;  3BQ1 A;  2C2E A;  2BKE A;  4LVS A;  1ZQL A;  5HRF A;  3Q8S B;  5IIK A;  4RZR A;  1S97 A;  5KFS A;  3GDX A;  3RBD A;  4S3N A;  1CUK A;  2XGQ A;  1ZQC A;  4KLD A;  3RJH A;  1S76 D;  4BXO A;  4BWJ A;  3K4G A;  5EWF A;  3MR2 A;  4KN4 A;  5KT3 A;  5IIO A;  5BOL A;  3MDC A;  3MFI A;  5L1J A;  8ICK A;  3WFS C;  3MGH A;  2R8I A;  3UPS A;  2Q66 A;  5J2J A;  4DLE A;  1IM4 A;  2JZB B;  1MQ2 A;  3AU6 A;  1KFS A;  5HHI A;  4UQG A;  4JV0 A;  3ETL A;  3LQC B;  5HRK A;  1FA0 A;  5C5J A;  4YCX A;  5KFP A;  4J9P A;  4ELU A;  3PO4 A;  3OSP A;  2C2R A;  2MUT B;  1KEJ A;  7ICK A;  1NJW A;  2R8G A;  3SV4 A;  5CA7 A;  3OUY A;  3M9N B;  4PGY A;  1Z3E B;  5DG9 A;  1D8Y A;  2M2U A;  1XU4 A;  3AQK A;  4ELV A;  4FO6 A;  1N48 A;  2MAX A;  2ISP A;  2XCA A;  8ICW A;  4YQW A;  4ATB A;  3WFR E;  3HW8 A;  2FLP A;  2UVU A;  4QWA A;  1BGX T;  3PX0 A;  3KHR A;  2ZH8 A;  2BHN A;  9ICA A;  4FS1 A;  4ECU A;  2BCQ A;  4M04 A;  4X4Q A;  5J0W A;  2R8K A;  4NM2 A;  2PFP A;  4NLN A;  9ICL A;  1U45 A;  3Q8R B;  4EBK A;  4WC3 A;  7ICU A;  4XRH A;  4I29 A;  2NRZ A;  1XC9 A;  4FHY A;  3RB4 A;  5KFH A;  3AQL A;  3TFR A;  9ICH A;  4O5E A;  3HJ4 A;  3OVB A;  4QZH A;  3QEB Z;  5KFF A;  4M9L A;  4MEY A;  4Q44 A;  4GC7 A;  2ZUD A;  3ISB A;  3PV8 A;  7ICJ A;  1KDH A;  3G6Y A;  4FHV A;  3TAR A;  5DB7 A;  3SV3 A;  4X4S A;  2P6R A;  5KG5 A;  2W9M A;  4EP7 A;  4GLX A;  2BDP A;  2HHX A;  2LYH A;  1S0M A;  2UVR A;  4F5R A;  2FPM A;  5KFX A;  1H38 A;  8ICZ A;  4Q8F A;  1Q79 A;  2JZB A;  1UEV A;  4YG2 A;  4KLI A;  4EYH B;  2F1H A;  5KT2 A;  2NRW A;  4YN4 A;  4QZB A;  4J9S A;  4QWD A;  1X2I A;  3ZDE A;  2J6T A;  3M9M B;  3RR7 A;  1TFW A;  1U9L A;  2C28 A;  1U48 A;  3EYZ A;  1QSY A;  2MUT A;  2PI4 A;  3LWM A;  4EBE A;  4RWO A;  3MR3 A;  2FPL A;  4RPY A;  2JEI A;  3ORY A;  5DLG A;  4QZD A;  2Y1I A;  4I2J A;  4KIT B;  1B43 A;  5HHH A;  4UB1 A;  1TK8 A;  1L5U A;  2PI5 A;  5TZV A;  3JPO A;  1UT5 A;  4ED7 A;  3V6J A;  2BGW A;  4YXM A;  4ED8 A;  4B9S A;  4I2F A;  4DLG A;  5CWR A;  1TVA A;  3RAQ A;  2ALZ A;  4F91 B;  8ICI A;  5J2E A;  3JPP A;  5KFQ A;  4IQU A;  3UXP A;  3PMN A;  4J9O A;  4IG8 A;  1RZT A;  2DPI A;  5DKW A;  3SI8 A;  4MFC A;  4E7X A;  4RUC A;  9ICV A;  1B22 A;  3BQ0 A;  4FH5 A;  3JYY A;  4UB4 A;  1SKW A;  1N56 A;  3TAP A;  4KMU A;  5KFG A;  1RYR A;  4B9L A;  4R65 A;  2C2D A;  9ICE A;  4IRD A;  4J9L A;  3HJ1 A;  5DBB A;  5KG0 A;  2W9A A;  4P4M A;  1BPD A;  2XCP A;  1ZJN A;  1U49 A;  1XS9 D;  1T7P A;  4F93 B;  5J0U A;  2ZHA A;  4Z6D A;  1VFG A;  2ZTC A;  1BPY A;  1S10 A;  4HYK A;  4P4O A;  1ZQR A;  7ICQ A;  4DQP A;  2AGQ A;  3TQ1 A;  2ZH4 A;  4RQ8 A;  1T8E A;  4EZ9 A;  3H40 A;  8ICX A;  4TUQ A;  3ZD9 A;  3B0Y A;  4DL6 A;  2XY7 A;  2PFO A;  8ICB A;  3OJS A;  4ED2 A;  4KLE A;  7ICR A;  1ZQH A;  8ICN A;  2J6S A;  5DB8 A;  2KN7 A;  2A1J B;  4EYI B;  9ICX A;  1F5A A;  4LZG A;  4P4P A;  2ZH3 A;  3PR5 B;  2M9N A;  9ICW A;  2AGP A;  4QZ9 A;  1KTQ A;  4UD5 A;  2ZH1 A;  3M8S A;  3JPS A;  7ICG A;  1C7Y A;  3RJI A;  3JZ0 A;  3Q8L A;  4NLG A;  2DR8 A;  5HRB A;  5KFO A;  4I2G A;  4YMN A;  5KT6 A;  2JEG A;  4DSI A;  4O9M A;  3TFS A;  4O3P A;  1UET A;  4O3R A;  3THV A;  2FMQ A;  1ZQS A;  8ICL A;  5DED A;  7ICH A;  2FPK A;  5HRI A;  1D8L A;  2F1J A;  1DK2 A;  1ZQV A;  4LZD A;  4J9R A;  4X5V A;  3UQ0 A;  4GXI A;  4ECS A;  4ED6 A;  5HRG A;  4YR0 A;  2DR9 A;  4TUP A;  2F1I A;  4BWM A;  1D9D A;  5BOM A;  4AT9 B;  4I2D A;  2BE3 A;  3PNC A;  5IIN A;  5KFW A;  1NJZ A;  1A77 A;  5DLF A;  4C8L A;  3NTU A;  4DQI A;  1ZQN A;  2ZJ8 A;  4GXJ A;  2KZM A;  3JPR A;  4RQ5 A;  4GC6 A;  3T3F A;  3UXO A;  5J2C A;  2BQR A;  3RTV A;  2ATL A;  1UA1 A;  1L3S A;  4QZ8 A;  1ZQI A;  3EWA A;  4DFJ A;  5DG7 A;  3PW7 A;  5HRH A;  1NK6 A;  1UT8 A;  4ELT A;  1SL2 A;  1JIH A;  1L3T A;  4E0D A;  3N4M B;  5L1K A;  2RDI A;  3NGD A;  4F3O A;  1JX4 A;  4NLK A;  2W8K A;  1KFD A;  1OU5 A;  4C8N A;  5HRL A;  4YD1 A;  3GIL A;  7ICO A;  3MAB A;  2XY5 A;  1SL1 A;  1MQ3 A;  3H8J A;  4B9M A;  4NLZ A;  9ICF A;  5J2K A;  2A1J A;  3ZDA A;  3OVA A;  5KFE A;  1ZQO A;  4IRC A;  4X4P A;  2ZTE A;  4KN7 A;  1RXV A;  5KFK A;  5J0T A;  4KLS A;  4EBJ A;  3MBY A;  4MEX A;  2R8H A;  5BPC A;  1COO A;  3T5J A;  3RB3 A;  3RJJ A;  4X0A A;  1ZQE A;  2BQ3 A;  1QTM A;  1K1Q A;  4RWQ A;  2ZH6 A;  1JMS A;  4YR2 A;  4PHD A;  7ICP A;  4F92 B;  4F4X A;  3H4B A;  4UBB A;  4DL7 A;  4RQ6 A;  9ICU A;  9ICR A;  2O1P A;  4LT6 A;  4R64 A;  1T3N A;  4FBT A;  1KNY A;  3PR4 A;  4Q45 A;  1WOT A;  3V6H A;  3C21 A;  3NYB A;  5J0O A;  4YP3 A;  3RB0 A;  4F5P A;  4K4I A;  1U4B A;  3OHB A;  1MSW D;  1Y88 A;  4RUA A;  5J0R A;  2V4R A;  3H4D A;  1NKB A;  3C18 A;  5HP4 A;  9ICJ A;  4AT9 A;  3V7L A;  1JQR A;  3MR6 A;  1BPZ A;  1X9M A;  5KG7 A;  4JWN A;  5DDM A;  4DOA A;  3QE9 Y;  2VAN A;  3GIK A;  3QEA Z;  2KTQ A;  3IM1 A;  3JPN A;  4Z6E A;  3C66 A;  1KSP A;  2IBK A;  1L3V A;  4O5K A;  4DL4 A;  7ICM A;  2W8L A;  3HP6 A;  4EZ6 A;  3T5K A;  1ZQB A;  2KP7 A;  1ZQX A;  1BPE A;  3C1Z A;  3RRG A;  4B9N A;  3EZ5 A;  4M0A A;  1S0V A;  2XC9 A;  2HHS A;  4F5O A;  2VA3 A;  2PBE A;  3PO5 A;  3H39 A;  4WC1 A;  1XO1 A;  4X4R A;  7ICT A;  4GXK A;  4ED0 A;  9ICC A;  2BCS A;  4X4N A;  5DGA A;  3M9O B;  1ZQP A;  1ZQU A;  5KG4 A;  4MFF A;  4PGX A;  2IA6 A;  4XQ7 A;  4WC5 A;  4R63 A;  3C5F A;  1TKD A;  1MIY A;  3H7I A;  3UPQ A;  5CB1 A;  4RPX A;  4EBC A;  3GIJ A;  5L9X A;  3TI0 A;  4KLJ A;  5DQG A;  8ICY A;  4RWP A;  1WCN A;  3C2L A;  4F4Y A;  3RRH A;  4DF8 A;  4TQR A;  1S77 D;  4C8M A;  3ISD A;  1ZQW A;  4IR1 A;  3V7J A;  5DQI A;  4QW8 A;  1DK3 A;  3RH5 A;  1EXN A;  4O3Q A;  5IIJ A;  5KT5 A;  4ECQ A;  4JV1 A;  4ED3 A;  4RQ1 A;  5KT7 A;  3JPT A;  2BPF A;  4NXZ A;  4NM1 A;  3H3A A;  4WC6 A;  4X4T A;  5DG8 A;  2FLN A;  3K75 D;  2V9W A;  1ZQG A;  7ICS A;  2R8J A;  4M47 A;  4F4K A;  1HJP A;  1XSP A;  1CEZ A;  4Z6C A;  3MFH A;  1L3U A;  3OHA A;  3LWL A;  3Q8K A;  3RB6 A;  5D4B A;  4YMO A;  4BDP A;  1ZQQ A;  3FDS A;  4ECZ A;  7ICN A;  8ICS A;  2AGO A;  3ISC A;  2XY6 A;  4AT7 B;  4AT8 B;  3H8S A;  4RQ7 A;  3B0X A;  1NZP A;  4M6W B;  4DSK A;  3PX4 A;  9ICG A;  4DEZ A;  2KZ3 A;  3RJF A;  5F9L A;  7ICV A;  4FS2 A;  3H8W A;  2IHM A;  4JUZ A;  5KG3 A;  1R89 A;  5IIM A;  1ZJM A;  4QWB A;  4JV2 A;  3UXN A;  4E80 A;  3OV7 A;  4WC4 A;  4ECW A;  4C8K A;  2ZUC A;  5DBA A;  3ZD8 A;  1D9F A;  3PML A;  5KFM A;  5KFN A;  1NKE A;  4DQR A;  2KFZ A;  4IQV A;  1R8C A;  2ASL A;  4G3I A;  2JEF A;  4J9N A;  5DDY A;  4DFP A;  2IHN A;  2DFL A;  3WFQ E;  4ECX A;  5DGB A;  1ZQA A;  2KFN A;  1PZN A;  3RJK A;  4I2B A;  2DR5 A;  5KFD A;  2RDJ A;  1XWL A;  2OWO A;  1U47 A;  1HUZ A;  4QZG A;  3BQT A;  4DO9 A;  5KFB A;  3UQ2 A;  2ZHB A;  4RQ2 A;  1DGS A;  4PHA A;  9ICI A;  2ASJ A;  9ICO A;  4R8U B;  1LV5 A;  5KFI A;  4M9N A;  3AUO A;  1IXR A;  3KHL A;  1ZYQ A;  4YMM A;  1QLN A;  3OGU A;  4J9M A;  1TFR A;  1BPB A;  5CR0 A;  4JK1 A;  3BDP A;  9ICT A;  4MFA A;  4DOB A;  4QZI A;  2P6U A;  4PPX A;  8ICM A;  4Q43 A;  4MF8 A;  1NO5 A;  7ICL A;  3GII A;  4QWE A;  5J2A A;  1NK7 A;  4UBC A;  5J0X A;  5DB9 A;  4WC7 A;  5KFA A;  1NJY A;  1ZET A;  4DSJ A;  2HVI A;  2HVH A;  4X0B A;  2ZH2 A;  4M9H A;  1V4A A;  4AT7 A;  3SZ2 A;  4RQ3 A;  3AQM A;  4AT8 A;  4IQW A;  3GIM A;  2AJQ A;  4M6W A;  4DQQ A;  4DOC A;  4FHP A;  3WFP A;  4KLG A;  1JN3 A;  4F5N A;  5HNK A;  4QZA A;  3GV7 B;  4DFK A;  1MIV A;  4ED1 A;  4RWN A;  2ZJ5 A;  3C2K A;  4DWI A;  2ISO A;  3RBE A;  1R8B A;  1WCL A;  5CP2 A;  1ZQM A;  1QSL A;  2JEJ A;  5IIL A;  1Z00 B;  4I27 A;  5HRE A;  4XQ8 A;  3RAX A;  4B9T A;  4K4G A;  2BPG A;  4QW9 A;  3C1Y A;  3M8R A;  4PH5 A;  4PGQ A;  2PXI A;  3RH4 A;  4FBU A;  4M9G A;  4QZF A;  1LB2 B;  1K1S A;  1BPX A;  4DQS A;  3C23 A;  3TAQ A;  5DBC A;  3PW2 A;  1BVS A;  5HR9 A;  2B21 A;  4UB5 A;  4KLU A;  3LDA A;  4I2C A;  2ZH5 A;  4WCW A;  1TV9 A;  1TK0 A;  4UB3 A;  2O5A A;  5KG2 A;  3V72 A;  2NRK A;  4X4U A;  5D46 A;  4UD4 A;  4R8U A;  4QZC A;  1TFY A;  1X9S A;  5KFR A;  4KLQ A;  1ZQD A;  1S0N A;  3GQC A; 
#chains in the Genus database with same CATH topology
 1XSN A;  1QCK A;  5KFU A;  2H3F A;  2HBK A;  5EOZ A;  4K4H A;  5F3X B;  5F9N A;  4FHX A;  2EH9 A;  2ZIX A;  5KFL A;  1NK0 A;  3HIY A;  4KMO B;  2QAR B;  2M2V A;  3IDW A;  4QNL A;  3AQN A;  3RFA A;  3MR5 A;  5JTI A;  3N7P D;  4YD2 A;  3QUC A;  4BGD A;  1UA0 A;  1HUO A;  4F71 A;  1XSL A;  4FZN A;  3WFO A;  1DXS A;  3IRU A;  2OH2 A;  4F2R A;  2HHQ A;  1OW5 A;  3NS1 A;  2J6U A;  2DRB A;  1A76 A;  4DCC A;  2WTF A;  4PHP A;  3BJY A;  2K4I A;  3PX6 A;  2V4Q A;  2KIW A;  1RYS A;  3Q8M A;  4O69 A;  3VCB A;  1ZOL A;  8ICE A;  3H0L B;  9ICK A;  3ER9 B;  1JXL A;  4Y2R A;  2ESE A;  2IMW P;  1UCV A;  4YFK A;  2K8A A;  3AQF A;  3KHG A;  2GWS A;  1MIW A;  2VA8 A;  4DSL A;  2ID1 A;  3N28 A;  2M2T A;  2OCE A;  5EWE A;  5KFY A;  5D49 A;  3OWG A;  5KG1 A;  1JAL A;  1RXW A;  7ICF A;  3HRD D;  2KSO B;  4FH3 A;  4ICA A;  4DS4 A;  2M2W A;  9ICS A;  4ECR A;  1V97 A;  2NRX A;  3SQI A;  2W3R A;  7ICE A;  3PVX A;  2QLT A;  3N7S C;  4I2E A;  2KG5 A;  2DVI A;  3SAF A;  5A0L A;  2XGP A;  8ICJ A;  4B6J A;  4DSE A;  2LPE A;  1RYU A;  3RF9 A;  5CHG A;  4XA5 A;  3WK8 A;  3C5G A;  4MF2 A;  3N97 B;  3LYS A;  2AU0 A;  4JWM A;  2PFN A;  4ZH4 A;  5CEH A;  4DL2 A;  1MC8 A;  3BQ2 A;  1NK5 A;  2W7O A;  2CXY A;  2AQ4 A;  1SKR A;  2K4E A;  9ICB A;  4F2S A;  2DPJ A;  2G07 A;  2ZH2 A;  1AQ6 A;  1ZD4 A;  2XIC A;  4KLH A;  5J2F A;  4M5D A;  3RJE A;  4KLT A;  3KOO A;  4TUR A;  4O3S A;  4ATB B;  2W55 A;  3C2M A;  1KW4 A;  2BR0 A;  3QU7 A;  5J2G A;  4Y2S A;  4WC2 A;  4OAF A;  4F4Z A;  2B6G A;  4DSF A;  2LBO A;  5EWG A;  5ALS A;  3PW4 A;  2WF6 A;  2BKE A;  3LVV A;  4LVS A;  1ZQL A;  5HRF A;  4RZR A;  5KFS A;  3GDX A;  2XGQ A;  4Y2X A;  1LKY A;  1ZQC A;  5AKZ A;  4BXO A;  5T14 A;  5EWF A;  3K4G A;  4XJE A;  2Y0S C;  2R8I A;  5J2J A;  2JZB B;  3AU6 A;  5ALO A;  1FA0 A;  3OPX A;  4ELU A;  1KEJ A;  7ICK A;  1NJW A;  3OUY A;  2MU2 A;  5DG9 A;  4P0P A;  4NXW A;  1XU4 A;  1TE2 A;  1PVR A;  4ELV A;  1N48 A;  2ISP A;  1SGG A;  3WFR E;  3HW8 A;  3PX0 A;  3KHR A;  2ZH8 A;  9ICA A;  2E3T A;  2WB1 C;  4ECU A;  1GO3 F;  1U45 A;  4XRH A;  4FHY A;  2OM6 A;  3TFR A;  9ICH A;  5HR7 A;  4NXV A;  3JCF A;  4QZH A;  2LKY A;  4LEZ A;  3G6Y A;  4FE3 A;  1ZD5 A;  3NUQ A;  4CF5 A;  2LYH A;  4F5R A;  4KLI A;  3BS7 A;  4QZB A;  2W43 A;  1UPH A;  2K60 A;  3F2B A;  2PI4 A;  4RWO A;  5ALJ A;  3MR3 A;  2JEI A;  4UB1 A;  1L5U A;  5TZV A;  2BDU A;  4UB8 U;  1RQL A;  4DLG A;  1SXD A;  5AK5 A;  3RAQ A;  2HSZ A;  2RRD A;  5KFQ A;  4IQU A;  4CDG A;  3PMN A;  1RZT A;  2JRZ A;  1B22 A;  1C20 A;  4FH5 A;  1MN8 A;  3JYY A;  4UB4 A;  3TAP A;  4KMU A;  4B9L A;  1FO4 A;  2XCP A;  1T7P A;  1BPY A;  5CFT A;  2LM4 A;  2R18 A;  5AK3 A;  3TQ1 A;  3H40 A;  3B0Y A;  2ZXH A;  8ICB A;  1ZQH A;  8ICN A;  1F5A A;  9ICX A;  5ALV A;  3PR5 B;  2EQY A;  2Y0S F;  5J8Y A;  5ALD A;  5AI4 A;  3THV A;  1ZQS A;  2G0A A;  5HRI A;  2F1J A;  4LZD A;  3WK9 A;  4ECS A;  4KM5 A;  3AM9 A;  1OXJ A;  2F1I A;  4JB3 A;  2F76 X;  5ALP A;  1D9D A;  5BOM A;  2W54 A;  1WYG A;  5AKG A;  4NL9 A;  1NJZ A;  4C8L A;  5ALL A;  2L5Y A;  2KZM A;  1L3S A;  3RTV A;  1HIW A;  5DG7 A;  2WB1 F;  5L1K A;  1JX4 A;  4NLK A;  4NLZ A;  1B0X A;  3OVA A;  5KFE A;  1ZQO A;  4IRC A;  1RXV A;  4MEX A;  1FFU A;  2ZH6 A;  2BQ3 A;  4F92 B;  4LT6 A;  4R64 A;  3PR4 A;  4IS7 A;  3C21 A;  3NYB A;  3V7L A;  1JQR A;  1X9M A;  1VJ5 A;  3JPN A;  4Z6E A;  2HCF A;  2W8L A;  4NWI A;  1BPE A;  4F5O A;  3PO5 A;  3H39 A;  4ED0 A;  4RQM A;  5DGA A;  4MFF A;  4PGX A;  2IA6 A;  4WC5 A;  1TKD A;  3H7I A;  3UPQ A;  4NLB A;  4RPX A;  4EBC A;  3GIJ A;  3GU3 A;  1SV0 A;  2ZG6 A;  4C8M A;  5JU5 A;  4JV1 A;  3H3A A;  2DF4 B;  5AM1 A;  2HN2 A;  2V9W A;  7ICS A;  4F4K A;  2KJ9 A;  4MKP A;  3RB6 A;  1ZQQ A;  3FDS A;  2AGO A;  4RQ7 A;  1Q8K A;  4M6W B;  2HN1 A;  5C0Y A;  2YMP A;  2BBJ A;  9ICG A;  2KZ3 A;  2LYB A;  3RJF A;  5F9L A;  1V85 A;  5KG3 A;  3QUB A;  3UXN A;  4E80 A;  4WC4 A;  4OJ5 A;  3PML A;  4G3I A;  5DGB A;  1WWU A;  4PJ0 U;  2KFN A;  1PZN A;  3RJK A;  2DR5 A;  5KFD A;  1XWL A;  1U47 A;  2EWR A;  3BQT A;  3ICX A;  5JTG A;  2ASJ A;  4YMM A;  3OGU A;  4J9M A;  1TFR A;  3IP4 B;  1ED1 A;  2HMX A;  4MFA A;  4MF8 A;  4I0U A;  2WHE A;  3GII A;  4QWE A;  5J2A A;  1QQ7 A;  3ETR A;  5J0X A;  5FP0 A;  1NK7 A;  1V4A A;  4AT7 A;  4IQW A;  2ZIX B;  1JN3 A;  5HNK A;  4DFK A;  4RWN A;  4BX9 C;  3C2K A;  2FJ6 A;  2VKQ A;  1ZRN A;  3RBE A;  1QSL A;  2JEJ A;  3NWI A;  4M9G A;  4PGQ A;  4QZF A;  1LB2 B;  3TKA A;  4KB6 A;  3SR6 A;  5ALI A;  1Q46 A;  4WH5 A;  3I76 A;  2LI6 A;  4KLU A;  4I2C A;  5D46 A;  3J81 j;  1ZQD A;  1S0N A;  2RLT A;  3WKD A;  3FYH A;  4RNM A;  5L1L A;  1Z4O A;  1J2N A;  3AN1 A;  2HHU A;  2AHO B;  5KG6 A;  4I28 A;  4O0I A;  3KFU F;  1S0O A;  2ZJA A;  4CNQ A;  3QZ8 A;  1V9P A;  1YLQ A;  3F5A A;  4Q8E A;  2DKZ A;  1XNS A;  8ICG A;  4KTQ A;  5KL1 B;  3AU2 A;  8ICT A;  3BZC A;  4CE6 A;  2UVW A;  1TAQ A;  2KJ5 A;  5J0S A;  2ZIW A;  1ZQF A;  4KLL A;  3EPG A;  2JHD A;  4RPZ A;  8ICF A;  4J9K A;  2IOH A;  5F2V O;  4F8R A;  2BQU A;  2YB1 A;  3K1Z A;  3QZ7 A;  4C0Z A;  3ZDD A;  4EGW A;  3PZP A;  4O3N A;  5L1M A;  3L5K A;  3SEN A;  2LYA A;  5III A;  3V6K A;  3HPO A;  4NKT A;  3SAG A;  3SYZ A;  3PSF A;  5KFC A;  2ZH7 A;  4Y2J A;  3JPQ A;  5EE0 A;  2KVC A;  1ZQJ A;  2Y1J A;  8ICP A;  1QSS A;  3L9D A;  3EW9 A;  4TUS A;  2XO7 A;  2W9B A;  4JLX A;  2NRT A;  4IQT A;  5HC9 A;  3MGV A;  2E8M A;  4F50 A;  2P66 A;  4UB2 A;  5DQH A;  1Z4N A;  1KRP A;  4P2H A;  2VA2 A;  5DB6 A;  2DR7 A;  1LKY B;  2D6F C;  4QZE A;  2FMS A;  4ECT A;  4BXO B;  3AQE A;  3ZDB A;  3WKA A;  1ARO P;  2KHV A;  2BCV A;  2BCR A;  4R66 A;  2IOF A;  5AI6 A;  4USA A;  4F5Q A;  5J2D A;  8ICC A;  3OUY B;  2G08 A;  1NI3 A;  5AKX A;  3EF2 A;  4DF4 A;  4UAW A;  4B9V A;  2HHP A;  4RT2 A;  2HW3 A;  4RQ0 A;  3HX0 A;  4ECY A;  4U7C A;  3C28 A;  4CRX A;  4KLM A;  4KLO A;  4WOY A;  2O6K A;  3BQ1 A;  2EZX A;  4AYB F;  2E8O A;  2W03 A;  3KBB A;  5IIK A;  3Q8S B;  1S97 A;  3RBD A;  2NV3 A;  3D2N A;  3RJH A;  4BWJ A;  9ICP A;  4KN4 A;  5IIO A;  5BOL A;  3MFI A;  8ICK A;  3MGH A;  5CFS A;  4ZOH C;  1MQ2 A;  1KFS A;  5C5J A;  2W7P A;  3KD3 A;  3PO4 A;  4OAG A;  3SD7 A;  5CA7 A;  3M9N B;  4PZO A;  5ALM A;  1Z3E B;  2G5I B;  4FO6 A;  2MAX A;  3DDH A;  4YQW A;  2UVU A;  3IG8 A;  3M1Y A;  4FS1 A;  4X4Q A;  4NM2 A;  2E8P A;  3Q8R B;  1YT3 A;  2NRZ A;  3RB4 A;  3PHZ A;  5K4L A;  2Q4T A;  4M9L A;  2KEY A;  4NXT A;  3PV8 A;  7ICJ A;  4NLC A;  3TAR A;  5DB7 A;  4FHV A;  2AXT U;  1ECW A;  2H3Z A;  2BDP A;  4OJO A;  8ICZ A;  2WAQ C;  2FPM A;  5KFX A;  1H38 A;  1Q79 A;  2NO4 A;  4EYH B;  2F1H A;  4YN4 A;  3ZDE A;  2J6T A;  3RR7 A;  1U9L A;  1U48 A;  1QSY A;  2FPL A;  3ORY A;  1IV8 A;  4QZD A;  2KKV A;  2PI5 A;  5AKY A;  3ERC C;  3V6J A;  4I2F A;  1WWV A;  1TVA A;  5CFU A;  2ALZ A;  2AH5 A;  3MC1 A;  3JPP A;  3IV6 A;  4K9B A;  2DPI A;  5DKW A;  3SI8 A;  3BQ0 A;  1SKW A;  1N5W A;  5KFG A;  1RYR A;  9ICE A;  5DBB A;  2HBM A;  1XS9 D;  4UAV A;  1S10 A;  4DQP A;  3O0F A;  8ICX A;  3WK5 A;  2KNJ A;  2PFO A;  4KLE A;  2J6S A;  2KN7 A;  5CRX A;  4EYI B;  2ZH3 A;  4A8E A;  2KKP A;  5ALR A;  3M8S A;  1C7Y A;  3Q8L A;  5KFO A;  4I2G A;  3TFS A;  1UET A;  1JUD A;  2CN1 A;  4O3R A;  2H3V A;  2FMQ A;  8ICL A;  7ICH A;  1D8L A;  4Y2Y A;  2PMZ C;  1DK2 A;  2NYV A;  4X5V A;  4IC9 A;  5HRG A;  4YR0 A;  4BWM A;  1UQV A;  2YTU A;  4JLZ A;  3T3F A;  5J2C A;  2BQR A;  4DFJ A;  3PW7 A;  1JIH A;  1L3T A;  4QIW C;  2W8K A;  4YD1 A;  3GIL A;  2Y9T A;  3DV9 A;  1SL1 A;  1MQ3 A;  2A1J A;  1DRG A;  4X4P A;  5BPC A;  3RB3 A;  4X0A A;  2OXO A;  3WU2 U;  1JMS A;  2WAQ F;  3H4B A;  3UM9 A;  1SV0 C;  1L7M A;  5J0O A;  4PZN A;  4EED A;  2KIV A;  3L4P A;  4F5P A;  1U4B A;  4K4I A;  1Y88 A;  5B66 U;  4RUA A;  2V4R A;  1NKB A;  1ZRM A;  2ZIV A;  2YX8 A;  4AT9 A;  3MR6 A;  5DDM A;  3QE9 Y;  1JRO A;  2ZXI A;  1KSP A;  4DL4 A;  4EZ6 A;  3T5K A;  4EEL A;  1ZQB A;  1ZQX A;  4B9N A;  2HHS A;  2WF9 A;  2KOB A;  1KBU A;  4GXK A;  3PSI A;  1F5S A;  2BCS A;  1ZQP A;  1ZQU A;  4R63 A;  3C5F A;  4CF4 A;  1SWW A;  4KLJ A;  1SIJ A;  8ICY A;  1T94 A;  2DGZ A;  1WCN A;  3C2L A;  5ALZ A;  1YZ7 A;  1S77 D;  3ISD A;  3NVV A;  4QW8 A;  3RH5 A;  4O3Q A;  4WC6 A;  4ED3 A;  4RQ1 A;  5DG8 A;  5ALE A;  1ZQG A;  4OD0 A;  2F2A B;  5KAI U;  1XSP A;  3D2S A;  3MFH A;  1L3U A;  3OHA A;  4BDP A;  4K4G A;  5D4B A;  8ICS A;  4AT7 B;  3ISC A;  2XY6 A;  2QAR A;  3B0X A;  3E0F A;  2B0C A;  4Y2V A;  2JMG A;  4DEZ A;  2ZIU A;  7ICV A;  4FS2 A;  4JUZ A;  2PMZ F;  1ZJM A;  1L8L A;  4C8K A;  1D9F A;  5KFM A;  5KFN A;  1NKE A;  5ALK A;  5GTH U;  4IQV A;  2ASL A;  4J9N A;  4DFP A;  3WFQ E;  1ZQA A;  2D3D A;  2W3S A;  3WKB A;  2JGA A;  3IG5 A;  4MHV A;  5KNI A;  4DO9 A;  1L7N A;  2I6X A;  2B51 A;  1LV5 A;  5KFI A;  4M9N A;  3AUO A;  3KHL A;  4QIW F;  1QLN A;  1BPB A;  4FFD A;  9ICT A;  4PPX A;  1NO5 A;  7ICL A;  5EE3 A;  4C4S A;  3NAS A;  4WC7 A;  3QU2 A;  5DB9 A;  3PST A;  3D2Q A;  1NJY A;  3NVW A;  4DSJ A;  2HVH A;  2HBJ A;  4G9B A;  3AQM A;  4DQQ A;  5H2F U;  2QB0 A;  4DWI A;  4NXU A;  4XQ8 A;  3C1Y A;  3M8R A;  4PH5 A;  3FAH A;  1COK A;  2GO7 A;  2EAP A;  5DBC A;  1NZB A;  4UB5 A;  2ZIW B;  4WCW A;  2O5A A;  2NRK A;  4X4U A;  1TFY A;  3KKA C;  5D63 A;  4KLQ A;  2M0N A;  2A1A A;  1PK1 A;  2GOL A;  3A0H U;  2F8L A;  4X4V A;  4GIB A;  4EBD A;  2Z7J A;  4WBY A;  4X4O A;  4EEY A;  2W04 A;  2BBH A;  2WF5 A;  2Q0Z X;  4Y2Q A;  5KFT A;  3HJE A;  3G6X A;  3PW0 A;  5J2I A;  1Q3V A;  4EV6 A;  4F4W A;  1N2X A;  5KTQ A;  1X6I A;  3UMC A;  3RJG A;  1PX5 A;  1Z00 A;  2GA9 D;  4O6A A;  4UAY A;  1TK5 A;  2DL0 A;  4C8O A;  1ZQT A;  5AKK A;  3RR8 A;  4Z6F A;  1FEZ A;  1SXE A;  2LM1 A;  5HRD A;  5J2H A;  4J9Q A;  2W9B B;  3GFK B;  3T5L A;  5KT4 A;  4OO1 J;  4NKU A;  4US9 A;  1SV4 A;  1L7O A;  2NRV A;  1NK8 A;  1UEU A;  4YVZ A;  3EPI A;  4O5C A;  3GV5 B;  3M7D A;  4LEY A;  2AQ0 A;  2HDO A;  4YR3 A;  2WF8 A;  2YY6 A;  1KLN A;  8ICU A;  2FMP A;  3OVS A;  3RH6 A;  1PUZ A;  1NOM A;  1NK9 A;  5ALT A;  8ICV A;  1BNO A;  5AI8 A;  1ZQY A;  2ODG A;  4DL3 A;  1ZQK A;  1JAJ A;  5D62 A;  2NO5 A;  3H37 A;  4KLF A;  1L7P A;  2FLL A;  4QWC A;  4IRK A;  9ICN A;  4M2Y A;  4EEB A;  1RDF A;  3V7K A;  2I9G A;  4DFM A;  2H3Q A;  1L6N A;  1RG6 A;  4OJP A;  1J2M A;  4RT3 A;  2W9C A;  3I28 A;  3GV8 B;  5ALN A;  4K96 A;  3LVW A;  4EEK A;  4EEN A;  4OAH A;  1NK4 A;  1RPL A;  1B4F A;  4UAZ A;  4N7R A;  4YXJ A;  2PFQ A;  4P0Q A;  4I2H A;  1ZQZ A;  2HHT A;  2E1E A;  2KV2 A;  4O3O A;  1TAU A;  8ICQ A;  2DKX A;  4FHW A;  4DS5 A;  5J0P A;  3SEI A;  3WKE A;  2YQE A;  2KMD A;  4RU9 A;  4PL1 A;  4RNN A;  2UVV A;  1NKC A;  2ASD A;  3E2E A;  2HI0 A;  2RHF A;  5CJ7 A;  3KTQ A;  1NJX A;  2QB1 A;  4S3N A;  1CUK A;  1GPJ A;  4UAT A;  4OAI Z;  2EAN A;  4KLD A;  5L1J A;  4GFJ A;  5KT3 A;  1PVQ A;  3UPS A;  2Q66 A;  3H0R B;  4FZL A;  1IM4 A;  5HHI A;  1QQ5 A;  1ZXI A;  3IN5 A;  5HR6 A;  4UB6 U;  3ETL A;  4NJ8 A;  3LQC B;  2F44 A;  4YCX A;  5KFP A;  3SV4 A;  4PGY A;  5E79 U;  4FO1 A;  2M2U A;  4AYB C;  2XCA A;  8ICW A;  2KD1 A;  2WF7 A;  2FLP A;  5AM3 A;  4QWA A;  1ZD3 A;  1X66 A;  3NVO A;  5AI5 A;  2BCQ A;  2R8K A;  4NLN A;  4WC3 A;  4EBK A;  7ICU A;  1XC9 A;  2KE7 A;  2EAO A;  5KFH A;  4HAI A;  2KHQ A;  3HJ4 A;  3OVB A;  3BQ7 A;  5KFF A;  4MEY A;  4GC7 A;  2ZUD A;  3ISB A;  2XVT A;  4C4T A;  4EP7 A;  4GLX A;  4C7Z A;  1S0M A;  2UVR A;  4Q8F A;  2MRL A;  5TIS U;  5AI0 A;  5KT2 A;  2NRW A;  3L3F X;  4J9S A;  1X2I A;  1TFW A;  3EYZ A;  2MUT A;  4LJX A;  4EBE A;  5AHX A;  8ICM A;  1N60 A;  4I2J A;  4KIT B;  3QNM A;  3JPO A;  4ED8 A;  4IL6 U;  1SWV A;  3FC4 A;  4F91 B;  8ICI A;  3UXP A;  5J2E A;  4J9O A;  4IG8 A;  1CI4 A;  1N63 A;  4K9A A;  9ICV A;  1QH9 A;  3GZF A;  4F72 A;  1SZH A;  2C2D A;  2EDU A;  5KG0 A;  4P4M A;  1ZJN A;  1U49 A;  4F93 B;  2ZHA A;  4HYK A;  4P4O A;  1IIP A;  2ZH4 A;  4RQ8 A;  1T8E A;  4TUQ A;  4DL6 A;  7ICR A;  2A1J B;  2MSN A;  2D8C A;  2M9N A;  5AIB A;  2AGP A;  4QZ9 A;  1KTQ A;  4UD5 A;  2ZH1 A;  3JPS A;  3JZ0 A;  2DR8 A;  4O3M A;  1ZD2 P;  4DSI A;  4O9M A;  4P0P B;  5DED A;  4OJL A;  4GXI A;  3H8M A;  4TUP A;  2A19 A;  2K4P A;  1RM6 C;  4AT9 B;  4I2D A;  5AM2 A;  4U6P A;  1XO0 A;  5KFW A;  5AKE A;  1A77 A;  5DLF A;  4DQI A;  3NTU A;  1ZQN A;  2ZJ8 A;  4GXJ A;  1L8O A;  3CYM A;  3JPR A;  1X40 A;  1ZQI A;  1VDV A;  3N7R C;  1UT8 A;  3TAD A;  1SL2 A;  2RDI A;  3NGD A;  2YML A;  2CRX A;  3UMG A;  1KFD A;  2EZZ A;  7ICO A;  4EX7 A;  3MAB A;  2IOF K;  9ICF A;  3ZDA A;  4K97 A;  3NRZ A;  5KFK A;  5J0T A;  3MBY A;  1URJ A;  2QKQ A;  2R8H A;  1COO A;  3RJJ A;  2JH1 A;  1QTM A;  4NXX A;  1QQ6 A;  4PHD A;  4RQ6 A;  9ICU A;  9ICR A;  1T3N A;  4Q45 A;  3V6H A;  4RQN A;  3HIL A;  5AM5 A;  4BJQ A;  1MSW D;  3H4D A;  3C18 A;  3QYP A;  1M6Y A;  5HP4 A;  9ICJ A;  4DOA A;  4CGZ A;  3C66 A;  2EAM A;  2ZIU B;  5ALH A;  3HP6 A;  2DBY A;  4O67 A;  5ALY A;  1WUD A;  3RRG A;  3WK6 A;  1S0V A;  2PBE A;  3BS5 A;  4WC1 A;  1XO1 A;  3F5E A;  2YN4 A;  1N62 A;  3DEE A;  5KG4 A;  5L9X A;  3TI0 A;  4F4Y A;  5AM0 A;  3WKC A;  4IR1 A;  1DK3 A;  5DQI A;  3QUT A;  9ICC A;  5IIJ A;  2BPF A;  5KT7 A;  3JPT A;  4NXZ A;  3K75 D;  1ZQ1 C;  4M47 A;  1HJP A;  1CEZ A;  4Z6C A;  4WQL A;  3Q8K A;  3LWL A;  3AQK A;  1JI7 A;  5J8Y C;  4O68 A;  3H8S A;  5ALG A;  4KX3 A;  4DSK A;  3PX4 A;  2QB0 B;  2JXJ A;  1OUQ A;  3NRW A;  4US8 A;  5IIM A;  3QX7 A;  3ZI4 A;  4JV2 A;  3OV7 A;  4ECW A;  5DBA A;  3ZD8 A;  2KFZ A;  4NL9 C;  1R8C A;  4DQR A;  2H3I A;  3OTQ A;  2JEF A;  1J97 A;  3B9J A;  3QUQ A;  4I2B A;  2OWO A;  1HUZ A;  4QZG A;  1F44 A;  5KFB A;  3UQ2 A;  1SB3 C;  2ZHB A;  1DGS A;  4PHA A;  2K4H A;  4UW9 A;  9ICI A;  1IXR A;  2KJ8 A;  2K8B B;  5CR0 A;  4JK1 A;  1P7D A;  3BDP A;  4DOB A;  1PK1 B;  4Q43 A;  5KFA A;  3FM9 A;  1ZET A;  4X0B A;  1F0M A;  2YB4 A;  2G06 A;  3SZ2 A;  4AT8 A;  5CHE A;  4KLG A;  2OEH A;  4QZA A;  2EZY A;  1MIV A;  2ZJ5 A;  4OCZ A;  2ISO A;  1WCL A;  5CP2 A;  1ZQM A;  2JV3 A;  3NVY A;  1Z00 B;  5HRE A;  3F53 A;  2BPG A;  2PXI A;  3RH4 A;  2HOF A;  1TAM A;  5ALU A;  2KVS A;  3TAQ A;  5HR9 A;  2B21 A;  3LDA A;  1TV9 A;  1TK0 A;  4UB3 A;  5KG2 A;  4UD4 A;  4R8U A;  4QZC A;  1X9S A;  3VC8 A;  2F77 X;  2RP5 A;  5AI9 A;  5HMM A;  9ICM A;  1SKS A;  4NY8 A;  3WK7 A;  8ICA A;  4Y2T A;  3QU9 A;  4Y2P A;  1N5X A;  2ZUB A;  3SMV A;  3TAN A;  3QXG A;  4I2A A;  3H38 A;  4WBZ A;  3EUB 2;  5KFJ A;  1Q78 A;  3HWT A;  2KIC A;  1KQQ A;  3T5H A;  3CW2 C;  2RQ5 A;  2ZTD A;  2ZH9 A;  2HHV A;  1T4G A;  2OYY A;  2H5X A;  4DL5 A;  3R9K A;  4IR9 A;  1KFT A;  3NVZ A;  5HML A;  4UAR A;  5EE9 A;  3A0B U;  8ICR A;  4TQS A;  5L1I A;  3MDA A;  1X9W A;  4K8V A;  2W9C B;  2XID A;  1VLB A;  3F2C A;  2I1Q A;  2BPC A;  3K7D A;  4UAS A;  3G6V A;  2C22 A;  4P0Q B;  2DQN B;  1LVH A;  8ICO A;  5DEC A;  1R8A A;  2DRA A;  1JXE A;  4I2I A;  3Q8P B;  1JRP A;  3KHH A;  4ECV A;  3IHQ B;  1SL0 A;  2VIX A;  3CNH A;  4XUS A;  2RFF A;  2F8K A;  4B9U A;  1SZP A;  4J03 A;  5KFV A;  1KKX A;  1DOQ A;  3MGI A;  3ED5 A;  4PHE A;  2WFA A;  3PY8 A;  5B3P A;  5J29 A;  2HHW A;  4DFD A;  4E8F A;  2FI1 A;  3ZDC A;  1BNP A;  3OJU A;  1DGJ A;  4M9J A;  1VJ7 A;  4RQ4 A;  2BCU A;  3Q8Q B;  2GH1 A;  5G5H A;  5J0Q A;  4HX0 A;  8ICH A;  2VJ5 A;  9ICQ A;  5J2B A;  5ALQ A;  3LK9 A;  3HT3 A;  2KSO A;  3PW5 A;  5KFZ A;  2YMQ A;  1S9F A;  1A6S A;  4RNO A;  7ICI A;  4WC0 A;  5AKJ A;  4LEV A;  3OSN A;  1Q3U A;  1N61 A;  5J0Y A;  3CP8 A;  5JUM A;  3TAC B;  2FDR A;  4C80 A;  4CCH A;  5KL8 B;  4EX6 A;  2C2E A;  3AEV A;  2LMR A;  1S8O A;  2YMM A;  1FIQ A;  1S76 D;  3MR2 A;  3MDC A;  3CK6 A;  3WFS C;  1A0P A;  5ALW A;  4DLE A;  1UHU A;  2K89 A;  3D6J A;  4AP9 A;  4UQG A;  4JV0 A;  2IHO A;  5HRK A;  4J9P A;  3OSP A;  2C2R A;  2MUT B;  2R8G A;  2MA1 A;  2JH7 A;  1D8Y A;  5ALF A;  5B3Q A;  4ATB A;  1PK3 A;  3AMZ A;  1Z1V A;  1BGX T;  2K8C B;  4BUG A;  2BHN A;  3HKZ C;  4M04 A;  4NV0 A;  5J0W A;  9ICL A;  2PFP A;  3BZK A;  4I29 A;  3AQL A;  4O5E A;  3QEB Z;  2DUY A;  4Q44 A;  1KDH A;  3SV3 A;  2DWQ A;  4X4S A;  2P6R A;  5KG5 A;  2W9M A;  3C29 A;  2HHX A;  1MA7 A;  3K1R B;  4CF3 A;  2JZB A;  1UEV A;  4YG2 A;  3U26 A;  2VJ4 A;  4QWD A;  3M9M B;  2C28 A;  1CRX A;  3LWM A;  4RPY A;  5DLG A;  2Y1I A;  3M6Z A;  1B43 A;  5HHH A;  1TK8 A;  4ED7 A;  1UT5 A;  2BGW A;  3H0M B;  4YXM A;  4B9S A;  5CWR A;  4C7Y A;  3ER8 C;  3E58 A;  4MFC A;  4E7X A;  4RUC A;  3M6K A;  1N56 A;  4R65 A;  4IRD A;  4J9L A;  2HOQ A;  4OJ6 A;  3HJ1 A;  2W9A A;  1BPD A;  4WQK A;  5J0U A;  4Z6D A;  2JR5 A;  2ZTC A;  1VFG A;  4ACO A;  1ZQR A;  7ICQ A;  1YZ6 A;  2AGQ A;  1O08 A;  2IUB A;  4EZ9 A;  3ZD9 A;  2XY7 A;  5AM4 A;  3OJS A;  4QJF B;  4ED2 A;  4WJ3 B;  3WK4 A;  2E1F A;  5GTI U;  3TAD C;  5DB8 A;  4LZG A;  4P4P A;  9ICW A;  7ICG A;  3RJI A;  4NLG A;  2FE9 A;  5HRB A;  4YMN A;  5KT6 A;  2JEG A;  4O3P A;  5AIA A;  3KZX A;  2G09 A;  5G5G A;  1FFV A;  2FPK A;  4KX5 A;  1ZQV A;  4J9R A;  1PVP A;  3UQ0 A;  2PKE A;  2DR9 A;  4ED6 A;  1RQN A;  2XI9 A;  2BE3 A;  3PNC A;  5IIN A;  5AIC A;  4RQ5 A;  4GC6 A;  3UXO A;  2ATL A;  1UA1 A;  2HOI A;  4QZ8 A;  1KN5 A;  3EWA A;  1K5O A;  2HBL A;  2A3V A;  5HRH A;  1NK6 A;  4K98 A;  4ELT A;  3HKZ F;  4E0D A;  3BS5 B;  3N4M B;  5KAF U;  2N1R A;  1V38 A;  4F3O A;  1X9X A;  1OU5 A;  4C8N A;  5HRL A;  2XY5 A;  4B9M A;  2E8N A;  3H8J A;  3UMB A;  5J2K A;  3KZI U;  2ZTE A;  4KN7 A;  4EBJ A;  4KLS A;  3T5J A;  5AKH A;  1X42 A;  1ZQE A;  4RWQ A;  1K1Q A;  4JMU A;  3AL0 B;  1Z19 A;  4YR2 A;  7ICP A;  5B5E U;  4F4X A;  4UBB A;  4DL7 A;  1D8B A;  2O1P A;  4FBT A;  1WOT A;  1KNY A;  2KK0 A;  4YP3 A;  3RB0 A;  3OHB A;  5J0R A;  4LEW A;  1BPZ A;  4JWN A;  4C4R A;  5KG7 A;  2VAN A;  3GIK A;  1HEK A;  3QEA Z;  3IM1 A;  2KTQ A;  2IBK A;  1L3V A;  4O5K A;  2GAF D;  7ICM A;  2KP7 A;  3C1Z A;  3EZ5 A;  4M0A A;  2XC9 A;  2VA3 A;  3QU4 A;  4X4R A;  5D61 A;  7ICT A;  3F2D A;  3QU5 A;  3ONN A;  4X4N A;  3M9O B;  2Y9U A;  3KKA A;  5ALX A;  4XQ7 A;  5AK4 A;  1MIY A;  5CB1 A;  4RWP A;  5DQG A;  3RRH A;  1S5L U;  4DF8 A;  4TQR A;  2ES6 A;  1ZQW A;  3V7J A;  1EXN A;  4UAU A;  5KT5 A;  4ECQ A;  4NM1 A;  4X4T A;  3S6J A;  3SAH A;  2FLN A;  2R8J A;  7ICN A;  4YMO A;  2B56 A;  4ECZ A;  2OHF A;  2FCL A;  4AT8 B;  1NZP A;  1KL9 A;  2GLE A;  3H8W A;  2IHM A;  1R89 A;  4QWB A;  1O03 A;  2KZZ A;  2ZUC A;  3PSP A;  5DDY A;  2IHN A;  2DFL A;  1WG8 A;  4ECX A;  3I1Y A;  4K99 A;  2RDJ A;  4RQ2 A;  2CPR A;  1Z1B A;  5EE1 A;  9ICO A;  2LHT A;  4R8U B;  1X6J A;  1ZYQ A;  2BZF A;  4QZI A;  2P6U A;  3T79 A;  5AK6 A;  4FZM A;  4UBC A;  5AKI A;  2HVI A;  4M9H A;  4RQ3 A;  2ZIV B;  3GIM A;  2AJQ A;  4M6W A;  4FHP A;  4DOC A;  2G5H B;  3WFP A;  4F5N A;  3GV7 B;  2B4V A;  2I5H A;  4ED1 A;  2W11 A;  1R8B A;  3CRX A;  5IIL A;  4I27 A;  3ALR A;  3RAX A;  4B9T A;  4QW9 A;  4FBU A;  4Y2U A;  1K1S A;  2F3N A;  1BPX A;  4DQS A;  3C23 A;  3PW2 A;  1BVS A;  1NNL A;  2ZH5 A;  2E5S A;  4PL2 A;  2P35 A;  3V72 A;  3NKU A;  1IG6 A;  3MCR A;  5AKL A;  1T3Q A;  5KFR A;  5JRT A;  3GQC A; 
#chains in the Genus database with same CATH homology
 1XSN A;  3FYH A;  5KFU A;  4RNM A;  5HMM A;  5L1L A;  5EOZ A;  4EBD A;  9ICM A;  1SKS A;  4X4V A;  4K4H A;  4NY8 A;  4WBY A;  5F9N A;  2HHU A;  4FHX A;  4X4O A;  4EEY A;  8ICA A;  5KFL A;  1NK0 A;  9ICP A;  3HIY A;  2Q0Z X;  5KG6 A;  4I28 A;  5KFT A;  2M2V A;  3AQN A;  3G6X A;  4O0I A;  3PW0 A;  3MR5 A;  2ZUB A;  5J2I A;  1S0O A;  2ZJA A;  4F4W A;  3QZ8 A;  3TAN A;  4YD2 A;  5KTQ A;  1V9P A;  4I2A A;  1YLQ A;  4BGD A;  1UA0 A;  1HUO A;  3H38 A;  1XSL A;  3RJG A;  1Z00 A;  1PX5 A;  4WBZ A;  5KFJ A;  3WFO A;  4UAY A;  4Q8E A;  1TK5 A;  8ICG A;  4F2R A;  2HHQ A;  4KTQ A;  4C8O A;  1Q78 A;  1ZQT A;  3HWT A;  3AU2 A;  3RR8 A;  3T5H A;  8ICT A;  2ZTD A;  2J6U A;  2ZH9 A;  1A76 A;  1T4G A;  1TAQ A;  2H5X A;  4Z6F A;  2UVW A;  2HHV A;  2WTF A;  4DL5 A;  4PHP A;  3BJY A;  5J0S A;  1ZQF A;  4IR9 A;  4KLL A;  5J2H A;  3EPG A;  4J9Q A;  2W9B B;  3PX6 A;  2V4Q A;  1KFT A;  5HRD A;  4RPZ A;  2DRB A;  8ICF A;  4J9K A;  5HML A;  3GFK B;  8ICR A;  4TQS A;  1RYS A;  5F2V O;  3Q8M A;  5L1I A;  3T5L A;  3MDA A;  2BQU A;  1X9W A;  4F8R A;  8ICE A;  9ICK A;  5KT4 A;  4NKU A;  3QZ7 A;  2NRV A;  1NK8 A;  2W9C B;  1UEU A;  1JXL A;  4YVZ A;  3EPI A;  2IMW P;  3ZDD A;  3GV5 B;  4O5C A;  4YFK A;  4O3N A;  3KHG A;  2GWS A;  1MIW A;  2I1Q A;  2VA8 A;  2AQ0 A;  2BPC A;  4DSL A;  2ID1 A;  4YR3 A;  2M2T A;  5III A;  5EWE A;  5KFY A;  5D49 A;  1KLN A;  3G6V A;  8ICU A;  3V6K A;  5KG1 A;  3HPO A;  1RXW A;  2C22 A;  2FMP A;  7ICF A;  4NKT A;  3OVS A;  3RH6 A;  8ICO A;  5DEC A;  3SYZ A;  1R8A A;  5KFC A;  2ZH7 A;  2DRA A;  1JXE A;  1NOM A;  4I2I A;  4FH3 A;  1NK9 A;  3Q8P B;  4ECV A;  3KHH A;  3IHQ B;  8ICV A;  4DS4 A;  3JPQ A;  1SL0 A;  1BNO A;  1ZQJ A;  1ZQY A;  9ICS A;  4DL3 A;  2Y1J A;  1ZQK A;  4ECR A;  8ICP A;  2M2W A;  1JAJ A;  3H37 A;  4XUS A;  4KLF A;  2RFF A;  2NRX A;  7ICE A;  1QSS A;  3L9D A;  3PVX A;  4B9U A;  3EW9 A;  1SZP A;  4TUS A;  2FLL A;  4I2E A;  2XO7 A;  4QWC A;  5KFV A;  4IRK A;  2DVI A;  1DOQ A;  2W9B A;  2XGP A;  2NRT A;  3MGI A;  9ICN A;  4IQT A;  4M2Y A;  5HC9 A;  2I9G A;  3V7K A;  8ICJ A;  4F50 A;  2KZZ A;  4PHE A;  4DSE A;  2P66 A;  4UB2 A;  3PY8 A;  4DFM A;  5DQH A;  5CHG A;  5J29 A;  4RT3 A;  4XA5 A;  1KRP A;  2HHW A;  2W9C A;  3C5G A;  2VA2 A;  5DB6 A;  4MF2 A;  3GV8 B;  4P2H A;  2DR7 A;  3N97 B;  4QZE A;  2FMS A;  4E8F A;  2AU0 A;  4JWM A;  4ECT A;  2PFN A;  4BXO B;  4ZH4 A;  4DL2 A;  3ZDC A;  3ZDB A;  1BNP A;  1MC8 A;  1ARO P;  1NK4 A;  3OJU A;  3BQ2 A;  2BCV A;  4M9J A;  1RPL A;  1VJ7 A;  4RQ4 A;  4UAZ A;  2BCR A;  4R66 A;  2BCU A;  4YXJ A;  1NK5 A;  2PFQ A;  3Q8Q B;  2AQ4 A;  1SKR A;  5J0Q A;  9ICB A;  8ICH A;  9ICQ A;  5J2B A;  4I2H A;  3LK9 A;  1ZQZ A;  3HT3 A;  4F2S A;  2HHT A;  3PW5 A;  2DPJ A;  5KFZ A;  4F5Q A;  5J2D A;  8ICC A;  1S9F A;  4O3O A;  3OUY B;  4RNO A;  4KLH A;  7ICI A;  5J2F A;  1TAU A;  8ICQ A;  4DF4 A;  4FHW A;  4M5D A;  4DS5 A;  3RJE A;  4KLT A;  4WC0 A;  5J0P A;  3OSN A;  4RU9 A;  2UVV A;  4RNN A;  4UAW A;  4TUR A;  4B9V A;  4O3S A;  2HHP A;  4ATB B;  4RT2 A;  3C2M A;  1NKC A;  2BR0 A;  2HW3 A;  4RQ0 A;  2ASD A;  5J2G A;  3E2E A;  3HX0 A;  4ECY A;  5J0Y A;  4WC2 A;  5JUM A;  4KLM A;  5CJ7 A;  4F4Z A;  3KTQ A;  4KLO A;  4DSF A;  5EWG A;  3PW4 A;  1NJX A;  4CCH A;  3BQ1 A;  2C2E A;  2BKE A;  4LVS A;  1ZQL A;  5HRF A;  3Q8S B;  5IIK A;  4RZR A;  1S97 A;  5KFS A;  3GDX A;  3RBD A;  4S3N A;  1CUK A;  2XGQ A;  1ZQC A;  4KLD A;  3RJH A;  1S76 D;  4BXO A;  4BWJ A;  3K4G A;  5EWF A;  3MR2 A;  4KN4 A;  5KT3 A;  5IIO A;  5BOL A;  3MDC A;  3MFI A;  5L1J A;  8ICK A;  3WFS C;  3MGH A;  2R8I A;  3UPS A;  2Q66 A;  5J2J A;  4DLE A;  1IM4 A;  2JZB B;  1MQ2 A;  3AU6 A;  1KFS A;  5HHI A;  4UQG A;  4JV0 A;  3ETL A;  3LQC B;  5HRK A;  1FA0 A;  5C5J A;  4YCX A;  5KFP A;  4J9P A;  4ELU A;  3PO4 A;  3OSP A;  2C2R A;  2MUT B;  1KEJ A;  7ICK A;  1NJW A;  2R8G A;  3SV4 A;  5CA7 A;  3OUY A;  3M9N B;  4PGY A;  1Z3E B;  5DG9 A;  1D8Y A;  2M2U A;  1XU4 A;  3AQK A;  4ELV A;  4FO6 A;  1N48 A;  2MAX A;  2ISP A;  2XCA A;  8ICW A;  4YQW A;  4ATB A;  3WFR E;  3HW8 A;  2FLP A;  2UVU A;  4QWA A;  1BGX T;  3PX0 A;  3KHR A;  2ZH8 A;  2BHN A;  9ICA A;  4FS1 A;  4ECU A;  2BCQ A;  4M04 A;  4X4Q A;  5J0W A;  2R8K A;  4NM2 A;  2PFP A;  4NLN A;  9ICL A;  1U45 A;  3Q8R B;  4EBK A;  4WC3 A;  7ICU A;  4XRH A;  4I29 A;  2NRZ A;  1XC9 A;  4FHY A;  3RB4 A;  5KFH A;  3AQL A;  3TFR A;  9ICH A;  4O5E A;  3HJ4 A;  3OVB A;  4QZH A;  3QEB Z;  5KFF A;  4M9L A;  4MEY A;  4Q44 A;  4GC7 A;  2ZUD A;  3ISB A;  3PV8 A;  7ICJ A;  1KDH A;  3G6Y A;  4FHV A;  3TAR A;  5DB7 A;  3SV3 A;  4X4S A;  2P6R A;  5KG5 A;  2W9M A;  4EP7 A;  4GLX A;  2BDP A;  2HHX A;  2LYH A;  1S0M A;  2UVR A;  4F5R A;  2FPM A;  5KFX A;  1H38 A;  8ICZ A;  4Q8F A;  1Q79 A;  2JZB A;  1UEV A;  4YG2 A;  4KLI A;  4EYH B;  2F1H A;  5KT2 A;  2NRW A;  4YN4 A;  4QZB A;  4J9S A;  4QWD A;  1X2I A;  3ZDE A;  2J6T A;  3M9M B;  3RR7 A;  1TFW A;  1U9L A;  2C28 A;  1U48 A;  3EYZ A;  1QSY A;  2MUT A;  2PI4 A;  3LWM A;  4EBE A;  4RWO A;  3MR3 A;  2FPL A;  4RPY A;  2JEI A;  3ORY A;  5DLG A;  4QZD A;  2Y1I A;  4I2J A;  4KIT B;  1B43 A;  5HHH A;  4UB1 A;  1TK8 A;  1L5U A;  2PI5 A;  5TZV A;  3JPO A;  1UT5 A;  4ED7 A;  3V6J A;  2BGW A;  4YXM A;  4ED8 A;  4B9S A;  4I2F A;  4DLG A;  5CWR A;  1TVA A;  3RAQ A;  2ALZ A;  4F91 B;  8ICI A;  5J2E A;  3JPP A;  5KFQ A;  4IQU A;  3UXP A;  3PMN A;  4J9O A;  4IG8 A;  1RZT A;  2DPI A;  5DKW A;  3SI8 A;  4MFC A;  4E7X A;  4RUC A;  9ICV A;  1B22 A;  3BQ0 A;  4FH5 A;  3JYY A;  4UB4 A;  1SKW A;  1N56 A;  3TAP A;  4KMU A;  5KFG A;  1RYR A;  4B9L A;  4R65 A;  2C2D A;  9ICE A;  4IRD A;  4J9L A;  3HJ1 A;  5DBB A;  5KG0 A;  2W9A A;  4P4M A;  1BPD A;  2XCP A;  1ZJN A;  1U49 A;  1XS9 D;  1T7P A;  4F93 B;  5J0U A;  2ZHA A;  4Z6D A;  1VFG A;  2ZTC A;  1BPY A;  1S10 A;  4HYK A;  4P4O A;  1ZQR A;  7ICQ A;  4DQP A;  2AGQ A;  3TQ1 A;  2ZH4 A;  4RQ8 A;  1T8E A;  4EZ9 A;  3H40 A;  8ICX A;  4TUQ A;  3ZD9 A;  3B0Y A;  4DL6 A;  2XY7 A;  2PFO A;  8ICB A;  3OJS A;  4ED2 A;  4KLE A;  7ICR A;  1ZQH A;  8ICN A;  2J6S A;  5DB8 A;  2KN7 A;  2A1J B;  4EYI B;  9ICX A;  1F5A A;  4LZG A;  4P4P A;  2ZH3 A;  3PR5 B;  2M9N A;  9ICW A;  2AGP A;  4QZ9 A;  1KTQ A;  4UD5 A;  2ZH1 A;  3M8S A;  3JPS A;  7ICG A;  1C7Y A;  3RJI A;  3JZ0 A;  3Q8L A;  4NLG A;  2DR8 A;  5HRB A;  5KFO A;  4I2G A;  4YMN A;  5KT6 A;  2JEG A;  4DSI A;  4O9M A;  3TFS A;  4O3P A;  1UET A;  4O3R A;  3THV A;  2FMQ A;  1ZQS A;  8ICL A;  5DED A;  7ICH A;  2FPK A;  5HRI A;  1D8L A;  2F1J A;  1DK2 A;  1ZQV A;  4LZD A;  4J9R A;  4X5V A;  3UQ0 A;  4GXI A;  4ECS A;  4ED6 A;  5HRG A;  4YR0 A;  2DR9 A;  4TUP A;  2F1I A;  4BWM A;  1D9D A;  5BOM A;  4AT9 B;  4I2D A;  2BE3 A;  3PNC A;  5IIN A;  5KFW A;  1NJZ A;  1A77 A;  5DLF A;  4C8L A;  3NTU A;  4DQI A;  1ZQN A;  2ZJ8 A;  4GXJ A;  2KZM A;  3JPR A;  4RQ5 A;  4GC6 A;  3T3F A;  3UXO A;  5J2C A;  2BQR A;  3RTV A;  2ATL A;  1UA1 A;  1L3S A;  4QZ8 A;  1ZQI A;  3EWA A;  4DFJ A;  5DG7 A;  3PW7 A;  5HRH A;  1NK6 A;  1UT8 A;  4ELT A;  1SL2 A;  1JIH A;  1L3T A;  4E0D A;  3N4M B;  5L1K A;  2RDI A;  3NGD A;  4F3O A;  1JX4 A;  4NLK A;  2W8K A;  1KFD A;  1OU5 A;  4C8N A;  5HRL A;  4YD1 A;  3GIL A;  7ICO A;  3MAB A;  2XY5 A;  1SL1 A;  1MQ3 A;  3H8J A;  4B9M A;  4NLZ A;  9ICF A;  5J2K A;  2A1J A;  3ZDA A;  3OVA A;  5KFE A;  1ZQO A;  4IRC A;  4X4P A;  2ZTE A;  4KN7 A;  1RXV A;  5KFK A;  5J0T A;  4KLS A;  4EBJ A;  3MBY A;  4MEX A;  2R8H A;  5BPC A;  1COO A;  3T5J A;  3RB3 A;  3RJJ A;  4X0A A;  1ZQE A;  2BQ3 A;  1QTM A;  1K1Q A;  4RWQ A;  2ZH6 A;  1JMS A;  4YR2 A;  4PHD A;  7ICP A;  4F92 B;  4F4X A;  3H4B A;  4UBB A;  4DL7 A;  4RQ6 A;  9ICU A;  9ICR A;  2O1P A;  4LT6 A;  4R64 A;  1T3N A;  4FBT A;  1KNY A;  3PR4 A;  4Q45 A;  1WOT A;  3V6H A;  3C21 A;  3NYB A;  5J0O A;  4YP3 A;  3RB0 A;  4F5P A;  4K4I A;  1U4B A;  3OHB A;  1MSW D;  1Y88 A;  4RUA A;  5J0R A;  2V4R A;  3H4D A;  1NKB A;  3C18 A;  5HP4 A;  9ICJ A;  4AT9 A;  3V7L A;  1JQR A;  3MR6 A;  1BPZ A;  1X9M A;  5KG7 A;  4JWN A;  5DDM A;  4DOA A;  3QE9 Y;  2VAN A;  3GIK A;  3QEA Z;  2KTQ A;  3IM1 A;  3JPN A;  4Z6E A;  3C66 A;  1KSP A;  2IBK A;  1L3V A;  4O5K A;  4DL4 A;  7ICM A;  2W8L A;  3HP6 A;  4EZ6 A;  3T5K A;  1ZQB A;  2KP7 A;  1ZQX A;  1BPE A;  3C1Z A;  3RRG A;  4B9N A;  3EZ5 A;  4M0A A;  1S0V A;  2XC9 A;  2HHS A;  4F5O A;  2VA3 A;  2PBE A;  3PO5 A;  3H39 A;  4WC1 A;  1XO1 A;  4X4R A;  7ICT A;  4GXK A;  4ED0 A;  9ICC A;  2BCS A;  4X4N A;  5DGA A;  3M9O B;  1ZQP A;  1ZQU A;  5KG4 A;  4MFF A;  4PGX A;  2IA6 A;  4XQ7 A;  4WC5 A;  4R63 A;  3C5F A;  1TKD A;  1MIY A;  3H7I A;  3UPQ A;  5CB1 A;  4RPX A;  4EBC A;  3GIJ A;  5L9X A;  3TI0 A;  4KLJ A;  5DQG A;  8ICY A;  4RWP A;  1WCN A;  3C2L A;  4F4Y A;  3RRH A;  4DF8 A;  4TQR A;  1S77 D;  4C8M A;  3ISD A;  1ZQW A;  4IR1 A;  3V7J A;  5DQI A;  4QW8 A;  1DK3 A;  3RH5 A;  1EXN A;  4O3Q A;  5IIJ A;  5KT5 A;  4ECQ A;  4JV1 A;  4ED3 A;  4RQ1 A;  5KT7 A;  3JPT A;  2BPF A;  4NXZ A;  4NM1 A;  3H3A A;  4WC6 A;  4X4T A;  5DG8 A;  2FLN A;  3K75 D;  2V9W A;  1ZQG A;  7ICS A;  2R8J A;  4M47 A;  4F4K A;  1HJP A;  1XSP A;  1CEZ A;  4Z6C A;  3MFH A;  1L3U A;  3OHA A;  3LWL A;  3Q8K A;  3RB6 A;  5D4B A;  4YMO A;  4BDP A;  1ZQQ A;  3FDS A;  4ECZ A;  7ICN A;  8ICS A;  2AGO A;  3ISC A;  2XY6 A;  4AT7 B;  4AT8 B;  3H8S A;  4RQ7 A;  3B0X A;  1NZP A;  4M6W B;  4DSK A;  3PX4 A;  9ICG A;  4DEZ A;  2KZ3 A;  3RJF A;  5F9L A;  7ICV A;  4FS2 A;  3H8W A;  2IHM A;  4JUZ A;  5KG3 A;  1R89 A;  5IIM A;  1ZJM A;  4QWB A;  4JV2 A;  3UXN A;  4E80 A;  3OV7 A;  4WC4 A;  4ECW A;  4C8K A;  2ZUC A;  5DBA A;  3ZD8 A;  1D9F A;  3PML A;  5KFM A;  5KFN A;  1NKE A;  4DQR A;  2KFZ A;  4IQV A;  1R8C A;  2ASL A;  4G3I A;  2JEF A;  4J9N A;  5DDY A;  4DFP A;  2IHN A;  2DFL A;  3WFQ E;  4ECX A;  5DGB A;  1ZQA A;  2KFN A;  1PZN A;  3RJK A;  4I2B A;  2DR5 A;  5KFD A;  2RDJ A;  1XWL A;  2OWO A;  1U47 A;  1HUZ A;  4QZG A;  3BQT A;  4DO9 A;  5KFB A;  3UQ2 A;  2ZHB A;  4RQ2 A;  1DGS A;  4PHA A;  9ICI A;  2ASJ A;  9ICO A;  4R8U B;  1LV5 A;  5KFI A;  4M9N A;  3AUO A;  1IXR A;  3KHL A;  1ZYQ A;  4YMM A;  1QLN A;  3OGU A;  4J9M A;  1TFR A;  1BPB A;  5CR0 A;  4JK1 A;  3BDP A;  9ICT A;  4MFA A;  4DOB A;  4QZI A;  2P6U A;  4PPX A;  8ICM A;  4Q43 A;  4MF8 A;  1NO5 A;  7ICL A;  3GII A;  4QWE A;  5J2A A;  1NK7 A;  4UBC A;  5J0X A;  5DB9 A;  4WC7 A;  5KFA A;  1NJY A;  1ZET A;  4DSJ A;  2HVI A;  2HVH A;  4X0B A;  2ZH2 A;  4M9H A;  1V4A A;  4AT7 A;  3SZ2 A;  4RQ3 A;  3AQM A;  4AT8 A;  4IQW A;  3GIM A;  2AJQ A;  4M6W A;  4DQQ A;  4DOC A;  4FHP A;  3WFP A;  4KLG A;  1JN3 A;  4F5N A;  5HNK A;  4QZA A;  3GV7 B;  4DFK A;  1MIV A;  4ED1 A;  4RWN A;  2ZJ5 A;  3C2K A;  4DWI A;  2ISO A;  3RBE A;  1R8B A;  1WCL A;  5CP2 A;  1ZQM A;  1QSL A;  2JEJ A;  5IIL A;  1Z00 B;  4I27 A;  5HRE A;  4XQ8 A;  3RAX A;  4B9T A;  4K4G A;  2BPG A;  4QW9 A;  3C1Y A;  3M8R A;  4PH5 A;  4PGQ A;  2PXI A;  3RH4 A;  4FBU A;  4M9G A;  4QZF A;  1LB2 B;  1K1S A;  1BPX A;  4DQS A;  3C23 A;  3TAQ A;  5DBC A;  3PW2 A;  1BVS A;  5HR9 A;  2B21 A;  4UB5 A;  4KLU A;  3LDA A;  4I2C A;  2ZH5 A;  4WCW A;  1TV9 A;  1TK0 A;  4UB3 A;  2O5A A;  5KG2 A;  3V72 A;  2NRK A;  4X4U A;  5D46 A;  4UD4 A;  4R8U A;  4QZC A;  1TFY A;  1X9S A;  5KFR A;  4KLQ A;  1ZQD A;  1S0N A;  3GQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...