5DB9A

Structure of human dna polymerase beta host-guest complex with the n7mg base paired with a dg
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 108
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5db9A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5db9A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5db9A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5db9A03
2M2WA 9ICRA 3PX4A 1D9FA 4Z6DA 4DQSA 4DSJA 4MEYA 5DB7A 1A76A 4O3NA 3OHAA 5D49A 3M8RA 3LWMA 4F4ZA 9ICOA 1UEUA 2Q0ZX 2ISPA 5KFGA 2ZH7A 1SL1A 1ZQKA 3HPOA 5HP4A 4I2IA 4IRKA 5KFJA 3OV7A 3K4GA 3B0YA 2AGOA 4KLTA 2HHQA 2DR7A 5KFVA 4UQGA 4KITB 2WTFA 2C2DA 8ICCA 4NLNA 4C8NA 4RWQA 5DBBA 1TK8A 4WC7A 2ZHAA 4J9RA 3ISDA 1UA1A 1KNYA 3E2EA 3WFRE 9ICUA 1SZPA 3MR6A 4EBKA 2P6UA 2ASJA 7ICNA 3JPNA 2C28A 5J0OA 5KG1A 2XGQA 1L3TA 1ZQHA 3ZDAA 1R8BA 3UPSA 4M9JA 3EPIA 4RNOA 2NRTA 4F4YA 2W9BA 4DL4A 4FHXA 3PW0A 4S3NA 4DQIA 3ZD8A 3M9OB 5DEDA 3LWLA 7ICMA 4DSFA 4WC3A 4M6WB 1B22A 2DR9A 4RNMA 1B43A 3H8JA 1ZQWA 5KT2A 3T5KA 1LV5A 4JV1A 2KZMA 5HRGA 4YQWA 1QSLA 4F2SA 1KTQA 4GXKA 5CA7A 5J0SA 3GILA 4DOBA 1U4BA 1NO5A 2F1IA 3OUYB 3H3AA 4ZH4A 5KFEA 2ZH4A 4JUZA 3PW5A 3M9MB 4X4OA 4WC2A 5KT7A 3SZ2A 1Q78A 2ZTCA 4FO6A 3PO4A 2PI5A 2VA2A 1K1SA 4YD2A 5L1IA 3MABA 4EBCA 3HJ1A 3WFPA 5KFDA 5HMLA 1K1QA 1BNPA 4WC6A 3RJIA 2M2TA 2W9MA 2JEJA 2FLLA 5J2CA 4I2AA 4FHYA 8ICBA 1L3UA 2HHPA 7ICUA 1AROP 9ICWA 5J0PA 3RH6A 5KFHA 1HUOA 2VA3A 4I2FA 4O9MA 9ICAA 3HWTA 1R8AA 1ZQAA 4M9NA 4KN4A 5J2FA 8ICUA 4O3QA 4IQUA 3TQ1A 1H38A 2JEIA 1Y88A 5IIJA 4YMMA 4R64A 5KFYA 4ED1A 4PHPA 4IQTA 1TVAA 1X9MA 1RYSA 3EWAA 5KG7A 5KFMA 4C8OA 3M8SA 4BXOB 4I28A 1QLNA 3MBYA 3C5GA 1NZPA 4IG8A 1Z00A 1TK5A 1IXRA 1DOQA 4LZDA 5KFFA 2BGWA 2NRVA 3Q8PB 4C8KA 1ZQCA 5J2KA 3ISCA 2NRWA 4F93B 2UVRA 3TAPA 1HJPA 1L5UA 4MF2A 4QZ8A 3UXNA 3ISBA 4B9VA 3LK9A 1TKDA 5C5JA 3KHRA 5DQGA 4TUPA 3BQ2A 3C18A 3ETLA 4IQWA 1U47A 4P2HA 4FBUA 4BGDA 4DSKA 4FHWA 2AQ0A 4NM2A 3GQCA 1Z3EB 4C8MA 3EPGA 4C8LA 3PW7A 4EEYA 1ZJMA 9ICHA 4E8FA 4R8UA 2ZH8A 5IIIA 2J6SA 4M2YA 2FPKA 5KFBA 9ICNA 1YLQA 4RQ3A 4NKTA 4YN4A 3OSNA 1RXVA 1NKEA 4X4UA 1UA0A 2ZUBA 2HHWA 1BVSA 1ZQMA 4ELVA 1XO1A 3LQCB 9ICPA 3B0XA 4O5EA 3EW9A 3H38A 4F91B 2HHUA 5KG0A 4J9KA 1WCLA 7ICIA 4ECWA 1KDHA 4KLLA 4KLMA 5CHGA 4PGQA 2FMPA 3GIJA 4P4OA 3RJJA 2I9GA 3UQ2A 9ICBA 2F1HA 5KFZA 3HJ4A 4AT8B 2BCVA 1ZQQA 3JPQA 5J0WA 4ELTA 2H5XA 4RWNA 2LYHA 2F1JA 3OJSA 3GIMA 2DFLA 4B9TA 3T5HA 3PY8A 4K4HA 2KTQA 2DPJA 2XO7A 1NK8A 4F8RA 1VJ7A 1IM4A 4P4MA 3Q8MA 4XQ7A 4RQ8A 4KLDA 4BDPA 5J2GA 2HHTA 3ZD9A 3V7KA 3RJFA 2NRXA 8ICMA 2JEGA 4NLGA 4YXMA 4DL7A 2AJQA 5L9XA 4Q44A 5IIKA 5DKWA 3QZ8A 3PVXA 5DECA 4RWPA 4F3OA 1XU4A 3C2MA 2Y1JA 3RAXA 4UB3A 2KZZA 4DL6A 4RT2A 4I2GA 8ICEA 8ICSA 4QZBA 5DLFA 4KLGA 2MUTA 2BR0A 8ICQA 8ICXA 5KFXA 4YD1A 4DQQA 9ICEA 2BE3A 1ZQEA 5L1JA 1DK3A 3V7JA 1NK7A 4NLZA 2R8JA 2GWSA 3RJHA 2ZJ8A 3MGIA 5J0UA 1NJZA 1JMSA 4J9QA 3BDPA 4O3SA 4DL3A 4KLIA 4X4NA 3FDSA 3JPOA 4RUCA 4DL5A 4Q8FA 3Q8LA 3KHLA 4M47A 9ICMA 5KFPA 2R8KA 3V6KA 4MFFA 8ICGA 1BGXT 1PZNA 4RQ6A 3G6VA 4X4SA 5CR0A 3RB3A 5DLGA 8ICWA 4RQ1A 5KFNA 8ICYA 4WBYA 4YXJA 2Q66A 2ALZA 2BHNA 2PFOA 1L3VA 1MIVA 3OVBA 4R65A 2BPFA 2ID1A 4P4PA 2A1JA 2HVIA 1V9PA 8ICNA 3PW4A 8ICIA 1FA0A 4F5PA 3SV4A 4YFKA 4NM1A 2ZH5A 1NK5A 9ICTA 1TV9A 4YMNA 5KFOA 2AQ4A 5HRKA 4O3PA 3UQ0A 3RB6A 3UPQA 7ICRA 7ICSA 4UAZA 4E0DA 5D46A 4R66A 4ATBB 2R8HA 5KG6A 1S0NA 3Q8RB 4IRDA 5DBAA 2BCQA 9ICCA 3GDXA 7ICTA 3QEBZ 2FMSA 1BPBA 1NK4A 1QSSA 5J2JA 4YR0A 4WCWA 5F2VO 2JEFA 3MR5A 2KP7A 1D8YA 3NGDA 2ZH1A 5DB8A 5KG3A 3PV8A 2W9CB 4Q43A 3HW8A 1XSPA 4KLFA 7ICJA 2O5AA 3L9DA 3RRHA 3RAQA 4DSEA 5KT6A 5KFRA 3ZDDA 4RWOA 4PH5A 2IHNA 3RJEA 5KT5A 2M2UA 2PXIA 1MSWD 2PBEA 3TFRA 3RH5A 3C66A 2BQRA 3C1YA 4NXZA 2ZJAA 4F5QA 4DOAA 3JPTA 3ORYA 4RQ2A 3TARA 3SV3A 5J2DA 4UD5A 3WFSC 4RPYA 3BJYA 4I2JA 4ECQA 1KFDA 3RR8A 4QZAA 3PMNA 4XUSA 8ICRA 3JPRA 4KLSA 1MIWA 2IA6A 5HNKA 1VFGA 3IHQB 2FLPA 4X4RA 2W8KA 4QZFA 1KFSA 4UB2A 4I2DA 5KG2A 4IR9A 3H4DA 3WFOA 1A77A 2HW3A 4E7XA 3C2LA 4YVZA 3H39A 9ICQA 4RPZA 3H4BA 1HUZA 1ZQVA 1SL0A 2P6RA 3OVAA 1TFYA 3GIKA 4EYIB 5KG4A 5J2EA 3T5JA 1N56A 4DWIA 1R89A 1T4GA 2B21A 4QZGA 4M0AA 7ICHA 4AT7B 3MR2A 4J9LA 4X0BA 3HX0A 4FBTA 1MQ3A 2FPLA 2JZBB 4RQ5A 2V4RA 5HMMA 4B9SA 4KLHA 8ICKA 3AQKA 4X4QA 4LT6A 2KFZA 4WC1A 8ICPA 1ZQFA 4PGYA 4M6WA 1XSLA 2XCAA 2Y1IA 1L3SA 3MGHA 2ASLA 1BPYA 2W9AA 5EWFA 2ZH2A 2AGQA 4GLXA 3OHBA 1R8CA 4I27A 4YCXA 5CJ7A 1BPDA 2C2RA 4CCHA 4XQ8A 7ICKA 4FS2A 3AU2A 5DQHA 2AGPA 4FH5A 3OUYA 8ICHA 5KFSA 3PX0A 4G3IA 2DVIA 4ELUA 3OSPA 3JPPA 3C2KA 4I2CA 3TFSA 4I2EA 4O0IA 5DGBA 4NY8A 8ICOA 3AUOA 3M9NB 1U48A 2XGPA 4DQRA 1MIYA 4ECXA 1UT8A 2M9NA 4Z6FA 5KT3A 3MFHA 3MDAA 8ICTA 2FMQA 4O3OA 4X5VA 5F9LA 4F5OA 3TAQA 5DB9A 1ZQDA 7ICPA 4FHPA 4K4GA 1XC9A 2ASDA 1NKCA 4MEXA 3G6YA 4ECRA 1ZQOA 4AT9B 3OVSA 2R8GA 3HP6A 3JYYA 4QW9A 3C1ZA 4QWCA 4J9NA 2ATLA 4KLUA 3GV8B 3H40A 1C7YA 4WC4A 1KRPA 1S0MA 5J0QA 5KFWA 3SI8A 4KTQA 1RYRA 1UEVA 4KMUA 1MQ2A 2KZ3A 5KFKA 4B9MA 3KHHA 1ZQIA 4BXOA 1QSYA 4QW8A 3MFIA 2UVVA 4RZRA 5IINA 1SKRA 9ICXA 3H8SA 5JUMA 3EYZA 1ZQRA 2W9BB 3V6HA 4FH3A 2ISOA 4UD4A 2ZH3A 4DEZA 4MF8A 5DQIA 1T3NA 4QZEA 1KLNA 3PMLA 1DK2A 3C5FA 4ECSA 4O3RA 4MFCA 1S76D 4QWDA 4JK1A 5TZVA 4ED6A 3PX6A 1ZQBA 1XS9D 5KFTA 4E80A 2UVWA 5HC9A 2FLNA 4BWMA 3RJGA 2P66A 4DQPA 4M04A 4Q45A 1T8EA 4JV2A 4XRHA 2KFNA 2NRZA 1S97A 4YMOA 1S10A 4HYKA 4QWBA 3RB4A 3PR4A 7ICLA 9ICIA 5BOMA 3BQ1A 4ECYA 3AU6A 4M5DA 9ICKA 1TFWA 3GFKB 1ZQXA 4KLEA 3V6JA 2BPGA 7ICGA 8ICZA 1UT5A 3GV7B 1ZYQA 2XCPA 3T5LA 5CB1A 2BCUA 1S77D 4AT9A 2XY6A 2DR5A 4WC5A 5HRHA 2IHMA 2KN7A 5L1LA 4DLEA 4K4IA 4JWNA 4UAYA 4F4WA 5EWGA 1X9WA 3EZ5A 4EBDA 1ZQUA 2DPIA 4GXJA 1TFRA 1NJYA 3H37A 4PHDA 1SKSA 1JAJA 5KT4A 2RDJA 3C23A 2BKEA 5J2AA 1NJWA 1Z00B 5EOZA 3MR3A 2AU0A 2HVHA 1WOTA 4AT8A 2ZUDA 4PGXA 4IQVA 5KFQA 1ZQLA 2IBKA 4F2RA 4PPXA 2XY5A 4IR1A 3JZ0A 2BCRA 1BPEA 4YR3A 4F5RA 4I29A 2PFNA 2HHSA 1S0OA 8ICLA 4X4TA 4EZ9A 2IMWP 3BQTA 2J6TA 2ZH6A 4DFKA 2O1PA 4M9GA 1TAQA 3KHGA 1EXNA 5HRIA 4PHEA 3H7IA 4ED3A 4RQ7A 1ZQPA 1D9DA 2M2VA 8ICFA 2DRAA 4Z6CA 4NKUA 4R8UB 4I2HA 4QZIA 1UETA 4XA5A 5DB6A 4LZGA 8ICVA 3H8WA 5J0YA 2ZTDA 4RQ0A 4MFAA 5HR9A 5CWRA 4RPXA 1CEZA 9ICVA 5KFAA 2BQ3A 1KFTA 1TAUA 5DG8A 9ICGA 8ICJA 2C22A 9ICJA 4QZCA 1F5AA 4EBJA 1XSNA 3ZDCA 5HHIA 3KTQA 5HREA 3TANA 3GIIA 7ICVA 3Q8SB 1QTMA 3AQMA 4UB5A 7ICFA 4TQSA 3FYHA 3UXPA 1TK0A 5BOLA 3JPSA 2BQUA 1JN3A 4DFPA 2ZHBA 3N4MB 3HIYA 4TUQA 4LVSA 4X4PA 4ECVA 4I2BA 4O5KA 7ICEA 1Q79A 1XWLA 4TUSA 2V4QA 2V9WA 1ZQNA 2BPCA 5DBCA 5KFCA 5DG9A 4JV0A 4GXIA 2NRKA 4UAWA 5IILA 1NK0A 2PFPA 4WC0A 5HRFA 1CUKA 4DOCA 2MAXA 3RTVA 3RBEA 5EWEA 3RRGA 3OGUA 3RR7A 4BWJA 1U49A 1D8LA 4PHAA 4DF4A 1JX4A 5HRDA 1V4AA 9ICLA 4DO9A 4ED8A 4WBZA 3G6XA 1KEJA 1BPXA 5J29A 4ECZA 1JXLA 4X4VA 9ICFA 4J9MA 4ATBA 5KFIA 5DGAA 5IIMA 4RUAA 3HT3A 1RPLA 1NJXA 2PFQA 4ED2A 4UBCA 3QE9Y 3THVA 4RU9A 3MDCA 7ICQA 3C21A 4F4XA 2RFFA 4F4KA 2MUTB 4GC7A 1ZQGA 1BNOA 1ZJNA 2RDIA 4JWMA 1JXEA 7ICOA 3IM1A 3T3FA 3GV5B 1ZQTA 3WFQE 4J9OA 4EBEA 1RZTA 2W9CA 3K75D 1ZETA 1SL2A 4RT3A 1MC8A 3PR5B 4F5NA 2I1QA 2ZJ5A 1SKWA 1T7PA 1NOMA 4B9NA 5KG5A 1S0VA 4GC6A 3UXOA 4J9PA 4DSLA 5KFLA 5CP2A 2XY7A 3V7LA 1LB2B 5DDYA 4UB1A 4KLJA 1NK6A 2UVUA 2W8LA 4ECTA 3AQLA 3AQNA 4X0AA 2ZH9A 2HHXA 5IIOA 4IRCA 1X2IA 2DRBA 3Q8QB 1WCNA 3RJKA 4QZDA 2BCSA 2J6UA 1U45A 3Q8KA 2ZTEA 1NK9A 4TURA 2A1JB 5KFUA 1JQRA 3NTUA 4M9HA 4DL2A 2VA8A 4YR2A 1DGSA 3V72A 3PNCA 3PW2A 5HRBA 3LDAA 2OWOA 4KLQA 2FPMA 4NLKA 5J0RA 4UBBA 1PX5A 5J2HA 4DLGA 2R8IA 1RXWA 4TQRA 4Z6EA 4RNNA 3N97B 4QWEA 2BDPA 2HHVA 5DG7A 4F92B 1U9LA 3TI0A 5BPCA 8ICAA 1OU5A 3QZ7A 2ZUCA 5J0XA 1N48A 1BPZA 5F9NA 5D4BA 3RB0A 4EYHB 1ZQYA 4O5CA 3RBDA 4DF8A 2VANA 4R63A 3ZDEA 5L1KA 4DFMA 1X9SA 3NYBA 1ZQSA 1ZQZA 4EZ6A 4DS5A 1KSPA 3ZDBA 4FS1A 4J9SA 4RQ4A 3BQ0A 4ED0A 3QEAZ 1NKBA 4AT7A 4Q8EA 4QWAA 4DS4A 2JZBA 1JIHA 4QZ9A 3OJUA 5J2IA 5KTQA 4YP3A 5HHHA 1COOA 4KN7A 2PI4A 3RH4A 4F50A 2XC9A 1S9FA 4B9LA 3SYZA 4B9UA 4DSIA 9ICSA 3PO5A 4YG2A 5HRLA 2DR8A 4M9LA 4EP7A 4QZHA 1ZQJA 5J2BA 4ED7A 2C2EA 4DFJA 5J0TA 4UB4A 4ECUA 4KLOA 4FHVA 5DDMA
chains in the Genus database with same CATH superfamily
9ICRA 4DSJA 4MEYA 9ICOA 2W03A 3LWMA 3NUQA 1SGGA 1LKYB 2OM6A 1KW4A 5KFJA 3SAFA 5KFVA 4KITB 1S8OA 4RWQA 4WC7A 1J2MA 2FE9A 3PZPA 2C28A 4UB8U 3UPSA 1PVRA 3EPIA 4DSFA 1VDVA 4WC3A 4M6WB 1B22A 2DR9A 4RNMA 1B43A 4JV1A 1PK1B 2LPEA 4F2SA 2ZG6A 5J0SA 2DGZA 4WC2A 5KT7A 3SZ2A 1Q78A 2PI5A 2ZIVB 3HJ1A 5L1IA 3KKAC 4MKPA 3QU5A 1Z19A 2W9MA 4I2AA 7ICUA 9ICWA 5J0PA 5KFHA 2VA3A 4DCCA 3VCBA 4O9MA 5ALMA 8ICUA 3QU7A 3TQ1A 1Y88A 5IIJA 1TVAA 2GAFD 1QLNA 4C8OA 4I28A 1NZPA 3TKAA 3M8SA 4BXOB 3MBYA 4LZDA 2NRVA 2CRXA 5J2KA 2NRWA 1L5UA 4MF2A 1Q8KA 4B9VA 3HKZF 5C5JA 2IOFA 3BQ2A 3C18A 3ETLA 2GA9D 2AQ0A 4C8LA 3HJEA 3PW7A 4E8FA 2W7OA 2Y9TA 3OSNA 1NKEA 3QUBA 5AI0A 3QUTA 2H3QA 1VLBA 2RRDA 2XI9A 1L7OA 1DXSA 1WCLA 7ICIA 3NRZA 5ALLA 5AKHA 2I5HA 4C4TA 4NV0A 2FMPA 3HJ4A 4X4OA 5KFZA 1ZQQA 4ELTA 5J0WA 3AL0B 4K4HA 4QIWC 1A6SA 4F8RA 4P4MA 4RQ8A 3K1ZA 5CFSA 4BDPA 5J2GA 1L8LA 3ZD9A 8ICMA 2JEGA 2QB0B 4DL7A 1J97A 3QZ8A 3WK4A 2KZZA 2LYBA 4DL6A 4I2GA 5DLFA 2BE3A 4NLZA 2ZJ8A 3A0HU 4O3SA 4J9QA 4FZNA 4Q8FA 3Q8LA 3BZKA 8ICGA 1BGXT 3RB3A 5JU5A 8ICWA 4NL9C 1TAMA 2Q66A 1MIVA 5AM3A 2HVIA 8ICNA 3KZIU 1FA0A 3SV4A 4Y2PA 4USAA 4YMNA 2KE7A 3RB6A 2ES6A 5D46A 2R8HA 5DBAA 3GDXA 2FMSA 1NK4A 5AK3A 5CFTA 2B0CA 1VJ5A 3PV8A 4Q43A 4KLFA 3RAQA 2F8LA 4DSEA 4C4RA 5KFRA 4PH5A 3R9KA 2K4PA 2ESEA 2PXIA 3C28A 3O0FA 4EELA 1MSWD 3C66A 3RH5A 2BQRA 1WWVA 3ERCC 3C1YA 1Z1VA 3JPTA 3ORYA 2R18A 1PUZA 4OJ6A 3TARA 5J2DA 3WFSC 5ALEA 3F2CA 1KFDA 4QZAA 3JPRA 4KLSA 3AQFA 1VFGA 1KFSA 1JROA 4C80A 1LKYA 4QZFA 4JLZA 3H4BA 1HUZA 3SENA 4EYIB 5KG4A 3WK9A 1DRGA 4DWIA 3BS7A 5AM4A 2B21A 1KL9A 4QZGA 3MR2A 4ACOA 3HX0A 2FPLA 4RQ5A 3SQIA 2V4RA 1SXDA 4X4QA 2KFZA 5ALUA 8ICPA 1ZQFA 4M6WA 1KN5A 3MGHA 1PK1A 4GLXA 2EDUA 4I27A 2C2RA 1BPDA 7ICKA 2AH5A 2JR5A 5KFSA 5F3XB 2DVIA 4KM5A 3LYSA 4I2EA 2EZZA 8ICOA 2WAQC 2ZIVA 3M9NB 1N61A 2XGPA 4DQRA 4ECXA 4Z6FA 2M9NA 3MFHA 3ALRA 4I0UA 4FHPA 1F44A 4K4GA 3IG5A 5AIBA 2ASDA 4OD0A 4AT9B 5JRTA 5AKEA 2E8NA 5J0QA 5KFWA 3SI8A 4KTQA 1RYRA 1UEVA 2E1FA 2KZ3A 5KFKA 4BXOA 4M9GA 5KAFU 1DK2A 3D2NA 4MFCA 4JK1A 2RQ5A 1AQ6A 2BBHA 4M04A 5ALHA 4JV2A 1S97A 3KD3A 1FFUA 4HYKA 3PR4A 5BOMA 3BQ1A 3AU6A 2RLTA 3GFKB 1ZQXA 8ICZA 3GV7B 2XCPA 3T5LA 5AKZA 3NKUA 3NASA 4UAYA 1NZBA 2DPIA 4GXJA 1TFRA 4PHDA 5KT4A 2RDJA 1NJWA 5AK4A 1ZD5A 4PGXA 4IQVA 2IBKA 2XY5A 4IR1A 4F5RA 8ICLA 3BQTA 4J03A 4OJPA 5HRIA 4RQ7A 2QB0A 3IN5A 4K99A 3H8MA 1O03A 5CWRA 1CEZA 4QIWF 9ICVA 1KFTA 4EBJA 2C22A 3KTQA 4Y2VA 3KKAA 4TQSA 4OJ5A 1JN3A 3N4MB 4O5KA 7ICEA 4WJ3B 2BPCA 5DBCA 1KKXA 2PFPA 5HRFA 4FO1A 4DOCA 3RTVA 3TACB 1NI3A 3RR7A 1ZRNA 1U49A 1JX4A 3KZXA 1V4AA 5G5GA 2DWQA 9ICLA 4WBZA 3G6XA 1SXEA 4ECZA 9ICFA 4LEYA 1Q46A 1RPLA 5AKKA 4UBCA 1RQLA 5AM1A 4RU9A 3MDCA 4Y2UA 4BJQA 2MUTB 3UM9A 5B66U 3WFQE 2YY6A 3K75D 2UVVA 4J9PA 4KLJA 3AQNA 2ZH9A 5IIOA 3BZCA 2BCSA 2J6UA 1U45A 2ZIXB 1JQRA 2EWRA 4DL2A 3PW2A 3PSFA 3PNCA 3ETRA 2OWOA 3N7RC 4NLKA 4US8A 4UBBA 4TQRA 4NWIA 2AHOB 3NVZA 1O08A 5AI4A 4F92B 2ZUCA 4DFDA 1BPZA 2XIDA 1FFVA 2VANA 5L1KA 2VIXA 1X9SA 1ZQSA 4RQ4A 3QEAZ 3OJUA 4YP3A 1COOA 3SD7A 3RH4A 3F2BA 2KHVA 4NJ8A 3PO5A 4Y2SA 4M9LA 1ZQJA 5J2BA 3C29A 4ECUA 2KSOB 5DDMA 1N62A 3ER9B 4FE3A 5B3PA 4CNQA 1ZD4A 5DB7A 1A76A 1YT3A 2OXOA 4F4ZA 1UEUA 1SB3C 2Q0ZX 2ISPA 2KIWA 2ZH7A 1SL1A 3HPOA 4IRKA 5HR6A 4UAUA 2EQYA 5AI6A 4AT9A 1TK8A 4J9RA 3ISDA 9ICUA 3MR6A 5J0OA 1ZQHA 2QARB 3WK8A 5AKYA 2NRTA 4S3NA 3M9OB 5DEDA 5ALIA 7ICMA 1OUQA 3H8JA 4UARA 1QSLA 1KTQA 4GXKA 5CA7A 3GILA 4DOBA 2YN4A 2ZXIA 4ZH4A 3M9MB 4FO6A 5KFDA 1K1QA 5JTIA 8ICBA 2YMPA 2M2TA 1TFYA 3RH6A 9ICAA 1R8AA 3FM9A 1JALA 1ZQAA 5G5HA 4M9NA 5J2FA 2KEYA 4K97A 4R64A 1RYSA 4OAFA 1YLQA 2F8KA 5KG7A 1N2XA 4Y2XA 2O6KA 5EE3A 1ZQCA 4EGWA 3IP4B 4F93B 3ISBA 3LK9A 2FDRA 1TKDA 5DQGA 5KL8B 3PSPA 4IQWA 4P2HA 4NXVA 4DSKA 3EPGA 4BX9C 9ICHA 3QYPA 2YB4A 3QU4A 1RG6A 3AN1A 2G5IB 2JH7A 3AQEA 1QCKA 1ZQMA 1XO1A 9ICPA 4C7ZA 5KAIU 3SAHA 4F91B 2GO7A 3ICXA 2VKQA 4ECWA 4QJFB 2W7PA 3RJJA 3GIJA 4AT8B 9ICBA 2I9GA 3UQ2A 2H5XA 2LYHA 3GIMA 2DFLA 2DPJA 1NK8A 3Q8MA 2K8CB 2DKZA 2MRLA 3WKCA 2NRXA 4ZOHC 4NLGA 4YXMA 2A1AA 2QLTA 5L9XA 4Q44A 2JMGA 4F3OA 1XU4A 1J2NA 3J81j 8ICEA 4KLGA 2MUTA 2BR0A 9ICEA 1ZQEA 1DK3A 1RM6C 4EX6A 3BDPA 5J0UA 4X4NA 3FDSA 3JPOA 2R8KA 3V6KA 2Q4TA 5CR0A 5DLGA 4WBYA 2WF8A 1N5XA 2PFOA 4R65A 2BPFA 2ZIXA 1V9PA 3MC1A 3PW4A 4O67A 4XJEA 3FC4A 5CFUA 5HRKA 5B5EU 4C0ZA 5AKXA 7ICRA 3I76A 1S0NA 4IRDA 9ICCA 3QEBZ 1OW5A 5F2VO 2NO4A 3VC8A 2JEFA 3MR5A 3WK6A 3K7DA 5B3QA 2KP7A 1D8YA 1JRPA 2VJ4A 2WFAA 5DB8A 5KG3A 3D6JA 3NVVA 4N7RA 5KT5A 2G09A 3EUB2 4DOAA 4RQ2A 2KSOA 4RPYA 3BJYA 1WWUA 2A3VA 2OH2A 4ECQA 3BS5B 4HAIA 8ICRA 3NS1A 5HNKA 4P0PB 2FLPA 1CRXA 4UB2A 5KG2A 3H4DA 2N1RA 4E7XA 3AMZA 3H39A 3I1YA 2H3IA 2F3NA 5ALQA 1R89A 1N60A 2QARA 2DUYA 1GPJA 4X0BA 8ICKA 4KLHA 4B9SA 1F5SA 3AQKA 4WC1A 1XSLA 2XCAA 2Y1IA 1L3SA 2ASLA 3QU2A 1R8CA 5CJ7A 2AGPA 1Q3VA 4G3IA 3OSPA 5ALGA 2KOBA 3F53A 2HBKA 1UT8A 4UASA 4O3OA 4X5VA 3TAQA 4F5OA 1ZQDA 3KFUF 2OCEA 4MEXA 4GFJA 4ECRA 2KHQA 3OVSA 5ALYA 2IOHA 3WU2U 3GV8B 1C7YA 1KRPA 1SZHA 4CF4A 1S0MA 1MQ2A 5AK5A 4HX0A 1ZQIA 9ICXA 4NXTA 4FH3A 2ZH3A 1UPHA 2NV3A 3SAGA 1KLNA 4QZEA 3PMLA 4ECSA 2G5HB 4ED6A 1Q3UA 1ZQBA 3L3FX 2FLNA 1UQVA 1XO0A 4XRHA 2KFNA 4QWBA 7ICLA 9ICIA 2K4EA 4EEBA 9ICKA 1TFWA 4KLEA 4EEKA 3V6JA 1UT5A 1S77D 1LVHA 2XY6A 3PSTA 4WC5A 2KN7A 4K4IA 4DLEA 5EWGA 1ZQUA 2HN1A 1UCVA 1NJYA 1SKSA 2WF6A 3C23A 2BKEA 5EOZA 2AU0A 4AT8A 4F2RA 5ALDA 4I29A 2HHSA 1S0OA 2IMWP 5CHEA 1TAQA 3KHGA 4PL2A 1L7MA 8ICFA 4Z6CA 4XA5A 2ZTDA 4RQMA 5HR9A 2K4IA 3NVOA 5KFAA 4K9BA 8ICJA 3TANA 1X66A 7ICVA 1QTMA 7ICFA 3FYHA 3UXPA 1TK0A 5BOLA 4TUQA 4ECVA 1XWLA 4TUSA 3UMCA 2M0NA 2V9WA 3T79A 2EAMA 3MGVA 4JV0A 4NXXA 4UAWA 5AKGA 4QNLA 2MAXA 4KB6A 5EWEA 4BWJA 2HBMA 3HILA 4DF4A 3IDWA 2FI1A 1BPXA 1JXLA 1N63A 5DGAA 5IIMA 1NJXA 4ED2A 1X6IA 4GIBA 3C21A 2CN1A 4GC7A 4JWMA 4PZOA 5CRXA 7ICOA 3IM1A 3T3FA 1ZQTA 2B56A 4EBEA 1ZETA 1SKWA 4RT3A 3PR5B 2I1QA 2ZJ5A 1T7PA 1NOMA 1S0VA 3UXOA 4Y2RA 5CP2A 3WKDA 1X9XA 3V7LA 5J8YC 2W8LA 2FJ6A 2JHDA 2HHXA 4IRCA 2DRBA 2B4VA 3RJKA 2ZTEA 1NK9A 2A1JB 2WF9A 3NTUA 2VA8A 1DGSA 3V72A 3BS5A 2G06A 2FPMA 5K4LA 2R8IA 4P0PA 1RXWA 2ZIWB 2BDPA 4QWEA 3IG8A 1OU5A 3QZ7A 1N48A 4EYHB 1ZQYA 2KV2A 5AM0A 4R63A 4EZ6A 1KSPA 4Y2JA 3QUQA 3BQ0A 4QWAA 4DS4A 1GO3F 1JIHA 3LVWA 5H2FU 1SV0C 5KTQA 2NYVA 4PZNA 2EZXA 5A0LA 1S9FA 4B9UA 4DSIA 9ICSA 5ALFA 3NWIA 4ED7A 2C2EA 4DFJA 2M2WA 4Z6DA 3OHAA 3M8RA 1HEKA 2XVTA 5KFGA 1ZQKA 5HP4A 1ZD3A 5AI8A 2HHQA 2E5SA 4KLTA 2DR7A 2ZHAA 4NLNA 1ED1A 4C8NA 5DBBA 3EF2A 1KNYA 3E2EA 3WFRE 4EBKA 2ASJA 7ICNA 3JPNA 4CE6A 2KVSA 4DL4A 4FHXA 3PW0A 4DQIA 3ZD8A 4NLCA 3LWLA 2I6XA 3TADC 5E79U 2LBOA 5KT2A 1ZQWA 1Z1BA 1LV5A 5HRGA 4YQWA 3M6ZA 5GTHU 1U4BA 1NO5A 2WHEA 3OUYB 2YMLA 3H3AA 4LEZA 1RQNA 4JUZA 4AP9A 2ZTCA 4EBCA 4YD2A 5HMLA 2E3TA 2G0AA 2FLLA 1L3UA 2HHPA 1AROP 1ECWA 3AQMA 4I2FA 3HWTA 5AK6A 4Y2TA 4O3QA 2JEIA 4YMMA 4PHPA 3EWAA 5KFMA 9ICTA 3C5GA 1TK5A 5KFFA 4C8KA 3L4PA 2JRZA 2UVRA 1HJPA 3UXNA 4TUPA 2EAPA 1U47A 4FBUA 4BGDA 4FHWA 3H0RB 3ER8C 4C8MA 4EEYA 2FPKA 5KFBA 4NKTA 4YN4A 1RXVA 1UA0A 3LQCB 1SV4A 4O5EA 3F5AA 4F71A 5KG0A 4KLLA 2OHFA 4PGQA 4P4OA 2BCVA 4RWNA 2LYAA 3OJSA 4OO1J 5TISU 2PKEA 4XQ7A 1V97A 4KLDA 1RYUA 3A0BU 4WOYA 2HHTA 3V7KA 1F0MA 2GLEA 2B6GA 5IIKA 5DECA 4RWPA 2KJ9A 3C2MA 3RAXA 5C0YA 2K8AA 5ALNA 4UB3A 4RT2A 4QZBA 4CF5A 3AM9A 8ICQA 4X4UA 4YD1A 3MGIA 1JMSA 4KLIA 2F2AB 1FO4A 4CDGA 4NL9A 4RUCA 5AI9A 9ICMA 3AEVA 4OAGA 2IUBA 4MFFA 1PZNA 3G6VA 2D6FC 4RQ1A 2GH1A 5KFNA 4YXJA 2ALZA 2BHNA 3OVBA 5T14A 2A1JA 4UB6U 2ZH5A 3SMVA 4NM1A 1NK5A 1TV9A 2WAQF 3UPQA 2W04A 1B0XA 2ZIWA 5AICA 4E0DA 4ATBB 2DKXA 1DGJA 7ICTA 1BPBA 5AI5A 3UMGA 5J2JA 4OJLA 3NVYA 4YR0A 4ICAA 2H3FA 2ZH1A 2F44A 3RFAA 2W3SA 4Y2QA 1WYGA 2W9CB 1XSPA 7ICJA 3L9DA 5CEHA 4FZMA 2PBEA 4NXUA 4NXZA 2HOQA 3H0LB 1KQQA 4I2JA 3RR8A 2K4HA 2HBLA 1X42A 2JGAA 4I2DA 3WFOA 3C2LA 2GOLA 2P6RA 1SL0A 3GIKA 5J2EA 3QX7A 3CYMA 1N56A 2YQEA 2K89A 1T4GA 4O3MA 4M0AA 7ICHA 3OWGA 4AT7B 3CNHA 4FBTA 2KKPA 1MQ3A 3QU9A 1T94A 5HMMA 1P7DA 4LT6A 2ZH2A 2BDUA 1BPYA 2W9AA 5EWFA 3OHBA 4CRXA 4YCXA 4CCHA 4XQ8A 4FS2A 5DQHA 3OUYA 2KJ8A 4ELUA 3JPPA 2MA1A 3C2KA 4I2CA 3TFSA 2E8MA 4O0IA 4K98A 2KKVA 1U48A 1PVQA 1MIYA 2RHFA 7ICPA 3NVWA 5DB9A 3G6YA 4B6JA 5D61A 2R8GA 3HP6A 3JYYA 4QW9A 3C1ZA 4QWCA 4WC4A 1QSYA 4QW8A 3MFIA 5IINA 1SKRA 5D63A 5JUMA 4CGZA 2W9BB 4KX5A 4OAHA 4UD4A 4MF8A 2JV3A 2BZFA 3C5FA 4O3RA 4QWDA 3PX6A 1XS9D 5KFTA 4E80A 3E0FA 2P66A 5AM5A 4Q45A 1SV0A 2NRZA 4P0QB 4YMOA 1S10A 4ECYA 3GU3A 3CW2C 2D3DA 5JTGA 2BPGA 1ZYQA 3WKAA 3U26A 2DR5A 5HRHA 2IHMA 1IIPA 4WQLA 5D62A 2FCLA 3H37A 1WG8A 1JAJA 1SIJA 2PMZC 1WOTA 1Z00B 3MR3A 2ZUDA 5KFQA 2BCRA 1BPEA 4YR3A 4EZ9A 1ZXIA 2J6TA 2ZH6A 4DFKA 2O1PA 4PHEA 2E8OA 2M2VA 2DRAA 4NKUA 3TADA 4R8UB 2YTUA 4I2HA 4QZIA 1UETA 5DB6A 8ICVA 3H8WA 4MFAA 4RPXA 1M6YA 3F2DA 2DBYA 3IRUA 1TAUA 9ICJA 4QZCA 1L8OA 2EAOA 1A0PA 5HHIA 3WK5A 3GIIA 4UB5A 1B4FA 2W11A 2BQUA 2ZHBA 3OPXA 4LVSA 1Q79A 2V4QA 1JI7A 2NRKA 3DDHA 4WC0A 1CUKA 4NLBA 2ODGA 2LM1A 1D8LA 3M1YA 3KOOA 2KD1A 2LI6A 4DO9A 3CK6A 5ALXA 1FIQA 4X4VA 4JB3A 4J9MA 2OEHA 4ATBA 5KFIA 2PFQA 4EV6A 7ICQA 4F4KA 1BNOA 1ZQGA 3GV5B 3BQ7A 4J9OA 2W9CA 1SL2A 1MC8A 2WB1C 4B9NA 4GC6A 4DSLA 2XY7A 1LB2B 5DDYA 3N7SC 3QXGA 4ECTA 2QKQA 1X40A 1X2IA 1WCNA 2F77X 5KFUA 2CXYA 4WQKA 4YR2A 5HRBA 3WKBA 4KLQA 1PX5A 4EX7A 5J2HA 4DLGA 2Z7JA 4Z6EA 2HHVA 5DG7A 3M7DA 5BPCA 3S6JA 2W3RA 5D4BA 5ALTA 3RBDA 5KNIA 3ZDEA 2JH1A 5ALKA 1ZD2P 4DFMA 1ZQZA 4LJXA 2HMXA 4KMOB 3NYBA 4DS5A 3ZDBA 2RP5A 4ED0A 4AT7A 5ALVA 1NKBA 4OAIZ 1PK3A 4QZ9A 4AYBC 3IV6A 5AKLA 1X6JA 2P35A 4US9A 4YG2A 4EP7A 4QZHA 4KLOA 4UB4A 2L5YA 4FHVA 3PX4A 1D9FA 4DQSA 1L6NA 4O3NA 5D49A 4FZLA 5ALOA 4I2IA 2ZXHA 3OV7A 3K4GA 3B0YA 2AGOA 2HCFA 4UQGA 2WTFA 2C2DA 8ICCA 4KX3A 2EH9A 1UA1A 1SZPA 4A8EA 2P6UA 5KG1A 2XGQA 1L3TA 3ZDAA 1R8BA 4M9JA 2KG5A 4RNOA 4F4YA 2W9BA 4JMUA 1YZ7A 4UAVA 5AM2A 4F72A 3T5KA 2KZMA 2F1IA 3OTQA 4Y2YA 1T3QA 4P0QA 5KFEA 2ZH4A 1S5LU 3PW5A 4U6PA 3PO4A 2VA2A 3WK7A 1K1SA 3MABA 3WFPA 4U7CA 4WC6A 1BNPA 3RJIA 3FAHA 2E1EA 2JEJA 5J2CA 4LEVA 4FHYA 1HUOA 1C20A 2QB1A 4KN4A 4IQUA 1H38A 3NRWA 4ED1A 1V85A 2LKYA 5KFYA 4IQTA 1X9MA 4BUGA 5AKIA 4WCWA 4IG8A 2EZYA 1Z00A 1IXRA 1DOQA 2ZIUB 2BGWA 2VJ5A 3Q8PB 2G07A 3ISCA 3TAPA 4QZ8A 3KHRA 4IL6U 1SWWA 4PL1A 2JXJA 1MN8A 2DQNB 2PMZF 4NM2A 1Z3EB 3GQCA 1ZJMA 4R8UA 2ZH8A 5IIIA 2J6SA 2G08A 9ICNA 4RQ3A 2HHWA 2ZUBA 1BVSA 4ELVA 3E58A 3B0XA 3EW9A 3H38A 2D8CA 1FEZA 2HHUA 3JCFA 4J9KA 2LHTA 1KDHA 5AKJA 4KLMA 5CHGA 2F1HA 3JPQA 4B9TA 2F1JA 3T5HA 3PY8A 2KTQA 3QNMA 2XO7A 1VJ7A 1IM4A 1ZOLA 1IV8A 3RJFA 1HIWA 5ALZA 4C4SA 2AJQA 5DKWA 1KBUA 3PVXA 4K96A 2Y1JA 1L7NA 3F5EA 5GTIU 8ICSA 3HRDD 1Z4NA 8ICXA 5KFXA 4DQQA 5L1JA 2WF7A 3V7JA 1NK7A 2R8JA 2GWSA 3RJHA 4FFDA 1NJZA 4DL3A 1QH9A 4DL5A 4M47A 3KHLA 2Y9UA 5KFPA 3QUCA 4RQ6A 4X4SA 1TE2A 3ONNA 8ICYA 1L3VA 2ID1A 4P4PA 8ICIA 4F5PA 4YFKA 2WB1F 2Y0SC 5KFOA 5ALWA 2AQ4A 4O3PA 3UQ0A 7ICSA 4UAZA 2HOFA 4O6AA 4R66A 5KG6A 4IS7A 3Q8RB 2HSZA 2BCQA 2EANA 1QSSA 5EE0A 2KNJA 1N5WA 3NGDA 2HDOA 3CP8A 3HW8A 1V38A 2O5AA 3RRHA 1WUDA 5KT6A 4RWOA 3ZDDA 2IHNA 3RJEA 2BBJA 2M2UA 3TFRA 5EE1A 2ZJAA 5FP0A 4F5QA 2HN2A 3PSIA 3SV3A 4UD5A 5HR7A 3GZFA 3PMNA 4XUSA 1MIWA 3K1RB 1K5OA 2IA6A 4AYBF 3IHQB 2KVCA 3I28A 4OJOA 4X4RA 2W8KA 1CI4A 1OXJA 2K8BB 4IR9A 1A77A 2H3VA 3L5KA 2HW3A 4YVZA 9ICQA 2KK0A 2HOIA 4RPZA 1ZQVA 2WF5A 3OVAA 1URJA 3T5JA 1UHUA 2W43A 4J9LA 3UMBA 2JZBB 2CPRA 4PGYA 5AIAA 4KLUA 3WKEA 2AGQA 3AU2A 4FH5A 8ICHA 3H0MB 3PX0A 3RF9A 5EE9A 5DGBA 4NY8A 4UW9A 3AUOA 4PJ0U 5KT3A 3MDAA 8ICTA 2FMQA 2IHOA 5F9LA 3SR6A 1XC9A 1NKCA 1ZQOA 2ATLA 4J9NA 2YMMA 3H40A 3CRXA 1QQ5A 2K60A 4KMUA 4B9MA 3KHHA 4RZRA 3H8SA 2ZIUA 3EYZA 1ZQRA 3V6HA 2ISOA 4DEZA 1T3NA 5DQIA 1IG6A 3PHZA 1S76D 5TZVA 2YX8A 2W55A 2UVWA 5HC9A 4BWMA 3RJGA 4DQPA 1QQ6A 1T8EA 2AXTU 3RB4A 3DV9A 2KICA 1QQ7A 4M5DA 1ZRMA 7ICGA 5CB1A 2BCUA 1COKA 2HBJA 5L1LA 3HKZC 4JWNA 4F4WA 3N7PD 3EZ5A 1X9WA 4EBDA 3SEIA 2NO5A 1NNLA 1ZQ1C 5J2AA 2HVHA 2OYYA 4PPXA 1ZQLA 3MCRA 2LM4A 3JZ0A 4X4TA 2PFNA 4K8VA 1EXNA 4ED3A 3H7IA 1D9DA 5AHXA 1ZQPA 3ED5A 2IOFK 1YZ6A 2A19A 4LZGA 5J0YA 4RQ0A 2XICA 2BQ3A 1F5AA 9ICGA 5DG8A 1XSNA 3ZDCA 5HREA 4LEWA 3Q8SB 4UATA 2YB1A 3JPSA 4DFPA 3HIYA 4X4PA 4EENA 4I2BA 5ALPA 5ALSA 1ZQNA 1L7PA 5KFCA 5DG9A 4GXIA 5ALJA 5IILA 2HI0A 1NK0A 2KIVA 1MA7A 1SWVA 5ALRA 3RBEA 3RRGA 3OGUA 2MU2A 3DEEA 4PHAA 5HRDA 4ED8A 1KEJA 5J29A 2KJ5A 2F76X 4RUAA 3HT3A 3N28A 3QE9Y 3THVA 2DL0A 4F4XA 2RFFA 1ZJNA 2RDIA 3M6KA 1JXEA 2Y0SF 1XNSA 5J8YA 1RZTA 4O69A 2B51A 4F5NA 4M2YA 3LVVA 5KG5A 2YMQA 4WH5A 4OCZA 2H3ZA 5KFLA 4MHVA 4UB1A 1NK6A 2UVUA 3AQLA 4X0AA 4G9BA 2LMRA 3Q8QB 4QZDA 3Q8KA 4TURA 4JLXA 5L1MA 4M9HA 1Z4OA 1D8BA 3LDAA 5J0RA 3N97B 4RNNA 1U9LA 1RDFA 2MSNA 3TI0A 3KBBA 8ICAA 4RQNA 5J0XA 5KL1B 5F9NA 3RB0A 4O5CA 3B9JA 2KMDA 4EEDA 4DF8A 1PVPA 4FS1A 4J9SA 4O68A 2W54A 4Q8EA 2JZBA 4IC9A 4C7YA 5J2IA 3D2SA 5HHHA 4KN7A 4CF3A 2PI4A 4F50A 1JUDA 2XC9A 4B9LA 3SYZA 5HRLA 4NXWA 3D2QA 2DR8A 2DF4B 3ZI4A 5J0TA 2E8PA 4K9AA
chains in the Genus database with same CATH topology
2M2WA 9ICRA 3PX4A 1D9FA 4Z6DA 4DQSA 4DSJA 4MEYA 5DB7A 1A76A 4O3NA 3OHAA 5D49A 3M8RA 3LWMA 4F4ZA 9ICOA 1UEUA 2Q0ZX 2ISPA 5KFGA 2ZH7A 1SL1A 1ZQKA 3HPOA 5HP4A 4I2IA 4IRKA 5KFJA 3OV7A 3K4GA 3B0YA 2AGOA 4KLTA 2HHQA 2DR7A 5KFVA 4UQGA 4KITB 2WTFA 2C2DA 8ICCA 4NLNA 4C8NA 4RWQA 5DBBA 1TK8A 4WC7A 2ZHAA 4J9RA 3ISDA 1UA1A 1KNYA 3E2EA 3WFRE 9ICUA 1SZPA 3MR6A 4EBKA 2P6UA 2ASJA 7ICNA 3JPNA 2C28A 5J0OA 5KG1A 2XGQA 1L3TA 1ZQHA 3ZDAA 1R8BA 3UPSA 4M9JA 3EPIA 4RNOA 2NRTA 4F4YA 2W9BA 4DL4A 4FHXA 3PW0A 4S3NA 4DQIA 3ZD8A 3M9OB 5DEDA 3LWLA 7ICMA 4DSFA 4WC3A 4M6WB 1B22A 2DR9A 4RNMA 1B43A 3H8JA 1ZQWA 5KT2A 3T5KA 1LV5A 4JV1A 2KZMA 5HRGA 4YQWA 1QSLA 4F2SA 1KTQA 4GXKA 5CA7A 5J0SA 3GILA 4DOBA 1U4BA 1NO5A 2F1IA 3OUYB 3H3AA 4ZH4A 5KFEA 2ZH4A 4JUZA 3PW5A 3M9MB 4X4OA 4WC2A 5KT7A 3SZ2A 1Q78A 2ZTCA 4FO6A 3PO4A 2PI5A 2VA2A 1K1SA 4YD2A 5L1IA 3MABA 4EBCA 3HJ1A 3WFPA 5KFDA 5HMLA 1K1QA 1BNPA 4WC6A 3RJIA 2M2TA 2W9MA 2JEJA 2FLLA 5J2CA 4I2AA 4FHYA 8ICBA 1L3UA 2HHPA 7ICUA 1AROP 9ICWA 5J0PA 3RH6A 5KFHA 1HUOA 2VA3A 4I2FA 4O9MA 9ICAA 3HWTA 1R8AA 1ZQAA 4M9NA 4KN4A 5J2FA 8ICUA 4O3QA 4IQUA 3TQ1A 1H38A 2JEIA 1Y88A 5IIJA 4YMMA 4R64A 5KFYA 4ED1A 4PHPA 4IQTA 1TVAA 1X9MA 1RYSA 3EWAA 5KG7A 5KFMA 4C8OA 3M8SA 4BXOB 4I28A 1QLNA 3MBYA 3C5GA 1NZPA 4IG8A 1Z00A 1TK5A 1IXRA 1DOQA 4LZDA 5KFFA 2BGWA 2NRVA 3Q8PB 4C8KA 1ZQCA 5J2KA 3ISCA 2NRWA 4F93B 2UVRA 3TAPA 1HJPA 1L5UA 4MF2A 4QZ8A 3UXNA 3ISBA 4B9VA 3LK9A 1TKDA 5C5JA 3KHRA 5DQGA 4TUPA 3BQ2A 3C18A 3ETLA 4IQWA 1U47A 4P2HA 4FBUA 4BGDA 4DSKA 4FHWA 2AQ0A 4NM2A 3GQCA 1Z3EB 4C8MA 3EPGA 4C8LA 3PW7A 4EEYA 1ZJMA 9ICHA 4E8FA 4R8UA 2ZH8A 5IIIA 2J6SA 4M2YA 2FPKA 5KFBA 9ICNA 1YLQA 4RQ3A 4NKTA 4YN4A 3OSNA 1RXVA 1NKEA 4X4UA 1UA0A 2ZUBA 2HHWA 1BVSA 1ZQMA 4ELVA 1XO1A 3LQCB 9ICPA 3B0XA 4O5EA 3EW9A 3H38A 4F91B 2HHUA 5KG0A 4J9KA 1WCLA 7ICIA 4ECWA 1KDHA 4KLLA 4KLMA 5CHGA 4PGQA 2FMPA 3GIJA 4P4OA 3RJJA 2I9GA 3UQ2A 9ICBA 2F1HA 5KFZA 3HJ4A 4AT8B 2BCVA 1ZQQA 3JPQA 5J0WA 4ELTA 2H5XA 4RWNA 2LYHA 2F1JA 3OJSA 3GIMA 2DFLA 4B9TA 3T5HA 3PY8A 4K4HA 2KTQA 2DPJA 2XO7A 1NK8A 4F8RA 1VJ7A 1IM4A 4P4MA 3Q8MA 4XQ7A 4RQ8A 4KLDA 4BDPA 5J2GA 2HHTA 3ZD9A 3V7KA 3RJFA 2NRXA 8ICMA 2JEGA 4NLGA 4YXMA 4DL7A 2AJQA 5L9XA 4Q44A 5IIKA 5DKWA 3QZ8A 3PVXA 5DECA 4RWPA 4F3OA 1XU4A 3C2MA 2Y1JA 3RAXA 4UB3A 2KZZA 4DL6A 4RT2A 4I2GA 8ICEA 8ICSA 4QZBA 5DLFA 4KLGA 2MUTA 2BR0A 8ICQA 8ICXA 5KFXA 4YD1A 4DQQA 9ICEA 2BE3A 1ZQEA 5L1JA 1DK3A 3V7JA 1NK7A 4NLZA 2R8JA 2GWSA 3RJHA 2ZJ8A 3MGIA 5J0UA 1NJZA 1JMSA 4J9QA 3BDPA 4O3SA 4DL3A 4KLIA 4X4NA 3FDSA 3JPOA 4RUCA 4DL5A 4Q8FA 3Q8LA 3KHLA 4M47A 9ICMA 5KFPA 2R8KA 3V6KA 4MFFA 8ICGA 1BGXT 1PZNA 4RQ6A 3G6VA 4X4SA 5CR0A 3RB3A 5DLGA 8ICWA 4RQ1A 5KFNA 8ICYA 4WBYA 4YXJA 2Q66A 2ALZA 2BHNA 2PFOA 1L3VA 1MIVA 3OVBA 4R65A 2BPFA 2ID1A 4P4PA 2A1JA 2HVIA 1V9PA 8ICNA 3PW4A 8ICIA 1FA0A 4F5PA 3SV4A 4YFKA 4NM1A 2ZH5A 1NK5A 9ICTA 1TV9A 4YMNA 5KFOA 2AQ4A 5HRKA 4O3PA 3UQ0A 3RB6A 3UPQA 7ICRA 7ICSA 4UAZA 4E0DA 5D46A 4R66A 4ATBB 2R8HA 5KG6A 1S0NA 3Q8RB 4IRDA 5DBAA 2BCQA 9ICCA 3GDXA 7ICTA 3QEBZ 2FMSA 1BPBA 1NK4A 1QSSA 5J2JA 4YR0A 4WCWA 5F2VO 2JEFA 3MR5A 2KP7A 1D8YA 3NGDA 2ZH1A 5DB8A 5KG3A 3PV8A 2W9CB 4Q43A 3HW8A 1XSPA 4KLFA 7ICJA 2O5AA 3L9DA 3RRHA 3RAQA 4DSEA 5KT6A 5KFRA 3ZDDA 4RWOA 4PH5A 2IHNA 3RJEA 5KT5A 2M2UA 2PXIA 1MSWD 2PBEA 3TFRA 3RH5A 3C66A 2BQRA 3C1YA 4NXZA 2ZJAA 4F5QA 4DOAA 3JPTA 3ORYA 4RQ2A 3TARA 3SV3A 5J2DA 4UD5A 3WFSC 4RPYA 3BJYA 4I2JA 4ECQA 1KFDA 3RR8A 4QZAA 3PMNA 4XUSA 8ICRA 3JPRA 4KLSA 1MIWA 2IA6A 5HNKA 1VFGA 3IHQB 2FLPA 4X4RA 2W8KA 4QZFA 1KFSA 4UB2A 4I2DA 5KG2A 4IR9A 3H4DA 3WFOA 1A77A 2HW3A 4E7XA 3C2LA 4YVZA 3H39A 9ICQA 4RPZA 3H4BA 1HUZA 1ZQVA 1SL0A 2P6RA 3OVAA 1TFYA 3GIKA 4EYIB 5KG4A 5J2EA 3T5JA 1N56A 4DWIA 1R89A 1T4GA 2B21A 4QZGA 4M0AA 7ICHA 4AT7B 3MR2A 4J9LA 4X0BA 3HX0A 4FBTA 1MQ3A 2FPLA 2JZBB 4RQ5A 2V4RA 5HMMA 4B9SA 4KLHA 8ICKA 3AQKA 4X4QA 4LT6A 2KFZA 4WC1A 8ICPA 1ZQFA 4PGYA 4M6WA 1XSLA 2XCAA 2Y1IA 1L3SA 3MGHA 2ASLA 1BPYA 2W9AA 5EWFA 2ZH2A 2AGQA 4GLXA 3OHBA 1R8CA 4I27A 4YCXA 5CJ7A 1BPDA 2C2RA 4CCHA 4XQ8A 7ICKA 4FS2A 3AU2A 5DQHA 2AGPA 4FH5A 3OUYA 8ICHA 5KFSA 3PX0A 4G3IA 2DVIA 4ELUA 3OSPA 3JPPA 3C2KA 4I2CA 3TFSA 4I2EA 4O0IA 5DGBA 4NY8A 8ICOA 3AUOA 3M9NB 1U48A 2XGPA 4DQRA 1MIYA 4ECXA 1UT8A 2M9NA 4Z6FA 5KT3A 3MFHA 3MDAA 8ICTA 2FMQA 4O3OA 4X5VA 5F9LA 4F5OA 3TAQA 5DB9A 1ZQDA 7ICPA 4FHPA 4K4GA 1XC9A 2ASDA 1NKCA 4MEXA 3G6YA 4ECRA 1ZQOA 4AT9B 3OVSA 2R8GA 3HP6A 3JYYA 4QW9A 3C1ZA 4QWCA 4J9NA 2ATLA 4KLUA 3GV8B 3H40A 1C7YA 4WC4A 1KRPA 1S0MA 5J0QA 5KFWA 3SI8A 4KTQA 1RYRA 1UEVA 4KMUA 1MQ2A 2KZ3A 5KFKA 4B9MA 3KHHA 1ZQIA 4BXOA 1QSYA 4QW8A 3MFIA 2UVVA 4RZRA 5IINA 1SKRA 9ICXA 3H8SA 5JUMA 3EYZA 1ZQRA 2W9BB 3V6HA 4FH3A 2ISOA 4UD4A 2ZH3A 4DEZA 4MF8A 5DQIA 1T3NA 4QZEA 1KLNA 3PMLA 1DK2A 3C5FA 4ECSA 4O3RA 4MFCA 1S76D 4QWDA 4JK1A 5TZVA 4ED6A 3PX6A 1ZQBA 1XS9D 5KFTA 4E80A 2UVWA 5HC9A 2FLNA 4BWMA 3RJGA 2P66A 4DQPA 4M04A 4Q45A 1T8EA 4JV2A 4XRHA 2KFNA 2NRZA 1S97A 4YMOA 1S10A 4HYKA 4QWBA 3RB4A 3PR4A 7ICLA 9ICIA 5BOMA 3BQ1A 4ECYA 3AU6A 4M5DA 9ICKA 1TFWA 3GFKB 1ZQXA 4KLEA 3V6JA 2BPGA 7ICGA 8ICZA 1UT5A 3GV7B 1ZYQA 2XCPA 3T5LA 5CB1A 2BCUA 1S77D 4AT9A 2XY6A 2DR5A 4WC5A 5HRHA 2IHMA 2KN7A 5L1LA 4DLEA 4K4IA 4JWNA 4UAYA 4F4WA 5EWGA 1X9WA 3EZ5A 4EBDA 1ZQUA 2DPIA 4GXJA 1TFRA 1NJYA 3H37A 4PHDA 1SKSA 1JAJA 5KT4A 2RDJA 3C23A 2BKEA 5J2AA 1NJWA 1Z00B 5EOZA 3MR3A 2AU0A 2HVHA 1WOTA 4AT8A 2ZUDA 4PGXA 4IQVA 5KFQA 1ZQLA 2IBKA 4F2RA 4PPXA 2XY5A 4IR1A 3JZ0A 2BCRA 1BPEA 4YR3A 4F5RA 4I29A 2PFNA 2HHSA 1S0OA 8ICLA 4X4TA 4EZ9A 2IMWP 3BQTA 2J6TA 2ZH6A 4DFKA 2O1PA 4M9GA 1TAQA 3KHGA 1EXNA 5HRIA 4PHEA 3H7IA 4ED3A 4RQ7A 1ZQPA 1D9DA 2M2VA 8ICFA 2DRAA 4Z6CA 4NKUA 4R8UB 4I2HA 4QZIA 1UETA 4XA5A 5DB6A 4LZGA 8ICVA 3H8WA 5J0YA 2ZTDA 4RQ0A 4MFAA 5HR9A 5CWRA 4RPXA 1CEZA 9ICVA 5KFAA 2BQ3A 1KFTA 1TAUA 5DG8A 9ICGA 8ICJA 2C22A 9ICJA 4QZCA 1F5AA 4EBJA 1XSNA 3ZDCA 5HHIA 3KTQA 5HREA 3TANA 3GIIA 7ICVA 3Q8SB 1QTMA 3AQMA 4UB5A 7ICFA 4TQSA 3FYHA 3UXPA 1TK0A 5BOLA 3JPSA 2BQUA 1JN3A 4DFPA 2ZHBA 3N4MB 3HIYA 4TUQA 4LVSA 4X4PA 4ECVA 4I2BA 4O5KA 7ICEA 1Q79A 1XWLA 4TUSA 2V4QA 2V9WA 1ZQNA 2BPCA 5DBCA 5KFCA 5DG9A 4JV0A 4GXIA 2NRKA 4UAWA 5IILA 1NK0A 2PFPA 4WC0A 5HRFA 1CUKA 4DOCA 2MAXA 3RTVA 3RBEA 5EWEA 3RRGA 3OGUA 3RR7A 4BWJA 1U49A 1D8LA 4PHAA 4DF4A 1JX4A 5HRDA 1V4AA 9ICLA 4DO9A 4ED8A 4WBZA 3G6XA 1KEJA 1BPXA 5J29A 4ECZA 1JXLA 4X4VA 9ICFA 4J9MA 4ATBA 5KFIA 5DGAA 5IIMA 4RUAA 3HT3A 1RPLA 1NJXA 2PFQA 4ED2A 4UBCA 3QE9Y 3THVA 4RU9A 3MDCA 7ICQA 3C21A 4F4XA 2RFFA 4F4KA 2MUTB 4GC7A 1ZQGA 1BNOA 1ZJNA 2RDIA 4JWMA 1JXEA 7ICOA 3IM1A 3T3FA 3GV5B 1ZQTA 3WFQE 4J9OA 4EBEA 1RZTA 2W9CA 3K75D 1ZETA 1SL2A 4RT3A 1MC8A 3PR5B 4F5NA 2I1QA 2ZJ5A 1SKWA 1T7PA 1NOMA 4B9NA 5KG5A 1S0VA 4GC6A 3UXOA 4J9PA 4DSLA 5KFLA 5CP2A 2XY7A 3V7LA 1LB2B 5DDYA 4UB1A 4KLJA 1NK6A 2UVUA 2W8LA 4ECTA 3AQLA 3AQNA 4X0AA 2ZH9A 2HHXA 5IIOA 4IRCA 1X2IA 2DRBA 3Q8QB 1WCNA 3RJKA 4QZDA 2BCSA 2J6UA 1U45A 3Q8KA 2ZTEA 1NK9A 4TURA 2A1JB 5KFUA 1JQRA 3NTUA 4M9HA 4DL2A 2VA8A 4YR2A 1DGSA 3V72A 3PNCA 3PW2A 5HRBA 3LDAA 2OWOA 4KLQA 2FPMA 4NLKA 5J0RA 4UBBA 1PX5A 5J2HA 4DLGA 2R8IA 1RXWA 4TQRA 4Z6EA 4RNNA 3N97B 4QWEA 2BDPA 2HHVA 5DG7A 4F92B 1U9LA 3TI0A 5BPCA 8ICAA 1OU5A 3QZ7A 2ZUCA 5J0XA 1N48A 1BPZA 5F9NA 5D4BA 3RB0A 4EYHB 1ZQYA 4O5CA 3RBDA 4DF8A 2VANA 4R63A 3ZDEA 5L1KA 4DFMA 1X9SA 3NYBA 1ZQSA 1ZQZA 4EZ6A 4DS5A 1KSPA 3ZDBA 4FS1A 4J9SA 4RQ4A 3BQ0A 4ED0A 3QEAZ 1NKBA 4AT7A 4Q8EA 4QWAA 4DS4A 2JZBA 1JIHA 4QZ9A 3OJUA 5J2IA 5KTQA 4YP3A 5HHHA 1COOA 4KN7A 2PI4A 3RH4A 4F50A 2XC9A 1S9FA 4B9LA 3SYZA 4B9UA 4DSIA 9ICSA 3PO5A 4YG2A 5HRLA 2DR8A 4M9LA 4EP7A 4QZHA 1ZQJA 5J2BA 4ED7A 2C2EA 4DFJA 5J0TA 4UB4A 4ECUA 4KLOA 4FHVA 5DDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M2W A;  9ICR A;  3PX4 A;  1D9F A;  4Z6D A;  4DQS A;  4DSJ A;  4MEY A;  5DB7 A;  1A76 A;  4O3N A;  3OHA A;  5D49 A;  3M8R A;  3LWM A;  4F4Z A;  9ICO A;  1UEU A;  2Q0Z X;  2ISP A;  5KFG A;  2ZH7 A;  1SL1 A;  1ZQK A;  3HPO A;  5HP4 A;  4I2I A;  4IRK A;  5KFJ A;  3OV7 A;  3K4G A;  3B0Y A;  2AGO A;  4KLT A;  2HHQ A;  2DR7 A;  5KFV A;  4UQG A;  4KIT B;  2WTF A;  2C2D A;  8ICC A;  4NLN A;  4C8N A;  4RWQ A;  5DBB A;  1TK8 A;  4WC7 A;  2ZHA A;  4J9R A;  3ISD A;  1UA1 A;  1KNY A;  3E2E A;  3WFR E;  9ICU A;  1SZP A;  3MR6 A;  4EBK A;  2P6U A;  2ASJ A;  7ICN A;  3JPN A;  2C28 A;  5J0O A;  5KG1 A;  2XGQ A;  1L3T A;  1ZQH A;  3ZDA A;  1R8B A;  3UPS A;  4M9J A;  3EPI A;  4RNO A;  2NRT A;  4F4Y A;  2W9B A;  4DL4 A;  4FHX A;  3PW0 A;  4S3N A;  4DQI A;  3ZD8 A;  3M9O B;  5DED A;  3LWL A;  7ICM A;  4DSF A;  4WC3 A;  4M6W B;  1B22 A;  2DR9 A;  4RNM A;  1B43 A;  3H8J A;  1ZQW A;  5KT2 A;  3T5K A;  1LV5 A;  4JV1 A;  2KZM A;  5HRG A;  4YQW A;  1QSL A;  4F2S A;  1KTQ A;  4GXK A;  5CA7 A;  5J0S A;  3GIL A;  4DOB A;  1U4B A;  1NO5 A;  2F1I A;  3OUY B;  3H3A A;  4ZH4 A;  5KFE A;  2ZH4 A;  4JUZ A;  3PW5 A;  3M9M B;  4X4O A;  4WC2 A;  5KT7 A;  3SZ2 A;  1Q78 A;  2ZTC A;  4FO6 A;  3PO4 A;  2PI5 A;  2VA2 A;  1K1S A;  4YD2 A;  5L1I A;  3MAB A;  4EBC A;  3HJ1 A;  3WFP A;  5KFD A;  5HML A;  1K1Q A;  1BNP A;  4WC6 A;  3RJI A;  2M2T A;  2W9M A;  2JEJ A;  2FLL A;  5J2C A;  4I2A A;  4FHY A;  8ICB A;  1L3U A;  2HHP A;  7ICU A;  1ARO P;  9ICW A;  5J0P A;  3RH6 A;  5KFH A;  1HUO A;  2VA3 A;  4I2F A;  4O9M A;  9ICA A;  3HWT A;  1R8A A;  1ZQA A;  4M9N A;  4KN4 A;  5J2F A;  8ICU A;  4O3Q A;  4IQU A;  3TQ1 A;  1H38 A;  2JEI A;  1Y88 A;  5IIJ A;  4YMM A;  4R64 A;  5KFY A;  4ED1 A;  4PHP A;  4IQT A;  1TVA A;  1X9M A;  1RYS A;  3EWA A;  5KG7 A;  5KFM A;  4C8O A;  3M8S A;  4BXO B;  4I28 A;  1QLN A;  3MBY A;  3C5G A;  1NZP A;  4IG8 A;  1Z00 A;  1TK5 A;  1IXR A;  1DOQ A;  4LZD A;  5KFF A;  2BGW A;  2NRV A;  3Q8P B;  4C8K A;  1ZQC A;  5J2K A;  3ISC A;  2NRW A;  4F93 B;  2UVR A;  3TAP A;  1HJP A;  1L5U A;  4MF2 A;  4QZ8 A;  3UXN A;  3ISB A;  4B9V A;  3LK9 A;  1TKD A;  5C5J A;  3KHR A;  5DQG A;  4TUP A;  3BQ2 A;  3C18 A;  3ETL A;  4IQW A;  1U47 A;  4P2H A;  4FBU A;  4BGD A;  4DSK A;  4FHW A;  2AQ0 A;  4NM2 A;  3GQC A;  1Z3E B;  4C8M A;  3EPG A;  4C8L A;  3PW7 A;  4EEY A;  1ZJM A;  9ICH A;  4E8F A;  4R8U A;  2ZH8 A;  5III A;  2J6S A;  4M2Y A;  2FPK A;  5KFB A;  9ICN A;  1YLQ A;  4RQ3 A;  4NKT A;  4YN4 A;  3OSN A;  1RXV A;  1NKE A;  4X4U A;  1UA0 A;  2ZUB A;  2HHW A;  1BVS A;  1ZQM A;  4ELV A;  1XO1 A;  3LQC B;  9ICP A;  3B0X A;  4O5E A;  3EW9 A;  3H38 A;  4F91 B;  2HHU A;  5KG0 A;  4J9K A;  1WCL A;  7ICI A;  4ECW A;  1KDH A;  4KLL A;  4KLM A;  5CHG A;  4PGQ A;  2FMP A;  3GIJ A;  4P4O A;  3RJJ A;  2I9G A;  3UQ2 A;  9ICB A;  2F1H A;  5KFZ A;  3HJ4 A;  4AT8 B;  2BCV A;  1ZQQ A;  3JPQ A;  5J0W A;  4ELT A;  2H5X A;  4RWN A;  2LYH A;  2F1J A;  3OJS A;  3GIM A;  2DFL A;  4B9T A;  3T5H A;  3PY8 A;  4K4H A;  2KTQ A;  2DPJ A;  2XO7 A;  1NK8 A;  4F8R A;  1VJ7 A;  1IM4 A;  4P4M A;  3Q8M A;  4XQ7 A;  4RQ8 A;  4KLD A;  4BDP A;  5J2G A;  2HHT A;  3ZD9 A;  3V7K A;  3RJF A;  2NRX A;  8ICM A;  2JEG A;  4NLG A;  4YXM A;  4DL7 A;  2AJQ A;  5L9X A;  4Q44 A;  5IIK A;  5DKW A;  3QZ8 A;  3PVX A;  5DEC A;  4RWP A;  4F3O A;  1XU4 A;  3C2M A;  2Y1J A;  3RAX A;  4UB3 A;  2KZZ A;  4DL6 A;  4RT2 A;  4I2G A;  8ICE A;  8ICS A;  4QZB A;  5DLF A;  4KLG A;  2MUT A;  2BR0 A;  8ICQ A;  8ICX A;  5KFX A;  4YD1 A;  4DQQ A;  9ICE A;  2BE3 A;  1ZQE A;  5L1J A;  1DK3 A;  3V7J A;  1NK7 A;  4NLZ A;  2R8J A;  2GWS A;  3RJH A;  2ZJ8 A;  3MGI A;  5J0U A;  1NJZ A;  1JMS A;  4J9Q A;  3BDP A;  4O3S A;  4DL3 A;  4KLI A;  4X4N A;  3FDS A;  3JPO A;  4RUC A;  4DL5 A;  4Q8F A;  3Q8L A;  3KHL A;  4M47 A;  9ICM A;  5KFP A;  2R8K A;  3V6K A;  4MFF A;  8ICG A;  1BGX T;  1PZN A;  4RQ6 A;  3G6V A;  4X4S A;  5CR0 A;  3RB3 A;  5DLG A;  8ICW A;  4RQ1 A;  5KFN A;  8ICY A;  4WBY A;  4YXJ A;  2Q66 A;  2ALZ A;  2BHN A;  2PFO A;  1L3V A;  1MIV A;  3OVB A;  4R65 A;  2BPF A;  2ID1 A;  4P4P A;  2A1J A;  2HVI A;  1V9P A;  8ICN A;  3PW4 A;  8ICI A;  1FA0 A;  4F5P A;  3SV4 A;  4YFK A;  4NM1 A;  2ZH5 A;  1NK5 A;  9ICT A;  1TV9 A;  4YMN A;  5KFO A;  2AQ4 A;  5HRK A;  4O3P A;  3UQ0 A;  3RB6 A;  3UPQ A;  7ICR A;  7ICS A;  4UAZ A;  4E0D A;  5D46 A;  4R66 A;  4ATB B;  2R8H A;  5KG6 A;  1S0N A;  3Q8R B;  4IRD A;  5DBA A;  2BCQ A;  9ICC A;  3GDX A;  7ICT A;  3QEB Z;  2FMS A;  1BPB A;  1NK4 A;  1QSS A;  5J2J A;  4YR0 A;  4WCW A;  5F2V O;  2JEF A;  3MR5 A;  2KP7 A;  1D8Y A;  3NGD A;  2ZH1 A;  5DB8 A;  5KG3 A;  3PV8 A;  2W9C B;  4Q43 A;  3HW8 A;  1XSP A;  4KLF A;  7ICJ A;  2O5A A;  3L9D A;  3RRH A;  3RAQ A;  4DSE A;  5KT6 A;  5KFR A;  3ZDD A;  4RWO A;  4PH5 A;  2IHN A;  3RJE A;  5KT5 A;  2M2U A;  2PXI A;  1MSW D;  2PBE A;  3TFR A;  3RH5 A;  3C66 A;  2BQR A;  3C1Y A;  4NXZ A;  2ZJA A;  4F5Q A;  4DOA A;  3JPT A;  3ORY A;  4RQ2 A;  3TAR A;  3SV3 A;  5J2D A;  4UD5 A;  3WFS C;  4RPY A;  3BJY A;  4I2J A;  4ECQ A;  1KFD A;  3RR8 A;  4QZA A;  3PMN A;  4XUS A;  8ICR A;  3JPR A;  4KLS A;  1MIW A;  2IA6 A;  5HNK A;  1VFG A;  3IHQ B;  2FLP A;  4X4R A;  2W8K A;  4QZF A;  1KFS A;  4UB2 A;  4I2D A;  5KG2 A;  4IR9 A;  3H4D A;  3WFO A;  1A77 A;  2HW3 A;  4E7X A;  3C2L A;  4YVZ A;  3H39 A;  9ICQ A;  4RPZ A;  3H4B A;  1HUZ A;  1ZQV A;  1SL0 A;  2P6R A;  3OVA A;  1TFY A;  3GIK A;  4EYI B;  5KG4 A;  5J2E A;  3T5J A;  1N56 A;  4DWI A;  1R89 A;  1T4G A;  2B21 A;  4QZG A;  4M0A A;  7ICH A;  4AT7 B;  3MR2 A;  4J9L A;  4X0B A;  3HX0 A;  4FBT A;  1MQ3 A;  2FPL A;  2JZB B;  4RQ5 A;  2V4R A;  5HMM A;  4B9S A;  4KLH A;  8ICK A;  3AQK A;  4X4Q A;  4LT6 A;  2KFZ A;  4WC1 A;  8ICP A;  1ZQF A;  4PGY A;  4M6W A;  1XSL A;  2XCA A;  2Y1I A;  1L3S A;  3MGH A;  2ASL A;  1BPY A;  2W9A A;  5EWF A;  2ZH2 A;  2AGQ A;  4GLX A;  3OHB A;  1R8C A;  4I27 A;  4YCX A;  5CJ7 A;  1BPD A;  2C2R A;  4CCH A;  4XQ8 A;  7ICK A;  4FS2 A;  3AU2 A;  5DQH A;  2AGP A;  4FH5 A;  3OUY A;  8ICH A;  5KFS A;  3PX0 A;  4G3I A;  2DVI A;  4ELU A;  3OSP A;  3JPP A;  3C2K A;  4I2C A;  3TFS A;  4I2E A;  4O0I A;  5DGB A;  4NY8 A;  8ICO A;  3AUO A;  3M9N B;  1U48 A;  2XGP A;  4DQR A;  1MIY A;  4ECX A;  1UT8 A;  2M9N A;  4Z6F A;  5KT3 A;  3MFH A;  3MDA A;  8ICT A;  2FMQ A;  4O3O A;  4X5V A;  5F9L A;  4F5O A;  3TAQ A;  5DB9 A;  1ZQD A;  7ICP A;  4FHP A;  4K4G A;  1XC9 A;  2ASD A;  1NKC A;  4MEX A;  3G6Y A;  4ECR A;  1ZQO A;  4AT9 B;  3OVS A;  2R8G A;  3HP6 A;  3JYY A;  4QW9 A;  3C1Z A;  4QWC A;  4J9N A;  2ATL A;  4KLU A;  3GV8 B;  3H40 A;  1C7Y A;  4WC4 A;  1KRP A;  1S0M A;  5J0Q A;  5KFW A;  3SI8 A;  4KTQ A;  1RYR A;  1UEV A;  4KMU A;  1MQ2 A;  2KZ3 A;  5KFK A;  4B9M A;  3KHH A;  1ZQI A;  4BXO A;  1QSY A;  4QW8 A;  3MFI A;  2UVV A;  4RZR A;  5IIN A;  1SKR A;  9ICX A;  3H8S A;  5JUM A;  3EYZ A;  1ZQR A;  2W9B B;  3V6H A;  4FH3 A;  2ISO A;  4UD4 A;  2ZH3 A;  4DEZ A;  4MF8 A;  5DQI A;  1T3N A;  4QZE A;  1KLN A;  3PML A;  1DK2 A;  3C5F A;  4ECS A;  4O3R A;  4MFC A;  1S76 D;  4QWD A;  4JK1 A;  5TZV A;  4ED6 A;  3PX6 A;  1ZQB A;  1XS9 D;  5KFT A;  4E80 A;  2UVW A;  5HC9 A;  2FLN A;  4BWM A;  3RJG A;  2P66 A;  4DQP A;  4M04 A;  4Q45 A;  1T8E A;  4JV2 A;  4XRH A;  2KFN A;  2NRZ A;  1S97 A;  4YMO A;  1S10 A;  4HYK A;  4QWB A;  3RB4 A;  3PR4 A;  7ICL A;  9ICI A;  5BOM A;  3BQ1 A;  4ECY A;  3AU6 A;  4M5D A;  9ICK A;  1TFW A;  3GFK B;  1ZQX A;  4KLE A;  3V6J A;  2BPG A;  7ICG A;  8ICZ A;  1UT5 A;  3GV7 B;  1ZYQ A;  2XCP A;  3T5L A;  5CB1 A;  2BCU A;  1S77 D;  4AT9 A;  2XY6 A;  2DR5 A;  4WC5 A;  5HRH A;  2IHM A;  2KN7 A;  5L1L A;  4DLE A;  4K4I A;  4JWN A;  4UAY A;  4F4W A;  5EWG A;  1X9W A;  3EZ5 A;  4EBD A;  1ZQU A;  2DPI A;  4GXJ A;  1TFR A;  1NJY A;  3H37 A;  4PHD A;  1SKS A;  1JAJ A;  5KT4 A;  2RDJ A;  3C23 A;  2BKE A;  5J2A A;  1NJW A;  1Z00 B;  5EOZ A;  3MR3 A;  2AU0 A;  2HVH A;  1WOT A;  4AT8 A;  2ZUD A;  4PGX A;  4IQV A;  5KFQ A;  1ZQL A;  2IBK A;  4F2R A;  4PPX A;  2XY5 A;  4IR1 A;  3JZ0 A;  2BCR A;  1BPE A;  4YR3 A;  4F5R A;  4I29 A;  2PFN A;  2HHS A;  1S0O A;  8ICL A;  4X4T A;  4EZ9 A;  2IMW P;  3BQT A;  2J6T A;  2ZH6 A;  4DFK A;  2O1P A;  4M9G A;  1TAQ A;  3KHG A;  1EXN A;  5HRI A;  4PHE A;  3H7I A;  4ED3 A;  4RQ7 A;  1ZQP A;  1D9D A;  2M2V A;  8ICF A;  2DRA A;  4Z6C A;  4NKU A;  4R8U B;  4I2H A;  4QZI A;  1UET A;  4XA5 A;  5DB6 A;  4LZG A;  8ICV A;  3H8W A;  5J0Y A;  2ZTD A;  4RQ0 A;  4MFA A;  5HR9 A;  5CWR A;  4RPX A;  1CEZ A;  9ICV A;  5KFA A;  2BQ3 A;  1KFT A;  1TAU A;  5DG8 A;  9ICG A;  8ICJ A;  2C22 A;  9ICJ A;  4QZC A;  1F5A A;  4EBJ A;  1XSN A;  3ZDC A;  5HHI A;  3KTQ A;  5HRE A;  3TAN A;  3GII A;  7ICV A;  3Q8S B;  1QTM A;  3AQM A;  4UB5 A;  7ICF A;  4TQS A;  3FYH A;  3UXP A;  1TK0 A;  5BOL A;  3JPS A;  2BQU A;  1JN3 A;  4DFP A;  2ZHB A;  3N4M B;  3HIY A;  4TUQ A;  4LVS A;  4X4P A;  4ECV A;  4I2B A;  4O5K A;  7ICE A;  1Q79 A;  1XWL A;  4TUS A;  2V4Q A;  2V9W A;  1ZQN A;  2BPC A;  5DBC A;  5KFC A;  5DG9 A;  4JV0 A;  4GXI A;  2NRK A;  4UAW A;  5IIL A;  1NK0 A;  2PFP A;  4WC0 A;  5HRF A;  1CUK A;  4DOC A;  2MAX A;  3RTV A;  3RBE A;  5EWE A;  3RRG A;  3OGU A;  3RR7 A;  4BWJ A;  1U49 A;  1D8L A;  4PHA A;  4DF4 A;  1JX4 A;  5HRD A;  1V4A A;  9ICL A;  4DO9 A;  4ED8 A;  4WBZ A;  3G6X A;  1KEJ A;  1BPX A;  5J29 A;  4ECZ A;  1JXL A;  4X4V A;  9ICF A;  4J9M A;  4ATB A;  5KFI A;  5DGA A;  5IIM A;  4RUA A;  3HT3 A;  1RPL A;  1NJX A;  2PFQ A;  4ED2 A;  4UBC A;  3QE9 Y;  3THV A;  4RU9 A;  3MDC A;  7ICQ A;  3C21 A;  4F4X A;  2RFF A;  4F4K A;  2MUT B;  4GC7 A;  1ZQG A;  1BNO A;  1ZJN A;  2RDI A;  4JWM A;  1JXE A;  7ICO A;  3IM1 A;  3T3F A;  3GV5 B;  1ZQT A;  3WFQ E;  4J9O A;  4EBE A;  1RZT A;  2W9C A;  3K75 D;  1ZET A;  1SL2 A;  4RT3 A;  1MC8 A;  3PR5 B;  4F5N A;  2I1Q A;  2ZJ5 A;  1SKW A;  1T7P A;  1NOM A;  4B9N A;  5KG5 A;  1S0V A;  4GC6 A;  3UXO A;  4J9P A;  4DSL A;  5KFL A;  5CP2 A;  2XY7 A;  3V7L A;  1LB2 B;  5DDY A;  4UB1 A;  4KLJ A;  1NK6 A;  2UVU A;  2W8L A;  4ECT A;  3AQL A;  3AQN A;  4X0A A;  2ZH9 A;  2HHX A;  5IIO A;  4IRC A;  1X2I A;  2DRB A;  3Q8Q B;  1WCN A;  3RJK A;  4QZD A;  2BCS A;  2J6U A;  1U45 A;  3Q8K A;  2ZTE A;  1NK9 A;  4TUR A;  2A1J B;  5KFU A;  1JQR A;  3NTU A;  4M9H A;  4DL2 A;  2VA8 A;  4YR2 A;  1DGS A;  3V72 A;  3PNC A;  3PW2 A;  5HRB A;  3LDA A;  2OWO A;  4KLQ A;  2FPM A;  4NLK A;  5J0R A;  4UBB A;  1PX5 A;  5J2H A;  4DLG A;  2R8I A;  1RXW A;  4TQR A;  4Z6E A;  4RNN A;  3N97 B;  4QWE A;  2BDP A;  2HHV A;  5DG7 A;  4F92 B;  1U9L A;  3TI0 A;  5BPC A;  8ICA A;  1OU5 A;  3QZ7 A;  2ZUC A;  5J0X A;  1N48 A;  1BPZ A;  5F9N A;  5D4B A;  3RB0 A;  4EYH B;  1ZQY A;  4O5C A;  3RBD A;  4DF8 A;  2VAN A;  4R63 A;  3ZDE A;  5L1K A;  4DFM A;  1X9S A;  3NYB A;  1ZQS A;  1ZQZ A;  4EZ6 A;  4DS5 A;  1KSP A;  3ZDB A;  4FS1 A;  4J9S A;  4RQ4 A;  3BQ0 A;  4ED0 A;  3QEA Z;  1NKB A;  4AT7 A;  4Q8E A;  4QWA A;  4DS4 A;  2JZB A;  1JIH A;  4QZ9 A;  3OJU A;  5J2I A;  5KTQ A;  4YP3 A;  5HHH A;  1COO A;  4KN7 A;  2PI4 A;  3RH4 A;  4F50 A;  2XC9 A;  1S9F A;  4B9L A;  3SYZ A;  4B9U A;  4DSI A;  9ICS A;  3PO5 A;  4YG2 A;  5HRL A;  2DR8 A;  4M9L A;  4EP7 A;  4QZH A;  1ZQJ A;  5J2B A;  4ED7 A;  2C2E A;  4DFJ A;  5J0T A;  4UB4 A;  4ECU A;  4KLO A;  4FHV A;  5DDM A; 
#chains in the Genus database with same CATH topology
 9ICR A;  4DSJ A;  4MEY A;  9ICO A;  2W03 A;  3LWM A;  3NUQ A;  1SGG A;  1LKY B;  2OM6 A;  1KW4 A;  5KFJ A;  3SAF A;  5KFV A;  4KIT B;  1S8O A;  4RWQ A;  4WC7 A;  1J2M A;  2FE9 A;  3PZP A;  2C28 A;  4UB8 U;  3UPS A;  1PVR A;  3EPI A;  4DSF A;  1VDV A;  4WC3 A;  4M6W B;  1B22 A;  2DR9 A;  4RNM A;  1B43 A;  4JV1 A;  1PK1 B;  2LPE A;  4F2S A;  2ZG6 A;  5J0S A;  2DGZ A;  4WC2 A;  5KT7 A;  3SZ2 A;  1Q78 A;  2PI5 A;  2ZIV B;  3HJ1 A;  5L1I A;  3KKA C;  4MKP A;  3QU5 A;  1Z19 A;  2W9M A;  4I2A A;  7ICU A;  9ICW A;  5J0P A;  5KFH A;  2VA3 A;  4DCC A;  3VCB A;  4O9M A;  5ALM A;  8ICU A;  3QU7 A;  3TQ1 A;  1Y88 A;  5IIJ A;  1TVA A;  2GAF D;  1QLN A;  4C8O A;  4I28 A;  1NZP A;  3TKA A;  3M8S A;  4BXO B;  3MBY A;  4LZD A;  2NRV A;  2CRX A;  5J2K A;  2NRW A;  1L5U A;  4MF2 A;  1Q8K A;  4B9V A;  3HKZ F;  5C5J A;  2IOF A;  3BQ2 A;  3C18 A;  3ETL A;  2GA9 D;  2AQ0 A;  4C8L A;  3HJE A;  3PW7 A;  4E8F A;  2W7O A;  2Y9T A;  3OSN A;  1NKE A;  3QUB A;  5AI0 A;  3QUT A;  2H3Q A;  1VLB A;  2RRD A;  2XI9 A;  1L7O A;  1DXS A;  1WCL A;  7ICI A;  3NRZ A;  5ALL A;  5AKH A;  2I5H A;  4C4T A;  4NV0 A;  2FMP A;  3HJ4 A;  4X4O A;  5KFZ A;  1ZQQ A;  4ELT A;  5J0W A;  3AL0 B;  4K4H A;  4QIW C;  1A6S A;  4F8R A;  4P4M A;  4RQ8 A;  3K1Z A;  5CFS A;  4BDP A;  5J2G A;  1L8L A;  3ZD9 A;  8ICM A;  2JEG A;  2QB0 B;  4DL7 A;  1J97 A;  3QZ8 A;  3WK4 A;  2KZZ A;  2LYB A;  4DL6 A;  4I2G A;  5DLF A;  2BE3 A;  4NLZ A;  2ZJ8 A;  3A0H U;  4O3S A;  4J9Q A;  4FZN A;  4Q8F A;  3Q8L A;  3BZK A;  8ICG A;  1BGX T;  3RB3 A;  5JU5 A;  8ICW A;  4NL9 C;  1TAM A;  2Q66 A;  1MIV A;  5AM3 A;  2HVI A;  8ICN A;  3KZI U;  1FA0 A;  3SV4 A;  4Y2P A;  4USA A;  4YMN A;  2KE7 A;  3RB6 A;  2ES6 A;  5D46 A;  2R8H A;  5DBA A;  3GDX A;  2FMS A;  1NK4 A;  5AK3 A;  5CFT A;  2B0C A;  1VJ5 A;  3PV8 A;  4Q43 A;  4KLF A;  3RAQ A;  2F8L A;  4DSE A;  4C4R A;  5KFR A;  4PH5 A;  3R9K A;  2K4P A;  2ESE A;  2PXI A;  3C28 A;  3O0F A;  4EEL A;  1MSW D;  3C66 A;  3RH5 A;  2BQR A;  1WWV A;  3ERC C;  3C1Y A;  1Z1V A;  3JPT A;  3ORY A;  2R18 A;  1PUZ A;  4OJ6 A;  3TAR A;  5J2D A;  3WFS C;  5ALE A;  3F2C A;  1KFD A;  4QZA A;  3JPR A;  4KLS A;  3AQF A;  1VFG A;  1KFS A;  1JRO A;  4C80 A;  1LKY A;  4QZF A;  4JLZ A;  3H4B A;  1HUZ A;  3SEN A;  4EYI B;  5KG4 A;  3WK9 A;  1DRG A;  4DWI A;  3BS7 A;  5AM4 A;  2B21 A;  1KL9 A;  4QZG A;  3MR2 A;  4ACO A;  3HX0 A;  2FPL A;  4RQ5 A;  3SQI A;  2V4R A;  1SXD A;  4X4Q A;  2KFZ A;  5ALU A;  8ICP A;  1ZQF A;  4M6W A;  1KN5 A;  3MGH A;  1PK1 A;  4GLX A;  2EDU A;  4I27 A;  2C2R A;  1BPD A;  7ICK A;  2AH5 A;  2JR5 A;  5KFS A;  5F3X B;  2DVI A;  4KM5 A;  3LYS A;  4I2E A;  2EZZ A;  8ICO A;  2WAQ C;  2ZIV A;  3M9N B;  1N61 A;  2XGP A;  4DQR A;  4ECX A;  4Z6F A;  2M9N A;  3MFH A;  3ALR A;  4I0U A;  4FHP A;  1F44 A;  4K4G A;  3IG5 A;  5AIB A;  2ASD A;  4OD0 A;  4AT9 B;  5JRT A;  5AKE A;  2E8N A;  5J0Q A;  5KFW A;  3SI8 A;  4KTQ A;  1RYR A;  1UEV A;  2E1F A;  2KZ3 A;  5KFK A;  4BXO A;  4M9G A;  5KAF U;  1DK2 A;  3D2N A;  4MFC A;  4JK1 A;  2RQ5 A;  1AQ6 A;  2BBH A;  4M04 A;  5ALH A;  4JV2 A;  1S97 A;  3KD3 A;  1FFU A;  4HYK A;  3PR4 A;  5BOM A;  3BQ1 A;  3AU6 A;  2RLT A;  3GFK B;  1ZQX A;  8ICZ A;  3GV7 B;  2XCP A;  3T5L A;  5AKZ A;  3NKU A;  3NAS A;  4UAY A;  1NZB A;  2DPI A;  4GXJ A;  1TFR A;  4PHD A;  5KT4 A;  2RDJ A;  1NJW A;  5AK4 A;  1ZD5 A;  4PGX A;  4IQV A;  2IBK A;  2XY5 A;  4IR1 A;  4F5R A;  8ICL A;  3BQT A;  4J03 A;  4OJP A;  5HRI A;  4RQ7 A;  2QB0 A;  3IN5 A;  4K99 A;  3H8M A;  1O03 A;  5CWR A;  1CEZ A;  4QIW F;  9ICV A;  1KFT A;  4EBJ A;  2C22 A;  3KTQ A;  4Y2V A;  3KKA A;  4TQS A;  4OJ5 A;  1JN3 A;  3N4M B;  4O5K A;  7ICE A;  4WJ3 B;  2BPC A;  5DBC A;  1KKX A;  2PFP A;  5HRF A;  4FO1 A;  4DOC A;  3RTV A;  3TAC B;  1NI3 A;  3RR7 A;  1ZRN A;  1U49 A;  1JX4 A;  3KZX A;  1V4A A;  5G5G A;  2DWQ A;  9ICL A;  4WBZ A;  3G6X A;  1SXE A;  4ECZ A;  9ICF A;  4LEY A;  1Q46 A;  1RPL A;  5AKK A;  4UBC A;  1RQL A;  5AM1 A;  4RU9 A;  3MDC A;  4Y2U A;  4BJQ A;  2MUT B;  3UM9 A;  5B66 U;  3WFQ E;  2YY6 A;  3K75 D;  2UVV A;  4J9P A;  4KLJ A;  3AQN A;  2ZH9 A;  5IIO A;  3BZC A;  2BCS A;  2J6U A;  1U45 A;  2ZIX B;  1JQR A;  2EWR A;  4DL2 A;  3PW2 A;  3PSF A;  3PNC A;  3ETR A;  2OWO A;  3N7R C;  4NLK A;  4US8 A;  4UBB A;  4TQR A;  4NWI A;  2AHO B;  3NVZ A;  1O08 A;  5AI4 A;  4F92 B;  2ZUC A;  4DFD A;  1BPZ A;  2XID A;  1FFV A;  2VAN A;  5L1K A;  2VIX A;  1X9S A;  1ZQS A;  4RQ4 A;  3QEA Z;  3OJU A;  4YP3 A;  1COO A;  3SD7 A;  3RH4 A;  3F2B A;  2KHV A;  4NJ8 A;  3PO5 A;  4Y2S A;  4M9L A;  1ZQJ A;  5J2B A;  3C29 A;  4ECU A;  2KSO B;  5DDM A;  1N62 A;  3ER9 B;  4FE3 A;  5B3P A;  4CNQ A;  1ZD4 A;  5DB7 A;  1A76 A;  1YT3 A;  2OXO A;  4F4Z A;  1UEU A;  1SB3 C;  2Q0Z X;  2ISP A;  2KIW A;  2ZH7 A;  1SL1 A;  3HPO A;  4IRK A;  5HR6 A;  4UAU A;  2EQY A;  5AI6 A;  4AT9 A;  1TK8 A;  4J9R A;  3ISD A;  9ICU A;  3MR6 A;  5J0O A;  1ZQH A;  2QAR B;  3WK8 A;  5AKY A;  2NRT A;  4S3N A;  3M9O B;  5DED A;  5ALI A;  7ICM A;  1OUQ A;  3H8J A;  4UAR A;  1QSL A;  1KTQ A;  4GXK A;  5CA7 A;  3GIL A;  4DOB A;  2YN4 A;  2ZXI A;  4ZH4 A;  3M9M B;  4FO6 A;  5KFD A;  1K1Q A;  5JTI A;  8ICB A;  2YMP A;  2M2T A;  1TFY A;  3RH6 A;  9ICA A;  1R8A A;  3FM9 A;  1JAL A;  1ZQA A;  5G5H A;  4M9N A;  5J2F A;  2KEY A;  4K97 A;  4R64 A;  1RYS A;  4OAF A;  1YLQ A;  2F8K A;  5KG7 A;  1N2X A;  4Y2X A;  2O6K A;  5EE3 A;  1ZQC A;  4EGW A;  3IP4 B;  4F93 B;  3ISB A;  3LK9 A;  2FDR A;  1TKD A;  5DQG A;  5KL8 B;  3PSP A;  4IQW A;  4P2H A;  4NXV A;  4DSK A;  3EPG A;  4BX9 C;  9ICH A;  3QYP A;  2YB4 A;  3QU4 A;  1RG6 A;  3AN1 A;  2G5I B;  2JH7 A;  3AQE A;  1QCK A;  1ZQM A;  1XO1 A;  9ICP A;  4C7Z A;  5KAI U;  3SAH A;  4F91 B;  2GO7 A;  3ICX A;  2VKQ A;  4ECW A;  4QJF B;  2W7P A;  3RJJ A;  3GIJ A;  4AT8 B;  9ICB A;  2I9G A;  3UQ2 A;  2H5X A;  2LYH A;  3GIM A;  2DFL A;  2DPJ A;  1NK8 A;  3Q8M A;  2K8C B;  2DKZ A;  2MRL A;  3WKC A;  2NRX A;  4ZOH C;  4NLG A;  4YXM A;  2A1A A;  2QLT A;  5L9X A;  4Q44 A;  2JMG A;  4F3O A;  1XU4 A;  1J2N A;  3J81 j;  8ICE A;  4KLG A;  2MUT A;  2BR0 A;  9ICE A;  1ZQE A;  1DK3 A;  1RM6 C;  4EX6 A;  3BDP A;  5J0U A;  4X4N A;  3FDS A;  3JPO A;  2R8K A;  3V6K A;  2Q4T A;  5CR0 A;  5DLG A;  4WBY A;  2WF8 A;  1N5X A;  2PFO A;  4R65 A;  2BPF A;  2ZIX A;  1V9P A;  3MC1 A;  3PW4 A;  4O67 A;  4XJE A;  3FC4 A;  5CFU A;  5HRK A;  5B5E U;  4C0Z A;  5AKX A;  7ICR A;  3I76 A;  1S0N A;  4IRD A;  9ICC A;  3QEB Z;  1OW5 A;  5F2V O;  2NO4 A;  3VC8 A;  2JEF A;  3MR5 A;  3WK6 A;  3K7D A;  5B3Q A;  2KP7 A;  1D8Y A;  1JRP A;  2VJ4 A;  2WFA A;  5DB8 A;  5KG3 A;  3D6J A;  3NVV A;  4N7R A;  5KT5 A;  2G09 A;  3EUB 2;  4DOA A;  4RQ2 A;  2KSO A;  4RPY A;  3BJY A;  1WWU A;  2A3V A;  2OH2 A;  4ECQ A;  3BS5 B;  4HAI A;  8ICR A;  3NS1 A;  5HNK A;  4P0P B;  2FLP A;  1CRX A;  4UB2 A;  5KG2 A;  3H4D A;  2N1R A;  4E7X A;  3AMZ A;  3H39 A;  3I1Y A;  2H3I A;  2F3N A;  5ALQ A;  1R89 A;  1N60 A;  2QAR A;  2DUY A;  1GPJ A;  4X0B A;  8ICK A;  4KLH A;  4B9S A;  1F5S A;  3AQK A;  4WC1 A;  1XSL A;  2XCA A;  2Y1I A;  1L3S A;  2ASL A;  3QU2 A;  1R8C A;  5CJ7 A;  2AGP A;  1Q3V A;  4G3I A;  3OSP A;  5ALG A;  2KOB A;  3F53 A;  2HBK A;  1UT8 A;  4UAS A;  4O3O A;  4X5V A;  3TAQ A;  4F5O A;  1ZQD A;  3KFU F;  2OCE A;  4MEX A;  4GFJ A;  4ECR A;  2KHQ A;  3OVS A;  5ALY A;  2IOH A;  3WU2 U;  3GV8 B;  1C7Y A;  1KRP A;  1SZH A;  4CF4 A;  1S0M A;  1MQ2 A;  5AK5 A;  4HX0 A;  1ZQI A;  9ICX A;  4NXT A;  4FH3 A;  2ZH3 A;  1UPH A;  2NV3 A;  3SAG A;  1KLN A;  4QZE A;  3PML A;  4ECS A;  2G5H B;  4ED6 A;  1Q3U A;  1ZQB A;  3L3F X;  2FLN A;  1UQV A;  1XO0 A;  4XRH A;  2KFN A;  4QWB A;  7ICL A;  9ICI A;  2K4E A;  4EEB A;  9ICK A;  1TFW A;  4KLE A;  4EEK A;  3V6J A;  1UT5 A;  1S77 D;  1LVH A;  2XY6 A;  3PST A;  4WC5 A;  2KN7 A;  4K4I A;  4DLE A;  5EWG A;  1ZQU A;  2HN1 A;  1UCV A;  1NJY A;  1SKS A;  2WF6 A;  3C23 A;  2BKE A;  5EOZ A;  2AU0 A;  4AT8 A;  4F2R A;  5ALD A;  4I29 A;  2HHS A;  1S0O A;  2IMW P;  5CHE A;  1TAQ A;  3KHG A;  4PL2 A;  1L7M A;  8ICF A;  4Z6C A;  4XA5 A;  2ZTD A;  4RQM A;  5HR9 A;  2K4I A;  3NVO A;  5KFA A;  4K9B A;  8ICJ A;  3TAN A;  1X66 A;  7ICV A;  1QTM A;  7ICF A;  3FYH A;  3UXP A;  1TK0 A;  5BOL A;  4TUQ A;  4ECV A;  1XWL A;  4TUS A;  3UMC A;  2M0N A;  2V9W A;  3T79 A;  2EAM A;  3MGV A;  4JV0 A;  4NXX A;  4UAW A;  5AKG A;  4QNL A;  2MAX A;  4KB6 A;  5EWE A;  4BWJ A;  2HBM A;  3HIL A;  4DF4 A;  3IDW A;  2FI1 A;  1BPX A;  1JXL A;  1N63 A;  5DGA A;  5IIM A;  1NJX A;  4ED2 A;  1X6I A;  4GIB A;  3C21 A;  2CN1 A;  4GC7 A;  4JWM A;  4PZO A;  5CRX A;  7ICO A;  3IM1 A;  3T3F A;  1ZQT A;  2B56 A;  4EBE A;  1ZET A;  1SKW A;  4RT3 A;  3PR5 B;  2I1Q A;  2ZJ5 A;  1T7P A;  1NOM A;  1S0V A;  3UXO A;  4Y2R A;  5CP2 A;  3WKD A;  1X9X A;  3V7L A;  5J8Y C;  2W8L A;  2FJ6 A;  2JHD A;  2HHX A;  4IRC A;  2DRB A;  2B4V A;  3RJK A;  2ZTE A;  1NK9 A;  2A1J B;  2WF9 A;  3NTU A;  2VA8 A;  1DGS A;  3V72 A;  3BS5 A;  2G06 A;  2FPM A;  5K4L A;  2R8I A;  4P0P A;  1RXW A;  2ZIW B;  2BDP A;  4QWE A;  3IG8 A;  1OU5 A;  3QZ7 A;  1N48 A;  4EYH B;  1ZQY A;  2KV2 A;  5AM0 A;  4R63 A;  4EZ6 A;  1KSP A;  4Y2J A;  3QUQ A;  3BQ0 A;  4QWA A;  4DS4 A;  1GO3 F;  1JIH A;  3LVW A;  5H2F U;  1SV0 C;  5KTQ A;  2NYV A;  4PZN A;  2EZX A;  5A0L A;  1S9F A;  4B9U A;  4DSI A;  9ICS A;  5ALF A;  3NWI A;  4ED7 A;  2C2E A;  4DFJ A;  2M2W A;  4Z6D A;  3OHA A;  3M8R A;  1HEK A;  2XVT A;  5KFG A;  1ZQK A;  5HP4 A;  1ZD3 A;  5AI8 A;  2HHQ A;  2E5S A;  4KLT A;  2DR7 A;  2ZHA A;  4NLN A;  1ED1 A;  4C8N A;  5DBB A;  3EF2 A;  1KNY A;  3E2E A;  3WFR E;  4EBK A;  2ASJ A;  7ICN A;  3JPN A;  4CE6 A;  2KVS A;  4DL4 A;  4FHX A;  3PW0 A;  4DQI A;  3ZD8 A;  4NLC A;  3LWL A;  2I6X A;  3TAD C;  5E79 U;  2LBO A;  5KT2 A;  1ZQW A;  1Z1B A;  1LV5 A;  5HRG A;  4YQW A;  3M6Z A;  5GTH U;  1U4B A;  1NO5 A;  2WHE A;  3OUY B;  2YML A;  3H3A A;  4LEZ A;  1RQN A;  4JUZ A;  4AP9 A;  2ZTC A;  4EBC A;  4YD2 A;  5HML A;  2E3T A;  2G0A A;  2FLL A;  1L3U A;  2HHP A;  1ARO P;  1ECW A;  3AQM A;  4I2F A;  3HWT A;  5AK6 A;  4Y2T A;  4O3Q A;  2JEI A;  4YMM A;  4PHP A;  3EWA A;  5KFM A;  9ICT A;  3C5G A;  1TK5 A;  5KFF A;  4C8K A;  3L4P A;  2JRZ A;  2UVR A;  1HJP A;  3UXN A;  4TUP A;  2EAP A;  1U47 A;  4FBU A;  4BGD A;  4FHW A;  3H0R B;  3ER8 C;  4C8M A;  4EEY A;  2FPK A;  5KFB A;  4NKT A;  4YN4 A;  1RXV A;  1UA0 A;  3LQC B;  1SV4 A;  4O5E A;  3F5A A;  4F71 A;  5KG0 A;  4KLL A;  2OHF A;  4PGQ A;  4P4O A;  2BCV A;  4RWN A;  2LYA A;  3OJS A;  4OO1 J;  5TIS U;  2PKE A;  4XQ7 A;  1V97 A;  4KLD A;  1RYU A;  3A0B U;  4WOY A;  2HHT A;  3V7K A;  1F0M A;  2GLE A;  2B6G A;  5IIK A;  5DEC A;  4RWP A;  2KJ9 A;  3C2M A;  3RAX A;  5C0Y A;  2K8A A;  5ALN A;  4UB3 A;  4RT2 A;  4QZB A;  4CF5 A;  3AM9 A;  8ICQ A;  4X4U A;  4YD1 A;  3MGI A;  1JMS A;  4KLI A;  2F2A B;  1FO4 A;  4CDG A;  4NL9 A;  4RUC A;  5AI9 A;  9ICM A;  3AEV A;  4OAG A;  2IUB A;  4MFF A;  1PZN A;  3G6V A;  2D6F C;  4RQ1 A;  2GH1 A;  5KFN A;  4YXJ A;  2ALZ A;  2BHN A;  3OVB A;  5T14 A;  2A1J A;  4UB6 U;  2ZH5 A;  3SMV A;  4NM1 A;  1NK5 A;  1TV9 A;  2WAQ F;  3UPQ A;  2W04 A;  1B0X A;  2ZIW A;  5AIC A;  4E0D A;  4ATB B;  2DKX A;  1DGJ A;  7ICT A;  1BPB A;  5AI5 A;  3UMG A;  5J2J A;  4OJL A;  3NVY A;  4YR0 A;  4ICA A;  2H3F A;  2ZH1 A;  2F44 A;  3RFA A;  2W3S A;  4Y2Q A;  1WYG A;  2W9C B;  1XSP A;  7ICJ A;  3L9D A;  5CEH A;  4FZM A;  2PBE A;  4NXU A;  4NXZ A;  2HOQ A;  3H0L B;  1KQQ A;  4I2J A;  3RR8 A;  2K4H A;  2HBL A;  1X42 A;  2JGA A;  4I2D A;  3WFO A;  3C2L A;  2GOL A;  2P6R A;  1SL0 A;  3GIK A;  5J2E A;  3QX7 A;  3CYM A;  1N56 A;  2YQE A;  2K89 A;  1T4G A;  4O3M A;  4M0A A;  7ICH A;  3OWG A;  4AT7 B;  3CNH A;  4FBT A;  2KKP A;  1MQ3 A;  3QU9 A;  1T94 A;  5HMM A;  1P7D A;  4LT6 A;  2ZH2 A;  2BDU A;  1BPY A;  2W9A A;  5EWF A;  3OHB A;  4CRX A;  4YCX A;  4CCH A;  4XQ8 A;  4FS2 A;  5DQH A;  3OUY A;  2KJ8 A;  4ELU A;  3JPP A;  2MA1 A;  3C2K A;  4I2C A;  3TFS A;  2E8M A;  4O0I A;  4K98 A;  2KKV A;  1U48 A;  1PVQ A;  1MIY A;  2RHF A;  7ICP A;  3NVW A;  5DB9 A;  3G6Y A;  4B6J A;  5D61 A;  2R8G A;  3HP6 A;  3JYY A;  4QW9 A;  3C1Z A;  4QWC A;  4WC4 A;  1QSY A;  4QW8 A;  3MFI A;  5IIN A;  1SKR A;  5D63 A;  5JUM A;  4CGZ A;  2W9B B;  4KX5 A;  4OAH A;  4UD4 A;  4MF8 A;  2JV3 A;  2BZF A;  3C5F A;  4O3R A;  4QWD A;  3PX6 A;  1XS9 D;  5KFT A;  4E80 A;  3E0F A;  2P66 A;  5AM5 A;  4Q45 A;  1SV0 A;  2NRZ A;  4P0Q B;  4YMO A;  1S10 A;  4ECY A;  3GU3 A;  3CW2 C;  2D3D A;  5JTG A;  2BPG A;  1ZYQ A;  3WKA A;  3U26 A;  2DR5 A;  5HRH A;  2IHM A;  1IIP A;  4WQL A;  5D62 A;  2FCL A;  3H37 A;  1WG8 A;  1JAJ A;  1SIJ A;  2PMZ C;  1WOT A;  1Z00 B;  3MR3 A;  2ZUD A;  5KFQ A;  2BCR A;  1BPE A;  4YR3 A;  4EZ9 A;  1ZXI A;  2J6T A;  2ZH6 A;  4DFK A;  2O1P A;  4PHE A;  2E8O A;  2M2V A;  2DRA A;  4NKU A;  3TAD A;  4R8U B;  2YTU A;  4I2H A;  4QZI A;  1UET A;  5DB6 A;  8ICV A;  3H8W A;  4MFA A;  4RPX A;  1M6Y A;  3F2D A;  2DBY A;  3IRU A;  1TAU A;  9ICJ A;  4QZC A;  1L8O A;  2EAO A;  1A0P A;  5HHI A;  3WK5 A;  3GII A;  4UB5 A;  1B4F A;  2W11 A;  2BQU A;  2ZHB A;  3OPX A;  4LVS A;  1Q79 A;  2V4Q A;  1JI7 A;  2NRK A;  3DDH A;  4WC0 A;  1CUK A;  4NLB A;  2ODG A;  2LM1 A;  1D8L A;  3M1Y A;  3KOO A;  2KD1 A;  2LI6 A;  4DO9 A;  3CK6 A;  5ALX A;  1FIQ A;  4X4V A;  4JB3 A;  4J9M A;  2OEH A;  4ATB A;  5KFI A;  2PFQ A;  4EV6 A;  7ICQ A;  4F4K A;  1BNO A;  1ZQG A;  3GV5 B;  3BQ7 A;  4J9O A;  2W9C A;  1SL2 A;  1MC8 A;  2WB1 C;  4B9N A;  4GC6 A;  4DSL A;  2XY7 A;  1LB2 B;  5DDY A;  3N7S C;  3QXG A;  4ECT A;  2QKQ A;  1X40 A;  1X2I A;  1WCN A;  2F77 X;  5KFU A;  2CXY A;  4WQK A;  4YR2 A;  5HRB A;  3WKB A;  4KLQ A;  1PX5 A;  4EX7 A;  5J2H A;  4DLG A;  2Z7J A;  4Z6E A;  2HHV A;  5DG7 A;  3M7D A;  5BPC A;  3S6J A;  2W3R A;  5D4B A;  5ALT A;  3RBD A;  5KNI A;  3ZDE A;  2JH1 A;  5ALK A;  1ZD2 P;  4DFM A;  1ZQZ A;  4LJX A;  2HMX A;  4KMO B;  3NYB A;  4DS5 A;  3ZDB A;  2RP5 A;  4ED0 A;  4AT7 A;  5ALV A;  1NKB A;  4OAI Z;  1PK3 A;  4QZ9 A;  4AYB C;  3IV6 A;  5AKL A;  1X6J A;  2P35 A;  4US9 A;  4YG2 A;  4EP7 A;  4QZH A;  4KLO A;  4UB4 A;  2L5Y A;  4FHV A;  3PX4 A;  1D9F A;  4DQS A;  1L6N A;  4O3N A;  5D49 A;  4FZL A;  5ALO A;  4I2I A;  2ZXH A;  3OV7 A;  3K4G A;  3B0Y A;  2AGO A;  2HCF A;  4UQG A;  2WTF A;  2C2D A;  8ICC A;  4KX3 A;  2EH9 A;  1UA1 A;  1SZP A;  4A8E A;  2P6U A;  5KG1 A;  2XGQ A;  1L3T A;  3ZDA A;  1R8B A;  4M9J A;  2KG5 A;  4RNO A;  4F4Y A;  2W9B A;  4JMU A;  1YZ7 A;  4UAV A;  5AM2 A;  4F72 A;  3T5K A;  2KZM A;  2F1I A;  3OTQ A;  4Y2Y A;  1T3Q A;  4P0Q A;  5KFE A;  2ZH4 A;  1S5L U;  3PW5 A;  4U6P A;  3PO4 A;  2VA2 A;  3WK7 A;  1K1S A;  3MAB A;  3WFP A;  4U7C A;  4WC6 A;  1BNP A;  3RJI A;  3FAH A;  2E1E A;  2JEJ A;  5J2C A;  4LEV A;  4FHY A;  1HUO A;  1C20 A;  2QB1 A;  4KN4 A;  4IQU A;  1H38 A;  3NRW A;  4ED1 A;  1V85 A;  2LKY A;  5KFY A;  4IQT A;  1X9M A;  4BUG A;  5AKI A;  4WCW A;  4IG8 A;  2EZY A;  1Z00 A;  1IXR A;  1DOQ A;  2ZIU B;  2BGW A;  2VJ5 A;  3Q8P B;  2G07 A;  3ISC A;  3TAP A;  4QZ8 A;  3KHR A;  4IL6 U;  1SWW A;  4PL1 A;  2JXJ A;  1MN8 A;  2DQN B;  2PMZ F;  4NM2 A;  1Z3E B;  3GQC A;  1ZJM A;  4R8U A;  2ZH8 A;  5III A;  2J6S A;  2G08 A;  9ICN A;  4RQ3 A;  2HHW A;  2ZUB A;  1BVS A;  4ELV A;  3E58 A;  3B0X A;  3EW9 A;  3H38 A;  2D8C A;  1FEZ A;  2HHU A;  3JCF A;  4J9K A;  2LHT A;  1KDH A;  5AKJ A;  4KLM A;  5CHG A;  2F1H A;  3JPQ A;  4B9T A;  2F1J A;  3T5H A;  3PY8 A;  2KTQ A;  3QNM A;  2XO7 A;  1VJ7 A;  1IM4 A;  1ZOL A;  1IV8 A;  3RJF A;  1HIW A;  5ALZ A;  4C4S A;  2AJQ A;  5DKW A;  1KBU A;  3PVX A;  4K96 A;  2Y1J A;  1L7N A;  3F5E A;  5GTI U;  8ICS A;  3HRD D;  1Z4N A;  8ICX A;  5KFX A;  4DQQ A;  5L1J A;  2WF7 A;  3V7J A;  1NK7 A;  2R8J A;  2GWS A;  3RJH A;  4FFD A;  1NJZ A;  4DL3 A;  1QH9 A;  4DL5 A;  4M47 A;  3KHL A;  2Y9U A;  5KFP A;  3QUC A;  4RQ6 A;  4X4S A;  1TE2 A;  3ONN A;  8ICY A;  1L3V A;  2ID1 A;  4P4P A;  8ICI A;  4F5P A;  4YFK A;  2WB1 F;  2Y0S C;  5KFO A;  5ALW A;  2AQ4 A;  4O3P A;  3UQ0 A;  7ICS A;  4UAZ A;  2HOF A;  4O6A A;  4R66 A;  5KG6 A;  4IS7 A;  3Q8R B;  2HSZ A;  2BCQ A;  2EAN A;  1QSS A;  5EE0 A;  2KNJ A;  1N5W A;  3NGD A;  2HDO A;  3CP8 A;  3HW8 A;  1V38 A;  2O5A A;  3RRH A;  1WUD A;  5KT6 A;  4RWO A;  3ZDD A;  2IHN A;  3RJE A;  2BBJ A;  2M2U A;  3TFR A;  5EE1 A;  2ZJA A;  5FP0 A;  4F5Q A;  2HN2 A;  3PSI A;  3SV3 A;  4UD5 A;  5HR7 A;  3GZF A;  3PMN A;  4XUS A;  1MIW A;  3K1R B;  1K5O A;  2IA6 A;  4AYB F;  3IHQ B;  2KVC A;  3I28 A;  4OJO A;  4X4R A;  2W8K A;  1CI4 A;  1OXJ A;  2K8B B;  4IR9 A;  1A77 A;  2H3V A;  3L5K A;  2HW3 A;  4YVZ A;  9ICQ A;  2KK0 A;  2HOI A;  4RPZ A;  1ZQV A;  2WF5 A;  3OVA A;  1URJ A;  3T5J A;  1UHU A;  2W43 A;  4J9L A;  3UMB A;  2JZB B;  2CPR A;  4PGY A;  5AIA A;  4KLU A;  3WKE A;  2AGQ A;  3AU2 A;  4FH5 A;  8ICH A;  3H0M B;  3PX0 A;  3RF9 A;  5EE9 A;  5DGB A;  4NY8 A;  4UW9 A;  3AUO A;  4PJ0 U;  5KT3 A;  3MDA A;  8ICT A;  2FMQ A;  2IHO A;  5F9L A;  3SR6 A;  1XC9 A;  1NKC A;  1ZQO A;  2ATL A;  4J9N A;  2YMM A;  3H40 A;  3CRX A;  1QQ5 A;  2K60 A;  4KMU A;  4B9M A;  3KHH A;  4RZR A;  3H8S A;  2ZIU A;  3EYZ A;  1ZQR A;  3V6H A;  2ISO A;  4DEZ A;  1T3N A;  5DQI A;  1IG6 A;  3PHZ A;  1S76 D;  5TZV A;  2YX8 A;  2W55 A;  2UVW A;  5HC9 A;  4BWM A;  3RJG A;  4DQP A;  1QQ6 A;  1T8E A;  2AXT U;  3RB4 A;  3DV9 A;  2KIC A;  1QQ7 A;  4M5D A;  1ZRM A;  7ICG A;  5CB1 A;  2BCU A;  1COK A;  2HBJ A;  5L1L A;  3HKZ C;  4JWN A;  4F4W A;  3N7P D;  3EZ5 A;  1X9W A;  4EBD A;  3SEI A;  2NO5 A;  1NNL A;  1ZQ1 C;  5J2A A;  2HVH A;  2OYY A;  4PPX A;  1ZQL A;  3MCR A;  2LM4 A;  3JZ0 A;  4X4T A;  2PFN A;  4K8V A;  1EXN A;  4ED3 A;  3H7I A;  1D9D A;  5AHX A;  1ZQP A;  3ED5 A;  2IOF K;  1YZ6 A;  2A19 A;  4LZG A;  5J0Y A;  4RQ0 A;  2XIC A;  2BQ3 A;  1F5A A;  9ICG A;  5DG8 A;  1XSN A;  3ZDC A;  5HRE A;  4LEW A;  3Q8S B;  4UAT A;  2YB1 A;  3JPS A;  4DFP A;  3HIY A;  4X4P A;  4EEN A;  4I2B A;  5ALP A;  5ALS A;  1ZQN A;  1L7P A;  5KFC A;  5DG9 A;  4GXI A;  5ALJ A;  5IIL A;  2HI0 A;  1NK0 A;  2KIV A;  1MA7 A;  1SWV A;  5ALR A;  3RBE A;  3RRG A;  3OGU A;  2MU2 A;  3DEE A;  4PHA A;  5HRD A;  4ED8 A;  1KEJ A;  5J29 A;  2KJ5 A;  2F76 X;  4RUA A;  3HT3 A;  3N28 A;  3QE9 Y;  3THV A;  2DL0 A;  4F4X A;  2RFF A;  1ZJN A;  2RDI A;  3M6K A;  1JXE A;  2Y0S F;  1XNS A;  5J8Y A;  1RZT A;  4O69 A;  2B51 A;  4F5N A;  4M2Y A;  3LVV A;  5KG5 A;  2YMQ A;  4WH5 A;  4OCZ A;  2H3Z A;  5KFL A;  4MHV A;  4UB1 A;  1NK6 A;  2UVU A;  3AQL A;  4X0A A;  4G9B A;  2LMR A;  3Q8Q B;  4QZD A;  3Q8K A;  4TUR A;  4JLX A;  5L1M A;  4M9H A;  1Z4O A;  1D8B A;  3LDA A;  5J0R A;  3N97 B;  4RNN A;  1U9L A;  1RDF A;  2MSN A;  3TI0 A;  3KBB A;  8ICA A;  4RQN A;  5J0X A;  5KL1 B;  5F9N A;  3RB0 A;  4O5C A;  3B9J A;  2KMD A;  4EED A;  4DF8 A;  1PVP A;  4FS1 A;  4J9S A;  4O68 A;  2W54 A;  4Q8E A;  2JZB A;  4IC9 A;  4C7Y A;  5J2I A;  3D2S A;  5HHH A;  4KN7 A;  4CF3 A;  2PI4 A;  4F50 A;  1JUD A;  2XC9 A;  4B9L A;  3SYZ A;  5HRL A;  4NXW A;  3D2Q A;  2DR8 A;  2DF4 B;  3ZI4 A;  5J0T A;  2E8P A;  4K9A A; 
#chains in the Genus database with same CATH homology
 2M2W A;  9ICR A;  3PX4 A;  1D9F A;  4Z6D A;  4DQS A;  4DSJ A;  4MEY A;  5DB7 A;  1A76 A;  4O3N A;  3OHA A;  5D49 A;  3M8R A;  3LWM A;  4F4Z A;  9ICO A;  1UEU A;  2Q0Z X;  2ISP A;  5KFG A;  2ZH7 A;  1SL1 A;  1ZQK A;  3HPO A;  5HP4 A;  4I2I A;  4IRK A;  5KFJ A;  3OV7 A;  3K4G A;  3B0Y A;  2AGO A;  4KLT A;  2HHQ A;  2DR7 A;  5KFV A;  4UQG A;  4KIT B;  2WTF A;  2C2D A;  8ICC A;  4NLN A;  4C8N A;  4RWQ A;  5DBB A;  1TK8 A;  4WC7 A;  2ZHA A;  4J9R A;  3ISD A;  1UA1 A;  1KNY A;  3E2E A;  3WFR E;  9ICU A;  1SZP A;  3MR6 A;  4EBK A;  2P6U A;  2ASJ A;  7ICN A;  3JPN A;  2C28 A;  5J0O A;  5KG1 A;  2XGQ A;  1L3T A;  1ZQH A;  3ZDA A;  1R8B A;  3UPS A;  4M9J A;  3EPI A;  4RNO A;  2NRT A;  4F4Y A;  2W9B A;  4DL4 A;  4FHX A;  3PW0 A;  4S3N A;  4DQI A;  3ZD8 A;  3M9O B;  5DED A;  3LWL A;  7ICM A;  4DSF A;  4WC3 A;  4M6W B;  1B22 A;  2DR9 A;  4RNM A;  1B43 A;  3H8J A;  1ZQW A;  5KT2 A;  3T5K A;  1LV5 A;  4JV1 A;  2KZM A;  5HRG A;  4YQW A;  1QSL A;  4F2S A;  1KTQ A;  4GXK A;  5CA7 A;  5J0S A;  3GIL A;  4DOB A;  1U4B A;  1NO5 A;  2F1I A;  3OUY B;  3H3A A;  4ZH4 A;  5KFE A;  2ZH4 A;  4JUZ A;  3PW5 A;  3M9M B;  4X4O A;  4WC2 A;  5KT7 A;  3SZ2 A;  1Q78 A;  2ZTC A;  4FO6 A;  3PO4 A;  2PI5 A;  2VA2 A;  1K1S A;  4YD2 A;  5L1I A;  3MAB A;  4EBC A;  3HJ1 A;  3WFP A;  5KFD A;  5HML A;  1K1Q A;  1BNP A;  4WC6 A;  3RJI A;  2M2T A;  2W9M A;  2JEJ A;  2FLL A;  5J2C A;  4I2A A;  4FHY A;  8ICB A;  1L3U A;  2HHP A;  7ICU A;  1ARO P;  9ICW A;  5J0P A;  3RH6 A;  5KFH A;  1HUO A;  2VA3 A;  4I2F A;  4O9M A;  9ICA A;  3HWT A;  1R8A A;  1ZQA A;  4M9N A;  4KN4 A;  5J2F A;  8ICU A;  4O3Q A;  4IQU A;  3TQ1 A;  1H38 A;  2JEI A;  1Y88 A;  5IIJ A;  4YMM A;  4R64 A;  5KFY A;  4ED1 A;  4PHP A;  4IQT A;  1TVA A;  1X9M A;  1RYS A;  3EWA A;  5KG7 A;  5KFM A;  4C8O A;  3M8S A;  4BXO B;  4I28 A;  1QLN A;  3MBY A;  3C5G A;  1NZP A;  4IG8 A;  1Z00 A;  1TK5 A;  1IXR A;  1DOQ A;  4LZD A;  5KFF A;  2BGW A;  2NRV A;  3Q8P B;  4C8K A;  1ZQC A;  5J2K A;  3ISC A;  2NRW A;  4F93 B;  2UVR A;  3TAP A;  1HJP A;  1L5U A;  4MF2 A;  4QZ8 A;  3UXN A;  3ISB A;  4B9V A;  3LK9 A;  1TKD A;  5C5J A;  3KHR A;  5DQG A;  4TUP A;  3BQ2 A;  3C18 A;  3ETL A;  4IQW A;  1U47 A;  4P2H A;  4FBU A;  4BGD A;  4DSK A;  4FHW A;  2AQ0 A;  4NM2 A;  3GQC A;  1Z3E B;  4C8M A;  3EPG A;  4C8L A;  3PW7 A;  4EEY A;  1ZJM A;  9ICH A;  4E8F A;  4R8U A;  2ZH8 A;  5III A;  2J6S A;  4M2Y A;  2FPK A;  5KFB A;  9ICN A;  1YLQ A;  4RQ3 A;  4NKT A;  4YN4 A;  3OSN A;  1RXV A;  1NKE A;  4X4U A;  1UA0 A;  2ZUB A;  2HHW A;  1BVS A;  1ZQM A;  4ELV A;  1XO1 A;  3LQC B;  9ICP A;  3B0X A;  4O5E A;  3EW9 A;  3H38 A;  4F91 B;  2HHU A;  5KG0 A;  4J9K A;  1WCL A;  7ICI A;  4ECW A;  1KDH A;  4KLL A;  4KLM A;  5CHG A;  4PGQ A;  2FMP A;  3GIJ A;  4P4O A;  3RJJ A;  2I9G A;  3UQ2 A;  9ICB A;  2F1H A;  5KFZ A;  3HJ4 A;  4AT8 B;  2BCV A;  1ZQQ A;  3JPQ A;  5J0W A;  4ELT A;  2H5X A;  4RWN A;  2LYH A;  2F1J A;  3OJS A;  3GIM A;  2DFL A;  4B9T A;  3T5H A;  3PY8 A;  4K4H A;  2KTQ A;  2DPJ A;  2XO7 A;  1NK8 A;  4F8R A;  1VJ7 A;  1IM4 A;  4P4M A;  3Q8M A;  4XQ7 A;  4RQ8 A;  4KLD A;  4BDP A;  5J2G A;  2HHT A;  3ZD9 A;  3V7K A;  3RJF A;  2NRX A;  8ICM A;  2JEG A;  4NLG A;  4YXM A;  4DL7 A;  2AJQ A;  5L9X A;  4Q44 A;  5IIK A;  5DKW A;  3QZ8 A;  3PVX A;  5DEC A;  4RWP A;  4F3O A;  1XU4 A;  3C2M A;  2Y1J A;  3RAX A;  4UB3 A;  2KZZ A;  4DL6 A;  4RT2 A;  4I2G A;  8ICE A;  8ICS A;  4QZB A;  5DLF A;  4KLG A;  2MUT A;  2BR0 A;  8ICQ A;  8ICX A;  5KFX A;  4YD1 A;  4DQQ A;  9ICE A;  2BE3 A;  1ZQE A;  5L1J A;  1DK3 A;  3V7J A;  1NK7 A;  4NLZ A;  2R8J A;  2GWS A;  3RJH A;  2ZJ8 A;  3MGI A;  5J0U A;  1NJZ A;  1JMS A;  4J9Q A;  3BDP A;  4O3S A;  4DL3 A;  4KLI A;  4X4N A;  3FDS A;  3JPO A;  4RUC A;  4DL5 A;  4Q8F A;  3Q8L A;  3KHL A;  4M47 A;  9ICM A;  5KFP A;  2R8K A;  3V6K A;  4MFF A;  8ICG A;  1BGX T;  1PZN A;  4RQ6 A;  3G6V A;  4X4S A;  5CR0 A;  3RB3 A;  5DLG A;  8ICW A;  4RQ1 A;  5KFN A;  8ICY A;  4WBY A;  4YXJ A;  2Q66 A;  2ALZ A;  2BHN A;  2PFO A;  1L3V A;  1MIV A;  3OVB A;  4R65 A;  2BPF A;  2ID1 A;  4P4P A;  2A1J A;  2HVI A;  1V9P A;  8ICN A;  3PW4 A;  8ICI A;  1FA0 A;  4F5P A;  3SV4 A;  4YFK A;  4NM1 A;  2ZH5 A;  1NK5 A;  9ICT A;  1TV9 A;  4YMN A;  5KFO A;  2AQ4 A;  5HRK A;  4O3P A;  3UQ0 A;  3RB6 A;  3UPQ A;  7ICR A;  7ICS A;  4UAZ A;  4E0D A;  5D46 A;  4R66 A;  4ATB B;  2R8H A;  5KG6 A;  1S0N A;  3Q8R B;  4IRD A;  5DBA A;  2BCQ A;  9ICC A;  3GDX A;  7ICT A;  3QEB Z;  2FMS A;  1BPB A;  1NK4 A;  1QSS A;  5J2J A;  4YR0 A;  4WCW A;  5F2V O;  2JEF A;  3MR5 A;  2KP7 A;  1D8Y A;  3NGD A;  2ZH1 A;  5DB8 A;  5KG3 A;  3PV8 A;  2W9C B;  4Q43 A;  3HW8 A;  1XSP A;  4KLF A;  7ICJ A;  2O5A A;  3L9D A;  3RRH A;  3RAQ A;  4DSE A;  5KT6 A;  5KFR A;  3ZDD A;  4RWO A;  4PH5 A;  2IHN A;  3RJE A;  5KT5 A;  2M2U A;  2PXI A;  1MSW D;  2PBE A;  3TFR A;  3RH5 A;  3C66 A;  2BQR A;  3C1Y A;  4NXZ A;  2ZJA A;  4F5Q A;  4DOA A;  3JPT A;  3ORY A;  4RQ2 A;  3TAR A;  3SV3 A;  5J2D A;  4UD5 A;  3WFS C;  4RPY A;  3BJY A;  4I2J A;  4ECQ A;  1KFD A;  3RR8 A;  4QZA A;  3PMN A;  4XUS A;  8ICR A;  3JPR A;  4KLS A;  1MIW A;  2IA6 A;  5HNK A;  1VFG A;  3IHQ B;  2FLP A;  4X4R A;  2W8K A;  4QZF A;  1KFS A;  4UB2 A;  4I2D A;  5KG2 A;  4IR9 A;  3H4D A;  3WFO A;  1A77 A;  2HW3 A;  4E7X A;  3C2L A;  4YVZ A;  3H39 A;  9ICQ A;  4RPZ A;  3H4B A;  1HUZ A;  1ZQV A;  1SL0 A;  2P6R A;  3OVA A;  1TFY A;  3GIK A;  4EYI B;  5KG4 A;  5J2E A;  3T5J A;  1N56 A;  4DWI A;  1R89 A;  1T4G A;  2B21 A;  4QZG A;  4M0A A;  7ICH A;  4AT7 B;  3MR2 A;  4J9L A;  4X0B A;  3HX0 A;  4FBT A;  1MQ3 A;  2FPL A;  2JZB B;  4RQ5 A;  2V4R A;  5HMM A;  4B9S A;  4KLH A;  8ICK A;  3AQK A;  4X4Q A;  4LT6 A;  2KFZ A;  4WC1 A;  8ICP A;  1ZQF A;  4PGY A;  4M6W A;  1XSL A;  2XCA A;  2Y1I A;  1L3S A;  3MGH A;  2ASL A;  1BPY A;  2W9A A;  5EWF A;  2ZH2 A;  2AGQ A;  4GLX A;  3OHB A;  1R8C A;  4I27 A;  4YCX A;  5CJ7 A;  1BPD A;  2C2R A;  4CCH A;  4XQ8 A;  7ICK A;  4FS2 A;  3AU2 A;  5DQH A;  2AGP A;  4FH5 A;  3OUY A;  8ICH A;  5KFS A;  3PX0 A;  4G3I A;  2DVI A;  4ELU A;  3OSP A;  3JPP A;  3C2K A;  4I2C A;  3TFS A;  4I2E A;  4O0I A;  5DGB A;  4NY8 A;  8ICO A;  3AUO A;  3M9N B;  1U48 A;  2XGP A;  4DQR A;  1MIY A;  4ECX A;  1UT8 A;  2M9N A;  4Z6F A;  5KT3 A;  3MFH A;  3MDA A;  8ICT A;  2FMQ A;  4O3O A;  4X5V A;  5F9L A;  4F5O A;  3TAQ A;  5DB9 A;  1ZQD A;  7ICP A;  4FHP A;  4K4G A;  1XC9 A;  2ASD A;  1NKC A;  4MEX A;  3G6Y A;  4ECR A;  1ZQO A;  4AT9 B;  3OVS A;  2R8G A;  3HP6 A;  3JYY A;  4QW9 A;  3C1Z A;  4QWC A;  4J9N A;  2ATL A;  4KLU A;  3GV8 B;  3H40 A;  1C7Y A;  4WC4 A;  1KRP A;  1S0M A;  5J0Q A;  5KFW A;  3SI8 A;  4KTQ A;  1RYR A;  1UEV A;  4KMU A;  1MQ2 A;  2KZ3 A;  5KFK A;  4B9M A;  3KHH A;  1ZQI A;  4BXO A;  1QSY A;  4QW8 A;  3MFI A;  2UVV A;  4RZR A;  5IIN A;  1SKR A;  9ICX A;  3H8S A;  5JUM A;  3EYZ A;  1ZQR A;  2W9B B;  3V6H A;  4FH3 A;  2ISO A;  4UD4 A;  2ZH3 A;  4DEZ A;  4MF8 A;  5DQI A;  1T3N A;  4QZE A;  1KLN A;  3PML A;  1DK2 A;  3C5F A;  4ECS A;  4O3R A;  4MFC A;  1S76 D;  4QWD A;  4JK1 A;  5TZV A;  4ED6 A;  3PX6 A;  1ZQB A;  1XS9 D;  5KFT A;  4E80 A;  2UVW A;  5HC9 A;  2FLN A;  4BWM A;  3RJG A;  2P66 A;  4DQP A;  4M04 A;  4Q45 A;  1T8E A;  4JV2 A;  4XRH A;  2KFN A;  2NRZ A;  1S97 A;  4YMO A;  1S10 A;  4HYK A;  4QWB A;  3RB4 A;  3PR4 A;  7ICL A;  9ICI A;  5BOM A;  3BQ1 A;  4ECY A;  3AU6 A;  4M5D A;  9ICK A;  1TFW A;  3GFK B;  1ZQX A;  4KLE A;  3V6J A;  2BPG A;  7ICG A;  8ICZ A;  1UT5 A;  3GV7 B;  1ZYQ A;  2XCP A;  3T5L A;  5CB1 A;  2BCU A;  1S77 D;  4AT9 A;  2XY6 A;  2DR5 A;  4WC5 A;  5HRH A;  2IHM A;  2KN7 A;  5L1L A;  4DLE A;  4K4I A;  4JWN A;  4UAY A;  4F4W A;  5EWG A;  1X9W A;  3EZ5 A;  4EBD A;  1ZQU A;  2DPI A;  4GXJ A;  1TFR A;  1NJY A;  3H37 A;  4PHD A;  1SKS A;  1JAJ A;  5KT4 A;  2RDJ A;  3C23 A;  2BKE A;  5J2A A;  1NJW A;  1Z00 B;  5EOZ A;  3MR3 A;  2AU0 A;  2HVH A;  1WOT A;  4AT8 A;  2ZUD A;  4PGX A;  4IQV A;  5KFQ A;  1ZQL A;  2IBK A;  4F2R A;  4PPX A;  2XY5 A;  4IR1 A;  3JZ0 A;  2BCR A;  1BPE A;  4YR3 A;  4F5R A;  4I29 A;  2PFN A;  2HHS A;  1S0O A;  8ICL A;  4X4T A;  4EZ9 A;  2IMW P;  3BQT A;  2J6T A;  2ZH6 A;  4DFK A;  2O1P A;  4M9G A;  1TAQ A;  3KHG A;  1EXN A;  5HRI A;  4PHE A;  3H7I A;  4ED3 A;  4RQ7 A;  1ZQP A;  1D9D A;  2M2V A;  8ICF A;  2DRA A;  4Z6C A;  4NKU A;  4R8U B;  4I2H A;  4QZI A;  1UET A;  4XA5 A;  5DB6 A;  4LZG A;  8ICV A;  3H8W A;  5J0Y A;  2ZTD A;  4RQ0 A;  4MFA A;  5HR9 A;  5CWR A;  4RPX A;  1CEZ A;  9ICV A;  5KFA A;  2BQ3 A;  1KFT A;  1TAU A;  5DG8 A;  9ICG A;  8ICJ A;  2C22 A;  9ICJ A;  4QZC A;  1F5A A;  4EBJ A;  1XSN A;  3ZDC A;  5HHI A;  3KTQ A;  5HRE A;  3TAN A;  3GII A;  7ICV A;  3Q8S B;  1QTM A;  3AQM A;  4UB5 A;  7ICF A;  4TQS A;  3FYH A;  3UXP A;  1TK0 A;  5BOL A;  3JPS A;  2BQU A;  1JN3 A;  4DFP A;  2ZHB A;  3N4M B;  3HIY A;  4TUQ A;  4LVS A;  4X4P A;  4ECV A;  4I2B A;  4O5K A;  7ICE A;  1Q79 A;  1XWL A;  4TUS A;  2V4Q A;  2V9W A;  1ZQN A;  2BPC A;  5DBC A;  5KFC A;  5DG9 A;  4JV0 A;  4GXI A;  2NRK A;  4UAW A;  5IIL A;  1NK0 A;  2PFP A;  4WC0 A;  5HRF A;  1CUK A;  4DOC A;  2MAX A;  3RTV A;  3RBE A;  5EWE A;  3RRG A;  3OGU A;  3RR7 A;  4BWJ A;  1U49 A;  1D8L A;  4PHA A;  4DF4 A;  1JX4 A;  5HRD A;  1V4A A;  9ICL A;  4DO9 A;  4ED8 A;  4WBZ A;  3G6X A;  1KEJ A;  1BPX A;  5J29 A;  4ECZ A;  1JXL A;  4X4V A;  9ICF A;  4J9M A;  4ATB A;  5KFI A;  5DGA A;  5IIM A;  4RUA A;  3HT3 A;  1RPL A;  1NJX A;  2PFQ A;  4ED2 A;  4UBC A;  3QE9 Y;  3THV A;  4RU9 A;  3MDC A;  7ICQ A;  3C21 A;  4F4X A;  2RFF A;  4F4K A;  2MUT B;  4GC7 A;  1ZQG A;  1BNO A;  1ZJN A;  2RDI A;  4JWM A;  1JXE A;  7ICO A;  3IM1 A;  3T3F A;  3GV5 B;  1ZQT A;  3WFQ E;  4J9O A;  4EBE A;  1RZT A;  2W9C A;  3K75 D;  1ZET A;  1SL2 A;  4RT3 A;  1MC8 A;  3PR5 B;  4F5N A;  2I1Q A;  2ZJ5 A;  1SKW A;  1T7P A;  1NOM A;  4B9N A;  5KG5 A;  1S0V A;  4GC6 A;  3UXO A;  4J9P A;  4DSL A;  5KFL A;  5CP2 A;  2XY7 A;  3V7L A;  1LB2 B;  5DDY A;  4UB1 A;  4KLJ A;  1NK6 A;  2UVU A;  2W8L A;  4ECT A;  3AQL A;  3AQN A;  4X0A A;  2ZH9 A;  2HHX A;  5IIO A;  4IRC A;  1X2I A;  2DRB A;  3Q8Q B;  1WCN A;  3RJK A;  4QZD A;  2BCS A;  2J6U A;  1U45 A;  3Q8K A;  2ZTE A;  1NK9 A;  4TUR A;  2A1J B;  5KFU A;  1JQR A;  3NTU A;  4M9H A;  4DL2 A;  2VA8 A;  4YR2 A;  1DGS A;  3V72 A;  3PNC A;  3PW2 A;  5HRB A;  3LDA A;  2OWO A;  4KLQ A;  2FPM A;  4NLK A;  5J0R A;  4UBB A;  1PX5 A;  5J2H A;  4DLG A;  2R8I A;  1RXW A;  4TQR A;  4Z6E A;  4RNN A;  3N97 B;  4QWE A;  2BDP A;  2HHV A;  5DG7 A;  4F92 B;  1U9L A;  3TI0 A;  5BPC A;  8ICA A;  1OU5 A;  3QZ7 A;  2ZUC A;  5J0X A;  1N48 A;  1BPZ A;  5F9N A;  5D4B A;  3RB0 A;  4EYH B;  1ZQY A;  4O5C A;  3RBD A;  4DF8 A;  2VAN A;  4R63 A;  3ZDE A;  5L1K A;  4DFM A;  1X9S A;  3NYB A;  1ZQS A;  1ZQZ A;  4EZ6 A;  4DS5 A;  1KSP A;  3ZDB A;  4FS1 A;  4J9S A;  4RQ4 A;  3BQ0 A;  4ED0 A;  3QEA Z;  1NKB A;  4AT7 A;  4Q8E A;  4QWA A;  4DS4 A;  2JZB A;  1JIH A;  4QZ9 A;  3OJU A;  5J2I A;  5KTQ A;  4YP3 A;  5HHH A;  1COO A;  4KN7 A;  2PI4 A;  3RH4 A;  4F50 A;  2XC9 A;  1S9F A;  4B9L A;  3SYZ A;  4B9U A;  4DSI A;  9ICS A;  3PO5 A;  4YG2 A;  5HRL A;  2DR8 A;  4M9L A;  4EP7 A;  4QZH A;  1ZQJ A;  5J2B A;  4ED7 A;  2C2E A;  4DFJ A;  5J0T A;  4UB4 A;  4ECU A;  4KLO A;  4FHV A;  5DDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...