5DB9A

Structure of human dna polymerase beta host-guest complex with the n7mg base paired with a dg
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
molecule tags Transferase/dna
source organism Homo sapiens
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
total genus 108
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5db9A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5db9A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5db9A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5db9A03
1ZQJA 3PW4A 1JX4A 2IA6A 4KLTA 4FH3A 2LYHA 4QZCA 5KT5A 9ICSA 3WFOA 1QSSA 3M8RA 5EOZA 2XY6A 4QZ8A 1COOA 4ZH4A 4I2FA 3OV7A 5KG5A 5KFOA 4F5OA 1ZQYA 2KZ3A 3JPRA 2R8KA 4RQ2A 4B9MA 4YP3A 3H8SA 2BPGA 1BPYA 4AT7A 1H38A 4X4VA 3C5FA 5DBAA 3RAXA 1ZQXA 2FPLA 5KFHA 5DLFA 1NJZA 2FMSA 4YQWA 3PVXA 5KFCA 2DR5A 4IG8A 5HRFA 3AQNA 1RZTA 4KLJA 3IM1A 3PMLA 4KITB 2W9CA 2C2EA 4Z6CA 4MFAA 4ECZA 4UB4A 4WC7A 3BQTA 3GV5B 1TFYA 3H39A 4ED8A 4RWQA 1B43A 4RU9A 3WFPA 2DRAA 1S76D 1PX5A 4TQRA 4KLIA 4ED6A 9ICUA 4M2YA 5DKWA 3G6XA 4RPYA 3N4MB 3GQCA 3BDPA 1NK8A 2HHSA 4C8LA 3PR5B 4R64A 1T8EA 4I28A 5J0WA 2M2VA 1MQ3A 4ECTA 4PGQA 4DSEA 4WC5A 3GIJA 4KLMA 3C2MA 4M47A 4B9UA 3TAQA 2VA8A 2BPCA 4DFMA 3RJIA 8ICIA 4RQ5A 5L1LA 4ATBA 4I2DA 3LWMA 2W8LA 9ICQA 3ORYA 2FLLA 4F5PA 3ZDAA 4KLHA 1SL1A 4M0AA 1A76A 2FPKA 4JUZA 5KFJA 3AU6A 2JEGA 2HVIA 1KSPA 4F50A 2OWOA 4J9RA 4P2HA 2AQ0A 4O5CA 1L3UA 5J2JA 4J9OA 4DQIA 1Z3EB 1B22A 2ZHAA 3H8JA 1ZQBA 4YFKA 4WC2A 4PGYA 5CWRA 4DQQA 3RH6A 4YXMA 4X4OA 7ICLA 4UAZA 2BCSA 5DGAA 1NJYA 4KLQA 4JK1A 1Z00B 5KFAA 1Q78A 1XU4A 5KFQA 5D49A 1ZQNA 5HMMA 5L1JA 1QTMA 4KLSA 4M5DA 1JXLA 5HMLA 4EBJA 4S3NA 4WCWA 1S0OA 7ICTA 3RH4A 4YN4A 3MGHA 4O3RA 4I2JA 1V4AA 3RH5A 5HRLA 5IINA 3EWAA 3Q8LA 4JWNA 2B21A 1JAJA 5KT6A 1Y88A 1S10A 2JZBB 1IXRA 1NJXA 2J6TA 1XSNA 5DDYA 4QZFA 2P6UA 2V9WA 8ICCA 2BE3A 9ICKA 3PW5A 2C22A 3M8SA 2Q66A 4WC1A 4EBKA 4LT6A 5TZVA 4GC6A 2PFOA 7ICRA 4PGXA 2NRXA 4DSJA 8ICEA 2H5XA 8ICWA 4DL6A 4I27A 3H3AA 4UB2A 2XY7A 3MR6A 4TQSA 8ICOA 2IMWP 2C28A 4P4MA 4DL7A 9ICWA 5KFVA 5L9XA 2W9BB 3T5JA 1X9SA 4RT3A 1NKCA 5JUMA 4X0BA 2P66A 5J0TA 4FHPA 4R8UB 4PHEA 2HHTA 3Q8QB 1JXEA 1ZQVA 4IRCA 4KLUA 4QWBA 1DGSA 3LWLA 2PFPA 2HHXA 3ZDCA 2ZTCA 4FHVA 2ASDA 4AT9B 3OVBA 4M9HA 1K1QA 5KFXA 3MR5A 7ICGA 8ICVA 4YVZA 7ICNA 2XCAA 4I2EA 1TFRA 4EBEA 4EYIB 4Q45A 4ECQA 4QWCA 4UAYA 4X4UA 1NJWA 4M9GA 5KFYA 3MGIA 4EBCA 4J9SA 2ZH4A 3V6HA 2FLNA 4ELUA 4JV1A 5J0OA 8ICUA 3V7JA 4RQ7A 5CP2A 4B9VA 2ZTDA 1SKRA 2KN7A 4Z6DA 4DL2A 1LB2B 5KG1A 3EPGA 3RJJA 4LVSA 4KMUA 4DEZA 4XQ7A 1KLNA 3RJGA 3IHQB 4RUCA 4J9MA 1RYRA 5KFLA 2DR8A 2ZJAA 1XWLA 4BXOB 4P4PA 4NLNA 1F5AA 3OHAA 4RWOA 5F2VO 4DLEA 4BDPA 8ICLA 1TK0A 4I2CA 4F4ZA 1L5UA 2ZJ5A 5J2FA 3GIMA 2PXIA 2AGPA 1ZJMA 5J2AA 4TUPA 4KLEA 1QSYA 4BWMA 2R8HA 1NKBA 2NRWA 1ZQIA 3MFHA 3C5GA 3QZ8A 4NXZA 1ZQOA 1XC9A 4NY8A 4FBTA 5J2EA 9ICPA 4YR0A 3E2EA 2BPFA 5HRGA 3HPOA 4IQUA 2ATLA 1TK8A 4ECYA 3NYBA 2MAXA 3OSNA 5HRBA 1R8AA 2NRKA 3V6KA 4M04A 4ECVA 2V4RA 4DQSA 1UA0A 1HUOA 2ZH6A 4FH5A 4DF8A 4J9PA 2BR0A 4K4HA 4E0DA 3JPOA 4RNOA 4QZ9A 3V72A 3QEBZ 1V9PA 3FDSA 3MBYA 4O0IA 3QE9Y 5CHGA 1U45A 1ZQSA 4O5KA 9ICOA 5KT3A 4DLGA 1ZQKA 7ICQA 4I2IA 2AGOA 4UAWA 3ZD9A 1ZQCA 4DSFA 3LK9A 9ICTA 4DSIA 4DOBA 4PH5A 5KG7A 2XO7A 4GC7A 4FBUA 3GIKA 9ICGA 8ICKA 2NRTA 2NRZA 4FS1A 4QZDA 5J0YA 2HHPA 3C66A 2O5AA 1ZQWA 3OGUA 1NK5A 4BXOA 4NLGA 2R8IA 3RR8A 1DK3A 5J2DA 1ZQZA 5KFPA 4RQ6A 2C2DA 3RR7A 4YXJA 4F2RA 4J9QA 3UXNA 7ICOA 5KFZA 4GXIA 3T5HA 1T3NA 1AROP 1UT5A 4MF8A 4QZBA 4X4RA 3BQ1A 3PX0A 4ED2A 4DF4A 2RFFA 5IIJA 8ICBA 4UB3A 4RQ4A 1IM4A 4TUQA 2ZH5A 2KZMA 4KLGA 2BCUA 2UVUA 4E8FA 4F5RA 4M9LA 8ICJA 4RWNA 3JPPA 2JEFA 2ASLA 1ZQLA 2R8GA 4F8RA 5HRIA 3UQ2A 2DVIA 2PI5A 1JN3A 4KLOA 5KG3A 4KLLA 4AT9A 3RTVA 4X5VA 4F4WA 2UVWA 3TAPA 9ICFA 3Q8RB 4KLFA 3WFQE 4MFFA 3H4DA 2ID1A 1UETA 4I29A 4ECRA 1MQ2A 4YMOA 3OUYB 1SL0A 1RYSA 3JPTA 1BVSA 3H38A 4LZDA 3ZD8A 3NTUA 1NK9A 2IHMA 2RDIA 4Q43A 2BGWA 3ZDEA 5KFDA 3H40A 1NKEA 4IR9A 5J0SA 3HJ4A 1ZQMA 3JPQA 2ALZA 4UD4A 4R65A 4DSKA 2VA3A 5DB9A 4ED1A 5IIIA 2PI4A 4C8OA 2W9BA 4C8NA 2ZH3A 1BPDA 4UBCA 4EZ9A 4UD5A 2XGQA 5HRDA 3TANA 4WC6A 4F93B 2O1PA 1L3SA 2ZH2A 4B9NA 4ECSA 4DL4A 1BPXA 3GIIA 3PO4A 8ICYA 7ICHA 8ICNA 5J2CA 3KHGA 4DFPA 4ED3A 1BGXT 5KG0A 3C18A 4J9LA 1ZJNA 4MFCA 3LDAA 1UEVA 1U49A 4O3SA 2HVHA 4M9NA 1FA0A 5CJ7A 3MR2A 3ISCA 3RRHA 3Q8KA 7ICVA 4XA5A 2ZH7A 4UB5A 4NLZA 3SZ2A 8ICSA 2ISOA 2W9AA 5KFTA 4RQ3A 3AUOA 5J2IA 3OSPA 1D9DA 4YCXA 3H37A 8ICMA 4RNMA 2MUTA 4QWAA 3FYHA 1KFDA 1ZQAA 1A77A 2ZUDA 5IILA 4YMMA 4MF2A 3PMNA 4I2AA 4RUAA 1BPEA 4QWDA 1Z00A 5J2BA 3Q8SB 1N48A 3PNCA 1ZQEA 4C8MA 3BJYA 3RJKA 3SYZA 4DL5A 4RZRA 1KRPA 4QZHA 4EP7A 4KN4A 4RNNA 2PFNA 8ICPA 1WCLA 2HW3A 5KFIA 5KTQA 5J0XA 4BWJA 4DS5A 1KFTA 4X4SA 2DFLA 1Q79A 4O3NA 3RB0A 1D8LA 1EXNA 2BCQA 1ZQQA 2GWSA 4MEXA 5F9NA 3C21A 1PZNA 3T5LA 2AGQA 5IIOA 2FPMA 3GV8B 4M6WA 4RPZA 4TUSA 3EZ5A 2AQ4A 3K75D 4EZ6A 1NO5A 1ZQUA 3TQ1A 4QZIA 3OVSA 3HW8A 2Y1IA 4X4NA 1ZQTA 7ICPA 4R63A 3TFSA 2A1JB 4GXKA 3RB6A 5BOLA 2W9MA 2RDJA 1ZQGA 1BNOA 4Q8EA 1QLNA 5D4BA 5DQIA 4LZGA 3UXPA 3PV8A 1XSLA 4I2BA 9ICBA 5DECA 4WC0A 9ICMA 3KTQA 3LQCB 4F3OA 4IRKA 5KG2A 2ZUCA 1S9FA 4FS2A 5J0UA 3MR3A 1UEUA 2ZH9A 3M9NB 3B0YA 3MDAA 1SKWA 5J2GA 4R66A 3AQKA 3T5KA 4BGDA 3OVAA 2W8KA 4DS4A 5DQGA 5DB7A 4Z6EA 4QW9A 3AQMA 2BQUA 4WC4A 3C1ZA 1K1SA 5HREA 2BDPA 2BCVA 4GXJA 3PW0A 2ZH1A 3H7IA 4UB1A 3G6YA 3C2KA 4QZAA 3M9MB 1U4BA 2WTFA 4AT7B 2DR7A 3H8WA 4IR1A 1JIHA 3EYZA 3TFRA 1ZQDA 5J29A 5EWEA 5KFMA 2IBKA 3RAQA 3PY8A 5HHHA 1XSPA 5KFKA 3SI8A 4JWMA 5KFRA 3NGDA 3BQ0A 5BOMA 8ICTA 1D8YA 1NK0A 3PX4A 1CUKA 2BKEA 3UXOA 4NM1A 3TARA 9ICEA 1ZQFA 2KZZA 4Z6FA 1U47A 3HJ1A 2BQ3A 3L9DA 3JZ0A 3C23A 5KG6A 2ASJA 2I9GA 4YMNA 1KEJA 5J0RA 4ELVA 3UPQA 1BPBA 2F1HA 1XO1A 5C5JA 4TURA 4ECUA 4QW8A 4JV0A 4PHPA 2XC9A 3HX0A 9ICCA 1N56A 4E80A 2ZH8A 5HR9A 4DFJA 2ISPA 4X0AA 4X4QA 3GV7B 3RJEA 4RT2A 2A1JA 2J6UA 2AJQA 3RJHA 4Q8FA 4B9SA 2JEJA 1T4GA 2XCPA 2F1JA 9ICHA 8ICHA 2F1IA 5KFBA 3G6VA 9ICVA 8ICAA 3SV4A 5KG4A 5KFSA 5CR0A 4KTQA 2UVRA 3JPSA 4DQPA 1TV9A 1BPZA 1SZPA 3HWTA 3MABA 4K4IA 3GFKB 8ICQA 3V6JA 3RB3A 4I2HA 2M2WA 5HP4A 7ICSA 4AT8A 4WC3A 5DB6A 4EYHB 3THVA 3RBDA 4G3IA 2M9NA 5J0QA 3V7LA 5L1IA 4J9KA 5L1KA 2XY5A 1ZETA 1JQRA 3UQ0A 4ECXA 1TKDA 3ISDA 4ED0A 2DPIA 2P6RA 4IQTA 7ICIA 8ICRA 1DK2A 3PW2A 5HHIA 5DBCA 3PR4A 4E7XA 2DRBA 4QZEA 5CB1A 1C7YA 1ZQHA 2XGPA 1SL2A 1LV5A 3C2LA 1MIVA 4DFKA 4F91B 3BQ2A 3GDXA 4KLDA 4YR2A 4O3QA 1NZPA 4P4OA 3PX6A 4K4GA 4DSLA 2IHNA 2V4QA 4F4YA 2W9CB 3PW7A 4F92B 2HHVA 2FLPA 4NLKA 1JMSA 7ICJA 2NRVA 5KT2A 1MIYA 3JPNA 3SV3A 4QZGA 8ICGA 3WFSC 2BCRA 1L3VA 2ZTEA 5D46A 2R8JA 9ICLA 5J2KA 1UA1A 1KFSA 1ZQRA 3ZDDA 4ELTA 4DQRA 5KFUA 2I1QA 5KFEA 4YR3A 2HHQA 3HP6A 4PHAA 1BNPA 4X4PA 5EWGA 2VA2A 1UT8A 2Q0ZX 2M2UA 5HRHA 1MIWA 1DOQA 5DBBA 4WBZA 5DG7A 3HIYA 3KHLA 4DOAA 4F5QA 1KDHA 3ISBA 2MUTB 4NKTA 3C1YA 2HHWA 4R8UA 5DLGA 4J9NA 4RQ8A 4YD2A 4EEYA 4M9JA 7ICUA 5DGBA 4DO9A 7ICKA 3RRGA 1KTQA 1S0VA 4M6WB 2BHNA 1R8CA 4NKUA 5KT7A 1R89A 4RQ1A 4AT8B 1RPLA 1VFGA 5F9LA 4O5EA 3ZDBA 1TFWA 2ZJ8A 5HNKA 1CEZA 2PFQA 3OJSA 4I2GA 4F4KA 5KFNA 5KFWA 4EBDA 4ATBB 9ICXA 3OHBA 4XQ8A 4ECWA 3JYYA 4IRDA 9ICNA 1KNYA 2Y1JA 4F4XA 1SKSA 2J6SA 1TK5A 4CCHA 2KP7A 3OJUA 4PPXA 7ICEA 5CA7A 1NK4A 4MEYA 1TVAA 4F2SA 1HUZA 4QWEA 4F5NA 2VANA 1S77D 2KFNA 5DG9A 8ICXA 5DEDA 2FMQA 4FHWA 5DQHA 3KHHA 3Q8MA 2UVVA 4RPXA 1OU5A 4XUSA 1WOTA 3B0XA 1TAUA 3EPIA 3TI0A 1ZQPA 4B9LA 1X2IA 5KFGA 8ICFA 3RBEA 1NK7A 9ICIA 4XRHA 1WCNA 5DDMA 1YLQA 4O9MA 4C8KA 9ICRA 2ZHBA 2M2TA 3MDCA 4DWIA 4IQWA 1HJPA 4UBBA 1ZYQA 1NK6A 1R8BA 5DG8A 3H4BA 4NM2A 2KTQA 5KFFA 4Q44A 5IIKA 2PBEA 4GLXA 1U9LA 1QSLA 4KN7A 2AU0A 7ICFA 5IIMA 1T7PA 2ZUBA 5DB8A 4DL3A 4WBYA 3QZ7A 3UPSA 2JZBA 3GILA 4B9TA 4O3PA 4ED7A 4UQGA 3RB4A 1S97A 4JV2A 2KFZA 3MFIA 4FO6A 5BPCA 3Q8PB 4X4TA 1RXWA 3ETLA 5KT4A 3QEAZ 4YG2A 4DOCA 2DPJA 3RJFA 2HHUA 5EWFA 3AQLA 5J2HA 3PO5A 9ICAA 4YD1A 1XS9D 4FHYA 3K4GA 1S0MA 1S0NA 1VJ7A 3EW9A 2JEIA 5J0PA 4RWPA 3HT3A 4HYKA 4FHXA 1X9MA 7ICMA 4PHDA 8ICZA 4O3OA 3V7KA 3T3FA 1MSWD 1MC8A 3N97B 1D9FA 9ICJA 1TAQA 3WFRE 4IQVA 1NOMA 3KHRA 5HC9A 2DR9A 1X9WA 5HRKA 1U48A 1RXVA 4RQ0A 3M9OB 1L3TA 2FMPA 3OUYA 2C2RA 3AU2A 2BQRA
chains in the Genus database with same CATH superfamily
3PW4A 4UARA 3WFOA 9ICSA 4CGZA 1QSSA 5EOZA 2XY6A 1QQ6A 5KG5A 2YX8A 4RQ2A 4O3MA 2LM1A 3H8SA 4X4VA 1H38A 1KBUA 2FPLA 2ZIUA 5DLFA 2FMSA 4IG8A 3AQNA 1PUZA 1SZHA 1RZTA 2YMQA 2W9CA 4Z6CA 4ECZA 4LJXA 1B43A 4Y2QA 1N5WA 9ICUA 4M2YA 5ALLA 3N4MB 3GQCA 5G5GA 2B0CA 4OJPA 4R64A 4I28A 5AM3A 2M2VA 3TADA 3I76A 4KLMA 2OXOA 3RJIA 2YMMA 4F5PA 1A76A 5AK4A 5KFJA 4Y2PA 2HVIA 4F50A 4O5CA 1L3UA 5F3XB 1Z3EB 5D63A 1ZQBA 4WC2A 4PGYA 4X4OA 2NO4A 4UAZA 1LKYA 2NO5A 3NKUA 1FFUA 3SQIA 4KLQA 4JK1A 2RQ5A 5KFAA 1XU4A 5HMMA 5L1JA 3M7DA 1JXLA 4EBJA 7ICTA 3MGHA 1Q3UA 2MA1A 2E3TA 3TKAA 3Q8LA 3RF9A 1X6JA 4JWNA 2B21A 2F8LA 1JAJA 5KT6A 2J6TA 1NJXA 1XSNA 5DDYA 2V9WA 1PK3A 2OEHA 2HN1A 5A0LA 3M8SA 4WC1A 2A1AA 4EBKA 4Y2XA 3WKBA 4GC6A 1F5SA 4KB6A 4DSJA 2NRXA 1KN5A 3BS5A 2IMWP 2C28A 9ICWA 2CN1A 5L9XA 3T5JA 5D62A 1NKCA 4X0BA 2P66A 4R8UB 3Q8QB 3SMVA 4IRCA 3LWLA 2PFPA 3ZDCA 4AT9B 2FI1A 4M9HA 2KHVA 4Q45A 4QWCA 3E0FA 1NJWA 2HN2A 2LI6A 5ALWA 5L1MA 5CP2A 4B9VA 1Z1BA 2KN7A 5AKJA 1LB2B 5KG1A 2WHEA 4LVSA 1RQNA 3HKZC 4RUCA 3C29A 2ZJAA 4BXOB 1M6YA 1COKA 5F2VO 8ICLA 5ALEA 3GIMA 1QSYA 2R8HA 4FBTA 5J2EA 9ICPA 3ED5A 3E2EA 5ALPA 1TK8A 1J97A 1R8AA 2LHTA 3V6KA 4M04A 4DQSA 4FH5A 1A6SA 2RLTA 4K4HA 5AI9A 4QZ9A 1PVQA 4C80A 1U45A 1ZQSA 5CFTA 2YN4A 2AGOA 2ESEA 1ZQCA 4DSFA 3A0HU 2EH9A 2K8BB 3LK9A 9ICTA 4DSIA 1L7NA 4PH5A 5KG7A 2XO7A 4GC7A 8ICKA 2NRTA 5J0YA 2O5AA 1LKYB 1NK5A 4BXOA 3RR8A 1ZQZA 3DDHA 2QKQA 4J9QA 7ICOA 2W7OA 3BQ1A 2JXJA 4ED2A 1WWVA 2KIWA 1LVHA 1KKXA 4M9LA 2JEFA 2R8GA 5HRIA 3FAHA 4C4SA 4KLLA 4X5VA 4F4WA 9ICFA 4MFFA 3H4DA 2YTUA 2ID1A 4P0QA 3NRWA 3H38A 1UHUA 5C0YA 2G06A 1NK9A 2IHMA 3H40A 1NKEA 2ALZA 4UD4A 4DSKA 5DB9A 2AH5A 4ED1A 2PI4A 2W9BA 4WC6A 5AHXA 2XGQA 2O1PA 4DL4A 2ES6A 3CK6A 2ZXHA 5KG0A 4J9LA 3WK6A 1ZJNA 4MFCA 1UEVA 4O3SA 4M9NA 3MR2A 3ISCA 2IHOA 1V38A 4I0UA 2YY6A 4NLZA 5B3PA 5J2IA 1D9DA 4RNMA 4QWAA 3S6JA 5IILA 5KAFU 4RUAA 2E8MA 3Q8SB 2MU2A 4HAIA 3SYZA 4DL5A 5KFIA 1SXDA 5J0XA 1KFTA 1D8LA 2GWSA 2FJ6A 2DKXA 4MEXA 2EZXA 2FE9A 3GV8B 2ZIXB 3H0RB 5AM4A 1ZQGA 3K7DA 4LZGA 4I2BA 1XSLA 9ICBA 3BS5B 3KTQA 3MR3A 3M9NB 3B0YA 2WB1F 2KKVA 4R66A 4OD0A 2RP5A 4BGDA 4DS4A 2AHOB 4Z6EA 3CRXA 2ZH1A 1N62A 4UB1A 5GTIU 1IIPA 1PK1B 1DGJA 3H8WA 1Z19A 5AM5A 2KE7A 5J29A 3PY8A 3RAQA 3AL0B 2Q4TA 2DQNB 3TARA 4P0PA 9ICEA 4Z6FA 3N7RC 5KG6A 2ASJA 1KEJA 3D2QA 1JALA 2QB0A 1XO1A 4TURA 2XC9A 4JV0A 1N56A 4X4QA 3HRDD 3RJHA 4EX6A 2JEJA 4CRXA 1T4GA 2XCPA 3JCFA 3F2DA 5KG4A 5KFSA 4K4IA 1TV9A 2WAQF 3V6JA 3RB3A 2M2WA 5HP4A 4AT8A 2M0NA 5DB6A 5ALOA 2M9NA 2EANA 4J9KA 2XY5A 1N61A 8ICRA 2P6RA 2CRXA 4IQTA 4QNLA 4RQNA 5CB1A 1C7YA 4NWIA 1LV5A 3C2LA 3GDXA 4YR2A 2JRZA 4F72A 4P0PB 4EELA 4DSLA 2PKEA 4F4YA 1Z1VA 2HHVA 2FLPA 2EAOA 3SEIA 3WFSC 3SV3A 1OW5A 2BCRA 9ICLA 1KFSA 1SWVA 1BNPA 5EWGA 2VA2A 2KKPA 1ZOLA 5DBBA 3DEEA 5DG7A 4DOAA 1KDHA 2KJ5A 2MUTB 2HHWA 4J9NA 3F53A 4RQ8A 4M9JA 4DO9A 1KTQA 1L7PA 2ZIVA 2FCLA 1RPLA 3ZDBA 2ZJ8A 1CEZA 2F77X 3OHBA 1ZXIA 4XQ8A 1Q46A 1JI7A 1TK5A 4OJLA 3OJUA 2CPRA 3AM9A 1HUZA 4QWEA 2WB1C 2KFNA 5DG9A 5DEDA 2ZIVB 3Q8MA 1OU5A 4XUSA 3EPIA 3KD3A 1WCNA 2M2TA 2W04A 4F71A 1NK6A 1R8BA 5DG8A 3J81j 4Q44A 4BX9C 2EDUA 1QSLA 2YB4A 7ICFA 5DB8A 3UPSA 2F8KA 4B9TA 4ED7A 1L8OA 3IG8A 1B0XA 2KOBA 2WF8A 3L4PA 9ICAA 4YD1A 1VJ7A 3EW9A 3HT3A 1X9MA 8ICZA 3V7KA 1D8BA 3N97B 9ICJA 1TAQA 3QYPA 3M8RA 3AU2A 1BPYA 1ZQJA 4KLTA 1SWWA 2K4PA 2LYHA 3QNMA 5JRTA 5KT5A 3IV6A 3WK9A 5TISU 4ZH4A 4I2FA 3OV7A 5KFOA 2R8KA 3JPRA 4OJOA 4YP3A 3LYSA 1NJZA 5KFHA 3NUQA 4NXTA 4US8A 3PMLA 2C2EA 4MFAA 2MSNA 3BQTA 3WK4A 3EF2A 5ALRA 1PX5A 2DUYA 3IG5A 4IS7A 1NK8A 3OTQA 2HHSA 5J0WA 4NL9C 1MQ3A 1QQ5A 4ECTA 2Y9UA 3D2NA 3GIJA 3C2MA 3TAQA 3QU9A 2B6GA 4DFMA 8ICIA 5L1LA 3O0FA 3LWMA 9ICQA 3NS1A 3ZDAA 1SL1A 3TADC 2FPKA 2ZIWA 2NYVA 4J9OA 4DQIA 3H8JA 4YFKA 2KK0A 4DQQA 4YXMA 4JB3A 5AKXA 1QQ7A 1Q78A 2LMRA 1ZD2P 5KFQA 1X42A 1VFGA 1S0OA 3RH4A 4O3RA 5HRLA 5IINA 2WF6A 4GFJA 4QZFA 2BE3A 9ICKA 1ZRNA 2C22A 5ALMA 2Q66A 4PGXA 8ICEA 5AI5A 4DL6A 3WKEA 4I27A 2XY7A 8ICOA 1WYGA 4DL7A 2W55A 4PHEA 1N63A 4KLUA 2HHXA 5B5EU 2ZTCA 2YMLA 7ICGA 2XCAA 2W11A 4I2EA 4EBCA 2FLNA 4ELUA 5AK3A 2DKZA 1L6NA 4OAGA 2HOQA 1IG6A 3EPGA 4DEZA 2K4HA 2WF5A 4J9MA 4NLNA 4P4PA 4BDPA 2LPEA 4I2CA 4F4ZA 5AM0A 1B4FA 2GO7A 2E1FA 5ALYA 1NKBA 3C5GA 3CW2C 4NXZA 1A0PA 4WJ3B 2ATLA 4ECYA 2MAXA 2A19A 2V4RA 1UA0A 2ZH6A 1VLBA 5FP0A 1WWUA 1FEZA 4A8EA 2HCFA 1ZQKA 4I2IA 3PSFA 1SV0A 4O6AA 4DOBA 5E79U 9ICGA 2IUBA 4UW9A 2QB1A 1ZQWA 3OGUA 4NLGA 5KFPA 3RR7A 4YXJA 4F2RA 4GXIA 1AROP 4OAHA 5EE3A 2RFFA 5IIJA 8ICBA 2VJ4A 4RQ4A 1IM4A 4G9BA 2KZMA 2XI9A 4KLGA 4AYBF 2W3SA 3QUBA 4EX7A 8ICJA 3JPPA 3PZPA 2DVIA 3UQ2A 4KLOA 5KG3A 2UVWA 3Q8RB 4KLFA 3WFQE 5ALDA 3OUYB 4NXXA 3JPTA 1BVSA 5AKIA 3ZD8A 4FZMA 1X66A 1PVPA 2RDIA 3OWGA 4IR9A 2A3VA 5J0SA 2EWRA 2Y0SF 5ALHA 3JPQA 1X6IA 4UAUA 1BPDA 4EZ9A 3HJEA 5AI6A 4F93B 5HR7A 2ZH2A 1O08A 4B9NA 2W54A 2DGZA 8ICNA 3KHGA 4DFPA 1BGXT 4CF5A 1U49A 3RRHA 3Q8KA 2ZH7A 1OXJA 7ICVA 3SZ2A 1WG8A 8ICSA 1NNLA 4OAIZ 4WH5A 4MF2A 4IL6U 4QWDA 1ZQEA 4C8MA 2FDRA 1GPJA 4RNNA 4X4SA 2DRAA 4ICAA 5KTQA 3RB0A 1EXNA 2BCQA 5ALQA 3C21A 1PZNA 3T5LA 3D6JA 5IIOA 4MKPA 1NO5A 2EAPA 3OVSA 3TQ1A 1J2NA 3HW8A 1ZQTA 3TFSA 1ZD3A 5BOLA 2Y9TA 1BNOA 4Q8EA 5D4BA 5DQIA 3PV8A 2YMPA 9ICMA 3LQCB 4IRKA 1S9FA 2ZUCA 4FS2A 3IRUA 2W03A 2GAFD 3AQKA 5DB7A 3AQMA 2XIDA 3C1ZA 1C20A 5HREA 2BDPA 2BCVA 3NVVA 5K4LA 2WTFA 1JIHA 5KFMA 3IP4B 2F2AB 5HHHA 1XSPA 2HDOA 5KFKA 1VJ5A 3BQ0A 1KL9A 8ICTA 1D8YA 2BKEA 3UXOA 2O6KA 1U47A 3HJ1A 3C23A 4YMNA 1JUDA 4AYBC 4E80A 4O69A 5J8YA 3QU7A 2A1JA 2J6UA 5ALGA 2PMZF 4B9SA 5KFBA 3G6VA 3BQ7A 2F44A 9ICVA 5AIAA 3SV4A 5CR0A 4DQPA 1SZPA 5ALSA 4EEKA 1F0MA 2WF9A 4WC3A 2BZFA 2H3QA 4EGWA 1J2MA 3DV9A 4ECXA 2DPIA 5HHIA 2YB1A 2RHFA 3U26A 4GIBA 3ER8C 3PSPA 3M1YA 3PW7A 4NV0A 3NWIA 1ECWA 1JMSA 2NRVA 8ICGA 4LEZA 5D46A 2R8JA 1ZQRA 5CEHA 4YR3A 2HHQA 3HP6A 4PHAA 2M2UA 4C4TA 4WBZA 3KHLA 4F5QA 3ISBA 4NKTA 5AICA 2VJ5A 3N7SC 4ACOA 1R8CA 4NKUA 4QJFB 4O5EA 4NLBA 3OJSA 3D2SA 4F4KA 5ALXA 9ICXA 3JYYA 4FFDA 2OYYA 2KP7A 5CA7A 4MEYA 3I28A 2GH1A 2VANA 1S77D 8ICXA 4FHWA 5DQHA 3KHHA 3NVZA 3B0XA 1O03A 4UB6U 4B9LA 4LEYA 5AI0A 3RBEA 2ZHBA 9ICRA 4C8KA 4IQWA 3KKAA 2KTQA 4NM2A 4HX0A 1SIJA 5CFSA 2E8NA 5JTGA 3PSTA 2ZUBA 4DL3A 4WBYA 1XO0A 3WU2U 4O3PA 1S97A 3MFIA 1RXWA 3SAGA 5KT4A 3AQLA 3SENA 5J2HA 3PO5A 3K4GA 1S0NA 2HBJA 2JEIA 2JGAA 4HYKA 4PHDA 5AKYA 3T3FA 1X9XA 1D9FA 2QB0B 5HR6A 5HC9A 1N60A 1U48A 1L7OA 2BQRA 4RWQA 3UMGA 4QZCA 4QZ8A 4EEBA 1ZQYA 2KZ3A 2D8CA 5DBAA 2LYAA 4KLJA 4KITB 4PL1A 4ED8A 2KSOB 4TQRA 4KLIA 4ED6A 3BDPA 2H3IA 3SAFA 4PGQA 4WC5A 4EV6A 2E5SA 4RQ5A 2IOFA 5AKLA 4ATBA 3ORYA 2KVSA 4M0AA 5JTIA 3AQFA 3AU6A 2JEGA 2OWOA 4J9RA 2AQ0A 3WK5A 2KHQA 3KBBA 4DFDA 5CWRA 1P7DA 2WAQC 1NJYA 2JMGA 5ALKA 1Z00B 2BBHA 2HOIA 4KLSA 1ZQNA 4M5DA 2JV3A 5HMLA 5ALFA 4WCWA 4YN4A 4I2JA 3F5EA 3RH5A 2EQYA 1S10A 1Y88A 2JZBB 1IXRA 2WFAA 2P6UA 3MGVA 5T14A 4IC9A 4LT6A 5TZVA 2PFOA 7ICRA 4MHVA 2H5XA 2AXTU 4UB2A 4KMOB 4TQSA 4P4MA 3N28A 2W9BB 1XNSA 4RT3A 2KIVA 4FHPA 5J0TA 2VKQA 2HHTA 4QWBA 3CP8A 4FHVA 2ASDA 3MR5A 4EBEA 4EYIB 4ECQA 5AK5A 4Y2VA 4M9GA 3MGIA 2G07A 1URJA 4JV1A 3V7JA 3KZIU 4RQ7A 2ZTDA 5EE0A 4Z6DA 4DL2A 3RJJA 4KMUA 1RYRA 5EE9A 5KFLA 2DR8A 5AK6A 3OHAA 1TK0A 2ZJ5A 5J2FA 1UQVA 3LVWA 2AGPA 1ZJMA 5J2AA 4TUPA 2H3FA 4KLEA 4BWMA 1ZQIA 3F2CA 1XC9A 3NVWA 5HRGA 2JHDA 2OHFA 3HPOA 2I6XA 5HRBA 2G5IB 2NRKA 3QUTA 1SXEA 2H3ZA 2BR0A 4E0DA 3JPOA 1Z4OA 3FDSA 3QE9Y 4O5KA 2XVTA 3QUQA 4C7ZA 7ICQA 1IV8A 2LYBA 1N5XA 2CXYA 3ZD9A 4K97A 1DXSA 3GIKA 4NXVA 4QZDA 2HHPA 5G5HA 2R8IA 4RQ6A 5KFZA 4U6PA 1T3NA 1UT5A 4QZBA 4EEDA 4DF4A 4EENA 4UB3A 4Y2YA 5KAIU 4E8FA 2IOHA 4F5RA 2WF7A 4NLCA 4RWNA 5AI8A 2ASLA 2KEYA 4AT9A 3TAPA 3M6ZA 2HBKA 3VC8A 4K8VA 1UETA 4I29A 2KSOA 1SL0A 5GTHU 5AI4A 4BJQA 4CDGA 2BGWA 3ZDEA 5AKEA 4X4PA 4C8OA 2R18A 4C8NA 1QH9A 4UBCA 3TANA 4ECSA 2KV2A 3PO4A 8ICYA 5J2CA 3C18A 3LDAA 4JLZA 4XA5A 2KICA 5D61A 2ISOA 2W9AA 1SV0C 4YCXA 3M6KA 8ICMA 2HOFA 1KFDA 4YMMA 4CNQA 5ALZA 4O67A 1Z00A 1N48A 7ICJA 3BJYA 4RZRA 1V97A 4QZHA 1KRPA 2W7PA 2PFNA 3R9KA 3WK8A 1ZQQA 5F9NA 2KMDA 4EZ6A 2AQ4A 4FE3A 1ZQUA 1ED1A 2Y1IA 7ICPA 4B6JA 4R63A 1UPHA 3RB6A 2RDJA 2EZZA 4F3OA 4K9BA 2K60A 5J0UA 4K9AA 1UEUA 2ZIUB 4NL9A 3VCBA 3T5KA 3OVAA 5DQGA 4QW9A 4WC4A 1K1SA 4GXJA 3PW0A 3H7IA 3C2KA 4QZAA 3M9MB 2DR7A 3BZKA 3NASA 3ER9B 4IR1A 3EYZA 2HBMA 2DWQA 2G0AA 5EWEA 4OJ6A 1Q8KA 1ZD4A 1S5LU 5KFRA 3NGDA 5BOMA 3T79A 2HMXA 3WK7A 4NM1A 2K89A 5ALIA 2LM4A 4QIWC 2BQ3A 1F44A 3JZ0A 4BUGA 5J0RA 3UPQA 2F1HA 3KKAC 3QUCA 4ECUA 4QW8A 1ZD5A 3HX0A 5AKGA 1YZ6A 4DFJA 1Q3VA 3SR6A 4RT2A 2B56A 1MA7A 9ICHA 8ICHA 8ICAA 4KTQA 2UVRA 3JPSA 1BPZA 3B9JA 2E8OA 1GO3F 3MABA 4UATA 1TAMA 4PZOA 2G5HB 4EYHB 3THVA 1DRGA 4G3IA 5ALNA 2KD1A 5L1IA 5L1KA 1ZETA 3I1YA 3ISDA 4KX3A 3PW2A 5DBCA 2HSZA 3PR4A 4E7XA 2DRBA 2XGPA 1MIVA 4F91B 4O3QA 4P4OA 4K4GA 4USAA 2W9CB 1SB3C 4NLKA 2JH1A 2K4EA 3BS7A 3SD7A 3UM9A 5CHEA 5KT2A 1MIYA 3JPNA 5J2KA 3L5KA 3ZDDA 2ODGA 4DQRA 2I1QA 4CF3A 2BBJA 1JRPA 1MIWA 1DOQA 2JR5A 3HIYA 4CF4A 3F2BA 2W3RA 3C1YA 5DLGA 7ICKA 3RRGA 2BHNA 1OUQA 5KT7A 1R89A 4AT8B 4O68A 3HKZF 5J8YC 5F9LA 1TFWA 4U7CA 2F3NA 4EBDA 4ATBB 2EZYA 4IRDA 3NRZA 1SKSA 2J6SA 4CCHA 7ICEA 5AKHA 2IOFK 1NK4A 1TVAA 4F2SA 4Y2JA 2E1EA 4F5NA 1SV4A 4C4RA 2FMQA 2GOLA 2UVVA 4RQMA 2Y0SC 3TI0A 1SGGA 1X2IA 5KFGA 8ICFA 4DCCA 1NK7A 9ICIA 4C0ZA 4NXUA 4O9MA 3MDCA 4DWIA 1HJPA 4UBBA 3H0LB 3K1ZA 4KN7A 5AM2A 1L7MA 2AU0A 5IIMA 3UMBA 2JZBA 4QIWF 3RB4A 5BPCA 4X4TA 4PZNA 3QEAZ 3RJFA 4YG2A 5EWFA 1NZBA 1XS9D 4FHYA 3CYMA 4FHXA 7ICMA 2E8PA 4IQVA 1NOMA 2OM6A 5HRKA 1RXVA 4RQ0A 3M9OB 8ICWA 4FH3A 1JX4A 2IA6A 2ZG6A 2KVCA 1COOA 2P35A 4KX5A 4F5OA 4B9MA 2BPGA 4AT7A 3C5FA 3RAXA 1ZQXA 4YQWA 5AIBA 5KFCA 3PVXA 2DR5A 3AN1A 5HRFA 2QARA 3IM1A 4WC7A 4UB4A 3GV5B 5KNIA 1TFYA 1V85A 2K8AA 3H39A 4WQLA 1UCVA 4RU9A 3QU5A 3WFPA 1S76D 4ZOHC 5DKWA 3G6XA 4RPYA 4C8LA 3PR5B 1T8EA 2I5HA 4DSEA 1KW4A 3UMCA 1PK1A 4B9UA 4M47A 2VA8A 2BPCA 4I2DA 2W8LA 2FLLA 4JUZA 3QU2A 1KSPA 4P2HA 4Y2SA 3ERCC 4C7YA 5J2JA 1B22A 2ZHAA 3GZFA 2QLTA 3RH6A 7ICLA 2BCSA 5DGAA 4P0QB 4K98A 1RG6A 5D49A 1QTMA 3KFUF 4S3NA 1V4AA 4US9A 3EWAA 2D3DA 4FO1A 8ICCA 2HBLA 4FZLA 3PW5A 3OPXA 1FFVA 3H3AA 2HI0A 3KOOA 5ALJA 5AM1A 3MR6A 2LKYA 5KFVA 1X9SA 5JUMA 3FM9A 2JH7A 1ZQVA 1JXEA 1DGSA 4UAVA 3OVBA 1K1QA 4Y2RA 5KFXA 8ICVA 7ICNA 4YVZA 1TFRA 2W43A 5AKKA 4UAYA 4X4UA 5KFYA 3MC1A 4J9SA 4Y2TA 4KM5A 2ZH4A 5ALVA 3V6HA 5J0OA 8ICUA 5CRXA 1SKRA 4UASA 1T94A 4XQ7A 1KLNA 3RJGA 3IHQB 3AQEA 1XWLA 1Z4NA 1F5AA 4RWOA 3WKCA 1MN8A 4DLEA 3ETRA 1K5OA 5AKZA 1L5UA 1CI4A 2PXIA 4JMUA 2NRWA 3MFHA 2QARB 3QZ8A 1ZQOA 5ALUA 4NY8A 2ZIXA 4YR0A 2BPFA 4IQUA 3NYBA 1QCKA 3OSNA 1RM6C 4ECVA 1HUOA 4UB8U 4DF8A 4J9PA 5B3QA 2DL0A 4RNOA 3V72A 3QEBZ 3F5AA 1V9PA 2K8CB 3N7PD 2N1RA 3MBYA 4O0IA 5CHGA 9ICOA 4WOYA 5KT3A 4DLGA 3PHZA 4CE6A 1FO4A 4UAWA 3QXGA 4FBUA 2MRLA 2NRZA 4FS1A 3E58A 3L3FX 3C66A 1DK3A 5J2DA 2C2DA 3TACB 3UXNA 2G09A 3T5HA 4LEVA 4X4RA 4MF8A 3PX0A 4N7RA 4XJEA 5EE1A 4TUQA 2ZH5A 4WQKA 2OCEA 2XICA 4PJ0U 2BCUA 2UVUA 4F8RA 1ZQLA 2PI5A 1JN3A 3RTVA 1YZ7A 1VDVA 2EAMA 4ECRA 1MQ2A 4YMOA 1RYSA 2NV3A 4LZDA 3NTUA 2RRDA 3IDWA 4Q43A 2OH2A 5KFDA 3HJ4A 1ZQMA 4R65A 2VA3A 5IIIA 2ZH3A 2GLEA 3H0MB 4UD5A 4OCZA 5HRDA 1L3SA 1BPXA 3GIIA 7ICHA 3NVOA 4ED3A 2G08A 2HVHA 1FA0A 5CJ7A 4UB5A 5KFTA 4RQ3A 3AUOA 3OSPA 3H37A 2MUTA 3FYHA 1ZQAA 1A77A 2ZUDA 3PMNA 4I2AA 1HEKA 1BPEA 2K4IA 5J2BA 3MCRA 3PNCA 3RJKA 4EP7A 4KN4A 8ICPA 1WCLA 2HW3A 4DS5A 4BWJA 2DFLA 1Q79A 4O3NA 4PL2A 5KL8B 2AGQA 2D6FC 2FPMA 2ZIWB 4M6WA 4RPZA 4TUSA 3EZ5A 3K75D 4QZIA 4X4NA 2A1JB 4GXKA 4K96A 2W9MA 1QLNA 3ICXA 3IN5A 3UXPA 5DECA 4WC0A 1S8OA 1L8LA 5KG2A 2B4VA 2ZH9A 1SKWA 3MDAA 5J2GA 3ALRA 2W8KA 1NI3A 2BQUA 3GU3A 3K1RB 3QX7A 3CNHA 3G6YA 1U4BA 4AT7B 4LEWA 2F76X 3TFRA 1ZQDA 2IBKA 4Y2UA 3SI8A 4JWMA 1NK0A 3PX4A 2PMZC 1CUKA 1CRXA 5KL1B 1ZQFA 2KZZA 3L9DA 2Z7JA 2I9GA 1ZQ1C 4ELVA 3ZI4A 1BPBA 2KJ9A 1RYUA 5C5JA 9ICCA 2ZH8A 4PHPA 5HR9A 4X0AA 2ISPA 3GV7B 3RJEA 2AJQA 3KZXA 2DF4B 4Q8FA 2F1JA 3SAHA 2F1IA 2ZXIA 3C28A 1AQ6A 3ONNA 3HWTA 3GFKB 8ICQA 2KNJA 4I2HA 7ICSA 1FIQA 3RBDA 5J0QA 3V7LA 1JQRA 3UQ0A 1TKDA 7ICIA 4ED0A 1DK2A 3HILA 5ALTA 4OAFA 4QZEA 1ZQHA 1SL2A 2GA9D 4DFKA 3BQ2A 4KLDA 1NZPA 3PX6A 2IHNA 2V4QA 1KQQA 2L5YA 4F92B 2H3VA 5H2FU 4QZGA 1L3VA 2KG5A 2ZTEA 4AP9A 2KJ8A 1UA1A 4ELTA 5KFUA 4FZNA 5KFEA 1PVRA 1YT3A 1UT8A 2Q0ZX 4OJ5A 5HRHA 3BZCA 2DBYA 2VIXA 4R8UA 4YD2A 4EEYA 7ICUA 5DGBA 3NVYA 3EUB2 1S0VA 4M6WB 3WKDA 4RQ1A 5HNKA 3H8MA 2PFQA 1JROA 3PSIA 4I2GA 1RDFA 5KFNA 5KFWA 4OO1J 3AEVA 4ECWA 3QU4A 9ICNA 1KNYA 4JLXA 2Y1JA 4F4XA 4PPXA 1HIWA 2LBOA 4NXWA 5CFUA 4RPXA 1WOTA 1TAUA 5B66U 1ZQPA 4K99A 1ZRMA 4XRHA 1RQLA 5DDMA 1YLQA 3AMZA 1ZYQA 3H4BA 5KFFA 5IIKA 5JU5A 2PBEA 4GLXA 3LVVA 1U9LA 3RFAA 1T7PA 3QZ7A 2B51A 3GILA 4UQGA 4JV2A 2KFZA 4FO6A 3Q8PB 3A0BU 3ETLA 4J03A 2DPJA 2HHUA 4DOCA 1TE2A 1T3QA 1X40A 4NJ8A 1S0MA 2YQEA 5J0PA 4RWPA 1N2XA 1WUDA 2BDUA 4O3OA 1MSWD 3WKAA 1MC8A 3FC4A 3WFRE 2DR9A 3KHRA 1X9WA 1L3TA 2FMPA 3OUYA 4KLHA 2C2RA
chains in the Genus database with same CATH topology
1ZQJA 3PW4A 1JX4A 2IA6A 4KLTA 4FH3A 2LYHA 4QZCA 5KT5A 9ICSA 3WFOA 1QSSA 3M8RA 5EOZA 2XY6A 4QZ8A 1COOA 4ZH4A 4I2FA 3OV7A 5KG5A 5KFOA 4F5OA 1ZQYA 2KZ3A 3JPRA 2R8KA 4RQ2A 4B9MA 4YP3A 3H8SA 2BPGA 1BPYA 4AT7A 1H38A 4X4VA 3C5FA 5DBAA 3RAXA 1ZQXA 2FPLA 5KFHA 5DLFA 1NJZA 2FMSA 4YQWA 3PVXA 5KFCA 2DR5A 4IG8A 5HRFA 3AQNA 1RZTA 4KLJA 3IM1A 3PMLA 4KITB 2W9CA 2C2EA 4Z6CA 4MFAA 4ECZA 4UB4A 4WC7A 3BQTA 3GV5B 1TFYA 3H39A 4ED8A 4RWQA 1B43A 4RU9A 3WFPA 2DRAA 1S76D 1PX5A 4TQRA 4KLIA 4ED6A 9ICUA 4M2YA 5DKWA 3G6XA 4RPYA 3N4MB 3GQCA 3BDPA 1NK8A 2HHSA 4C8LA 3PR5B 4R64A 1T8EA 4I28A 5J0WA 2M2VA 1MQ3A 4ECTA 4PGQA 4DSEA 4WC5A 3GIJA 4KLMA 3C2MA 4M47A 4B9UA 3TAQA 2VA8A 2BPCA 4DFMA 3RJIA 8ICIA 4RQ5A 5L1LA 4ATBA 4I2DA 3LWMA 2W8LA 9ICQA 3ORYA 2FLLA 4F5PA 3ZDAA 4KLHA 1SL1A 4M0AA 1A76A 2FPKA 4JUZA 5KFJA 3AU6A 2JEGA 2HVIA 1KSPA 4F50A 2OWOA 4J9RA 4P2HA 2AQ0A 4O5CA 1L3UA 5J2JA 4J9OA 4DQIA 1Z3EB 1B22A 2ZHAA 3H8JA 1ZQBA 4YFKA 4WC2A 4PGYA 5CWRA 4DQQA 3RH6A 4YXMA 4X4OA 7ICLA 4UAZA 2BCSA 5DGAA 1NJYA 4KLQA 4JK1A 1Z00B 5KFAA 1Q78A 1XU4A 5KFQA 5D49A 1ZQNA 5HMMA 5L1JA 1QTMA 4KLSA 4M5DA 1JXLA 5HMLA 4EBJA 4S3NA 4WCWA 1S0OA 7ICTA 3RH4A 4YN4A 3MGHA 4O3RA 4I2JA 1V4AA 3RH5A 5HRLA 5IINA 3EWAA 3Q8LA 4JWNA 2B21A 1JAJA 5KT6A 1Y88A 1S10A 2JZBB 1IXRA 1NJXA 2J6TA 1XSNA 5DDYA 4QZFA 2P6UA 2V9WA 8ICCA 2BE3A 9ICKA 3PW5A 2C22A 3M8SA 2Q66A 4WC1A 4EBKA 4LT6A 5TZVA 4GC6A 2PFOA 7ICRA 4PGXA 2NRXA 4DSJA 8ICEA 2H5XA 8ICWA 4DL6A 4I27A 3H3AA 4UB2A 2XY7A 3MR6A 4TQSA 8ICOA 2IMWP 2C28A 4P4MA 4DL7A 9ICWA 5KFVA 5L9XA 2W9BB 3T5JA 1X9SA 4RT3A 1NKCA 5JUMA 4X0BA 2P66A 5J0TA 4FHPA 4R8UB 4PHEA 2HHTA 3Q8QB 1JXEA 1ZQVA 4IRCA 4KLUA 4QWBA 1DGSA 3LWLA 2PFPA 2HHXA 3ZDCA 2ZTCA 4FHVA 2ASDA 4AT9B 3OVBA 4M9HA 1K1QA 5KFXA 3MR5A 7ICGA 8ICVA 4YVZA 7ICNA 2XCAA 4I2EA 1TFRA 4EBEA 4EYIB 4Q45A 4ECQA 4QWCA 4UAYA 4X4UA 1NJWA 4M9GA 5KFYA 3MGIA 4EBCA 4J9SA 2ZH4A 3V6HA 2FLNA 4ELUA 4JV1A 5J0OA 8ICUA 3V7JA 4RQ7A 5CP2A 4B9VA 2ZTDA 1SKRA 2KN7A 4Z6DA 4DL2A 1LB2B 5KG1A 3EPGA 3RJJA 4LVSA 4KMUA 4DEZA 4XQ7A 1KLNA 3RJGA 3IHQB 4RUCA 4J9MA 1RYRA 5KFLA 2DR8A 2ZJAA 1XWLA 4BXOB 4P4PA 4NLNA 1F5AA 3OHAA 4RWOA 5F2VO 4DLEA 4BDPA 8ICLA 1TK0A 4I2CA 4F4ZA 1L5UA 2ZJ5A 5J2FA 3GIMA 2PXIA 2AGPA 1ZJMA 5J2AA 4TUPA 4KLEA 1QSYA 4BWMA 2R8HA 1NKBA 2NRWA 1ZQIA 3MFHA 3C5GA 3QZ8A 4NXZA 1ZQOA 1XC9A 4NY8A 4FBTA 5J2EA 9ICPA 4YR0A 3E2EA 2BPFA 5HRGA 3HPOA 4IQUA 2ATLA 1TK8A 4ECYA 3NYBA 2MAXA 3OSNA 5HRBA 1R8AA 2NRKA 3V6KA 4M04A 4ECVA 2V4RA 4DQSA 1UA0A 1HUOA 2ZH6A 4FH5A 4DF8A 4J9PA 2BR0A 4K4HA 4E0DA 3JPOA 4RNOA 4QZ9A 3V72A 3QEBZ 1V9PA 3FDSA 3MBYA 4O0IA 3QE9Y 5CHGA 1U45A 1ZQSA 4O5KA 9ICOA 5KT3A 4DLGA 1ZQKA 7ICQA 4I2IA 2AGOA 4UAWA 3ZD9A 1ZQCA 4DSFA 3LK9A 9ICTA 4DSIA 4DOBA 4PH5A 5KG7A 2XO7A 4GC7A 4FBUA 3GIKA 9ICGA 8ICKA 2NRTA 2NRZA 4FS1A 4QZDA 5J0YA 2HHPA 3C66A 2O5AA 1ZQWA 3OGUA 1NK5A 4BXOA 4NLGA 2R8IA 3RR8A 1DK3A 5J2DA 1ZQZA 5KFPA 4RQ6A 2C2DA 3RR7A 4YXJA 4F2RA 4J9QA 3UXNA 7ICOA 5KFZA 4GXIA 3T5HA 1T3NA 1AROP 1UT5A 4MF8A 4QZBA 4X4RA 3BQ1A 3PX0A 4ED2A 4DF4A 2RFFA 5IIJA 8ICBA 4UB3A 4RQ4A 1IM4A 4TUQA 2ZH5A 2KZMA 4KLGA 2BCUA 2UVUA 4E8FA 4F5RA 4M9LA 8ICJA 4RWNA 3JPPA 2JEFA 2ASLA 1ZQLA 2R8GA 4F8RA 5HRIA 3UQ2A 2DVIA 2PI5A 1JN3A 4KLOA 5KG3A 4KLLA 4AT9A 3RTVA 4X5VA 4F4WA 2UVWA 3TAPA 9ICFA 3Q8RB 4KLFA 3WFQE 4MFFA 3H4DA 2ID1A 1UETA 4I29A 4ECRA 1MQ2A 4YMOA 3OUYB 1SL0A 1RYSA 3JPTA 1BVSA 3H38A 4LZDA 3ZD8A 3NTUA 1NK9A 2IHMA 2RDIA 4Q43A 2BGWA 3ZDEA 5KFDA 3H40A 1NKEA 4IR9A 5J0SA 3HJ4A 1ZQMA 3JPQA 2ALZA 4UD4A 4R65A 4DSKA 2VA3A 5DB9A 4ED1A 5IIIA 2PI4A 4C8OA 2W9BA 4C8NA 2ZH3A 1BPDA 4UBCA 4EZ9A 4UD5A 2XGQA 5HRDA 3TANA 4WC6A 4F93B 2O1PA 1L3SA 2ZH2A 4B9NA 4ECSA 4DL4A 1BPXA 3GIIA 3PO4A 8ICYA 7ICHA 8ICNA 5J2CA 3KHGA 4DFPA 4ED3A 1BGXT 5KG0A 3C18A 4J9LA 1ZJNA 4MFCA 3LDAA 1UEVA 1U49A 4O3SA 2HVHA 4M9NA 1FA0A 5CJ7A 3MR2A 3ISCA 3RRHA 3Q8KA 7ICVA 4XA5A 2ZH7A 4UB5A 4NLZA 3SZ2A 8ICSA 2ISOA 2W9AA 5KFTA 4RQ3A 3AUOA 5J2IA 3OSPA 1D9DA 4YCXA 3H37A 8ICMA 4RNMA 2MUTA 4QWAA 3FYHA 1KFDA 1ZQAA 1A77A 2ZUDA 5IILA 4YMMA 4MF2A 3PMNA 4I2AA 4RUAA 1BPEA 4QWDA 1Z00A 5J2BA 3Q8SB 1N48A 3PNCA 1ZQEA 4C8MA 3BJYA 3RJKA 3SYZA 4DL5A 4RZRA 1KRPA 4QZHA 4EP7A 4KN4A 4RNNA 2PFNA 8ICPA 1WCLA 2HW3A 5KFIA 5KTQA 5J0XA 4BWJA 4DS5A 1KFTA 4X4SA 2DFLA 1Q79A 4O3NA 3RB0A 1D8LA 1EXNA 2BCQA 1ZQQA 2GWSA 4MEXA 5F9NA 3C21A 1PZNA 3T5LA 2AGQA 5IIOA 2FPMA 3GV8B 4M6WA 4RPZA 4TUSA 3EZ5A 2AQ4A 3K75D 4EZ6A 1NO5A 1ZQUA 3TQ1A 4QZIA 3OVSA 3HW8A 2Y1IA 4X4NA 1ZQTA 7ICPA 4R63A 3TFSA 2A1JB 4GXKA 3RB6A 5BOLA 2W9MA 2RDJA 1ZQGA 1BNOA 4Q8EA 1QLNA 5D4BA 5DQIA 4LZGA 3UXPA 3PV8A 1XSLA 4I2BA 9ICBA 5DECA 4WC0A 9ICMA 3KTQA 3LQCB 4F3OA 4IRKA 5KG2A 2ZUCA 1S9FA 4FS2A 5J0UA 3MR3A 1UEUA 2ZH9A 3M9NB 3B0YA 3MDAA 1SKWA 5J2GA 4R66A 3AQKA 3T5KA 4BGDA 3OVAA 2W8KA 4DS4A 5DQGA 5DB7A 4Z6EA 4QW9A 3AQMA 2BQUA 4WC4A 3C1ZA 1K1SA 5HREA 2BDPA 2BCVA 4GXJA 3PW0A 2ZH1A 3H7IA 4UB1A 3G6YA 3C2KA 4QZAA 3M9MB 1U4BA 2WTFA 4AT7B 2DR7A 3H8WA 4IR1A 1JIHA 3EYZA 3TFRA 1ZQDA 5J29A 5EWEA 5KFMA 2IBKA 3RAQA 3PY8A 5HHHA 1XSPA 5KFKA 3SI8A 4JWMA 5KFRA 3NGDA 3BQ0A 5BOMA 8ICTA 1D8YA 1NK0A 3PX4A 1CUKA 2BKEA 3UXOA 4NM1A 3TARA 9ICEA 1ZQFA 2KZZA 4Z6FA 1U47A 3HJ1A 2BQ3A 3L9DA 3JZ0A 3C23A 5KG6A 2ASJA 2I9GA 4YMNA 1KEJA 5J0RA 4ELVA 3UPQA 1BPBA 2F1HA 1XO1A 5C5JA 4TURA 4ECUA 4QW8A 4JV0A 4PHPA 2XC9A 3HX0A 9ICCA 1N56A 4E80A 2ZH8A 5HR9A 4DFJA 2ISPA 4X0AA 4X4QA 3GV7B 3RJEA 4RT2A 2A1JA 2J6UA 2AJQA 3RJHA 4Q8FA 4B9SA 2JEJA 1T4GA 2XCPA 2F1JA 9ICHA 8ICHA 2F1IA 5KFBA 3G6VA 9ICVA 8ICAA 3SV4A 5KG4A 5KFSA 5CR0A 4KTQA 2UVRA 3JPSA 4DQPA 1TV9A 1BPZA 1SZPA 3HWTA 3MABA 4K4IA 3GFKB 8ICQA 3V6JA 3RB3A 4I2HA 2M2WA 5HP4A 7ICSA 4AT8A 4WC3A 5DB6A 4EYHB 3THVA 3RBDA 4G3IA 2M9NA 5J0QA 3V7LA 5L1IA 4J9KA 5L1KA 2XY5A 1ZETA 1JQRA 3UQ0A 4ECXA 1TKDA 3ISDA 4ED0A 2DPIA 2P6RA 4IQTA 7ICIA 8ICRA 1DK2A 3PW2A 5HHIA 5DBCA 3PR4A 4E7XA 2DRBA 4QZEA 5CB1A 1C7YA 1ZQHA 2XGPA 1SL2A 1LV5A 3C2LA 1MIVA 4DFKA 4F91B 3BQ2A 3GDXA 4KLDA 4YR2A 4O3QA 1NZPA 4P4OA 3PX6A 4K4GA 4DSLA 2IHNA 2V4QA 4F4YA 2W9CB 3PW7A 4F92B 2HHVA 2FLPA 4NLKA 1JMSA 7ICJA 2NRVA 5KT2A 1MIYA 3JPNA 3SV3A 4QZGA 8ICGA 3WFSC 2BCRA 1L3VA 2ZTEA 5D46A 2R8JA 9ICLA 5J2KA 1UA1A 1KFSA 1ZQRA 3ZDDA 4ELTA 4DQRA 5KFUA 2I1QA 5KFEA 4YR3A 2HHQA 3HP6A 4PHAA 1BNPA 4X4PA 5EWGA 2VA2A 1UT8A 2Q0ZX 2M2UA 5HRHA 1MIWA 1DOQA 5DBBA 4WBZA 5DG7A 3HIYA 3KHLA 4DOAA 4F5QA 1KDHA 3ISBA 2MUTB 4NKTA 3C1YA 2HHWA 4R8UA 5DLGA 4J9NA 4RQ8A 4YD2A 4EEYA 4M9JA 7ICUA 5DGBA 4DO9A 7ICKA 3RRGA 1KTQA 1S0VA 4M6WB 2BHNA 1R8CA 4NKUA 5KT7A 1R89A 4RQ1A 4AT8B 1RPLA 1VFGA 5F9LA 4O5EA 3ZDBA 1TFWA 2ZJ8A 5HNKA 1CEZA 2PFQA 3OJSA 4I2GA 4F4KA 5KFNA 5KFWA 4EBDA 4ATBB 9ICXA 3OHBA 4XQ8A 4ECWA 3JYYA 4IRDA 9ICNA 1KNYA 2Y1JA 4F4XA 1SKSA 2J6SA 1TK5A 4CCHA 2KP7A 3OJUA 4PPXA 7ICEA 5CA7A 1NK4A 4MEYA 1TVAA 4F2SA 1HUZA 4QWEA 4F5NA 2VANA 1S77D 2KFNA 5DG9A 8ICXA 5DEDA 2FMQA 4FHWA 5DQHA 3KHHA 3Q8MA 2UVVA 4RPXA 1OU5A 4XUSA 1WOTA 3B0XA 1TAUA 3EPIA 3TI0A 1ZQPA 4B9LA 1X2IA 5KFGA 8ICFA 3RBEA 1NK7A 9ICIA 4XRHA 1WCNA 5DDMA 1YLQA 4O9MA 4C8KA 9ICRA 2ZHBA 2M2TA 3MDCA 4DWIA 4IQWA 1HJPA 4UBBA 1ZYQA 1NK6A 1R8BA 5DG8A 3H4BA 4NM2A 2KTQA 5KFFA 4Q44A 5IIKA 2PBEA 4GLXA 1U9LA 1QSLA 4KN7A 2AU0A 7ICFA 5IIMA 1T7PA 2ZUBA 5DB8A 4DL3A 4WBYA 3QZ7A 3UPSA 2JZBA 3GILA 4B9TA 4O3PA 4ED7A 4UQGA 3RB4A 1S97A 4JV2A 2KFZA 3MFIA 4FO6A 5BPCA 3Q8PB 4X4TA 1RXWA 3ETLA 5KT4A 3QEAZ 4YG2A 4DOCA 2DPJA 3RJFA 2HHUA 5EWFA 3AQLA 5J2HA 3PO5A 9ICAA 4YD1A 1XS9D 4FHYA 3K4GA 1S0MA 1S0NA 1VJ7A 3EW9A 2JEIA 5J0PA 4RWPA 3HT3A 4HYKA 4FHXA 1X9MA 7ICMA 4PHDA 8ICZA 4O3OA 3V7KA 3T3FA 1MSWD 1MC8A 3N97B 1D9FA 9ICJA 1TAQA 3WFRE 4IQVA 1NOMA 3KHRA 5HC9A 2DR9A 1X9WA 5HRKA 1U48A 1RXVA 4RQ0A 3M9OB 1L3TA 2FMPA 3OUYA 2C2RA 3AU2A 2BQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQJ A;  3PW4 A;  1JX4 A;  2IA6 A;  4KLT A;  4FH3 A;  2LYH A;  4QZC A;  5KT5 A;  9ICS A;  3WFO A;  1QSS A;  3M8R A;  5EOZ A;  2XY6 A;  4QZ8 A;  1COO A;  4ZH4 A;  4I2F A;  3OV7 A;  5KG5 A;  5KFO A;  4F5O A;  1ZQY A;  2KZ3 A;  3JPR A;  2R8K A;  4RQ2 A;  4B9M A;  4YP3 A;  3H8S A;  2BPG A;  1BPY A;  4AT7 A;  1H38 A;  4X4V A;  3C5F A;  5DBA A;  3RAX A;  1ZQX A;  2FPL A;  5KFH A;  5DLF A;  1NJZ A;  2FMS A;  4YQW A;  3PVX A;  5KFC A;  2DR5 A;  4IG8 A;  5HRF A;  3AQN A;  1RZT A;  4KLJ A;  3IM1 A;  3PML A;  4KIT B;  2W9C A;  2C2E A;  4Z6C A;  4MFA A;  4ECZ A;  4UB4 A;  4WC7 A;  3BQT A;  3GV5 B;  1TFY A;  3H39 A;  4ED8 A;  4RWQ A;  1B43 A;  4RU9 A;  3WFP A;  2DRA A;  1S76 D;  1PX5 A;  4TQR A;  4KLI A;  4ED6 A;  9ICU A;  4M2Y A;  5DKW A;  3G6X A;  4RPY A;  3N4M B;  3GQC A;  3BDP A;  1NK8 A;  2HHS A;  4C8L A;  3PR5 B;  4R64 A;  1T8E A;  4I28 A;  5J0W A;  2M2V A;  1MQ3 A;  4ECT A;  4PGQ A;  4DSE A;  4WC5 A;  3GIJ A;  4KLM A;  3C2M A;  4M47 A;  4B9U A;  3TAQ A;  2VA8 A;  2BPC A;  4DFM A;  3RJI A;  8ICI A;  4RQ5 A;  5L1L A;  4ATB A;  4I2D A;  3LWM A;  2W8L A;  9ICQ A;  3ORY A;  2FLL A;  4F5P A;  3ZDA A;  4KLH A;  1SL1 A;  4M0A A;  1A76 A;  2FPK A;  4JUZ A;  5KFJ A;  3AU6 A;  2JEG A;  2HVI A;  1KSP A;  4F50 A;  2OWO A;  4J9R A;  4P2H A;  2AQ0 A;  4O5C A;  1L3U A;  5J2J A;  4J9O A;  4DQI A;  1Z3E B;  1B22 A;  2ZHA A;  3H8J A;  1ZQB A;  4YFK A;  4WC2 A;  4PGY A;  5CWR A;  4DQQ A;  3RH6 A;  4YXM A;  4X4O A;  7ICL A;  4UAZ A;  2BCS A;  5DGA A;  1NJY A;  4KLQ A;  4JK1 A;  1Z00 B;  5KFA A;  1Q78 A;  1XU4 A;  5KFQ A;  5D49 A;  1ZQN A;  5HMM A;  5L1J A;  1QTM A;  4KLS A;  4M5D A;  1JXL A;  5HML A;  4EBJ A;  4S3N A;  4WCW A;  1S0O A;  7ICT A;  3RH4 A;  4YN4 A;  3MGH A;  4O3R A;  4I2J A;  1V4A A;  3RH5 A;  5HRL A;  5IIN A;  3EWA A;  3Q8L A;  4JWN A;  2B21 A;  1JAJ A;  5KT6 A;  1Y88 A;  1S10 A;  2JZB B;  1IXR A;  1NJX A;  2J6T A;  1XSN A;  5DDY A;  4QZF A;  2P6U A;  2V9W A;  8ICC A;  2BE3 A;  9ICK A;  3PW5 A;  2C22 A;  3M8S A;  2Q66 A;  4WC1 A;  4EBK A;  4LT6 A;  5TZV A;  4GC6 A;  2PFO A;  7ICR A;  4PGX A;  2NRX A;  4DSJ A;  8ICE A;  2H5X A;  8ICW A;  4DL6 A;  4I27 A;  3H3A A;  4UB2 A;  2XY7 A;  3MR6 A;  4TQS A;  8ICO A;  2IMW P;  2C28 A;  4P4M A;  4DL7 A;  9ICW A;  5KFV A;  5L9X A;  2W9B B;  3T5J A;  1X9S A;  4RT3 A;  1NKC A;  5JUM A;  4X0B A;  2P66 A;  5J0T A;  4FHP A;  4R8U B;  4PHE A;  2HHT A;  3Q8Q B;  1JXE A;  1ZQV A;  4IRC A;  4KLU A;  4QWB A;  1DGS A;  3LWL A;  2PFP A;  2HHX A;  3ZDC A;  2ZTC A;  4FHV A;  2ASD A;  4AT9 B;  3OVB A;  4M9H A;  1K1Q A;  5KFX A;  3MR5 A;  7ICG A;  8ICV A;  4YVZ A;  7ICN A;  2XCA A;  4I2E A;  1TFR A;  4EBE A;  4EYI B;  4Q45 A;  4ECQ A;  4QWC A;  4UAY A;  4X4U A;  1NJW A;  4M9G A;  5KFY A;  3MGI A;  4EBC A;  4J9S A;  2ZH4 A;  3V6H A;  2FLN A;  4ELU A;  4JV1 A;  5J0O A;  8ICU A;  3V7J A;  4RQ7 A;  5CP2 A;  4B9V A;  2ZTD A;  1SKR A;  2KN7 A;  4Z6D A;  4DL2 A;  1LB2 B;  5KG1 A;  3EPG A;  3RJJ A;  4LVS A;  4KMU A;  4DEZ A;  4XQ7 A;  1KLN A;  3RJG A;  3IHQ B;  4RUC A;  4J9M A;  1RYR A;  5KFL A;  2DR8 A;  2ZJA A;  1XWL A;  4BXO B;  4P4P A;  4NLN A;  1F5A A;  3OHA A;  4RWO A;  5F2V O;  4DLE A;  4BDP A;  8ICL A;  1TK0 A;  4I2C A;  4F4Z A;  1L5U A;  2ZJ5 A;  5J2F A;  3GIM A;  2PXI A;  2AGP A;  1ZJM A;  5J2A A;  4TUP A;  4KLE A;  1QSY A;  4BWM A;  2R8H A;  1NKB A;  2NRW A;  1ZQI A;  3MFH A;  3C5G A;  3QZ8 A;  4NXZ A;  1ZQO A;  1XC9 A;  4NY8 A;  4FBT A;  5J2E A;  9ICP A;  4YR0 A;  3E2E A;  2BPF A;  5HRG A;  3HPO A;  4IQU A;  2ATL A;  1TK8 A;  4ECY A;  3NYB A;  2MAX A;  3OSN A;  5HRB A;  1R8A A;  2NRK A;  3V6K A;  4M04 A;  4ECV A;  2V4R A;  4DQS A;  1UA0 A;  1HUO A;  2ZH6 A;  4FH5 A;  4DF8 A;  4J9P A;  2BR0 A;  4K4H A;  4E0D A;  3JPO A;  4RNO A;  4QZ9 A;  3V72 A;  3QEB Z;  1V9P A;  3FDS A;  3MBY A;  4O0I A;  3QE9 Y;  5CHG A;  1U45 A;  1ZQS A;  4O5K A;  9ICO A;  5KT3 A;  4DLG A;  1ZQK A;  7ICQ A;  4I2I A;  2AGO A;  4UAW A;  3ZD9 A;  1ZQC A;  4DSF A;  3LK9 A;  9ICT A;  4DSI A;  4DOB A;  4PH5 A;  5KG7 A;  2XO7 A;  4GC7 A;  4FBU A;  3GIK A;  9ICG A;  8ICK A;  2NRT A;  2NRZ A;  4FS1 A;  4QZD A;  5J0Y A;  2HHP A;  3C66 A;  2O5A A;  1ZQW A;  3OGU A;  1NK5 A;  4BXO A;  4NLG A;  2R8I A;  3RR8 A;  1DK3 A;  5J2D A;  1ZQZ A;  5KFP A;  4RQ6 A;  2C2D A;  3RR7 A;  4YXJ A;  4F2R A;  4J9Q A;  3UXN A;  7ICO A;  5KFZ A;  4GXI A;  3T5H A;  1T3N A;  1ARO P;  1UT5 A;  4MF8 A;  4QZB A;  4X4R A;  3BQ1 A;  3PX0 A;  4ED2 A;  4DF4 A;  2RFF A;  5IIJ A;  8ICB A;  4UB3 A;  4RQ4 A;  1IM4 A;  4TUQ A;  2ZH5 A;  2KZM A;  4KLG A;  2BCU A;  2UVU A;  4E8F A;  4F5R A;  4M9L A;  8ICJ A;  4RWN A;  3JPP A;  2JEF A;  2ASL A;  1ZQL A;  2R8G A;  4F8R A;  5HRI A;  3UQ2 A;  2DVI A;  2PI5 A;  1JN3 A;  4KLO A;  5KG3 A;  4KLL A;  4AT9 A;  3RTV A;  4X5V A;  4F4W A;  2UVW A;  3TAP A;  9ICF A;  3Q8R B;  4KLF A;  3WFQ E;  4MFF A;  3H4D A;  2ID1 A;  1UET A;  4I29 A;  4ECR A;  1MQ2 A;  4YMO A;  3OUY B;  1SL0 A;  1RYS A;  3JPT A;  1BVS A;  3H38 A;  4LZD A;  3ZD8 A;  3NTU A;  1NK9 A;  2IHM A;  2RDI A;  4Q43 A;  2BGW A;  3ZDE A;  5KFD A;  3H40 A;  1NKE A;  4IR9 A;  5J0S A;  3HJ4 A;  1ZQM A;  3JPQ A;  2ALZ A;  4UD4 A;  4R65 A;  4DSK A;  2VA3 A;  5DB9 A;  4ED1 A;  5III A;  2PI4 A;  4C8O A;  2W9B A;  4C8N A;  2ZH3 A;  1BPD A;  4UBC A;  4EZ9 A;  4UD5 A;  2XGQ A;  5HRD A;  3TAN A;  4WC6 A;  4F93 B;  2O1P A;  1L3S A;  2ZH2 A;  4B9N A;  4ECS A;  4DL4 A;  1BPX A;  3GII A;  3PO4 A;  8ICY A;  7ICH A;  8ICN A;  5J2C A;  3KHG A;  4DFP A;  4ED3 A;  1BGX T;  5KG0 A;  3C18 A;  4J9L A;  1ZJN A;  4MFC A;  3LDA A;  1UEV A;  1U49 A;  4O3S A;  2HVH A;  4M9N A;  1FA0 A;  5CJ7 A;  3MR2 A;  3ISC A;  3RRH A;  3Q8K A;  7ICV A;  4XA5 A;  2ZH7 A;  4UB5 A;  4NLZ A;  3SZ2 A;  8ICS A;  2ISO A;  2W9A A;  5KFT A;  4RQ3 A;  3AUO A;  5J2I A;  3OSP A;  1D9D A;  4YCX A;  3H37 A;  8ICM A;  4RNM A;  2MUT A;  4QWA A;  3FYH A;  1KFD A;  1ZQA A;  1A77 A;  2ZUD A;  5IIL A;  4YMM A;  4MF2 A;  3PMN A;  4I2A A;  4RUA A;  1BPE A;  4QWD A;  1Z00 A;  5J2B A;  3Q8S B;  1N48 A;  3PNC A;  1ZQE A;  4C8M A;  3BJY A;  3RJK A;  3SYZ A;  4DL5 A;  4RZR A;  1KRP A;  4QZH A;  4EP7 A;  4KN4 A;  4RNN A;  2PFN A;  8ICP A;  1WCL A;  2HW3 A;  5KFI A;  5KTQ A;  5J0X A;  4BWJ A;  4DS5 A;  1KFT A;  4X4S A;  2DFL A;  1Q79 A;  4O3N A;  3RB0 A;  1D8L A;  1EXN A;  2BCQ A;  1ZQQ A;  2GWS A;  4MEX A;  5F9N A;  3C21 A;  1PZN A;  3T5L A;  2AGQ A;  5IIO A;  2FPM A;  3GV8 B;  4M6W A;  4RPZ A;  4TUS A;  3EZ5 A;  2AQ4 A;  3K75 D;  4EZ6 A;  1NO5 A;  1ZQU A;  3TQ1 A;  4QZI A;  3OVS A;  3HW8 A;  2Y1I A;  4X4N A;  1ZQT A;  7ICP A;  4R63 A;  3TFS A;  2A1J B;  4GXK A;  3RB6 A;  5BOL A;  2W9M A;  2RDJ A;  1ZQG A;  1BNO A;  4Q8E A;  1QLN A;  5D4B A;  5DQI A;  4LZG A;  3UXP A;  3PV8 A;  1XSL A;  4I2B A;  9ICB A;  5DEC A;  4WC0 A;  9ICM A;  3KTQ A;  3LQC B;  4F3O A;  4IRK A;  5KG2 A;  2ZUC A;  1S9F A;  4FS2 A;  5J0U A;  3MR3 A;  1UEU A;  2ZH9 A;  3M9N B;  3B0Y A;  3MDA A;  1SKW A;  5J2G A;  4R66 A;  3AQK A;  3T5K A;  4BGD A;  3OVA A;  2W8K A;  4DS4 A;  5DQG A;  5DB7 A;  4Z6E A;  4QW9 A;  3AQM A;  2BQU A;  4WC4 A;  3C1Z A;  1K1S A;  5HRE A;  2BDP A;  2BCV A;  4GXJ A;  3PW0 A;  2ZH1 A;  3H7I A;  4UB1 A;  3G6Y A;  3C2K A;  4QZA A;  3M9M B;  1U4B A;  2WTF A;  4AT7 B;  2DR7 A;  3H8W A;  4IR1 A;  1JIH A;  3EYZ A;  3TFR A;  1ZQD A;  5J29 A;  5EWE A;  5KFM A;  2IBK A;  3RAQ A;  3PY8 A;  5HHH A;  1XSP A;  5KFK A;  3SI8 A;  4JWM A;  5KFR A;  3NGD A;  3BQ0 A;  5BOM A;  8ICT A;  1D8Y A;  1NK0 A;  3PX4 A;  1CUK A;  2BKE A;  3UXO A;  4NM1 A;  3TAR A;  9ICE A;  1ZQF A;  2KZZ A;  4Z6F A;  1U47 A;  3HJ1 A;  2BQ3 A;  3L9D A;  3JZ0 A;  3C23 A;  5KG6 A;  2ASJ A;  2I9G A;  4YMN A;  1KEJ A;  5J0R A;  4ELV A;  3UPQ A;  1BPB A;  2F1H A;  1XO1 A;  5C5J A;  4TUR A;  4ECU A;  4QW8 A;  4JV0 A;  4PHP A;  2XC9 A;  3HX0 A;  9ICC A;  1N56 A;  4E80 A;  2ZH8 A;  5HR9 A;  4DFJ A;  2ISP A;  4X0A A;  4X4Q A;  3GV7 B;  3RJE A;  4RT2 A;  2A1J A;  2J6U A;  2AJQ A;  3RJH A;  4Q8F A;  4B9S A;  2JEJ A;  1T4G A;  2XCP A;  2F1J A;  9ICH A;  8ICH A;  2F1I A;  5KFB A;  3G6V A;  9ICV A;  8ICA A;  3SV4 A;  5KG4 A;  5KFS A;  5CR0 A;  4KTQ A;  2UVR A;  3JPS A;  4DQP A;  1TV9 A;  1BPZ A;  1SZP A;  3HWT A;  3MAB A;  4K4I A;  3GFK B;  8ICQ A;  3V6J A;  3RB3 A;  4I2H A;  2M2W A;  5HP4 A;  7ICS A;  4AT8 A;  4WC3 A;  5DB6 A;  4EYH B;  3THV A;  3RBD A;  4G3I A;  2M9N A;  5J0Q A;  3V7L A;  5L1I A;  4J9K A;  5L1K A;  2XY5 A;  1ZET A;  1JQR A;  3UQ0 A;  4ECX A;  1TKD A;  3ISD A;  4ED0 A;  2DPI A;  2P6R A;  4IQT A;  7ICI A;  8ICR A;  1DK2 A;  3PW2 A;  5HHI A;  5DBC A;  3PR4 A;  4E7X A;  2DRB A;  4QZE A;  5CB1 A;  1C7Y A;  1ZQH A;  2XGP A;  1SL2 A;  1LV5 A;  3C2L A;  1MIV A;  4DFK A;  4F91 B;  3BQ2 A;  3GDX A;  4KLD A;  4YR2 A;  4O3Q A;  1NZP A;  4P4O A;  3PX6 A;  4K4G A;  4DSL A;  2IHN A;  2V4Q A;  4F4Y A;  2W9C B;  3PW7 A;  4F92 B;  2HHV A;  2FLP A;  4NLK A;  1JMS A;  7ICJ A;  2NRV A;  5KT2 A;  1MIY A;  3JPN A;  3SV3 A;  4QZG A;  8ICG A;  3WFS C;  2BCR A;  1L3V A;  2ZTE A;  5D46 A;  2R8J A;  9ICL A;  5J2K A;  1UA1 A;  1KFS A;  1ZQR A;  3ZDD A;  4ELT A;  4DQR A;  5KFU A;  2I1Q A;  5KFE A;  4YR3 A;  2HHQ A;  3HP6 A;  4PHA A;  1BNP A;  4X4P A;  5EWG A;  2VA2 A;  1UT8 A;  2Q0Z X;  2M2U A;  5HRH A;  1MIW A;  1DOQ A;  5DBB A;  4WBZ A;  5DG7 A;  3HIY A;  3KHL A;  4DOA A;  4F5Q A;  1KDH A;  3ISB A;  2MUT B;  4NKT A;  3C1Y A;  2HHW A;  4R8U A;  5DLG A;  4J9N A;  4RQ8 A;  4YD2 A;  4EEY A;  4M9J A;  7ICU A;  5DGB A;  4DO9 A;  7ICK A;  3RRG A;  1KTQ A;  1S0V A;  4M6W B;  2BHN A;  1R8C A;  4NKU A;  5KT7 A;  1R89 A;  4RQ1 A;  4AT8 B;  1RPL A;  1VFG A;  5F9L A;  4O5E A;  3ZDB A;  1TFW A;  2ZJ8 A;  5HNK A;  1CEZ A;  2PFQ A;  3OJS A;  4I2G A;  4F4K A;  5KFN A;  5KFW A;  4EBD A;  4ATB B;  9ICX A;  3OHB A;  4XQ8 A;  4ECW A;  3JYY A;  4IRD A;  9ICN A;  1KNY A;  2Y1J A;  4F4X A;  1SKS A;  2J6S A;  1TK5 A;  4CCH A;  2KP7 A;  3OJU A;  4PPX A;  7ICE A;  5CA7 A;  1NK4 A;  4MEY A;  1TVA A;  4F2S A;  1HUZ A;  4QWE A;  4F5N A;  2VAN A;  1S77 D;  2KFN A;  5DG9 A;  8ICX A;  5DED A;  2FMQ A;  4FHW A;  5DQH A;  3KHH A;  3Q8M A;  2UVV A;  4RPX A;  1OU5 A;  4XUS A;  1WOT A;  3B0X A;  1TAU A;  3EPI A;  3TI0 A;  1ZQP A;  4B9L A;  1X2I A;  5KFG A;  8ICF A;  3RBE A;  1NK7 A;  9ICI A;  4XRH A;  1WCN A;  5DDM A;  1YLQ A;  4O9M A;  4C8K A;  9ICR A;  2ZHB A;  2M2T A;  3MDC A;  4DWI A;  4IQW A;  1HJP A;  4UBB A;  1ZYQ A;  1NK6 A;  1R8B A;  5DG8 A;  3H4B A;  4NM2 A;  2KTQ A;  5KFF A;  4Q44 A;  5IIK A;  2PBE A;  4GLX A;  1U9L A;  1QSL A;  4KN7 A;  2AU0 A;  7ICF A;  5IIM A;  1T7P A;  2ZUB A;  5DB8 A;  4DL3 A;  4WBY A;  3QZ7 A;  3UPS A;  2JZB A;  3GIL A;  4B9T A;  4O3P A;  4ED7 A;  4UQG A;  3RB4 A;  1S97 A;  4JV2 A;  2KFZ A;  3MFI A;  4FO6 A;  5BPC A;  3Q8P B;  4X4T A;  1RXW A;  3ETL A;  5KT4 A;  3QEA Z;  4YG2 A;  4DOC A;  2DPJ A;  3RJF A;  2HHU A;  5EWF A;  3AQL A;  5J2H A;  3PO5 A;  9ICA A;  4YD1 A;  1XS9 D;  4FHY A;  3K4G A;  1S0M A;  1S0N A;  1VJ7 A;  3EW9 A;  2JEI A;  5J0P A;  4RWP A;  3HT3 A;  4HYK A;  4FHX A;  1X9M A;  7ICM A;  4PHD A;  8ICZ A;  4O3O A;  3V7K A;  3T3F A;  1MSW D;  1MC8 A;  3N97 B;  1D9F A;  9ICJ A;  1TAQ A;  3WFR E;  4IQV A;  1NOM A;  3KHR A;  5HC9 A;  2DR9 A;  1X9W A;  5HRK A;  1U48 A;  1RXV A;  4RQ0 A;  3M9O B;  1L3T A;  2FMP A;  3OUY A;  2C2R A;  3AU2 A;  2BQR A; 
#chains in the Genus database with same CATH topology
 3PW4 A;  4UAR A;  3WFO A;  9ICS A;  4CGZ A;  1QSS A;  5EOZ A;  2XY6 A;  1QQ6 A;  5KG5 A;  2YX8 A;  4RQ2 A;  4O3M A;  2LM1 A;  3H8S A;  4X4V A;  1H38 A;  1KBU A;  2FPL A;  2ZIU A;  5DLF A;  2FMS A;  4IG8 A;  3AQN A;  1PUZ A;  1SZH A;  1RZT A;  2YMQ A;  2W9C A;  4Z6C A;  4ECZ A;  4LJX A;  1B43 A;  4Y2Q A;  1N5W A;  9ICU A;  4M2Y A;  5ALL A;  3N4M B;  3GQC A;  5G5G A;  2B0C A;  4OJP A;  4R64 A;  4I28 A;  5AM3 A;  2M2V A;  3TAD A;  3I76 A;  4KLM A;  2OXO A;  3RJI A;  2YMM A;  4F5P A;  1A76 A;  5AK4 A;  5KFJ A;  4Y2P A;  2HVI A;  4F50 A;  4O5C A;  1L3U A;  5F3X B;  1Z3E B;  5D63 A;  1ZQB A;  4WC2 A;  4PGY A;  4X4O A;  2NO4 A;  4UAZ A;  1LKY A;  2NO5 A;  3NKU A;  1FFU A;  3SQI A;  4KLQ A;  4JK1 A;  2RQ5 A;  5KFA A;  1XU4 A;  5HMM A;  5L1J A;  3M7D A;  1JXL A;  4EBJ A;  7ICT A;  3MGH A;  1Q3U A;  2MA1 A;  2E3T A;  3TKA A;  3Q8L A;  3RF9 A;  1X6J A;  4JWN A;  2B21 A;  2F8L A;  1JAJ A;  5KT6 A;  2J6T A;  1NJX A;  1XSN A;  5DDY A;  2V9W A;  1PK3 A;  2OEH A;  2HN1 A;  5A0L A;  3M8S A;  4WC1 A;  2A1A A;  4EBK A;  4Y2X A;  3WKB A;  4GC6 A;  1F5S A;  4KB6 A;  4DSJ A;  2NRX A;  1KN5 A;  3BS5 A;  2IMW P;  2C28 A;  9ICW A;  2CN1 A;  5L9X A;  3T5J A;  5D62 A;  1NKC A;  4X0B A;  2P66 A;  4R8U B;  3Q8Q B;  3SMV A;  4IRC A;  3LWL A;  2PFP A;  3ZDC A;  4AT9 B;  2FI1 A;  4M9H A;  2KHV A;  4Q45 A;  4QWC A;  3E0F A;  1NJW A;  2HN2 A;  2LI6 A;  5ALW A;  5L1M A;  5CP2 A;  4B9V A;  1Z1B A;  2KN7 A;  5AKJ A;  1LB2 B;  5KG1 A;  2WHE A;  4LVS A;  1RQN A;  3HKZ C;  4RUC A;  3C29 A;  2ZJA A;  4BXO B;  1M6Y A;  1COK A;  5F2V O;  8ICL A;  5ALE A;  3GIM A;  1QSY A;  2R8H A;  4FBT A;  5J2E A;  9ICP A;  3ED5 A;  3E2E A;  5ALP A;  1TK8 A;  1J97 A;  1R8A A;  2LHT A;  3V6K A;  4M04 A;  4DQS A;  4FH5 A;  1A6S A;  2RLT A;  4K4H A;  5AI9 A;  4QZ9 A;  1PVQ A;  4C80 A;  1U45 A;  1ZQS A;  5CFT A;  2YN4 A;  2AGO A;  2ESE A;  1ZQC A;  4DSF A;  3A0H U;  2EH9 A;  2K8B B;  3LK9 A;  9ICT A;  4DSI A;  1L7N A;  4PH5 A;  5KG7 A;  2XO7 A;  4GC7 A;  8ICK A;  2NRT A;  5J0Y A;  2O5A A;  1LKY B;  1NK5 A;  4BXO A;  3RR8 A;  1ZQZ A;  3DDH A;  2QKQ A;  4J9Q A;  7ICO A;  2W7O A;  3BQ1 A;  2JXJ A;  4ED2 A;  1WWV A;  2KIW A;  1LVH A;  1KKX A;  4M9L A;  2JEF A;  2R8G A;  5HRI A;  3FAH A;  4C4S A;  4KLL A;  4X5V A;  4F4W A;  9ICF A;  4MFF A;  3H4D A;  2YTU A;  2ID1 A;  4P0Q A;  3NRW A;  3H38 A;  1UHU A;  5C0Y A;  2G06 A;  1NK9 A;  2IHM A;  3H40 A;  1NKE A;  2ALZ A;  4UD4 A;  4DSK A;  5DB9 A;  2AH5 A;  4ED1 A;  2PI4 A;  2W9B A;  4WC6 A;  5AHX A;  2XGQ A;  2O1P A;  4DL4 A;  2ES6 A;  3CK6 A;  2ZXH A;  5KG0 A;  4J9L A;  3WK6 A;  1ZJN A;  4MFC A;  1UEV A;  4O3S A;  4M9N A;  3MR2 A;  3ISC A;  2IHO A;  1V38 A;  4I0U A;  2YY6 A;  4NLZ A;  5B3P A;  5J2I A;  1D9D A;  4RNM A;  4QWA A;  3S6J A;  5IIL A;  5KAF U;  4RUA A;  2E8M A;  3Q8S B;  2MU2 A;  4HAI A;  3SYZ A;  4DL5 A;  5KFI A;  1SXD A;  5J0X A;  1KFT A;  1D8L A;  2GWS A;  2FJ6 A;  2DKX A;  4MEX A;  2EZX A;  2FE9 A;  3GV8 B;  2ZIX B;  3H0R B;  5AM4 A;  1ZQG A;  3K7D A;  4LZG A;  4I2B A;  1XSL A;  9ICB A;  3BS5 B;  3KTQ A;  3MR3 A;  3M9N B;  3B0Y A;  2WB1 F;  2KKV A;  4R66 A;  4OD0 A;  2RP5 A;  4BGD A;  4DS4 A;  2AHO B;  4Z6E A;  3CRX A;  2ZH1 A;  1N62 A;  4UB1 A;  5GTI U;  1IIP A;  1PK1 B;  1DGJ A;  3H8W A;  1Z19 A;  5AM5 A;  2KE7 A;  5J29 A;  3PY8 A;  3RAQ A;  3AL0 B;  2Q4T A;  2DQN B;  3TAR A;  4P0P A;  9ICE A;  4Z6F A;  3N7R C;  5KG6 A;  2ASJ A;  1KEJ A;  3D2Q A;  1JAL A;  2QB0 A;  1XO1 A;  4TUR A;  2XC9 A;  4JV0 A;  1N56 A;  4X4Q A;  3HRD D;  3RJH A;  4EX6 A;  2JEJ A;  4CRX A;  1T4G A;  2XCP A;  3JCF A;  3F2D A;  5KG4 A;  5KFS A;  4K4I A;  1TV9 A;  2WAQ F;  3V6J A;  3RB3 A;  2M2W A;  5HP4 A;  4AT8 A;  2M0N A;  5DB6 A;  5ALO A;  2M9N A;  2EAN A;  4J9K A;  2XY5 A;  1N61 A;  8ICR A;  2P6R A;  2CRX A;  4IQT A;  4QNL A;  4RQN A;  5CB1 A;  1C7Y A;  4NWI A;  1LV5 A;  3C2L A;  3GDX A;  4YR2 A;  2JRZ A;  4F72 A;  4P0P B;  4EEL A;  4DSL A;  2PKE A;  4F4Y A;  1Z1V A;  2HHV A;  2FLP A;  2EAO A;  3SEI A;  3WFS C;  3SV3 A;  1OW5 A;  2BCR A;  9ICL A;  1KFS A;  1SWV A;  1BNP A;  5EWG A;  2VA2 A;  2KKP A;  1ZOL A;  5DBB A;  3DEE A;  5DG7 A;  4DOA A;  1KDH A;  2KJ5 A;  2MUT B;  2HHW A;  4J9N A;  3F53 A;  4RQ8 A;  4M9J A;  4DO9 A;  1KTQ A;  1L7P A;  2ZIV A;  2FCL A;  1RPL A;  3ZDB A;  2ZJ8 A;  1CEZ A;  2F77 X;  3OHB A;  1ZXI A;  4XQ8 A;  1Q46 A;  1JI7 A;  1TK5 A;  4OJL A;  3OJU A;  2CPR A;  3AM9 A;  1HUZ A;  4QWE A;  2WB1 C;  2KFN A;  5DG9 A;  5DED A;  2ZIV B;  3Q8M A;  1OU5 A;  4XUS A;  3EPI A;  3KD3 A;  1WCN A;  2M2T A;  2W04 A;  4F71 A;  1NK6 A;  1R8B A;  5DG8 A;  3J81 j;  4Q44 A;  4BX9 C;  2EDU A;  1QSL A;  2YB4 A;  7ICF A;  5DB8 A;  3UPS A;  2F8K A;  4B9T A;  4ED7 A;  1L8O A;  3IG8 A;  1B0X A;  2KOB A;  2WF8 A;  3L4P A;  9ICA A;  4YD1 A;  1VJ7 A;  3EW9 A;  3HT3 A;  1X9M A;  8ICZ A;  3V7K A;  1D8B A;  3N97 B;  9ICJ A;  1TAQ A;  3QYP A;  3M8R A;  3AU2 A;  1BPY A;  1ZQJ A;  4KLT A;  1SWW A;  2K4P A;  2LYH A;  3QNM A;  5JRT A;  5KT5 A;  3IV6 A;  3WK9 A;  5TIS U;  4ZH4 A;  4I2F A;  3OV7 A;  5KFO A;  2R8K A;  3JPR A;  4OJO A;  4YP3 A;  3LYS A;  1NJZ A;  5KFH A;  3NUQ A;  4NXT A;  4US8 A;  3PML A;  2C2E A;  4MFA A;  2MSN A;  3BQT A;  3WK4 A;  3EF2 A;  5ALR A;  1PX5 A;  2DUY A;  3IG5 A;  4IS7 A;  1NK8 A;  3OTQ A;  2HHS A;  5J0W A;  4NL9 C;  1MQ3 A;  1QQ5 A;  4ECT A;  2Y9U A;  3D2N A;  3GIJ A;  3C2M A;  3TAQ A;  3QU9 A;  2B6G A;  4DFM A;  8ICI A;  5L1L A;  3O0F A;  3LWM A;  9ICQ A;  3NS1 A;  3ZDA A;  1SL1 A;  3TAD C;  2FPK A;  2ZIW A;  2NYV A;  4J9O A;  4DQI A;  3H8J A;  4YFK A;  2KK0 A;  4DQQ A;  4YXM A;  4JB3 A;  5AKX A;  1QQ7 A;  1Q78 A;  2LMR A;  1ZD2 P;  5KFQ A;  1X42 A;  1VFG A;  1S0O A;  3RH4 A;  4O3R A;  5HRL A;  5IIN A;  2WF6 A;  4GFJ A;  4QZF A;  2BE3 A;  9ICK A;  1ZRN A;  2C22 A;  5ALM A;  2Q66 A;  4PGX A;  8ICE A;  5AI5 A;  4DL6 A;  3WKE A;  4I27 A;  2XY7 A;  8ICO A;  1WYG A;  4DL7 A;  2W55 A;  4PHE A;  1N63 A;  4KLU A;  2HHX A;  5B5E U;  2ZTC A;  2YML A;  7ICG A;  2XCA A;  2W11 A;  4I2E A;  4EBC A;  2FLN A;  4ELU A;  5AK3 A;  2DKZ A;  1L6N A;  4OAG A;  2HOQ A;  1IG6 A;  3EPG A;  4DEZ A;  2K4H A;  2WF5 A;  4J9M A;  4NLN A;  4P4P A;  4BDP A;  2LPE A;  4I2C A;  4F4Z A;  5AM0 A;  1B4F A;  2GO7 A;  2E1F A;  5ALY A;  1NKB A;  3C5G A;  3CW2 C;  4NXZ A;  1A0P A;  4WJ3 B;  2ATL A;  4ECY A;  2MAX A;  2A19 A;  2V4R A;  1UA0 A;  2ZH6 A;  1VLB A;  5FP0 A;  1WWU A;  1FEZ A;  4A8E A;  2HCF A;  1ZQK A;  4I2I A;  3PSF A;  1SV0 A;  4O6A A;  4DOB A;  5E79 U;  9ICG A;  2IUB A;  4UW9 A;  2QB1 A;  1ZQW A;  3OGU A;  4NLG A;  5KFP A;  3RR7 A;  4YXJ A;  4F2R A;  4GXI A;  1ARO P;  4OAH A;  5EE3 A;  2RFF A;  5IIJ A;  8ICB A;  2VJ4 A;  4RQ4 A;  1IM4 A;  4G9B A;  2KZM A;  2XI9 A;  4KLG A;  4AYB F;  2W3S A;  3QUB A;  4EX7 A;  8ICJ A;  3JPP A;  3PZP A;  2DVI A;  3UQ2 A;  4KLO A;  5KG3 A;  2UVW A;  3Q8R B;  4KLF A;  3WFQ E;  5ALD A;  3OUY B;  4NXX A;  3JPT A;  1BVS A;  5AKI A;  3ZD8 A;  4FZM A;  1X66 A;  1PVP A;  2RDI A;  3OWG A;  4IR9 A;  2A3V A;  5J0S A;  2EWR A;  2Y0S F;  5ALH A;  3JPQ A;  1X6I A;  4UAU A;  1BPD A;  4EZ9 A;  3HJE A;  5AI6 A;  4F93 B;  5HR7 A;  2ZH2 A;  1O08 A;  4B9N A;  2W54 A;  2DGZ A;  8ICN A;  3KHG A;  4DFP A;  1BGX T;  4CF5 A;  1U49 A;  3RRH A;  3Q8K A;  2ZH7 A;  1OXJ A;  7ICV A;  3SZ2 A;  1WG8 A;  8ICS A;  1NNL A;  4OAI Z;  4WH5 A;  4MF2 A;  4IL6 U;  4QWD A;  1ZQE A;  4C8M A;  2FDR A;  1GPJ A;  4RNN A;  4X4S A;  2DRA A;  4ICA A;  5KTQ A;  3RB0 A;  1EXN A;  2BCQ A;  5ALQ A;  3C21 A;  1PZN A;  3T5L A;  3D6J A;  5IIO A;  4MKP A;  1NO5 A;  2EAP A;  3OVS A;  3TQ1 A;  1J2N A;  3HW8 A;  1ZQT A;  3TFS A;  1ZD3 A;  5BOL A;  2Y9T A;  1BNO A;  4Q8E A;  5D4B A;  5DQI A;  3PV8 A;  2YMP A;  9ICM A;  3LQC B;  4IRK A;  1S9F A;  2ZUC A;  4FS2 A;  3IRU A;  2W03 A;  2GAF D;  3AQK A;  5DB7 A;  3AQM A;  2XID A;  3C1Z A;  1C20 A;  5HRE A;  2BDP A;  2BCV A;  3NVV A;  5K4L A;  2WTF A;  1JIH A;  5KFM A;  3IP4 B;  2F2A B;  5HHH A;  1XSP A;  2HDO A;  5KFK A;  1VJ5 A;  3BQ0 A;  1KL9 A;  8ICT A;  1D8Y A;  2BKE A;  3UXO A;  2O6K A;  1U47 A;  3HJ1 A;  3C23 A;  4YMN A;  1JUD A;  4AYB C;  4E80 A;  4O69 A;  5J8Y A;  3QU7 A;  2A1J A;  2J6U A;  5ALG A;  2PMZ F;  4B9S A;  5KFB A;  3G6V A;  3BQ7 A;  2F44 A;  9ICV A;  5AIA A;  3SV4 A;  5CR0 A;  4DQP A;  1SZP A;  5ALS A;  4EEK A;  1F0M A;  2WF9 A;  4WC3 A;  2BZF A;  2H3Q A;  4EGW A;  1J2M A;  3DV9 A;  4ECX A;  2DPI A;  5HHI A;  2YB1 A;  2RHF A;  3U26 A;  4GIB A;  3ER8 C;  3PSP A;  3M1Y A;  3PW7 A;  4NV0 A;  3NWI A;  1ECW A;  1JMS A;  2NRV A;  8ICG A;  4LEZ A;  5D46 A;  2R8J A;  1ZQR A;  5CEH A;  4YR3 A;  2HHQ A;  3HP6 A;  4PHA A;  2M2U A;  4C4T A;  4WBZ A;  3KHL A;  4F5Q A;  3ISB A;  4NKT A;  5AIC A;  2VJ5 A;  3N7S C;  4ACO A;  1R8C A;  4NKU A;  4QJF B;  4O5E A;  4NLB A;  3OJS A;  3D2S A;  4F4K A;  5ALX A;  9ICX A;  3JYY A;  4FFD A;  2OYY A;  2KP7 A;  5CA7 A;  4MEY A;  3I28 A;  2GH1 A;  2VAN A;  1S77 D;  8ICX A;  4FHW A;  5DQH A;  3KHH A;  3NVZ A;  3B0X A;  1O03 A;  4UB6 U;  4B9L A;  4LEY A;  5AI0 A;  3RBE A;  2ZHB A;  9ICR A;  4C8K A;  4IQW A;  3KKA A;  2KTQ A;  4NM2 A;  4HX0 A;  1SIJ A;  5CFS A;  2E8N A;  5JTG A;  3PST A;  2ZUB A;  4DL3 A;  4WBY A;  1XO0 A;  3WU2 U;  4O3P A;  1S97 A;  3MFI A;  1RXW A;  3SAG A;  5KT4 A;  3AQL A;  3SEN A;  5J2H A;  3PO5 A;  3K4G A;  1S0N A;  2HBJ A;  2JEI A;  2JGA A;  4HYK A;  4PHD A;  5AKY A;  3T3F A;  1X9X A;  1D9F A;  2QB0 B;  5HR6 A;  5HC9 A;  1N60 A;  1U48 A;  1L7O A;  2BQR A;  4RWQ A;  3UMG A;  4QZC A;  4QZ8 A;  4EEB A;  1ZQY A;  2KZ3 A;  2D8C A;  5DBA A;  2LYA A;  4KLJ A;  4KIT B;  4PL1 A;  4ED8 A;  2KSO B;  4TQR A;  4KLI A;  4ED6 A;  3BDP A;  2H3I A;  3SAF A;  4PGQ A;  4WC5 A;  4EV6 A;  2E5S A;  4RQ5 A;  2IOF A;  5AKL A;  4ATB A;  3ORY A;  2KVS A;  4M0A A;  5JTI A;  3AQF A;  3AU6 A;  2JEG A;  2OWO A;  4J9R A;  2AQ0 A;  3WK5 A;  2KHQ A;  3KBB A;  4DFD A;  5CWR A;  1P7D A;  2WAQ C;  1NJY A;  2JMG A;  5ALK A;  1Z00 B;  2BBH A;  2HOI A;  4KLS A;  1ZQN A;  4M5D A;  2JV3 A;  5HML A;  5ALF A;  4WCW A;  4YN4 A;  4I2J A;  3F5E A;  3RH5 A;  2EQY A;  1S10 A;  1Y88 A;  2JZB B;  1IXR A;  2WFA A;  2P6U A;  3MGV A;  5T14 A;  4IC9 A;  4LT6 A;  5TZV A;  2PFO A;  7ICR A;  4MHV A;  2H5X A;  2AXT U;  4UB2 A;  4KMO B;  4TQS A;  4P4M A;  3N28 A;  2W9B B;  1XNS A;  4RT3 A;  2KIV A;  4FHP A;  5J0T A;  2VKQ A;  2HHT A;  4QWB A;  3CP8 A;  4FHV A;  2ASD A;  3MR5 A;  4EBE A;  4EYI B;  4ECQ A;  5AK5 A;  4Y2V A;  4M9G A;  3MGI A;  2G07 A;  1URJ A;  4JV1 A;  3V7J A;  3KZI U;  4RQ7 A;  2ZTD A;  5EE0 A;  4Z6D A;  4DL2 A;  3RJJ A;  4KMU A;  1RYR A;  5EE9 A;  5KFL A;  2DR8 A;  5AK6 A;  3OHA A;  1TK0 A;  2ZJ5 A;  5J2F A;  1UQV A;  3LVW A;  2AGP A;  1ZJM A;  5J2A A;  4TUP A;  2H3F A;  4KLE A;  4BWM A;  1ZQI A;  3F2C A;  1XC9 A;  3NVW A;  5HRG A;  2JHD A;  2OHF A;  3HPO A;  2I6X A;  5HRB A;  2G5I B;  2NRK A;  3QUT A;  1SXE A;  2H3Z A;  2BR0 A;  4E0D A;  3JPO A;  1Z4O A;  3FDS A;  3QE9 Y;  4O5K A;  2XVT A;  3QUQ A;  4C7Z A;  7ICQ A;  1IV8 A;  2LYB A;  1N5X A;  2CXY A;  3ZD9 A;  4K97 A;  1DXS A;  3GIK A;  4NXV A;  4QZD A;  2HHP A;  5G5H A;  2R8I A;  4RQ6 A;  5KFZ A;  4U6P A;  1T3N A;  1UT5 A;  4QZB A;  4EED A;  4DF4 A;  4EEN A;  4UB3 A;  4Y2Y A;  5KAI U;  4E8F A;  2IOH A;  4F5R A;  2WF7 A;  4NLC A;  4RWN A;  5AI8 A;  2ASL A;  2KEY A;  4AT9 A;  3TAP A;  3M6Z A;  2HBK A;  3VC8 A;  4K8V A;  1UET A;  4I29 A;  2KSO A;  1SL0 A;  5GTH U;  5AI4 A;  4BJQ A;  4CDG A;  2BGW A;  3ZDE A;  5AKE A;  4X4P A;  4C8O A;  2R18 A;  4C8N A;  1QH9 A;  4UBC A;  3TAN A;  4ECS A;  2KV2 A;  3PO4 A;  8ICY A;  5J2C A;  3C18 A;  3LDA A;  4JLZ A;  4XA5 A;  2KIC A;  5D61 A;  2ISO A;  2W9A A;  1SV0 C;  4YCX A;  3M6K A;  8ICM A;  2HOF A;  1KFD A;  4YMM A;  4CNQ A;  5ALZ A;  4O67 A;  1Z00 A;  1N48 A;  7ICJ A;  3BJY A;  4RZR A;  1V97 A;  4QZH A;  1KRP A;  2W7P A;  2PFN A;  3R9K A;  3WK8 A;  1ZQQ A;  5F9N A;  2KMD A;  4EZ6 A;  2AQ4 A;  4FE3 A;  1ZQU A;  1ED1 A;  2Y1I A;  7ICP A;  4B6J A;  4R63 A;  1UPH A;  3RB6 A;  2RDJ A;  2EZZ A;  4F3O A;  4K9B A;  2K60 A;  5J0U A;  4K9A A;  1UEU A;  2ZIU B;  4NL9 A;  3VCB A;  3T5K A;  3OVA A;  5DQG A;  4QW9 A;  4WC4 A;  1K1S A;  4GXJ A;  3PW0 A;  3H7I A;  3C2K A;  4QZA A;  3M9M B;  2DR7 A;  3BZK A;  3NAS A;  3ER9 B;  4IR1 A;  3EYZ A;  2HBM A;  2DWQ A;  2G0A A;  5EWE A;  4OJ6 A;  1Q8K A;  1ZD4 A;  1S5L U;  5KFR A;  3NGD A;  5BOM A;  3T79 A;  2HMX A;  3WK7 A;  4NM1 A;  2K89 A;  5ALI A;  2LM4 A;  4QIW C;  2BQ3 A;  1F44 A;  3JZ0 A;  4BUG A;  5J0R A;  3UPQ A;  2F1H A;  3KKA C;  3QUC A;  4ECU A;  4QW8 A;  1ZD5 A;  3HX0 A;  5AKG A;  1YZ6 A;  4DFJ A;  1Q3V A;  3SR6 A;  4RT2 A;  2B56 A;  1MA7 A;  9ICH A;  8ICH A;  8ICA A;  4KTQ A;  2UVR A;  3JPS A;  1BPZ A;  3B9J A;  2E8O A;  1GO3 F;  3MAB A;  4UAT A;  1TAM A;  4PZO A;  2G5H B;  4EYH B;  3THV A;  1DRG A;  4G3I A;  5ALN A;  2KD1 A;  5L1I A;  5L1K A;  1ZET A;  3I1Y A;  3ISD A;  4KX3 A;  3PW2 A;  5DBC A;  2HSZ A;  3PR4 A;  4E7X A;  2DRB A;  2XGP A;  1MIV A;  4F91 B;  4O3Q A;  4P4O A;  4K4G A;  4USA A;  2W9C B;  1SB3 C;  4NLK A;  2JH1 A;  2K4E A;  3BS7 A;  3SD7 A;  3UM9 A;  5CHE A;  5KT2 A;  1MIY A;  3JPN A;  5J2K A;  3L5K A;  3ZDD A;  2ODG A;  4DQR A;  2I1Q A;  4CF3 A;  2BBJ A;  1JRP A;  1MIW A;  1DOQ A;  2JR5 A;  3HIY A;  4CF4 A;  3F2B A;  2W3R A;  3C1Y A;  5DLG A;  7ICK A;  3RRG A;  2BHN A;  1OUQ A;  5KT7 A;  1R89 A;  4AT8 B;  4O68 A;  3HKZ F;  5J8Y C;  5F9L A;  1TFW A;  4U7C A;  2F3N A;  4EBD A;  4ATB B;  2EZY A;  4IRD A;  3NRZ A;  1SKS A;  2J6S A;  4CCH A;  7ICE A;  5AKH A;  2IOF K;  1NK4 A;  1TVA A;  4F2S A;  4Y2J A;  2E1E A;  4F5N A;  1SV4 A;  4C4R A;  2FMQ A;  2GOL A;  2UVV A;  4RQM A;  2Y0S C;  3TI0 A;  1SGG A;  1X2I A;  5KFG A;  8ICF A;  4DCC A;  1NK7 A;  9ICI A;  4C0Z A;  4NXU A;  4O9M A;  3MDC A;  4DWI A;  1HJP A;  4UBB A;  3H0L B;  3K1Z A;  4KN7 A;  5AM2 A;  1L7M A;  2AU0 A;  5IIM A;  3UMB A;  2JZB A;  4QIW F;  3RB4 A;  5BPC A;  4X4T A;  4PZN A;  3QEA Z;  3RJF A;  4YG2 A;  5EWF A;  1NZB A;  1XS9 D;  4FHY A;  3CYM A;  4FHX A;  7ICM A;  2E8P A;  4IQV A;  1NOM A;  2OM6 A;  5HRK A;  1RXV A;  4RQ0 A;  3M9O B;  8ICW A;  4FH3 A;  1JX4 A;  2IA6 A;  2ZG6 A;  2KVC A;  1COO A;  2P35 A;  4KX5 A;  4F5O A;  4B9M A;  2BPG A;  4AT7 A;  3C5F A;  3RAX A;  1ZQX A;  4YQW A;  5AIB A;  5KFC A;  3PVX A;  2DR5 A;  3AN1 A;  5HRF A;  2QAR A;  3IM1 A;  4WC7 A;  4UB4 A;  3GV5 B;  5KNI A;  1TFY A;  1V85 A;  2K8A A;  3H39 A;  4WQL A;  1UCV A;  4RU9 A;  3QU5 A;  3WFP A;  1S76 D;  4ZOH C;  5DKW A;  3G6X A;  4RPY A;  4C8L A;  3PR5 B;  1T8E A;  2I5H A;  4DSE A;  1KW4 A;  3UMC A;  1PK1 A;  4B9U A;  4M47 A;  2VA8 A;  2BPC A;  4I2D A;  2W8L A;  2FLL A;  4JUZ A;  3QU2 A;  1KSP A;  4P2H A;  4Y2S A;  3ERC C;  4C7Y A;  5J2J A;  1B22 A;  2ZHA A;  3GZF A;  2QLT A;  3RH6 A;  7ICL A;  2BCS A;  5DGA A;  4P0Q B;  4K98 A;  1RG6 A;  5D49 A;  1QTM A;  3KFU F;  4S3N A;  1V4A A;  4US9 A;  3EWA A;  2D3D A;  4FO1 A;  8ICC A;  2HBL A;  4FZL A;  3PW5 A;  3OPX A;  1FFV A;  3H3A A;  2HI0 A;  3KOO A;  5ALJ A;  5AM1 A;  3MR6 A;  2LKY A;  5KFV A;  1X9S A;  5JUM A;  3FM9 A;  2JH7 A;  1ZQV A;  1JXE A;  1DGS A;  4UAV A;  3OVB A;  1K1Q A;  4Y2R A;  5KFX A;  8ICV A;  7ICN A;  4YVZ A;  1TFR A;  2W43 A;  5AKK A;  4UAY A;  4X4U A;  5KFY A;  3MC1 A;  4J9S A;  4Y2T A;  4KM5 A;  2ZH4 A;  5ALV A;  3V6H A;  5J0O A;  8ICU A;  5CRX A;  1SKR A;  4UAS A;  1T94 A;  4XQ7 A;  1KLN A;  3RJG A;  3IHQ B;  3AQE A;  1XWL A;  1Z4N A;  1F5A A;  4RWO A;  3WKC A;  1MN8 A;  4DLE A;  3ETR A;  1K5O A;  5AKZ A;  1L5U A;  1CI4 A;  2PXI A;  4JMU A;  2NRW A;  3MFH A;  2QAR B;  3QZ8 A;  1ZQO A;  5ALU A;  4NY8 A;  2ZIX A;  4YR0 A;  2BPF A;  4IQU A;  3NYB A;  1QCK A;  3OSN A;  1RM6 C;  4ECV A;  1HUO A;  4UB8 U;  4DF8 A;  4J9P A;  5B3Q A;  2DL0 A;  4RNO A;  3V72 A;  3QEB Z;  3F5A A;  1V9P A;  2K8C B;  3N7P D;  2N1R A;  3MBY A;  4O0I A;  5CHG A;  9ICO A;  4WOY A;  5KT3 A;  4DLG A;  3PHZ A;  4CE6 A;  1FO4 A;  4UAW A;  3QXG A;  4FBU A;  2MRL A;  2NRZ A;  4FS1 A;  3E58 A;  3L3F X;  3C66 A;  1DK3 A;  5J2D A;  2C2D A;  3TAC B;  3UXN A;  2G09 A;  3T5H A;  4LEV A;  4X4R A;  4MF8 A;  3PX0 A;  4N7R A;  4XJE A;  5EE1 A;  4TUQ A;  2ZH5 A;  4WQK A;  2OCE A;  2XIC A;  4PJ0 U;  2BCU A;  2UVU A;  4F8R A;  1ZQL A;  2PI5 A;  1JN3 A;  3RTV A;  1YZ7 A;  1VDV A;  2EAM A;  4ECR A;  1MQ2 A;  4YMO A;  1RYS A;  2NV3 A;  4LZD A;  3NTU A;  2RRD A;  3IDW A;  4Q43 A;  2OH2 A;  5KFD A;  3HJ4 A;  1ZQM A;  4R65 A;  2VA3 A;  5III A;  2ZH3 A;  2GLE A;  3H0M B;  4UD5 A;  4OCZ A;  5HRD A;  1L3S A;  1BPX A;  3GII A;  7ICH A;  3NVO A;  4ED3 A;  2G08 A;  2HVH A;  1FA0 A;  5CJ7 A;  4UB5 A;  5KFT A;  4RQ3 A;  3AUO A;  3OSP A;  3H37 A;  2MUT A;  3FYH A;  1ZQA A;  1A77 A;  2ZUD A;  3PMN A;  4I2A A;  1HEK A;  1BPE A;  2K4I A;  5J2B A;  3MCR A;  3PNC A;  3RJK A;  4EP7 A;  4KN4 A;  8ICP A;  1WCL A;  2HW3 A;  4DS5 A;  4BWJ A;  2DFL A;  1Q79 A;  4O3N A;  4PL2 A;  5KL8 B;  2AGQ A;  2D6F C;  2FPM A;  2ZIW B;  4M6W A;  4RPZ A;  4TUS A;  3EZ5 A;  3K75 D;  4QZI A;  4X4N A;  2A1J B;  4GXK A;  4K96 A;  2W9M A;  1QLN A;  3ICX A;  3IN5 A;  3UXP A;  5DEC A;  4WC0 A;  1S8O A;  1L8L A;  5KG2 A;  2B4V A;  2ZH9 A;  1SKW A;  3MDA A;  5J2G A;  3ALR A;  2W8K A;  1NI3 A;  2BQU A;  3GU3 A;  3K1R B;  3QX7 A;  3CNH A;  3G6Y A;  1U4B A;  4AT7 B;  4LEW A;  2F76 X;  3TFR A;  1ZQD A;  2IBK A;  4Y2U A;  3SI8 A;  4JWM A;  1NK0 A;  3PX4 A;  2PMZ C;  1CUK A;  1CRX A;  5KL1 B;  1ZQF A;  2KZZ A;  3L9D A;  2Z7J A;  2I9G A;  1ZQ1 C;  4ELV A;  3ZI4 A;  1BPB A;  2KJ9 A;  1RYU A;  5C5J A;  9ICC A;  2ZH8 A;  4PHP A;  5HR9 A;  4X0A A;  2ISP A;  3GV7 B;  3RJE A;  2AJQ A;  3KZX A;  2DF4 B;  4Q8F A;  2F1J A;  3SAH A;  2F1I A;  2ZXI A;  3C28 A;  1AQ6 A;  3ONN A;  3HWT A;  3GFK B;  8ICQ A;  2KNJ A;  4I2H A;  7ICS A;  1FIQ A;  3RBD A;  5J0Q A;  3V7L A;  1JQR A;  3UQ0 A;  1TKD A;  7ICI A;  4ED0 A;  1DK2 A;  3HIL A;  5ALT A;  4OAF A;  4QZE A;  1ZQH A;  1SL2 A;  2GA9 D;  4DFK A;  3BQ2 A;  4KLD A;  1NZP A;  3PX6 A;  2IHN A;  2V4Q A;  1KQQ A;  2L5Y A;  4F92 B;  2H3V A;  5H2F U;  4QZG A;  1L3V A;  2KG5 A;  2ZTE A;  4AP9 A;  2KJ8 A;  1UA1 A;  4ELT A;  5KFU A;  4FZN A;  5KFE A;  1PVR A;  1YT3 A;  1UT8 A;  2Q0Z X;  4OJ5 A;  5HRH A;  3BZC A;  2DBY A;  2VIX A;  4R8U A;  4YD2 A;  4EEY A;  7ICU A;  5DGB A;  3NVY A;  3EUB 2;  1S0V A;  4M6W B;  3WKD A;  4RQ1 A;  5HNK A;  3H8M A;  2PFQ A;  1JRO A;  3PSI A;  4I2G A;  1RDF A;  5KFN A;  5KFW A;  4OO1 J;  3AEV A;  4ECW A;  3QU4 A;  9ICN A;  1KNY A;  4JLX A;  2Y1J A;  4F4X A;  4PPX A;  1HIW A;  2LBO A;  4NXW A;  5CFU A;  4RPX A;  1WOT A;  1TAU A;  5B66 U;  1ZQP A;  4K99 A;  1ZRM A;  4XRH A;  1RQL A;  5DDM A;  1YLQ A;  3AMZ A;  1ZYQ A;  3H4B A;  5KFF A;  5IIK A;  5JU5 A;  2PBE A;  4GLX A;  3LVV A;  1U9L A;  3RFA A;  1T7P A;  3QZ7 A;  2B51 A;  3GIL A;  4UQG A;  4JV2 A;  2KFZ A;  4FO6 A;  3Q8P B;  3A0B U;  3ETL A;  4J03 A;  2DPJ A;  2HHU A;  4DOC A;  1TE2 A;  1T3Q A;  1X40 A;  4NJ8 A;  1S0M A;  2YQE A;  5J0P A;  4RWP A;  1N2X A;  1WUD A;  2BDU A;  4O3O A;  1MSW D;  3WKA A;  1MC8 A;  3FC4 A;  3WFR E;  2DR9 A;  3KHR A;  1X9W A;  1L3T A;  2FMP A;  3OUY A;  4KLH A;  2C2R A; 
#chains in the Genus database with same CATH homology
 1ZQJ A;  3PW4 A;  1JX4 A;  2IA6 A;  4KLT A;  4FH3 A;  2LYH A;  4QZC A;  5KT5 A;  9ICS A;  3WFO A;  1QSS A;  3M8R A;  5EOZ A;  2XY6 A;  4QZ8 A;  1COO A;  4ZH4 A;  4I2F A;  3OV7 A;  5KG5 A;  5KFO A;  4F5O A;  1ZQY A;  2KZ3 A;  3JPR A;  2R8K A;  4RQ2 A;  4B9M A;  4YP3 A;  3H8S A;  2BPG A;  1BPY A;  4AT7 A;  1H38 A;  4X4V A;  3C5F A;  5DBA A;  3RAX A;  1ZQX A;  2FPL A;  5KFH A;  5DLF A;  1NJZ A;  2FMS A;  4YQW A;  3PVX A;  5KFC A;  2DR5 A;  4IG8 A;  5HRF A;  3AQN A;  1RZT A;  4KLJ A;  3IM1 A;  3PML A;  4KIT B;  2W9C A;  2C2E A;  4Z6C A;  4MFA A;  4ECZ A;  4UB4 A;  4WC7 A;  3BQT A;  3GV5 B;  1TFY A;  3H39 A;  4ED8 A;  4RWQ A;  1B43 A;  4RU9 A;  3WFP A;  2DRA A;  1S76 D;  1PX5 A;  4TQR A;  4KLI A;  4ED6 A;  9ICU A;  4M2Y A;  5DKW A;  3G6X A;  4RPY A;  3N4M B;  3GQC A;  3BDP A;  1NK8 A;  2HHS A;  4C8L A;  3PR5 B;  4R64 A;  1T8E A;  4I28 A;  5J0W A;  2M2V A;  1MQ3 A;  4ECT A;  4PGQ A;  4DSE A;  4WC5 A;  3GIJ A;  4KLM A;  3C2M A;  4M47 A;  4B9U A;  3TAQ A;  2VA8 A;  2BPC A;  4DFM A;  3RJI A;  8ICI A;  4RQ5 A;  5L1L A;  4ATB A;  4I2D A;  3LWM A;  2W8L A;  9ICQ A;  3ORY A;  2FLL A;  4F5P A;  3ZDA A;  4KLH A;  1SL1 A;  4M0A A;  1A76 A;  2FPK A;  4JUZ A;  5KFJ A;  3AU6 A;  2JEG A;  2HVI A;  1KSP A;  4F50 A;  2OWO A;  4J9R A;  4P2H A;  2AQ0 A;  4O5C A;  1L3U A;  5J2J A;  4J9O A;  4DQI A;  1Z3E B;  1B22 A;  2ZHA A;  3H8J A;  1ZQB A;  4YFK A;  4WC2 A;  4PGY A;  5CWR A;  4DQQ A;  3RH6 A;  4YXM A;  4X4O A;  7ICL A;  4UAZ A;  2BCS A;  5DGA A;  1NJY A;  4KLQ A;  4JK1 A;  1Z00 B;  5KFA A;  1Q78 A;  1XU4 A;  5KFQ A;  5D49 A;  1ZQN A;  5HMM A;  5L1J A;  1QTM A;  4KLS A;  4M5D A;  1JXL A;  5HML A;  4EBJ A;  4S3N A;  4WCW A;  1S0O A;  7ICT A;  3RH4 A;  4YN4 A;  3MGH A;  4O3R A;  4I2J A;  1V4A A;  3RH5 A;  5HRL A;  5IIN A;  3EWA A;  3Q8L A;  4JWN A;  2B21 A;  1JAJ A;  5KT6 A;  1Y88 A;  1S10 A;  2JZB B;  1IXR A;  1NJX A;  2J6T A;  1XSN A;  5DDY A;  4QZF A;  2P6U A;  2V9W A;  8ICC A;  2BE3 A;  9ICK A;  3PW5 A;  2C22 A;  3M8S A;  2Q66 A;  4WC1 A;  4EBK A;  4LT6 A;  5TZV A;  4GC6 A;  2PFO A;  7ICR A;  4PGX A;  2NRX A;  4DSJ A;  8ICE A;  2H5X A;  8ICW A;  4DL6 A;  4I27 A;  3H3A A;  4UB2 A;  2XY7 A;  3MR6 A;  4TQS A;  8ICO A;  2IMW P;  2C28 A;  4P4M A;  4DL7 A;  9ICW A;  5KFV A;  5L9X A;  2W9B B;  3T5J A;  1X9S A;  4RT3 A;  1NKC A;  5JUM A;  4X0B A;  2P66 A;  5J0T A;  4FHP A;  4R8U B;  4PHE A;  2HHT A;  3Q8Q B;  1JXE A;  1ZQV A;  4IRC A;  4KLU A;  4QWB A;  1DGS A;  3LWL A;  2PFP A;  2HHX A;  3ZDC A;  2ZTC A;  4FHV A;  2ASD A;  4AT9 B;  3OVB A;  4M9H A;  1K1Q A;  5KFX A;  3MR5 A;  7ICG A;  8ICV A;  4YVZ A;  7ICN A;  2XCA A;  4I2E A;  1TFR A;  4EBE A;  4EYI B;  4Q45 A;  4ECQ A;  4QWC A;  4UAY A;  4X4U A;  1NJW A;  4M9G A;  5KFY A;  3MGI A;  4EBC A;  4J9S A;  2ZH4 A;  3V6H A;  2FLN A;  4ELU A;  4JV1 A;  5J0O A;  8ICU A;  3V7J A;  4RQ7 A;  5CP2 A;  4B9V A;  2ZTD A;  1SKR A;  2KN7 A;  4Z6D A;  4DL2 A;  1LB2 B;  5KG1 A;  3EPG A;  3RJJ A;  4LVS A;  4KMU A;  4DEZ A;  4XQ7 A;  1KLN A;  3RJG A;  3IHQ B;  4RUC A;  4J9M A;  1RYR A;  5KFL A;  2DR8 A;  2ZJA A;  1XWL A;  4BXO B;  4P4P A;  4NLN A;  1F5A A;  3OHA A;  4RWO A;  5F2V O;  4DLE A;  4BDP A;  8ICL A;  1TK0 A;  4I2C A;  4F4Z A;  1L5U A;  2ZJ5 A;  5J2F A;  3GIM A;  2PXI A;  2AGP A;  1ZJM A;  5J2A A;  4TUP A;  4KLE A;  1QSY A;  4BWM A;  2R8H A;  1NKB A;  2NRW A;  1ZQI A;  3MFH A;  3C5G A;  3QZ8 A;  4NXZ A;  1ZQO A;  1XC9 A;  4NY8 A;  4FBT A;  5J2E A;  9ICP A;  4YR0 A;  3E2E A;  2BPF A;  5HRG A;  3HPO A;  4IQU A;  2ATL A;  1TK8 A;  4ECY A;  3NYB A;  2MAX A;  3OSN A;  5HRB A;  1R8A A;  2NRK A;  3V6K A;  4M04 A;  4ECV A;  2V4R A;  4DQS A;  1UA0 A;  1HUO A;  2ZH6 A;  4FH5 A;  4DF8 A;  4J9P A;  2BR0 A;  4K4H A;  4E0D A;  3JPO A;  4RNO A;  4QZ9 A;  3V72 A;  3QEB Z;  1V9P A;  3FDS A;  3MBY A;  4O0I A;  3QE9 Y;  5CHG A;  1U45 A;  1ZQS A;  4O5K A;  9ICO A;  5KT3 A;  4DLG A;  1ZQK A;  7ICQ A;  4I2I A;  2AGO A;  4UAW A;  3ZD9 A;  1ZQC A;  4DSF A;  3LK9 A;  9ICT A;  4DSI A;  4DOB A;  4PH5 A;  5KG7 A;  2XO7 A;  4GC7 A;  4FBU A;  3GIK A;  9ICG A;  8ICK A;  2NRT A;  2NRZ A;  4FS1 A;  4QZD A;  5J0Y A;  2HHP A;  3C66 A;  2O5A A;  1ZQW A;  3OGU A;  1NK5 A;  4BXO A;  4NLG A;  2R8I A;  3RR8 A;  1DK3 A;  5J2D A;  1ZQZ A;  5KFP A;  4RQ6 A;  2C2D A;  3RR7 A;  4YXJ A;  4F2R A;  4J9Q A;  3UXN A;  7ICO A;  5KFZ A;  4GXI A;  3T5H A;  1T3N A;  1ARO P;  1UT5 A;  4MF8 A;  4QZB A;  4X4R A;  3BQ1 A;  3PX0 A;  4ED2 A;  4DF4 A;  2RFF A;  5IIJ A;  8ICB A;  4UB3 A;  4RQ4 A;  1IM4 A;  4TUQ A;  2ZH5 A;  2KZM A;  4KLG A;  2BCU A;  2UVU A;  4E8F A;  4F5R A;  4M9L A;  8ICJ A;  4RWN A;  3JPP A;  2JEF A;  2ASL A;  1ZQL A;  2R8G A;  4F8R A;  5HRI A;  3UQ2 A;  2DVI A;  2PI5 A;  1JN3 A;  4KLO A;  5KG3 A;  4KLL A;  4AT9 A;  3RTV A;  4X5V A;  4F4W A;  2UVW A;  3TAP A;  9ICF A;  3Q8R B;  4KLF A;  3WFQ E;  4MFF A;  3H4D A;  2ID1 A;  1UET A;  4I29 A;  4ECR A;  1MQ2 A;  4YMO A;  3OUY B;  1SL0 A;  1RYS A;  3JPT A;  1BVS A;  3H38 A;  4LZD A;  3ZD8 A;  3NTU A;  1NK9 A;  2IHM A;  2RDI A;  4Q43 A;  2BGW A;  3ZDE A;  5KFD A;  3H40 A;  1NKE A;  4IR9 A;  5J0S A;  3HJ4 A;  1ZQM A;  3JPQ A;  2ALZ A;  4UD4 A;  4R65 A;  4DSK A;  2VA3 A;  5DB9 A;  4ED1 A;  5III A;  2PI4 A;  4C8O A;  2W9B A;  4C8N A;  2ZH3 A;  1BPD A;  4UBC A;  4EZ9 A;  4UD5 A;  2XGQ A;  5HRD A;  3TAN A;  4WC6 A;  4F93 B;  2O1P A;  1L3S A;  2ZH2 A;  4B9N A;  4ECS A;  4DL4 A;  1BPX A;  3GII A;  3PO4 A;  8ICY A;  7ICH A;  8ICN A;  5J2C A;  3KHG A;  4DFP A;  4ED3 A;  1BGX T;  5KG0 A;  3C18 A;  4J9L A;  1ZJN A;  4MFC A;  3LDA A;  1UEV A;  1U49 A;  4O3S A;  2HVH A;  4M9N A;  1FA0 A;  5CJ7 A;  3MR2 A;  3ISC A;  3RRH A;  3Q8K A;  7ICV A;  4XA5 A;  2ZH7 A;  4UB5 A;  4NLZ A;  3SZ2 A;  8ICS A;  2ISO A;  2W9A A;  5KFT A;  4RQ3 A;  3AUO A;  5J2I A;  3OSP A;  1D9D A;  4YCX A;  3H37 A;  8ICM A;  4RNM A;  2MUT A;  4QWA A;  3FYH A;  1KFD A;  1ZQA A;  1A77 A;  2ZUD A;  5IIL A;  4YMM A;  4MF2 A;  3PMN A;  4I2A A;  4RUA A;  1BPE A;  4QWD A;  1Z00 A;  5J2B A;  3Q8S B;  1N48 A;  3PNC A;  1ZQE A;  4C8M A;  3BJY A;  3RJK A;  3SYZ A;  4DL5 A;  4RZR A;  1KRP A;  4QZH A;  4EP7 A;  4KN4 A;  4RNN A;  2PFN A;  8ICP A;  1WCL A;  2HW3 A;  5KFI A;  5KTQ A;  5J0X A;  4BWJ A;  4DS5 A;  1KFT A;  4X4S A;  2DFL A;  1Q79 A;  4O3N A;  3RB0 A;  1D8L A;  1EXN A;  2BCQ A;  1ZQQ A;  2GWS A;  4MEX A;  5F9N A;  3C21 A;  1PZN A;  3T5L A;  2AGQ A;  5IIO A;  2FPM A;  3GV8 B;  4M6W A;  4RPZ A;  4TUS A;  3EZ5 A;  2AQ4 A;  3K75 D;  4EZ6 A;  1NO5 A;  1ZQU A;  3TQ1 A;  4QZI A;  3OVS A;  3HW8 A;  2Y1I A;  4X4N A;  1ZQT A;  7ICP A;  4R63 A;  3TFS A;  2A1J B;  4GXK A;  3RB6 A;  5BOL A;  2W9M A;  2RDJ A;  1ZQG A;  1BNO A;  4Q8E A;  1QLN A;  5D4B A;  5DQI A;  4LZG A;  3UXP A;  3PV8 A;  1XSL A;  4I2B A;  9ICB A;  5DEC A;  4WC0 A;  9ICM A;  3KTQ A;  3LQC B;  4F3O A;  4IRK A;  5KG2 A;  2ZUC A;  1S9F A;  4FS2 A;  5J0U A;  3MR3 A;  1UEU A;  2ZH9 A;  3M9N B;  3B0Y A;  3MDA A;  1SKW A;  5J2G A;  4R66 A;  3AQK A;  3T5K A;  4BGD A;  3OVA A;  2W8K A;  4DS4 A;  5DQG A;  5DB7 A;  4Z6E A;  4QW9 A;  3AQM A;  2BQU A;  4WC4 A;  3C1Z A;  1K1S A;  5HRE A;  2BDP A;  2BCV A;  4GXJ A;  3PW0 A;  2ZH1 A;  3H7I A;  4UB1 A;  3G6Y A;  3C2K A;  4QZA A;  3M9M B;  1U4B A;  2WTF A;  4AT7 B;  2DR7 A;  3H8W A;  4IR1 A;  1JIH A;  3EYZ A;  3TFR A;  1ZQD A;  5J29 A;  5EWE A;  5KFM A;  2IBK A;  3RAQ A;  3PY8 A;  5HHH A;  1XSP A;  5KFK A;  3SI8 A;  4JWM A;  5KFR A;  3NGD A;  3BQ0 A;  5BOM A;  8ICT A;  1D8Y A;  1NK0 A;  3PX4 A;  1CUK A;  2BKE A;  3UXO A;  4NM1 A;  3TAR A;  9ICE A;  1ZQF A;  2KZZ A;  4Z6F A;  1U47 A;  3HJ1 A;  2BQ3 A;  3L9D A;  3JZ0 A;  3C23 A;  5KG6 A;  2ASJ A;  2I9G A;  4YMN A;  1KEJ A;  5J0R A;  4ELV A;  3UPQ A;  1BPB A;  2F1H A;  1XO1 A;  5C5J A;  4TUR A;  4ECU A;  4QW8 A;  4JV0 A;  4PHP A;  2XC9 A;  3HX0 A;  9ICC A;  1N56 A;  4E80 A;  2ZH8 A;  5HR9 A;  4DFJ A;  2ISP A;  4X0A A;  4X4Q A;  3GV7 B;  3RJE A;  4RT2 A;  2A1J A;  2J6U A;  2AJQ A;  3RJH A;  4Q8F A;  4B9S A;  2JEJ A;  1T4G A;  2XCP A;  2F1J A;  9ICH A;  8ICH A;  2F1I A;  5KFB A;  3G6V A;  9ICV A;  8ICA A;  3SV4 A;  5KG4 A;  5KFS A;  5CR0 A;  4KTQ A;  2UVR A;  3JPS A;  4DQP A;  1TV9 A;  1BPZ A;  1SZP A;  3HWT A;  3MAB A;  4K4I A;  3GFK B;  8ICQ A;  3V6J A;  3RB3 A;  4I2H A;  2M2W A;  5HP4 A;  7ICS A;  4AT8 A;  4WC3 A;  5DB6 A;  4EYH B;  3THV A;  3RBD A;  4G3I A;  2M9N A;  5J0Q A;  3V7L A;  5L1I A;  4J9K A;  5L1K A;  2XY5 A;  1ZET A;  1JQR A;  3UQ0 A;  4ECX A;  1TKD A;  3ISD A;  4ED0 A;  2DPI A;  2P6R A;  4IQT A;  7ICI A;  8ICR A;  1DK2 A;  3PW2 A;  5HHI A;  5DBC A;  3PR4 A;  4E7X A;  2DRB A;  4QZE A;  5CB1 A;  1C7Y A;  1ZQH A;  2XGP A;  1SL2 A;  1LV5 A;  3C2L A;  1MIV A;  4DFK A;  4F91 B;  3BQ2 A;  3GDX A;  4KLD A;  4YR2 A;  4O3Q A;  1NZP A;  4P4O A;  3PX6 A;  4K4G A;  4DSL A;  2IHN A;  2V4Q A;  4F4Y A;  2W9C B;  3PW7 A;  4F92 B;  2HHV A;  2FLP A;  4NLK A;  1JMS A;  7ICJ A;  2NRV A;  5KT2 A;  1MIY A;  3JPN A;  3SV3 A;  4QZG A;  8ICG A;  3WFS C;  2BCR A;  1L3V A;  2ZTE A;  5D46 A;  2R8J A;  9ICL A;  5J2K A;  1UA1 A;  1KFS A;  1ZQR A;  3ZDD A;  4ELT A;  4DQR A;  5KFU A;  2I1Q A;  5KFE A;  4YR3 A;  2HHQ A;  3HP6 A;  4PHA A;  1BNP A;  4X4P A;  5EWG A;  2VA2 A;  1UT8 A;  2Q0Z X;  2M2U A;  5HRH A;  1MIW A;  1DOQ A;  5DBB A;  4WBZ A;  5DG7 A;  3HIY A;  3KHL A;  4DOA A;  4F5Q A;  1KDH A;  3ISB A;  2MUT B;  4NKT A;  3C1Y A;  2HHW A;  4R8U A;  5DLG A;  4J9N A;  4RQ8 A;  4YD2 A;  4EEY A;  4M9J A;  7ICU A;  5DGB A;  4DO9 A;  7ICK A;  3RRG A;  1KTQ A;  1S0V A;  4M6W B;  2BHN A;  1R8C A;  4NKU A;  5KT7 A;  1R89 A;  4RQ1 A;  4AT8 B;  1RPL A;  1VFG A;  5F9L A;  4O5E A;  3ZDB A;  1TFW A;  2ZJ8 A;  5HNK A;  1CEZ A;  2PFQ A;  3OJS A;  4I2G A;  4F4K A;  5KFN A;  5KFW A;  4EBD A;  4ATB B;  9ICX A;  3OHB A;  4XQ8 A;  4ECW A;  3JYY A;  4IRD A;  9ICN A;  1KNY A;  2Y1J A;  4F4X A;  1SKS A;  2J6S A;  1TK5 A;  4CCH A;  2KP7 A;  3OJU A;  4PPX A;  7ICE A;  5CA7 A;  1NK4 A;  4MEY A;  1TVA A;  4F2S A;  1HUZ A;  4QWE A;  4F5N A;  2VAN A;  1S77 D;  2KFN A;  5DG9 A;  8ICX A;  5DED A;  2FMQ A;  4FHW A;  5DQH A;  3KHH A;  3Q8M A;  2UVV A;  4RPX A;  1OU5 A;  4XUS A;  1WOT A;  3B0X A;  1TAU A;  3EPI A;  3TI0 A;  1ZQP A;  4B9L A;  1X2I A;  5KFG A;  8ICF A;  3RBE A;  1NK7 A;  9ICI A;  4XRH A;  1WCN A;  5DDM A;  1YLQ A;  4O9M A;  4C8K A;  9ICR A;  2ZHB A;  2M2T A;  3MDC A;  4DWI A;  4IQW A;  1HJP A;  4UBB A;  1ZYQ A;  1NK6 A;  1R8B A;  5DG8 A;  3H4B A;  4NM2 A;  2KTQ A;  5KFF A;  4Q44 A;  5IIK A;  2PBE A;  4GLX A;  1U9L A;  1QSL A;  4KN7 A;  2AU0 A;  7ICF A;  5IIM A;  1T7P A;  2ZUB A;  5DB8 A;  4DL3 A;  4WBY A;  3QZ7 A;  3UPS A;  2JZB A;  3GIL A;  4B9T A;  4O3P A;  4ED7 A;  4UQG A;  3RB4 A;  1S97 A;  4JV2 A;  2KFZ A;  3MFI A;  4FO6 A;  5BPC A;  3Q8P B;  4X4T A;  1RXW A;  3ETL A;  5KT4 A;  3QEA Z;  4YG2 A;  4DOC A;  2DPJ A;  3RJF A;  2HHU A;  5EWF A;  3AQL A;  5J2H A;  3PO5 A;  9ICA A;  4YD1 A;  1XS9 D;  4FHY A;  3K4G A;  1S0M A;  1S0N A;  1VJ7 A;  3EW9 A;  2JEI A;  5J0P A;  4RWP A;  3HT3 A;  4HYK A;  4FHX A;  1X9M A;  7ICM A;  4PHD A;  8ICZ A;  4O3O A;  3V7K A;  3T3F A;  1MSW D;  1MC8 A;  3N97 B;  1D9F A;  9ICJ A;  1TAQ A;  3WFR E;  4IQV A;  1NOM A;  3KHR A;  5HC9 A;  2DR9 A;  1X9W A;  5HRK A;  1U48 A;  1RXV A;  4RQ0 A;  3M9O B;  1L3T A;  2FMP A;  3OUY A;  2C2R A;  3AU2 A;  2BQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...