5DD4A

Apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
221
structure length
221
Chain Sequence
YSSNPTFYLGIDCIIFGFNEGEISLLLLKRNFEPAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGAFGAIDRDPGERVVSIAYYALININEYDRELVQKHNAYWVNINELPALIFDHPEMVDKAREMMKQKASVEPIGFNLLPKLFTLSQLQSLYEAIYGEPMDKRNFRKRVAEMDFIEKTDKIDKLGSKRGAALYKFNGKAYRKDPKFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel transcriptional regulator of L-arabinose utilization in human gut bacteria.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Transcription regulator
molecule keywords TRANSCRIPTIONAL REGULATOR AraR
total genus 55
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dd4A02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5dd4A01
1SJYA 4NB5A 2P5VA 3TDUC 5BS6A 3G73A 4M6YA 3F6AA 1ZHFA 2KIFA 5FSIA 4O5VA 3TOAA 3VFZA 4KG4A 2W57A 5K5OA 1R5HA 3I59B 2YSRA 1YIOA 3CNGA 4KIGA 2TDXA 4L9JA 3JAMZ 2Q9PA 5L3BA 1HKSA 5LHHA 1IZ1A 1WQ2A 4R79A 3M1EA 5C8LA 3JAMK 2V79A 2XKPA 1LNWA 2P7CB 3DFGA 3SHFA 1YS7A 1OPCA 3DF8A 3W6KB 2PI0A 3P6YA 3R60A 2XVCA 4S2WA 1USSA 4EJOA 2NNYA 4OMZA 1K2EA 2FBHA 3HYIA 3J80K 1R00A 3CDHA 3RKWA 3KCCA 4I01A 3ID9A 1CF7B 4JZUA 5LEKA 1S7OA 1J7KA 2NNNA 2HQRA 1S3JA 1ZLJA 4G6DA 3HSEA 1SOIA 2GZWA 3R61A 4CZZA 5K5RA 1PVFA 3JW4A 1B6AA 1Z6TA 1ONVA 2RV8A 2ZBKA 1TW3A 2D45A 4KN4X 4JZTA 4U0YA 4RB2C 3BAPA 1MJAA 1XN7A 1KHZA 1IXSB 4RAYA 2NS0A 4KN7X 4QLCU 5ICFA 3DPTA 4FT8A 2ZNZA 3E97A 3LFKA 3DKWA 5HLIA 3IKTA 1SU2A 1L3LA 1PUEE 5LRRA 5HDNA 4ENJA 3I64A 5DUKA 3K0LA 1IN6A 4P55A 1XGOA 1KQ8A 4L0ZB 5GHMA 4IRHA 2PJPA 2ZCWA 1V4RA 3GZ6A 2BEOA 2OZ6A 2R7DA 2KRFA 5LHIA 1PPXA 4PGHA 2O5WA 5HVQC 3SHDA 4IJXA 5GHPA 2A6HF 5AONA 2LF7A 5ED4A 1YW7A 2HDCA 5ILUA 1SZ3A 3U2RA 3TKYA 1ZGJA 4A2UA 4UUVA 1PP8F 3FJYA 4B8XA 1ZAOA 2Q0OA 3CUOA 2ZMEB 3R6SA 2Z3YA 4L18B 1T38A 2E1NA 3BPVA 3IRQA 5E1XA 1J9IA 1SMTA 3E6MA 1MJBA 2FF4A 2Z5UA 4A0XA 3EYYA 4LK1F 1L0OC 2H6BA 2CW0F 4Y17A 4HX8A 3HUGA 3KVHA 1B9MA 2XGXA 4AVPA 4JZSA 2KJCA 1TUMA 2OQGA 4A5MA 4IHTA 2PEXA 1SD7A 1QGPA 4BNCA 3MAJA 4HQEA 4FHTA 1ZGAA 5F6FA 2IA0A 5IW5A 3BROA 5FGMA 5E17F 3HIFA 3E6CC 2A8TA 1R1TA 4CGZA 4WWCA 3Q2TA 1ON1A 1V8WA 1FOKA 3MEXA 1F3YA 4HX4A 1P6RA 2D2WA 5D4SA 3B02A 1XD7A 2FNPA 1PUNA 4LG0A 4R1HA 2EFNA 3HHHA 3MDGA 2MH9A 2FE3A 1KYWA 1YFHA 2HYFA 4XBFA 1U78A 2R3SA 5ICCA 1R23A 3K2ZA 3GVAA 3WGIA 4LLLA 3COAC 1FYLA 2UZKA 4BYYA 4RS8A 1V8MA 2NYXA 2UWMA 1HQCA 1D8JA 1LDJA 4EGYA 1PDNC 1MQWA 1GVJA 2ADUA 2JSCA 2KIUA 1TBXA 3EXQA 5HLHA 3O3KA 4KMUX 5L3FA 2G7HA 2FRHA 4YIIA 2AS5F 5FSLA 2STTA 2QBYB 5DUIA 5GHNA 4EM2A 1HW2A 3EEUA 2VN2A 4XRFA 3FWEA 1AOYA 3A6SA 1YW9A 1B59A 1MJ9A 3V8LA 5K1YA 4XSZF 4UV8A 1HKQA 2MBFA 2HGCA 2VODA 1FLIA 1VTNC 1DPUA 5CVRA 5ILSA 3IWZA 4V14A 2V9VA 3FK9A 5FSMA 2HKOA 5L3DA 3LWFA 3ISPA 5E8IA 3FFUA 3BDDA 3CUQA 2G74A 3N9UA 2L4MA 3R0JA 4NQWA 5ICGA 1VK6A 2XROA 4N9HA 3ZR1A 4OIOF 2VNQA 2O03A 1S7AA 3F3XA 3O52A 4RB1A 4KIFA 3F8FA 1YO5C 3Q9VA 2GT2A 2FOKA 4UVAA 2M30A 4G6QA 3V4GA 1BOAA 2P5KA 1MQEA 5FFXA 3BY6A 4KICA 4ZYDA 4G94A 3CUQC 1BI3A 2XAFA 3NRVA 1W7PB 3N97A 1NQZA 2YU3A 1G3WA 5EEHA 2B06A 3WTSC 3ZMDA 2YX4A 1FBQA 5D6EA 1IN5A 4RGRA 1WKMA 3LQQA 4ZG0A 1PPWA 1OYYA 3NEUA 1U3EM 3T5XA 2L3DA 3HSFA 1LVAA 4RB0A 1Z7UA 4PGGA 4LFUA 1FY7A 3H3ZA 5HLGA 1IXCA 3BM4A 2G73A 4UVBA 1V8UA 1KA8A 3TO9A 2DAOA 4M6XA 1U20A 1IUYA 4IPAA 1KU2A 2STWA 1GHCA 4BH9A 3LA3A 4ON0A 2A6EF 2MLGA 3HHJA 5LRSA 4KNYA 2HR3A 1V8RA 3X0NA 4BQAA 2XV4S 4P9FA 4Z2YA 3I59A 3BZ6A 2DSDA 3OOPA 1KYZA 2FU4A 4YPHA 5IT3A 2QKMB 4GYIA 4CHUA 4JBAA 4LLGF 2A8PA 4EV0A 2COMA 1ZH5A 2L02A 3DQVC 4KIBA 4ZYHA 3RI4A 1I1GA 4HLXA 1HW5A 2VBZA 4I0BA 2VT3A 2QLZA 3X0PA 1BIAA 1QZZA 4L5JA 2XAJA 4U88A 1OYWA 3GW2A 4I2OA 1RNLA 1R67A 2HEOA 2JRTA 3K1MA 2UXNA 3BWGA 4WX9A 1J5YA 2CL3A 1U5TC 4NFWA 3GG6A 4GYGA 2EFQA 5DCFA 3SZTA 1SFUA 1MDMA 3VODA 4HAMA 4G7OF 3K1PA 1RUNA 2O0YA 2X4HA 2M45A 2DU9A 3ZMSA 3K69A 2OBPA 3GZ5A 5DD8A 3FMRA 3WU1B 1HSTA 4HDUA 2FBIA 2DQLA 2ICJA 5BPDA 4TV7A 4IVNA 4XSXF 1TNTA 1LDKB 2CG4A 4OMYA 3X0OA 4EJWA 3LQRA 2BV6A 3IC7A 4M9SA 2HFHA 2ESNA 1Z6RA 1DP7P 1U6GA 1YS6A 1FBSA 4NFXA 3VOEA 4ZH4F 2J5PA 2RVCA 5J8FA 2PBIA 2DK8A 4EQQA 3P9CA 2QQAA 1VHZA 3GYHX 3O61A 3WHWA 3V7SA 2WTEA 4O3MA 2VBYA 3C18A 2F5FA 2DI3A 3QOPA 4YIFA 3OGAA 3KEQA 1XCVA 1R5GA 3FMSA 4AIJA 5CVVA 4KT5C 1FX7A 5D5XB 3KLNA 3I7VA 1CF7A 3ZN0A 1USTA 3DKUA 5D5UB 3X0KA 2X0LA 1V8NA 2A68F 1RYAA 1X3UA 3H92A 2IPQX 5L3CA 2EK5A 2I6KA 1D3YA 1C0WA 3HRUA 2PMHA 3ULQB 2FQ3A 3EQLF 1O57A 4IF4A 5ERIA 4DNCA 2V1DA 5A2QZ 3RH7A 4HV6A 1REPC 2ESHA 1JXSA 3U1DA 3WTYC 1KT9A 3M8EA 1BI0A 4YFXF 3FM5A 1EH7A 3X0RA 4G7ZF 5FB2A 5CVJA 2KDWA 4XLNF 1HZTA 3BJAA 5CJ9A 2IJLA 1BJAA 3PQKA 4P5OA 2MH2A 5JHUA 4EM0B 3L7WA 3KFWX 4MQVA 2K27A 1W5SA 2GAUA 2VBXA 4CICA 2PQVA 2W4EA 1BN5A 4Q4ZF 3WODF 3KP7A 1U5TA 4KYWA 2EB7A 3RKXA 1UHWA 3KZYA 3P9IA 2WWYA 1B9NA 1XSVA 5FLXK 4CYDA 3GLXA 1Z91A 3KE2A 4OOIA 3SMDA 2OD5A 2F2EA 2DPDA 3ZR0A 3ELKA 4OIRF 5GHOA 2PFBA 3KP2A 2K4BA 3W6JB 1V8VA 2JPBA 5ANUA 3C1DA 1RUOA 1BC7C 2F5EA 4WK8F 4YG2F 2QJOA 4Y15A 2DQRA 4ILQA 1I27A 4KYXA 2G7UA 2P8TA 3QU6A 2CO5A 3EYIA 3F8CA 2DT5A 3VEPA 5IT9K 1F1ZA 1I9AA 4Q48A 5C7TA 3KLOA 3SXYA 3SFZA 4HDVA 4GO1A 4RGSA 4L5IA 4M9XA 2YVPA 5LPGA 2FNAA 4HVYA 1XDUA 5HOOA 4UNOA 1BM9A 2R5WA 1YW8A 2A3SA 2EV6A 4GGGA 4MGRA 5E1ZB 3FZVA 1W7PA 3CJNA 2PMUA 1R22A 3E6DA 3A6VA 5IW4A 2F5DA 4D0PA 4EM1A 3ZN1A 2GWRA 1UB9A 3M9AA 2A8RA 2DHOA 4IJAA 3CUQB 1QVJA 3KP5A 1LJ9A 4OIQF 1OW2A 1CGPA 3E5XA 3FF5A 4M73A 3WTXC 2RRKA 2FMYA 4KDPA 5CVUA 3H3UA 4GCVA 1MZBA 5FLXZ 5BOXA 4ENKA 1ZN2A 1RI7A 3B73A 1I6XA 3F23A 1BI2A 5E8GA 4HW0A 3J80Z 2LNBA 1FSEA 1P4AA 4MHGA 5K5QA 1V8IA 2QBYA 3ML6A 4MQ9F 3ACAA 3GUDA 5I8UA 1ULYA 5CFJA 2ZFWA 5DDGA 1VIUA 3F8BA 1JKNA 4WF2A 4YPRA 2QJTA 4R8HA 1G4DA 2PG4A 2HYGD 2RGVA 2ZMEA 3T0YA 4U0VA 3REOA 4KG3A 3RKYA 4PCQA 1V3FA 4JZVA 3M7GA 4Q5SF 2H09A 1IRFA 2YVMA 2P6SA 5TRDA 1XSBA 1LB2A 3MGMA 3KZZA 1QO0D 3O69A 3OV8A 1JHFA 3D0SA 2GXBA 1SFXA 4YFKF 3MFKA 4G9YA 3FMQA 3J7AO 2K4JA 3Q9SA 4C9WA 5D6FA 2JTVA 4AWXB 3Q91A 4M72A 2ISZA 1PUSA 1S8NA 1XSXA 4HYEA 3WTTC 4K6EA 4WCGA 3GFLA 2G9WA 2P5LC 1LDDA 1QPMA 1R36A 1IRGA 2YR2A 3IRRA 2O61A 2J5OA 4ENMA 5D5VB 3ZMVA 3CO6C 1K78B 1KU7A 2AZWA 1NFSA 2GA1A 2VC1A 2ZJ2A 2HTSA 4S04A 3N77A 1WI9A 1OMIA 2YX7A 1TTYA 5F1RA 4LG0B 3GF2A 2V1UA 5H20A 2B2KA 4HA8A 1UFMA 3KP3A 2DUKA 2QQBA 1IRYA 3ECHA 4I7HA 3BP8A 2RC4A 4LJZF 4LD5A 2FSWA 1B4AA 4HQMA 1P2FA 2XSQA 2A8QA 3MZHA 3R0AA 2L4AA 4M74A 4NHJA 4CDGA 3MZYA 2Y0MA 2P4WA 1ZLKA 1Z05A 5HS7A 1E2XA 4HBLA 1PP7U 2H6CA 1PPVA 2VOPA 2YPRA 1KGSA 3SZPA 4H0EA 3BPXA 3LAPA 4LLNA 2RDPA 1T0FA 1ZG3A 3MCZA 5HS9A 3F6OA 5GHJA 3WTUC 2DBBA 3AC9A 3ZPLA 1Q33A 2XUBA 1GXQA 3SQNA 1YTYA 2FBKA 4HOBA 4N9IA 1T6SA 2HZTA 2ETHA 5CFIA 2K86A 3ZMUA 5DCMB 3JSOA 3PFIA 5HZXA 2BBYA 4A5NA 5CLSA 3C7JA 3J81K 2FEZA 3EF5A 1IN4A 2KKOA 4Q47A 3QSJA 5FD6A 2EJRA 3IKVA 4A6DA 3F8NA 1OYIA 3WU0A 2DTRA 2QVOA 5FD5A 1UCRA 1Q27A 1XGNA 4KMFA 3FXUA 3RYRA 1I5ZA 5JFRA 1PUQA 2W84A 2HS5A 3A6UA 3R4KA 3O6ZA 1TQMA 4A12A 4MTDA 3CO7C 3DV8A 4HF1A 5BONA 3RTRA 4ZYEA 2EFWA 3O2PE 2CQKA 2O6GE 3E5QA 3H95A 5HDGA 3TO6A 1QBJA 2PNYA 2Q2EA 3QAHA 3HRMA 1QQIA 2JT1A 1MK1A 1ON2A 1J75A 2AXLA 1ZARA 5TJJA 3CLOA 2R7FA 4HZFA 1HX3A 1IW7F 3Q1PA 3F21A 5DYMA 2P7VB 3V8KA 4UVCA 4YFNF 2H27A 1T39A 3P5TA 2A5YB 4MEYF 2A61A 3GO5A 1SD4A 4E70A 4CXFA 2DSBA 4WXCA 1Y0UA 2ISYA 3FHZA 3WE3A 1MP2A 2RKHA 2E1CA 3GFIA 3SONA 3Q2SA 3ABUA 3HOSA 1KQ0A 2RN7A 3G0QA 3IHUA 4BHPA 1R1UA 1P4XA 3WTZA 2EV5A 3F8MA 5F64A 3L9FA 1TQIA 1LEAA 1O7LA 3WE2A 4ENNA 3QRFF 1VIQA 4F7ZA 1HXDA 4P96A 3GZ8A 3BOQA 1V8LA 5J6XA 5CYVA 1VC8A 2LSOA 4L9NA 1F5TA 3EUHA 1B1BA 2XRNA 2O5FA 5LLQA 2J8QA 2LKPA 3V7CA 3QU3A 4WXHA 4ZYGA 2LDUA 2OU2A 1G0SA 1XCBA 4L9VA 3EETA 3E5UA 1YG2A 3F22A 3DEUA 3WTVC 4L0YB 1R7JA 4Y13A 1H9TA 2FA5A 3I4PA 3I9XA 1GXPA 4GXOA 1RZ4A 3X0LA 2FXAA 4I02A 4A6EA 3VB2A 5ANVA 2JZYA 3RPUA 4EJUA 3GWZA 5JVTA 2E7WA 1G6NA 4RGXA 1J59A 4MNUA 1XGMA 1NQYA 3J81Z 1ZG5A 1OR7A 1E17A 1P92A 2W24A 2XAGA 4UXNA 4N1TA 4DQ2A 5L3EA 2BYVE 1P4WA 3LSTA 2QQ9A 2W85A 1ZRCA 4PZJA 4KFCA 1MUTA 4AIHA 2MA3A 2IVMA 2YVNA 1YYVA 5H6RA 2K02A 2QZ8A 2BGCA 1EH8A 2E7XA 3RJPA 1D5VA 3HHGA 3KETA 3KP6A 5LGTA 4JK1X 4I09A 2IT0A 2PN6A 1FNNA 1TW2A 2RQPA 3I0TA 3GWYA 3RDIA 1Q1HA 1ZG1A 4U7BA 3HOTA 5BQTA 2Z9OA 2PLYA 1IXRC 1VRLA 4B09A 3TO7A 3I7UA 1VCDA 1FYMA 4XLPF 3T8TA 3GX4X 2GIVA 2OAZA 2XAQA 1T2KA 1X84A 4M71A 4LGWA 1G3SA 5DV5A 3FX3A 2FVVA 3D5LA 1R1VA 5H6QA 5GHIA 4MEXF 2FKBA 4CO8A 1NHAA 2P6TA 5DPKA 4LB5A 1KU3A 1HKTA 6PAXA 2DW4A 2QWWA 4UV9A 3C3WA 3I71A 1VHGA 5ILVA 5D5WB 3WGHA 3GXOA 1O3QA 1K7AA 4N1UA 1DPRA 1V8TA 1ZREA 1MKMA 2FMLA 4S2YA 2DFIA 1IAWA 4RGUA 3QPHA 1ZRDA 3MWMA 2BE5F 2HTJA 5E18F 2Q8KA 2VXZA 1GA7A 2NAZA 2DLLA 3A6TA 3E6BA 3JSPA 5FSKA 3L09A 3HSRA 4LMYA 2A07F 3X0MA 3GFMA 1JE8A 1MR2A 1U2WA 2QM3A 3DXJF 1WWXA 1FYKA 2KJBA 3ABTA 2LF8A 3DP7A 2HKXA 1JHHA 2XKOA 1BIBA 1FZPB 3P9KA 1Z9CA 4IXAA 4FX0A 4BHCA 5D8LB 1DUXC 4AD9A 3WG9A 4RB3C 3FM3A 5KK1A 3KEOA 5FSOA 3JTHA 4ESJA 1YLFA 4BHBA 3ZMZA 1KQ9A 5AIQA 5FSNA 2M87A 1IN7A 2VE9A 1QZYA 4G8XA 4BAYA 3KP4A 4EMSA 3F13A 2Y48A 1LQ1A 1WRJA 1XGSA 5GHQA 3ZP5A 3MCFA 4N0BA 1V8SA 5ICEA 5LGUA 2C6YA 1ZYRF 4OINF 4ICKA 1EH6A 1IF1A 2ACJA 4S2XA 5KVRA 2JVBA 4IRIA 3M8FA 4PDKA 3E3VA 3F72A 3I54A 1WSUA 1BBYA 4HLYA 5DCMA 2VNPA 2I8TA 1D8KA 2OZUA 3RYPA 1ZRFA 3J7Ye 2F5CA 4U0WA 1YQAA 1XDSA 1ODDA 3GEZA 3K9TA 2RNJA 5BMZA 3ERED 2EFPA 2O3FA 2ELHA 2HQNA 2DO7A 2CYYA 4DYWA 3QPTA 3TDZC 5L3GA 1KU9A 5ISYA 4EGZA 2YVOA 3DPLC 1V8YA 4HX7A 2L54A 3X0QA 5A2QK 3BJOA 4O6JA 3U9GA 1FBUA 3V8JA 4C9XA 3DUPA 2VC0A 3RIRA 3LAJA 3ROUA 1MGTA 1K6OA 4HFQA 3GFJA 1IN8A 1X83A 4ESFA 3I53A 4S05A 5D8KB 2PQ8A 3LA7A 5HDKA 3FCMA 3FSPA 5DD4A 2CFXA 4I0AA 4AIKA 3CTAA 1TNSA 1Z1DA 4A0ZA 2XAHA 4ASNA 1DDNA 1W4MA 3JTGA 2M8EA 4L9TA 3HTSB 2M5WA 4RAZA 1H0MA 1S29A 3X0IA 3X0JA 1K78A 2KIMA 3L00A 1K79A 2CSOA 4ZZDA 1FT9A 3RPQA 5ANTA 1EV7A 1MD0A 3O6BB 2MLKA 2IA2A 3HTUA 1HW1A 1XMAA 3MQ0A 2ICKA 1W7PD 4WXDA 1I1SA 2MD5A 1RIOH 2GB5A 2DK5A 3U53A 5C7QA 1J0RA 2XHKA 2Z99A 3EDPA 2EWNA 1QNTA 3FXQA 2I8UA 4M9ZA 2ZNYA 2A8SA 2L01A 2ZKZA 2KDVA 3NQOA 1FP1D 1F9NA 2MC3A 5E20A 2A69F 1JGSA 1MDMB 3HRSA 1XSCA 2A6TA 2IA1A 1OKRA 2CGPA 4BXUA 3PQJA 3AAFA 5LEJA 5BPIA 1TQPA 3BJ6A 3T8RA 4ETSA 2K7LA 2VBWA 2EV0A 4G7HF 4U7DA 4K2EA 3O8SA 5EEGA 1S6LA 5ANWA 4HF0A 1NFZA 1TLHB 1FPQA 3ZMTA 1JRKA 3I58A 2B0VA 3MDIA 3IWFA 5E1WA 2VOOA 4ESBA 2XASA 5JI6A 2VONA 3N4MA 3EESA 2DPUA 4YOQA 1O3TA 4I98B 2GT4A 5D4RA 3QP6A 3GRNA 2V1XA 4KUMA 5J8CA 5LGNA 5HS8A 5JR3A 1FP2A 2Z33A 2EA2A 3IL2A 1SMYF 2UXXA 4KA4A 1W5TA 3HYQA 1U8RA 2O8XA 3I5UA 3QP5A 3G3ZA 3V7RA 1SFEA 1T98A 5IT9Z 2IP2A 4EJVA 1XB4A 3R03A 1G9QA 1XMKA 1VC9A 1SAXA 1KTGA 1FWZA 4P9UA 1HBXG 4MPOA 1SD5A 1H9GA 4LB6B 1UHMA 2QUFA 4HF2A 2YYHA 1FC3A 3P7NA 4IHSA 1A04A 4EVIA 4IRGA 4JQFA 3ZQ7A 2QYOA 2Y75A 2GA2A 4QWQA 1HSJA 3COUA 2JPCA 3WGGA 1STZA 2ZO4A 2H94A 1SD6A 4KTBA 5LBQA 1F4KA 4OU0A 3X0SA 2VT2A 5FO5A 1R58A 2OQRA 1X51A 5CVIA 4LK0F 4OIPF 2D1HA 1G3TA 3Q93A 3K1NA 3L85A 3LA2A 4EJTA 3T1BA 2XIGA 4A0YA 3Q5FA 1AWCA 2ZXJA 1O3RA 2V6CA 3WTWC 4FX4A 4UHTA 1Q54A 1O7FA 3BHOA 1LEBA 1BC8C 1J2XA 1BI1A 2O1CA 1O3SA 2DSCA 3Q4IA 5DEQA 2HOEA 3ECOA 1G3YA 3HRTA 1K26A 2W25A 3TOBA 2D1VA 5AIPA 2OA4A 2EA4A 1XSDA 2GXGA 4MTEA 4S2VA 5FFZA 1XSAA 2NRAC 4HV5A 2EFOA 3TQNA 5LHGA 2IRFG 2WV0A 1RRSA 3L2CA 2IW5A 2HWVA 5ANSA 1RRQA 4ZZLA 2B0LA 3F6VA 2GQQA 2CWEA 3S2WA 3TGNA 1FSHA 1U5TB 2QENA 2VE8A 2WC2A 3E57A 2M1BA 3FXRA
chains in the Genus database with same CATH superfamily
3BR0A 1SJYA 1OCOH 3ERMA 3LMMA 3QYFA 4NB5A 4V2FA 3PSIA 3AL0C 2P5VA 3WG7H 2V26A 3IUOA 1TWGJ 4XKVA 4X1EA 3TDUC 5BS6A 4M6YA 4D7NA 3G73A 1OCRH 1LFUP 1ZHFA 2KIFA 3F6AA 3NAUA 4O5VA 3TOAA 5FSIA 3GTKJ 3VFZA 5K7FA 1ORKA 2KISA 1LE8A 2LYCA 1MNEA 5JLXA 4KG4A 2W57A 2W00A 5K5OA 1MNMC 1R5HA 1TC3C 2KL4A 4XRSG 3I59B 1XC5A 2YSRA 5EG0B 1YIOA 3CNGA 4KIGA 1P7JA 2DTZA 2TDXA 4L9JA 4LIUA 3JAMZ 1DU0A 1HDDC 3I4NJ 2HXOA 2Q9PA 5L3BA 1HKSA 5LHHA 1IZ1A 4BDZA 1WQ2A 4R79A 3RSNA 3M1EA 5C8LA 3K70D 2L7KA 2VJ4A 3JAMK 2V79A 4MO7A 2XB5A 2XKPA 1HF0A 1LNWA 2P7CB 2KRCA 3DFGA 3SHFA 5E3LA 1YS7A 5HNFA 2JA8J 1OPCA 3DF8A 3W6KB 2PI0A 3P6YA 3H5RA 5IPAA 3PJRA 3A01B 5J3LA 3R60A 2XVCA 2NVXJ 4S2WA 1USSA 4EJOA 2NNYA 4OMZA 2F5VA 1ITYA 1XPXA 1K2EA 1X1PA 3DKYA 2FBHA 3HYIA 3J80K 4QIWN 1R00A 3CDHA 4BY7J 3H3VK 3RKWA 3KCCA 4I01A 1WH5A 1QHGA 2XPUA 3B6AA 3JRBA 2OJED 3GTPJ 2VPRA 2LD5A 2ME0A 1RC9A 3ID9A 2BXYA 1CF7B 4JZUA 5LEKA 1D1BA 3OYHA 3JRIA 3K4NA 1S7OA 1J7KA 2NNNA 2HQRA 1S3JA 1ZLJA 4G6DA 4XLAA 1ETXA 1RPWA 2VKVA 3HSEA 1SOIA 5B3SH 2GZWA 3R61A 2E5NA 2K40A 1XG1A 4CZZA 5FKOA 5K5RA 1PVFA 1N75A 3JW4A 1B6AA 3DBLB 2E1MC 3CZ6A 1FIPA 5GAGJ 2HZDA 1MH4A 1Z6TA 2QCOA 1ONVA 2RV8A 2ZBKA 1TW3A 1K61A 2D45A 2LP0A 2CQXA 4KN4X 2PX9A 4JZTA 4U0YA 3RZDJ 2DMUA 4RB2C 2VPLA 2BHYA 3BAPA 1MJAA 1XN7A 4XLHA 1KHZA 1IXSB 3LSGA 4RAYA 4XORA 3ZQLA 2NS0A 4KN7X 4QLCU 5ICFA 3DPTA 4FT8A 3PO3J 4M3EA 2ZNZA 2IXSA 5FKKA 4F92B 3E97A 4BXXJ 3LFKA 3DKWA 5HLIA 2V9KA 1VQKI 3IKTA 1SU2A 1L3LA 4BGDA 1PUEE 2DT7B 5LRRA 5HDNA 1FTZA 2JSPA 4ENJA 4IHYA 5B1BH 4AC0A 3I64A 3J7AY 5DUKA 3OS0A 3K0LA 1IN6A 3I55I 4P55A 1TWAJ 1XGOA 1KQ8A 2E35A 1U8BA 4KITB 4L0ZB 5GHMA 4IRHA 2PJPA 2JVHA 3K4LA 4XLCA 1OR7C 2TRTA 2ZCWA 1V4RA 3GZ6A 1UG0A 2BEOA 2OZ6A 4XK4A 2R7DA 5IP9J 2KRFA 5LHIA 3OYCA 1XX5A 1PPXA 4PGHA 5EYRA 4DBQA 4EATA 1ZGWA 1MMSA 2O5WA 5HVQC 4BQOA 4NUBA 2TCTA 1MMDA 2X6OA 3SHDA 4IJXA 2VKDA 5GHPA 2A6HF 5AONA 2LF7A 5ED4A 1YW7A 5KAIC 2HDCA 2WBMA 5ILUA 1SZ3A 3CC4I 3U2RA 3TKYA 1ZGJA 4A2UA 4UUVA 3ASNH 3NWSA 1QVUA 1PP8F 3CMYA 1ZAOA 2Q0OA 3CUOA 3R6SA 2ZMEB 4B8XA 2LC2A 3FJYA 3OR2C 2Z3YA 3S17J 3HJEA 4L18B 1T38A 2R5YB 2E1NA 3VYSB 4XN0A 3BPVA 2EIMH 1K83J 3IRQA 5E1XA 3ZCOA 1J9IA 1SMTA 4HSTA 1WI3A 3E6MA 1MJBA 2FF4A 2Z5UA 4A0XA 3EYYA 3LL7A 4LK1F 1L0OC 2H6BA 1OQYA 3RQIA 2DYRH 2CW0F 4Y17A 4HX8A 3HUGA 3KVHA 1B9MA 2XGXA 5F0CA 4PJMA 4PJLA 2DA7A 2DT6A 2DDAA 4AVPA 4JZSA 2KJCA 4XM3A 1TUMA 1WJBA 3OYLA 2OQGA 3FXJA 4A5MA 5IY5H 4IHTA 2CUFA 2XPVA 2PEXA 1SD7A 2CUZA 1RKTA 4Y7NJ 1QGPA 4OAYA 5HLTA 4D1QA 2R7VA 4BNCA 3PO2J 3MAJA 3CLQA 4HQEA 1E3OC 1P7IA 4FHTA 2DA5A 2OC6A 1ZGAA 2IGMA 5F6FA 3FISA 2FUG2 2IA0A 3H1CA 5IW5A 1DQUA 3BROA 2GXAA 5FGMA 5E17F 3HIFA 3K4JA 3E6CC 2A8TA 1R1TA 2EILH 4FCYA 3ZQQA 2LFBA 4CGZA 2LH9A 4WWCA 1H88C 3Q2TA 4ZC3A 1ON1A 1V8WA 3OSFA 2MSYA 3VPRA 3MEXA 3I56I 1FOKA 3G1LA 1F3YA 1MNDA 3IAM2 3GTOJ 4HX4A 1P6RA 4PSWA 2D2WA 5J1YA 2ICWG 1WCMJ 5D4SA 3B02A 1HDPA 1XD7A 2FNPA 4LG0A 1PUNA 4R1HA 2EFNA 2M7BA 2Y2ZA 1RR8C 4AIDA 1WFXA 3HHHA 1YOVB 3OOUA 3MDGA 3OWTA 1I3AA 2MH9A 2FE3A 5LFAA 1KYWA 1YFHA 1V55H 2HYFA 4XBFA 3EUKL 1U78A 2R3SA 3PNTA 5ICCA 1R23A 4JX4A 3K2ZA 3GVAA 3WGIA 2D5VA 4LLLA 3COAC 2NVTJ 4IL6C 3HZJA 2Q1ZB 3HPGA 4XLFA 2F4MB 1FYLA 2QKLB 2UZKA 1WJAA 4BYYA 1XMXA 4RS8A 1V8MA 2NYXA 4C3JJ 2UWMA 3C2GA 1HQCA 1D8JA 2H8WA 2F4OB 1LDJA 3PFYA 4EGYA 1PDNC 1MMAA 4FE4A 1MQWA 1GVJA 1TL8A 2ADUA 3BCBA 2JSCA 2KIUA 3HKZA 1JJ6C 2R7QA 1TBXA 3ZQGA 3CJTB 1UMQA 3EXQA 5HLHA 2WADA 3O3KA 4GRIA 4KMUX 5L3FA 2G7HA 2FRHA 2E2HJ 3OYEA 2L9VA 3TEDA 4YIIA 1G8XA 3FXOA 2AS5F 2STTA 5FSLA 2QBYB 5DUIA 5GHNA 4EM2A 4BBRJ 1HW2A 3EEUA 2VN2A 4XRFA 1NH3A 3FWEA 1AOYA 3U1KA 3A6SA 1YW9A 1B59A 3MD2A 1MJ9A 2LVSA 3V8LA 4A3IJ 3D5SC 5K1YA 4XSZF 4UV8A 1HKQA 3TW6A 2MBFA 2HGCA 2QF7A 2VODA 1FLIA 4BE1A 1VTNC 1DPUA 5CVRA 1AHDP 1LVKA 5ILSA 3IWZA 2M4KA 2W4SA 4V14A 2V9VA 3FK9A 3ZOBA 5FSMA 2HKOA 5EZHA 5L3DA 3LWFA 4I99C 3ISPA 5E8IA 3CC2I 3FFUA 3BDDA 3F0CA 1Z3XA 2B63J 2OTLI 3CUQA 4B4CA 4XONA 2G74A 3N9UA 4KJZA 2L4MA 2XPWA 5IP7J 2L9RA 3R0JA 4NQWA 5ICGA 1H89C 1VK6A 2XROA 4N9HA 3ZR1A 2M4GA 1VQMI 4OIOF 4RDUA 2VNQA 1GUUA 2O03A 1S7AA 3F3XA 4A3GJ 3O52A 4RB1A 4KIFA 4A3BJ 1OCCH 3F8FA 1YO5C 3Q9VA 4A3KJ 1R49A 2R7SA 2GT2A 2FOKA 4UVAA 1B8IA 2M30A 3Q0WA 4Y4RA 3BC8A 1UZCA 2CZRA 4LIVA 4G6QA 3V4GA 1BOAA 2L2OA 4C3IJ 2P5KA 4UB6C 1NK2P 1MQEA 2WY8Q 5FFXA 1GT0C 5M5YJ 2G0EA 2BHZA 3BY6A 4KICA 4ZYDA 4G94A 3CUQC 5FJ8J 4IHVA 1BI3A 3P5JA 2XAFA 3NRVA 1W7PB 3N97A 2CQNA 2YU3A 2XB0X 1NQZA 1G3WA 3W3CA 4BACA 1X4PA 2HU9A 1I3QJ 4B1RA 2CV0A 5EEHA 2B06A 3IAS2 3WTSC 2MGQA 3ZMDA 2YX4A 1FBQA 3CCVI 5D6EA 1IN5A 4RGRA 3ZQHA 1WKMA 3LQQA 4ZG0A 1D0YA 5J1RA 1PPWA 1OYYA 3FKIJ 3SYTA 2KQRA 3NEUA 1U3EM 4PK4A 2ELKA 3T5XA 4RBOA 2L3DA 3G1OA 3HSFA 1XS9A 1LVAA 4RB0A 4FASD 5B66C 4HNUA 1Z7UA 2A5WA 4PGGA 4LFUA 1FY7A 3H3ZA 5HLGA 1IXCA 1TWHJ 3BM4A 2VI6A 3CMMA 2G73A 4UVBA 1V8UA 1KA8A 3TO9A 3FBIB 4NQWB 2DAOA 4M6XA 1U20A 1IUYA 4IPAA 1ZK8A 4IHXA 3OY9A 2MABA 1KU2A 5EG0A 2STWA 1GHCA 4BH9A 3E1SA 5FKMA 3LA3A 4ON0A 3LSJA 2A6EF 2MLGA 2VB6A 4ANJA 3HHJA 2CMPA 5LRSA 3J7ZI 4KNYA 2HR3A 2R92J 1V8RA 2HYJA 4QPOA 1Y8QB 3TMOA 3BZKA 3X0NA 4BQAA 2XV4S 3MVPA 4P9FA 5J47A 4Z2YA 5K7ZA 3I59A 2JK3A 3BZ6A 2DSDA 3OOPA 1KYZA 2FU4A 4YPHA 4J7GA 4LOCA 1Z77A 1GV2A 2ZXWH 1RRJA 5IT3A 3GBGA 2QKMB 1VQ9I 4E7ZA 4GYIA 3TW7A 4CHUA 4JBAA 4LLGF 2A8PA 4IX7A 4EV0A 2COMA 3D1NI 2L02A 3DQVC 1ZH5A 4KIBA 3QWLA 4ZYHA 4PFPA 2CS3A 3RI4A 3HOWJ 1I1GA 4HLXA 3CCLI 1HW5A 4LG3A 5GAHJ 2VBZA 2VQLA 3RQ4A 4I0BA 2V6EA 2VT3A 2QLZA 3X0PA 3M8JA 3SEQA 1BIAA 1QZZA 4BKXA 3OYFA 4XMYA 2RNGA 4E7JA 4L5JA 2XAJA 4U88A 1OYWA 2X6XA 4RAGA 1MBKA 3GW2A 4I2OA 1RNLA 4A3EJ 3DLAA 4GDFA 1UELB 4DYQA 1VQ6I 1W5CC 1R67A 2HEOA 2WAEA 4BY1J 2JRTA 3K1MA 2UXNA 3BWGA 1S5LC 4WX9A 1J5YA 2XGCA 2CL3A 3KYDB 3QODA 2LY1A 1U5TC 4NFWA 3GG6A 3OIQA 4GYGA 4BJTA 4QSHA 1MBHA 2EFQA 1G59A 3ZQIA 4BE2A 5DCFA 3SZTA 1SFUA 2K9QA 1GDTA 1MDMA 3VODA 1NK3P 4HAMA 4S0HB 4G7OF 3K1PA 1RUNA 2O0YA 2X4HA 3CC7I 2M45A 2DU9A 3ZMSA 3K69A 2OBPA 3GZ5A 1IV6A 1R6RA 3A02A 5DD8A 1E3PA 2CUJA 2X9DA 3ESWB 3FMRA 3H0GJ 4IKFA 3WU1B 4CZCA 3PM1A 3VYTB 3MKWB 3HOYJ 4FTHA 1T08B 1HSTA 4HDUA 2FBIA 2DQLA 4FQGA 4IZZA 1IJWC 2ICJA 5BPDA 1JTXA 2QA4I 3K6GA 4PJNA 4C2UA 2WAQA 4TV7A 4IVNA 4XSXF 5FKNA 1TNTA 1LDKB 2CG4A 4OMYA 3X0OA 4EJWA 3LQRA 3S3OA 5JHFA 2V7FA 2BV6A 3IC7A 4M9SA 2HFHA 2ESNA 1Z6RA 1DP7P 1U6GA 1YS6A 2EQRA 1HCRA 4IOAF 1FBSA 4NFXA 2DCEA 3VOEA 4F3QA 4ZH4F 2J5PA 1POGA 4JYKA 2RVCA 1N77A 5J8FA 2E1MB 2PBIA 2DK8A 4EQQA 1XTAA 3OL4A 4C30A 3P9CA 2K9MA 2QQAA 1VHZA 1Z21A 3GYHX 3QQAA 3VWBA 4NDLA 1FOXA 3O61A 2DMPA 4XQFA 3WHWA 4RMNA 3SEZA 1T0FC 2WTEA 3V7SA 3A01A 3OYKA 2Y9YA 4O3MA 2K9LA 2VBYA 3C18A 2F5FA 2DI3A 2CFOA 3QOPA 4YIFA 2OCCH 3OGAA 3KEQA 1XCVA 1R5GA 2M34A 3Q0UA 3FMSA 4AIJA 2IGOA 5CVVA 5C4XJ 4KT5C 4NC8A 1ETVA 1VZ0A 2KZGA 1FX7A 5D5XB 3KLNA 2M3AA 3KX2A 4F52A 1UHSA 3CCMI 3I7VA 1Y39A 2DYSH 2DN0A 3WHBA 1CF7A 4PFOA 1USTA 3OIOA 3ZN0A 5D5UB 3DKUA 2H8RA 3X0KA 2X0LA 1V8NA 2YUSA 1LE8B 2A68F 2JUGA 1RYAA 1X3UA 2BZTA 3H92A 2IPQX 2QGUA 5L3CA 2EK5A 2I6KA 1D3YA 1JUSA 1YJWI 2DMQA 5B1AH 2CV1A 1C0WA 3HRUA 2PMHA 1HA8A 1MSEC 3ULQB 2P81A 1MMNA 2FQ3A 2DXIA 3EQLF 1O57A 1NG7A 4IF4A 5ERIA 1YIJI 1WVRA 2GOMA 4DNCA 5CKTA 4D7MA 2V1DA 2L9NA 2BW3A 4M3BA 4IO9F 3KYLA 1F36A 3S8PA 5A2QZ 3RH7A 1ETYA 4HV6A 4Y52J 1REPC 1HC8A 3K4KA 2ESHA 1JXSA 3U1DA 3WTYC 1KT9A 3M8EA 3FIWA 3HPHA 1BI0A 1R4NB 4YFXF 5DS9A 2VL8A 2KRHA 3FM5A 1EH7A 1LPQA 3X0RA 4G7ZF 5FB2A 5CVJA 4ZDOA 2KDWA 3HM5A 4XLNF 5EF6A 1HLVA 3BJAA 3W2AA 1HZTA 5CJ9A 1Z3YA 2IJLA 2WAFA 1BJAA 3PQKA 4P5OA 2DFFA 2MH2A 5JHUA 2BY2A 4EM0B 3L7WA 4XOPA 4BJ6C 2VQHA 4E7IA 1VQLI 4KISA 3KFWX 3M07A 2YU9J 4MQVA 2EZHA 2K27A 1W5SA 2GAUA 2VBXA 1APLC 5F04A 4CICA 2PQVA 2W4EA 1NTCA 3LSHA 4JP0A 1BN5A 2BVLA 4HNVA 4Q4ZF 2O9LA 3HOZJ 4B43A 3WODF 4CCNA 3BG7A 1GV5A 1JUMA 2K3PA 3KP7A 1U5TA 2X85A 1EA3A 4KYWA 5KHDA 2EB7A 3RKXA 4A3FJ 3TBIA 1UHWA 3KZYA 3P9IA 2WWYA 2XRLA 3KZIC 1B9NA 1O4XA 1XSVA 5FLXK 4CYDA 3GLXA 1Z91A 3KE2A 4OOIA 4YEJA 3SMDA 4ABZA 4E4HA 2OD5A 2F2EA 2DPDA 3OYJA 3ZR0A 3ELKA 4OIRF 2R5ZA 5GHOA 1EJ9A 2PFBA 3UNGC 4AYBN 3KP2A 3G2BA 2K4BA 2DMNA 3W6JB 1V8VA 2JPBA 1ZTRA 5ANUA 3ABMH 3S32A 1RESA 2MYSA 1Z67A 4A93J 3C1DA 1RUOA 4N4NB 3H36A 2XGEA 4PJ0C 2R7TA 1BC7C 2F5EA 4WK8F 4YG2F 3QYEA 2WY7Q 2LKSA 4XKWA 1QHHD 4E7LA 2QJOA 4Y15A 2DQRA 4ILQA 1IRXA 1I27A 2E36A 3OR1C 4KYXA 2G7UA 2P8TA 2F48A 3W2WA 3QU6A 5FLMJ 1VQOI 2CO5A 3EYIA 3F8CA 2DT5A 3VEPA 1RETA 5IT9K 1BL0A 1F1ZA 1I9AA 2F6CA 4Q48A 4BUPA 1JI8A 3KLOA 5C7TA 2R4GA 3IH3A 2EH3A 3HC7A 3SXYA 3SFZA 4HDVA 4GO1A 3PUFA 1B72B 1K6YA 2DMTA 4RGSA 4L5IA 2DOAA 4M9XA 2YVPA 3LNQA 1I39A 5LPGA 2FNAA 2MFZA 3AG4H 4HVYA 1TWCJ 4XRSA 3L2RA 2VQGA 1XDUA 3S3NA 1U9OA 5HOOA 5KNLA 4UNOA 1EKEA 1BM9A 5EEAA 2R5WA 1YW8A 2A3SA 2EV6A 2DA1A 1YJ9I 4GGGA 4MGRA 5E1ZB 5EGOB 3FZVA 1W7PA 3CJNA 2PMUA 1R22A 1U9NA 3E6DA 3A6VA 5IW4A 2F5DA 4D0PA 4EM1A 3ZN1A 2K85A 2OTJI 2GWRA 1UB9A 5B5EC 3M9AA 3S1MJ 2A8RA 4L5EA 2DHOA 4IJAA 3CUQB 4MIMA 1QVJA 3KP5A 4CSWA 1LJ9A 4OIQF 3JRCA 2JWTA 1CGPA 3E5XA 1OW2A 3FF5A 4M73A 1TZLA 1B8IB 4JOMA 4CYCB 3WTXC 2RRKA 2FMYA 3FHNA 4KDPA 5CVUA 2VXDA 4JX5A 3H3UA 3ZGKA 3M3YJ 4GCVA 1MZBA 2OF7A 5FLXZ 5BOXA 3S15J 2ID3A 4ENKA 5J1UA 1ZN2A 1RI7A 3B73A 3DKXA 3BG6A 4B47A 1I6XA 3F23A 1BI2A 5E8GA 4J01A 4HW0A 4ZTJA 5K7HA 4RM2A 3CP2A 3J80Z 2LNBA 1FSEA 1P4AA 2CUEA 4MHGA 5K5QA 1V8IA 2QBYA 3ASOH 5E79C 3ML6A 4MQ9F 1QA6A 2EZLA 2IS2A 2HXIA 3CF2A 3ACAA 3GUDA 5I8UA 1ULYA 5CFJA 2L7FP 4PJJA 2ZFWA 5DDGA 1ETKA 1YI2I 3F8BA 1VIUA 3CDIA 2A05A 1JKNA 1H8AC 4WF2A 4YPRA 2QJTA 1LFPA 3KEYA 4PSXA 4R8HA 1G4DA 2PG4A 4AVZA 2Y30A 4GFBA 2HYGD 2JJ7A 2RGVA 2ZXHA 2LMDA 3S1RJ 2ZMEA 2K3FA 3T0YA 4BXFA 2JRMA 4U0VA 3REOA 2FJ1A 1E3HA 2DA4A 4KG3A 5F27A 3RKYA 4H4KC 1PJRA 4C3HJ 1BJZA 4PCQA 1V3FA 4JZVA 3M7GA 4Q5SF 2H09A 1IRFA 2YVMA 1MBGA 2LTPA 1Y1VJ 2P6SA 5TRDA 1XSBA 2LBFA 2AQEA 1LB2A 3MGMA 3KZZA 3M1CA 1QO0D 1QZEA 1S9HA 3O69A 1SVLA 1SANA 3FXLA 3OV8A 3CCSI 1JHFA 3D0SA 2GXBA 1DGWY 2M8GX 3FBNB 3HG9A 1SFXA 3CMAI 2OUMA 4B44A 3ZQFA 2XSDC 4YFKF 2JQ7A 4UUSB 4G9YA 3MFKA 3FMQA 3J7AO 2K4JA 3BTJA 3Q9SA 4C9WA 5D6FA 2JTVA 4AWXB 3Q91A 4M72A 2ISZA 2CJJA 1S8NA 1XSXA 1PUSA 4HYEA 2R7UA 3WTTC 3BG9A 4C2TA 4K6EA 4WCGA 1MBJA 3S93A 3GFLA 2COBA 2G9WA 5EDNA 1WJDA 2Y31A 2P5LC 2EIKH 4FISA 1LDDA 5FROA 1QPMA 1R36A 2ZJPF 2YR2A 1IRGA 1IDYA 3IRRA 2O61A 2J5OA 4ENMA 1DP3A 1OCPA 3ZMVA 5D5VB 3CO6C 1JKPC 1K78B 1KU7A 2AZWA 1NFSA 3NARA 1SFKA 2GA1A 1X1BA 3LSIA 2VC1A 2ZJ2A 2HTSA 1SFOJ 4S04A 1VQ7I 4CUGA 1X1AA 3NWTA 3WHCA 1JUPA 3N77A 1WI9A 1OMIA 3AKZA 1A6QA 2YX7A 4OWRB 2CW8A 1TTYA 2VUMJ 5F1RA 3OYAA 4LG0B 3GF2A 3SDGA 2V1UA 4DYCA 2JMWA 5H20A 1DU6A 2B2KA 4HA8A 1UFMA 3KP3A 2DUKA 2Z16A 2QQBA 3HL2A 1IRYA 4A3JJ 3ECHA 3ZRGA 4I7HA 3BP8A 2BY3A 2RC4A 4LJZF 4LD5A 2FSWA 1B4AA 2Y0SA 1TT0A 2R7RA 4XR6A 2L9SA 4HQMA 1P2FA 1CQTA 2XSQA 4P1WA 3LFUA 2A8QA 3BR1A 1V54H 3MZHA 3PSFA 2NVQJ 3R0AA 2L4AA 3H5NA 3K2AA 3GTLJ 1SC7A 4B48A 4M74A 4NHJA 4CDGA 2PJRB 3MZYA 2Y0MA 4XN3A 2P4WA 4J7HA 2VLAA 4QPQA 1FIAA 1ZLKA 4IHWA 1Z05A 2QEXI 5HS7A 3BR2A 1JTYA 1X58A 1YHQI 1E2XA 4HBLA 1PP7U 4I76A 2DA3A 2H6CA 1FMVA 2EIJH 2YPRA 2VOPA 1PPVA 3A03A 1KGSA 3SZPA 3VSKA 1TWFJ 4H0EA 3BPXA 3LAPA 2EINH 3A0HC 4LLNA 4BL0B 2RDPA 3Q3SA 1T0FA 4CCKA 5GPCA 3HKZN 5EGOA 1VI0A 1ZG3A 1YITI 3MCZA 5HS9A 3F6OA 3PL8A 5GHJA 3WTUC 2DBBA 3AC9A 3ZPLA 3S1QJ 1Q33A 5E3OA 2XUBA 3OYIA 1A6IA 1GXQA 2CRGA 5C3EJ 3SQNA 1YTYA 1ACIA 2FBKA 2K9SA 4HOBA 4N9IA 2R7XA 4AM3A 1T6SA 1T8IA 2M7AA 2DOFA 3VSLA 4YRVA 4OAZA 2HZTA 2ETHA 5JLWA 4XKBA 2LY9A 4BS9A 5CFIA 3HEFA 2K86A 3ZMUA 5DCMB 3JSOA 3PFIA 5HZXA 2BBYA 4A5NA 5CLSA 2HDDA 4XLEA 3C7JA 3J81K 4NBQA 2FEZA 2DDBA 1WGXA 2CW7A 3EF5A 1IN4A 2KKOA 4Q47A 3QSJA 3SFIA 3DEEA 5FD6A 2EJRA 2VKEA 3V42A 5GTIC 3IKVA 3BCAA 1JKOC 1V5EA 4A6DA 3LSKA 1ETWA 1Y0NA 2I10A 3F8NA 1OYIA 2UV1A 3WU0A 2DTRA 3AG3H 4X0GA 3DTEA 2QVOA 2AO9A 3A4CA 5FD5A 1UCRA 1Q27A 1XGNA 4KMFA 3FXUA 3RYRA 2CU7A 2ZMEC 1I5ZA 1WPKA 5JFRA 1PUQA 2W84A 2HS5A 3A6UA 1FEXA 2E2IJ 3R4KA 1LFBA 3JRDA 3L2VA 2FD5A 3G1MA 3O6ZA 1TQMA 2IAIA 4Y33A 5M5WJ 3ZQCA 4A12A 4MTDA 3CO7C 1P9QC 3DV8A 4HF1A 5BONA 3RTRA 4ZYEA 2EFWA 3O2PE 3I9V2 2CQKA 3BR3A 2O6GE 3E5QA 3S16J 2XSJC 2ECCA 3H95A 5HDGA 3TO6A 3J7YJ 1QBJA 2HVSA 5IYCJ 2PNYA 2Q2EA 3QAHA 2E1OA 3HRMA 2ZFUA 1QQIA 2JT1A 1WH7A 1MK1A 3Q0VA 2ZC2A 1X19A 1W0UA 1ON2A 1J75A 2BXZA 3H5AA 2AXLA 2DA6A 5E3NA 1ZARA 3OIPA 2HQAA 5TJJA 3CLOA 2R7FA 4HZFA 3K7AJ 2PMZA 3DWLE 3OS1A 1OCTC 4DW6A 1HX3A 1IW7F 2BOLA 3GTGJ 3Q1PA 3F21A 5DYMA 2P7VB 3V8KA 4UVCA 2LOOA 5J40A 4YFNF 4HNTA 2H27A 1T39A 3P5TA 2A5YB 4MEYF 2A61A 4NC7A 2Y69H 3GO5A 3K70C 2E60A 3ZR8X 2OPTA 1D1AA 3EPZA 1SD4A 2KFDA 4DYRA 1UAAA 4E70A 4CXFA 3S3MA 4DGWB 4BBSJ 4WXCA 1Y0UA 1Y6IA 3G6EI 2DSBA 2ISYA 3JR9A 3WE3A 3FHZA 1MP2A 2HI3A 3K10A 3OL3A 3HOXJ 1D0ZA 2RKHA 2E1CA 1R9TJ 3GFIA 3DTKA 1LUJB 2JN6A 3SONA 2CV2A 3Q2SA 3ABUA 1AA7A 3HOSA 1KQ0A 2RN7A 2W7NA 3GTMJ 3G0QA 3IHUA 3L2UA 1PUFB 2W1OA 4BHPA 1K4SA 1R1UA 1P4XA 3WTZA 2EV5A 1FMWA 1VQNI 3F8MA 5F64A 3U21A 3L9FA 1TQIA 1D5YA 1LEAA 1O7LA 3HB9A 3WE2A 3FXMA 1WJ5A 2LKXA 4ENNA 3FKJA 3CJRB 3DBHB 3OYNA 4RLFA 2VQCA 4RA2A 3QRFF 1VIQA 4F7ZA 1VQ5I 1HXDA 3VDXA 2KZVA 4P96A 3GZ8A 3BOQA 1V8LA 2KMUA 1T33A 5CYVA 5J6XA 1VC8A 2LSOA 4L9NA 1F5TA 4FE7A 2HPIA 3G71I 2OCEA 3EUHA 1B1BA 2XRNA 4V19K 2O5FA 5LLQA 1VQPI 2J8QA 2W82A 2LKPA 2DFEA 1FTTA 3V7CA 3QPSA 3QU3A 4WXHA 2WB1A 4ZYGA 2LDUA 2OU2A 4AU7A 1G0SA 1XCBA 4L9VA 2PMZN 2NS8A 5EZGA 3MMYB 2KIQA 3EETA 1MW7A 3F9KA 3K4MA 4XRMA 2RREA 3E5UA 1YG2A 2V9PA 4ZDPA 3F22A 3DEUA 1PVEA 3WTVC 4L0YB 1N78A 1R7JA 4Y13A 3CCQI 2NXNB 1D1CA 1SVOA 1H9TA 2X48A 2YS9A 2FA5A 1IG7A 1B72A 2EPFA 5GADJ 4JX6A 3I4PA 5F1JA 3C2BA 1ETOA 3I9XA 1GXPA 4XIDA 4GXOA 4CA0A 1IC8A 5BNGA 5GPAA 3PNVA 1RZ4A 3X0LA 2FXAA 4I02A 3TP0A 1MBFA 2FX0A 4A6EA 2LLKA 3VB2A 5GP9A 2MD0A 5ANVA 2JZYA 3RPUA 2V1NA 3GWZA 3DU5A 4EJUA 5JVTA 4E7KA 2LBFB 4FETA 2E7WA 1W1WE 1VNDA 1G6NA 2X6YA 1BR4A 4RGXA 3H0DA 1I50J 2EZKA 3AL0B 1SAUA 2IBDA 2L7MP 1J59A 1ENHA 4MNUA 1XGMA 2ZXIA 1NQYA 3J81Z 1ZG5A 1OR7A 3CQZJ 2XC7A 1E17A 1P92A 4DZPA 2W24A 2XAGA 1ETQA 4UXNA 4N1TA 3EUAA 4DQ2A 5L3EA 2BYVE 3BR6A 2IS6A 1Z0XA 3AFHA 1P4WA 2MC4A 3LSTA 3TL4X 2QQ9A 2W85A 3VYUB 3HDDA 1JGGA 1ZRCA 4PZJA 4KFCA 4BQNA 1MUTA 1X1CA 2XF6A 2M0MA 4AIHA 2UUZA 2MA3A 2IVMA 4MLOA 1YYVA 2VASA 4XICA 2YVNA 4A3DJ 5F0FA 2F4IA 5H6RA 2K02A 2QZ8A 2BGCA 1EH8A 2E7XA 3RJPA 1D5VA 3HHGA 3PIOF 3KETA 2XDVA 4NC6A 3KP6A 2GOXB 5LGTA 1SEUA 4JK1X 4B3XA 4Y3OA 1MBEA 1A35A 4I09A 5IYDJ 3CCEI 2IT0A 3MZ8A 2PN6A 1FNNA 2B7EA 1TW2A 2RQPA 3I0TA 3A2KA 1M1EB 3GWYA 3RDIA 3QOEA 1Q1HA 1ZG1A 1ZR4A 4U7BA 3HOTA 5BQTA 2NS7A 2Z9OA 2IS1A 4XOTA 2PLYA 1IXRC 3S1NJ 3OYDA 1VRLA 4B3AA 4B09A 3TO7A 2MW8A 3I7UA 1VCDA 1FYMA 5IOZA 4XLPF 3T8TA 1UJ8A 2BW3B 3GX4X 2LG4A 3IH2A 4CCLA 3JREA 2GIVA 2OAZA 2XAQA 1WJCA 1T2KA 1X84A 3QPLA 4QTRA 4M71A 4LGWA 1G3SA 5DV5A 3FX3A 2FVVA 3D5LA 4F55A 4MFEA 2M0CA 1FJLA 4A3LJ 2R93J 3FK6A 1BR1A 3OYMA 1R1VA 4KT6A 1W0TA 5H6QA 3HOUJ 1IUFA 1Q1VA 4IQ4A 1YRNB 1LKXA 4MEXF 1V5GA 5GHIA 1Z7LA 4D5CA 2FKBA 4CO8A 1NHAA 4UUTA 4ZJZA 2P6TA 5FRMA 2QSHX 3IV5A 1KU3A 4LB5A 3CF5F 1HKTA 5DPKA 2GM4A 6PAXA 2DW4A 2QWWA 4M3GA 3EUHC 2VIXA 4UV9A 3BG3A 5CQEA 1YX3A 5TISC 5H2FC 3C3WA 1MMGA 2ZSHB 3CD6I 3I71A 4C9YA 1ERDA 4II2A 1VHGA 5ILVA 2WB1N 1JKRC 3MKZA 5D5WB 3ONQA 3WGHA 2PJRA 3D5RC 3A1YA 3GXOA 1O3QA 1K7AA 4N1UA 3I3LA 1DPRA 1V8TA 4XNFA 5DM6F 1ZREA 2XF7A 3IP4B 5M3FJ 1MKMA 1QU3A 2FMLA 3KPHA 2BY0A 2R7WA 4S2YA 2DFIA 3HGGA 1A36A 1IAWA 3M4OJ 2VJIA 3QPHA 3MWMA 4RGUA 2BE5F 1ZRDA 2HTJA 5E18F 3K4BA 2Q8KA 4CYCA 2VXZA 2ID6A 1GA7A 2LR8A 2NAZA 2DLLA 1YJNI 1BOBA 3RKQA 4HG2A 2KHMA 3HXLA 2E5ZA 4BU2A 3A6TA 3E6BA 4DBRA 3JSPA 5FSKA 3L09A 3HSRA 4LMYA 4D9JA 4EEFG 5M5XJ 2OV7A 4CCOA 3HOVJ 3S14J 2A07F 3DCFA 3X0MA 4I6ZA 3GFMA 1JE8A 1MR2A 1U2WA 2KPMA 2QM3A 3DXJF 1WWXA 3H35A 3LSMA 1FYKA 2KJBA 3ABTA 2ELJA 2LF8A 3DP7A 2HKXA 1JHHA 2XKOA 3BG5A 1BIBA 1FZPB 3FDYA 3P9KA 1Z9CA 1PUFA 2DOEA 4IXAA 4FX0A 4BHCA 1X2MA 5D8LB 1DUXC 4AD9A 2LREA 3WG9A 2CQQA 4RB3C 3FM3A 2NOJB 5KK1A 3KEOA 2JA7J 3JTHA 5FSOA 2KDZA 1WZ2A 3QYBA 3CESA 4ESJA 1YLFA 4BHBA 3ZMZA 1KQ9A 5AIQA 4M6VA 5FSNA 3BZCA 2JVGA 2M87A 1IN7A 2VE9A 1QZYA 2L5QA 4G8XA 4BAYA 4RAFA 2BY1A 1BR2A 3KP4A 4EMSA 3F13A 2Y48A 1ZR2A 1JKQC 3CJQB 4E6KG 1LQ1A 1WRJA 1XGSA 2HQ5A 5GHQA 2DFHA 1RR7A 3ZP5A 3MCFA 2DODA 2EBIA 2HPMA 4N0BA 3E7LA 2ZB9A 4II3A 1V8SA 1T56A 5ICEA 1R5ID 5LGUA 1OLTA 1K4TA 2VJJA 2C6YA 1ZYRF 4OINF 1KONA 2I8DA 4ICKA 1EH6A 1IF1A 2ACJA 4S2XA 5KVRA 2JVBA 4IRIA 2X1EA 1FOWA 1A31A 5FLVA 3G4SI 3M8FA 4PDKA 3E3VA 3F72A 3I54A 3N05A 3IH4A 5FKLA 1WSUA 1BBYA 4HLYA 5DCMA 4E7SA 2O7OA 2VNPA 2Q2EB 1YX5A 2I8TA 1Y56A 1D8KA 2OZUA 3RYPA 1ZRFA 1F43A 2WV1A 1UG2A 2F5CA 3CDLA 3JCUC 4U0WA 1YQAA 3J7Ye 1AU7A 3SDBA 1XDSA 9ANTA 1ODDA 3GEZA 3K9TA 1ZKGA 2RNJA 3RPUD 5BMZA 1TT5B 4U87A 2B9SA 3ERED 2EFPA 2O3FA 4LITA 2ELHA 5DTDA 2Y9ZA 2HQNA 1MH3A 3CP8A 2RQQA 2DO7A 1WJEA 2CYYA 4DYWA 4M3FA 4IQJA 3QPTA 2JUCA 3TDZC 5L3GA 1KU9A 5ISYA 4W97A 4EGZA 3GMEA 1NG6A 2YVOA 3DPLC 3MKLA 1V8YA 2XAUA 4NNJA 4DJAA 1OJLA 4HX7A 2L54A 3FXKA 2KDOA 4ZDLA 3X0QA 5A2QK 3BJOA 5EJCA 3UKGA 3W6VA 4O6JA 3U9GA 1MSFC 1FBUA 3V8JA 4C9XA 3DUPA 2VC0A 3RIRA 4F93B 3BQZA 5CQGA 5IOYA 3LAJA 3ROUA 2ME6A 1MGTA 1K6OA 4HFQA 3GFJA 1IN8A 1X83A 4ESFA 1YRNA 3E0JB 3I53A 4S05A 2JA5J 5D8KB 1JT0A 1R4MB 2PQ8A 4ZTFA 3LA7A 1BA5A 5HDKA 3FCMA 5M3MJ 3OYGA 5KAFC 1E0EA 3FSPA 5DD4A 2CFXA 4I0AA 5TGTA 2GBYA 1VQ8I 4AIKA 3CTAA 1OISA 1TNSA 2KLOA 3H9GA 3CCJI 1Z1DA 2LY2A 4A0ZA 5J4YA 3S2DJ 3GLLA 2XAHA 4ASNA 2BVMA 4G6TB 5JVGF 3ABKH 4M3DA 1DDNA 1W4MA 2DJNA 3JTGA 2FOWA 2M8EA 4L9TA 3HTSB 5IYBJ 3S2HJ 3L2QA 2M5WA 3GTJJ 4RAZA 2DJIA 3LOCA 2GIZA 1H0MA 1BW5A 1QVTA 2O5RA 4BJ5C 1S29A 2Z2SB 3X0IA 3DLLF 2R5YA 1S72I 2GLOA 2Z1DA 3X0JA 3O8GA 2HDWA 4IOCF 2KIMA 1K78A 3L00A 1K79A 3GCMA 2CSOA 2LRDA 3C2HA 4ZZDA 1FT9A 2R7OA 3MKYB 3RPQA 5ANTA 1EV7A 4J19A 1MD0A 2X6WA 3O6BB 2MLKA 2IA2A 1QRYA 2HOSA 3HTUA 1HW1A 5F0HA 1XMAA 3MQ0A 2R5ZB 2QSFX 2ICKA 1W7PD 4WXDA 1I1SA 3HUGB 1EF4A 1RKWA 2MD5A 1RIOH 2P0WA 2ZJRF 2GB5A 4UY8I 2DK5A 3BR5A 2CH0A 3U53A 2NOGA 1J0RA 2XHKA 4BEHA 5C7QA 2Z99A 5C44J 2WA0A 2JA6J 3EDPA 3JRHA 2EWNA 3RCOA 1JJ8C 1QNTA 2ZJQF 3H9QA 3FXQA 4RLQA 5J4VA 2R7ZJ 2I8UA 3DEWA 4M9ZA 2ZNYA 4HRIA 2E34A 3CCYA 2A8SA 4YELA 2L01A 2ZKZA 3JRFA 2KDVA 4N4OB 1IV8A 2QSGX 3NQOA 1FP1D 3BQYA 1F9NA 2MC3A 2IGNA 5E20A 2A69F 1GVDA 3BTIA 1JGSA 1MDMB 3TP3A 3PIPF 4C2MJ 4D5FA 1YE9A 1IDZA 3HRSA 1XSCA 2A6TA 2IA1A 3KYCB 1OKRA 4RM3A 1WHUA 1AKHB 2CGPA 2FQ4A 4BXUA 3PQJA 3AAFA 5LEJA 3HBLA 1X2NA 1TQPA 3BJ6A 3T8RA 5BPIA 4ETSA 1R71A 5KCMA 2K7LA 2VJ5A 2VBWA 4BDYA 1Y1WJ 4BEHB 2EV0A 5HNHA 2NVUB 4U7DA 4G7HF 1G2HA 4K2EA 3O8SA 3OMYA 3L1PA 1X1DA 5EEGA 4J00A 2LK2A 4IEJA 2NVYJ 3A0BC 2QQ8A 4Z6YA 1A5JA 1S6LA 4UB8C 4HF0A 5ANWA 4CCMA 2JA2A 4DOZA 1D0XA 1AKHA 1VF9A 1NFZA 1TLHB 4A3CJ 3CMEI 1T95A 3BTCA 1FPQA 1J09A 2VKHA 3ZMTA 3BTLA 1JRKA 3L2WA 2DA2A 3I58A 2B0VA 3MDIA 1JT6A 1KZHA 3IWFA 5E1WA 2V4JC 2HOTA 2VOOA 4MFDA 2W48A 3LSPA 5LD2C 3DPUA 4V2GA 4ESBA 2XASA 1GLNA 5JI6A 2VONA 4F91B 2KT0A 1ZELA 3N4MA 3AG1H 1QPIA 3EESA 2DPUA 4YOQA 4E7HA 1O3TA 4I98B 2GT4A 3JRAA 5D4RA 3QP6A 3GRNA 3VYRB 2KP6A 3AG2H 1OCZH 4BE0A 3I4MJ 4AYBA 1FOYA 2V1XA 3DBRB 3SZGA 1W36C 4KUMA 4HSRA 5J8CA 2HNHA 5LGNA 2IGKA 5HS8A 5JR3A 3BLYA 1FP2A 5GAEJ 2EA2A 2Z33A 2IS4A 2H1KA 1S7EA 3IL2A 1SMYF 2UXXA 1HOMA 4KA4A 1W5TA 2CQ7A 3HYQA 2R0QC 1U8RA 4XL9A 3UR3C 3K4CA 2O8XA 3I5UA 3QP5A 3G3ZA 2H1LA 5HODA 5E3MA 3V7RA 1SFEA 1T98A 3B6CA 2K9NA 2IP2A 5IT9Z 1U0JA 4EJVA 1XB4A 3PNYA 1OFCX 4AUXA 1MIJA 3R03A 3SJMA 1G9QA 2X1CA 1XMKA 1VC9A 1SAXA 1KTGA 1FWZA 4P9UA 1X3WB 3DTIA 5IP6A 4W1UA 3JRGA 2X51A 1HBXG 5GTHC 4MPOA 1SD5A 1H9GA 4LB6B 3OYBA 3CCUI 2ECBA 1UHMA 4G12A 2WAQN 2Y0SN 2QUFA 4HF2A 2YYHA 1FC3A 3P7NA 4IHSA 2XGDA 4ITVA 2X1DA 3H9JA 1A04A 4EVIA 4IRGA 4JQFA 3RZOJ 4PUSA 3GTQJ 1W36D 3ZQ7A 2IEKA 2QYOA 2Y75A 1IRZA 2GA2A 4QWQA 1HSJA 3COUA 3WU2C 2JPCA 2K5CA 4XKCA 1I6HJ 3CCRI 1IGNA 3WGGA 2O8KA 1STZA 2N8GA 2AQFA 4CH7A 2ZO4A 2H94A 2L7ZA 1BW6A 1SD6A 2RAEA 4KTBA 3OSGA 5C4JJ 4X6AJ 5LBQA 5DM7F 1F4KA 4OU0A 3X0SA 2VT2A 1VFCA 5FO5A 1R58A 2HOAA 2OQRA 2ZSIB 3FK7A 1X51A 5CVIA 4CCJA 2MG4A 4LK0F 4A69C 3MN2A 2L0KA 4ZYAA 4OIPF 2D1HA 1G3TA 3Q93A 3X2QH 3K1NA 1SVMA 3L85A 3KIOA 3LA2A 4EJTA 1TP4A 3T1BA 2XIGA 4HEA2 4A0YA 3Q5FA 1AWCA 2ZXJA 1O3RA 1N25A 4BQQA 2V6CA 3WTWC 4HPQA 3ZXSA 2E19A 4FX4A 4UHTA 1Q54A 1O7FA 2EZIA 3BHOA 1LEBA 1X3ZB 1BC8C 1J2XA 2M2EA 2XF5A 3GZNB 2AXTC 1BI1A 1DGRM 1PYVA 3ABLH 2O1CA 4YIRX 1O3SA 2DSCA 5CPRB 1WJFA 3Q4IA 3OS2A 5DEQA 2HOEA 3ECOA 1G3YA 3HRTA 1K26A 2W25A 3TOBA 1Y8RB 2D1VA 3LSRA 4A3MJ 3O8HA 5AIPA 2OA4A 2EA4A 1XSDA 2HVRA 2GXGA 4MTEA 1V5FA 4S2VA 2HVQA 5FFZA 4DZJA 2AHQA 4DIQA 2I5UA 1XSAA 4UUSA 3W2VA 2NRAC 4HV5A 2EFOA 3TQNA 5LHGA 1VQ4I 2IRFG 2WV0A 1RRSA 3L2CA 2E2JJ 2IW5A 2HWVA 3BT9A 3PUBA 5ANSA 1RRQA 2B0LA 3F6VA 3HGYA 2GQQA 2CWEA 3S2WA 3TGNA 4ZZLA 1FSHA 5FRNA 3DU6A 1U5TB 1IO2A 2QENA 1ZQ3P 2VE8A 2WC2A 2E71A 2M1BA 3E57A 3FXRA 5F08A 2M9HA 1X4OA
chains in the Genus database with same CATH topology
1SJYA 4NB5A 2P5VA 3TDUC 5BS6A 3G73A 4M6YA 3F6AA 1ZHFA 2KIFA 5FSIA 4O5VA 3TOAA 3VFZA 4KG4A 2W57A 5K5OA 1R5HA 3I59B 2YSRA 1YIOA 3CNGA 4KIGA 2TDXA 4L9JA 3JAMZ 2Q9PA 5L3BA 1HKSA 5LHHA 1IZ1A 1WQ2A 4R79A 3M1EA 5C8LA 3JAMK 2V79A 2XKPA 1LNWA 2P7CB 3DFGA 3SHFA 1YS7A 1OPCA 3DF8A 3W6KB 2PI0A 3P6YA 3R60A 2XVCA 4S2WA 1USSA 4EJOA 2NNYA 4OMZA 1K2EA 2FBHA 3HYIA 3J80K 1R00A 3CDHA 3RKWA 3KCCA 4I01A 3ID9A 1CF7B 4JZUA 5LEKA 1S7OA 1J7KA 2NNNA 2HQRA 1S3JA 1ZLJA 4G6DA 3HSEA 1SOIA 2GZWA 3R61A 4CZZA 5K5RA 1PVFA 3JW4A 1B6AA 1Z6TA 1ONVA 2RV8A 2ZBKA 1TW3A 2D45A 4KN4X 4JZTA 4U0YA 4RB2C 3BAPA 1MJAA 1XN7A 1KHZA 1IXSB 4RAYA 2NS0A 4KN7X 4QLCU 5ICFA 3DPTA 4FT8A 2ZNZA 3E97A 3LFKA 3DKWA 5HLIA 3IKTA 1SU2A 1L3LA 1PUEE 5LRRA 5HDNA 4ENJA 3I64A 5DUKA 3K0LA 1IN6A 4P55A 1XGOA 1KQ8A 4L0ZB 5GHMA 4IRHA 2PJPA 2ZCWA 1V4RA 3GZ6A 2BEOA 2OZ6A 2R7DA 2KRFA 5LHIA 1PPXA 4PGHA 2O5WA 5HVQC 3SHDA 4IJXA 5GHPA 2A6HF 5AONA 2LF7A 5ED4A 1YW7A 2HDCA 5ILUA 1SZ3A 3U2RA 3TKYA 1ZGJA 4A2UA 4UUVA 1PP8F 3FJYA 4B8XA 1ZAOA 2Q0OA 3CUOA 2ZMEB 3R6SA 2Z3YA 4L18B 1T38A 2E1NA 3BPVA 3IRQA 5E1XA 1J9IA 1SMTA 3E6MA 1MJBA 2FF4A 2Z5UA 4A0XA 3EYYA 4LK1F 1L0OC 2H6BA 2CW0F 4Y17A 4HX8A 3HUGA 3KVHA 1B9MA 2XGXA 4AVPA 4JZSA 2KJCA 1TUMA 2OQGA 4A5MA 4IHTA 2PEXA 1SD7A 1QGPA 4BNCA 3MAJA 4HQEA 4FHTA 1ZGAA 5F6FA 2IA0A 5IW5A 3BROA 5FGMA 5E17F 3HIFA 3E6CC 2A8TA 1R1TA 4CGZA 4WWCA 3Q2TA 1ON1A 1V8WA 1FOKA 3MEXA 1F3YA 4HX4A 1P6RA 2D2WA 5D4SA 3B02A 1XD7A 2FNPA 1PUNA 4LG0A 4R1HA 2EFNA 3HHHA 3MDGA 2MH9A 2FE3A 1KYWA 1YFHA 2HYFA 4XBFA 1U78A 2R3SA 5ICCA 1R23A 3K2ZA 3GVAA 3WGIA 4LLLA 3COAC 1FYLA 2UZKA 4BYYA 4RS8A 1V8MA 2NYXA 2UWMA 1HQCA 1D8JA 1LDJA 4EGYA 1PDNC 1MQWA 1GVJA 2ADUA 2JSCA 2KIUA 1TBXA 3EXQA 5HLHA 3O3KA 4KMUX 5L3FA 2G7HA 2FRHA 4YIIA 2AS5F 5FSLA 2STTA 2QBYB 5DUIA 5GHNA 4EM2A 1HW2A 3EEUA 2VN2A 4XRFA 3FWEA 1AOYA 3A6SA 1YW9A 1B59A 1MJ9A 3V8LA 5K1YA 4XSZF 4UV8A 1HKQA 2MBFA 2HGCA 2VODA 1FLIA 1VTNC 1DPUA 5CVRA 5ILSA 3IWZA 4V14A 2V9VA 3FK9A 5FSMA 2HKOA 5L3DA 3LWFA 3ISPA 5E8IA 3FFUA 3BDDA 3CUQA 2G74A 3N9UA 2L4MA 3R0JA 4NQWA 5ICGA 1VK6A 2XROA 4N9HA 3ZR1A 4OIOF 2VNQA 2O03A 1S7AA 3F3XA 3O52A 4RB1A 4KIFA 3F8FA 1YO5C 3Q9VA 2GT2A 2FOKA 4UVAA 2M30A 2CZRA 4G6QA 3V4GA 1BOAA 2P5KA 1MQEA 5FFXA 3BY6A 4KICA 4ZYDA 4G94A 3CUQC 1BI3A 2XAFA 3NRVA 1W7PB 3N97A 1NQZA 2YU3A 1G3WA 5EEHA 2B06A 3WTSC 3ZMDA 2YX4A 1FBQA 5D6EA 1IN5A 4RGRA 1WKMA 3LQQA 4ZG0A 1PPWA 1OYYA 3NEUA 1U3EM 3T5XA 2L3DA 3HSFA 1LVAA 4RB0A 1Z7UA 4PGGA 4LFUA 1FY7A 3H3ZA 5HLGA 1IXCA 3BM4A 2G73A 4UVBA 1V8UA 1KA8A 3TO9A 2DAOA 4M6XA 1U20A 1IUYA 4IPAA 1KU2A 2STWA 1GHCA 4BH9A 3LA3A 4ON0A 2A6EF 2MLGA 3HHJA 5LRSA 4KNYA 2HR3A 1V8RA 3X0NA 4BQAA 2XV4S 4P9FA 4Z2YA 3I59A 3BZ6A 2DSDA 3OOPA 1KYZA 2FU4A 4YPHA 4J7GA 5IT3A 2QKMB 4GYIA 4CHUA 4JBAA 4LLGF 2A8PA 4EV0A 2COMA 1ZH5A 2L02A 3DQVC 4KIBA 4ZYHA 3RI4A 1I1GA 4HLXA 1HW5A 2VBZA 4I0BA 2VT3A 2QLZA 3X0PA 1BIAA 1QZZA 4L5JA 2XAJA 4U88A 1OYWA 3GW2A 4I2OA 1RNLA 1R67A 2HEOA 2JRTA 3K1MA 2UXNA 3BWGA 4WX9A 1J5YA 2CL3A 1U5TC 4NFWA 3GG6A 4GYGA 2EFQA 5DCFA 3SZTA 1SFUA 1MDMA 3VODA 4HAMA 4G7OF 3K1PA 1RUNA 2O0YA 2X4HA 2M45A 2DU9A 3ZMSA 3K69A 2OBPA 3GZ5A 5DD8A 3FMRA 3WU1B 1HSTA 4HDUA 2FBIA 2DQLA 2ICJA 5BPDA 4TV7A 4IVNA 4XSXF 1TNTA 1LDKB 2CG4A 4OMYA 3X0OA 4EJWA 3LQRA 2BV6A 3IC7A 4M9SA 2HFHA 2ESNA 1Z6RA 1DP7P 1U6GA 1YS6A 1FBSA 4NFXA 3VOEA 4ZH4F 2J5PA 2RVCA 5J8FA 2PBIA 2DK8A 4EQQA 3P9CA 2QQAA 1VHZA 3GYHX 3O61A 3WHWA 3V7SA 2WTEA 4O3MA 2VBYA 3C18A 2F5FA 2DI3A 3QOPA 4YIFA 3OGAA 3KEQA 1XCVA 1R5GA 3FMSA 4AIJA 5CVVA 4KT5C 1FX7A 5D5XB 3KLNA 3I7VA 1CF7A 3ZN0A 1USTA 3DKUA 5D5UB 3X0KA 2X0LA 1V8NA 2A68F 1RYAA 1X3UA 3H92A 2IPQX 5L3CA 2EK5A 2I6KA 1D3YA 1C0WA 3HRUA 2PMHA 3ULQB 2FQ3A 3EQLF 1O57A 4IF4A 5ERIA 4DNCA 2V1DA 5A2QZ 3RH7A 4HV6A 1REPC 2ESHA 1JXSA 3U1DA 3WTYC 1KT9A 3M8EA 1BI0A 4YFXF 3FM5A 1EH7A 3X0RA 4G7ZF 5FB2A 5CVJA 2KDWA 4XLNF 1HZTA 3BJAA 5CJ9A 2IJLA 1BJAA 3PQKA 4P5OA 2MH2A 5JHUA 4EM0B 3L7WA 3KFWX 4MQVA 2K27A 1W5SA 2GAUA 2VBXA 4CICA 2PQVA 2W4EA 1BN5A 4Q4ZF 3WODF 3KP7A 1U5TA 4KYWA 2EB7A 3RKXA 1UHWA 3KZYA 3P9IA 2WWYA 1B9NA 1XSVA 5FLXK 4CYDA 3GLXA 1Z91A 3KE2A 4OOIA 3SMDA 2OD5A 2F2EA 2DPDA 3ZR0A 3ELKA 4OIRF 5GHOA 2PFBA 3KP2A 2K4BA 3W6JB 1V8VA 2JPBA 5ANUA 3C1DA 1RUOA 1BC7C 2F5EA 4WK8F 4YG2F 2QJOA 4Y15A 2DQRA 4ILQA 1I27A 4KYXA 2G7UA 2P8TA 3QU6A 2CO5A 3EYIA 3F8CA 2DT5A 3VEPA 5IT9K 1F1ZA 1I9AA 4Q48A 5C7TA 3KLOA 3SXYA 3SFZA 4HDVA 4GO1A 4RGSA 4L5IA 4M9XA 2YVPA 5LPGA 2FNAA 4HVYA 1XDUA 5HOOA 4UNOA 1BM9A 2R5WA 1YW8A 2A3SA 2EV6A 4GGGA 4MGRA 5E1ZB 3FZVA 1W7PA 3CJNA 2PMUA 1R22A 3E6DA 3A6VA 5IW4A 2F5DA 4D0PA 4EM1A 3ZN1A 2GWRA 1UB9A 3M9AA 2A8RA 2DHOA 4IJAA 3CUQB 1QVJA 3KP5A 1LJ9A 4OIQF 1OW2A 1CGPA 3E5XA 3FF5A 4M73A 3WTXC 2RRKA 2FMYA 4KDPA 5CVUA 3H3UA 4GCVA 1MZBA 5FLXZ 5BOXA 4ENKA 1ZN2A 1RI7A 3B73A 1I6XA 3F23A 1BI2A 5E8GA 4HW0A 3J80Z 2LNBA 1FSEA 1P4AA 4MHGA 5K5QA 1V8IA 2QBYA 3ML6A 4MQ9F 3ACAA 3GUDA 5I8UA 1ULYA 5CFJA 2ZFWA 5DDGA 1VIUA 3F8BA 1JKNA 4WF2A 4YPRA 2QJTA 4R8HA 1G4DA 2PG4A 2HYGD 2RGVA 2ZMEA 3T0YA 4U0VA 3REOA 4KG3A 3RKYA 4PCQA 1V3FA 4JZVA 3M7GA 4Q5SF 2H09A 1IRFA 2YVMA 2P6SA 5TRDA 1XSBA 1LB2A 3MGMA 3KZZA 1QO0D 3O69A 3OV8A 1JHFA 3D0SA 2GXBA 1SFXA 4YFKF 3MFKA 4G9YA 3FMQA 3J7AO 2K4JA 3Q9SA 4C9WA 5D6FA 2JTVA 4AWXB 3Q91A 4M72A 2ISZA 1PUSA 1S8NA 1XSXA 4HYEA 3WTTC 4K6EA 4WCGA 3GFLA 2G9WA 2P5LC 1LDDA 1QPMA 1R36A 1IRGA 2YR2A 3IRRA 2O61A 2J5OA 4ENMA 5D5VB 3ZMVA 3CO6C 1K78B 1KU7A 2AZWA 1NFSA 2GA1A 2VC1A 2ZJ2A 2HTSA 4S04A 3N77A 1WI9A 1OMIA 2YX7A 1TTYA 5F1RA 4LG0B 3GF2A 2V1UA 5H20A 2B2KA 4HA8A 1UFMA 3KP3A 2DUKA 2QQBA 1IRYA 3ECHA 4I7HA 3BP8A 2RC4A 4LJZF 4LD5A 2FSWA 1B4AA 4HQMA 1P2FA 2XSQA 2A8QA 3MZHA 3R0AA 2L4AA 4M74A 4NHJA 4CDGA 3MZYA 2Y0MA 2P4WA 4J7HA 1ZLKA 1Z05A 5HS7A 1E2XA 4HBLA 1PP7U 2H6CA 1PPVA 2VOPA 2YPRA 1KGSA 3SZPA 4H0EA 3BPXA 3LAPA 4LLNA 2RDPA 1T0FA 1ZG3A 3MCZA 5HS9A 3F6OA 5GHJA 3WTUC 2DBBA 3AC9A 3ZPLA 1Q33A 2XUBA 1GXQA 3SQNA 1YTYA 2FBKA 4HOBA 4N9IA 1T6SA 2HZTA 2ETHA 5CFIA 2K86A 3ZMUA 5DCMB 3JSOA 3PFIA 5HZXA 2BBYA 4A5NA 5CLSA 3C7JA 3J81K 2FEZA 3EF5A 1IN4A 2KKOA 4Q47A 3QSJA 5FD6A 2EJRA 3IKVA 4A6DA 3F8NA 1OYIA 3WU0A 2DTRA 2QVOA 5FD5A 1UCRA 1Q27A 1XGNA 4KMFA 3FXUA 3RYRA 1I5ZA 5JFRA 1PUQA 2W84A 2HS5A 3A6UA 3R4KA 3O6ZA 1TQMA 4A12A 4MTDA 3CO7C 3DV8A 4HF1A 5BONA 3RTRA 4ZYEA 2EFWA 3O2PE 2CQKA 2O6GE 3E5QA 3H95A 5HDGA 3TO6A 1QBJA 2PNYA 2Q2EA 3QAHA 3HRMA 1QQIA 2JT1A 1MK1A 1ON2A 1J75A 2AXLA 1ZARA 5TJJA 3CLOA 2R7FA 4HZFA 1HX3A 1IW7F 3Q1PA 3F21A 5DYMA 2P7VB 3V8KA 4UVCA 4YFNF 2H27A 1T39A 3P5TA 2A5YB 4MEYF 2A61A 3GO5A 1SD4A 4E70A 4CXFA 2DSBA 4WXCA 1Y0UA 2ISYA 3FHZA 3WE3A 1MP2A 2RKHA 2E1CA 3GFIA 3SONA 3Q2SA 3ABUA 3HOSA 1KQ0A 2RN7A 3G0QA 3IHUA 4BHPA 1R1UA 1P4XA 3WTZA 2EV5A 3F8MA 5F64A 3L9FA 1TQIA 1LEAA 1O7LA 3WE2A 4ENNA 3QRFF 1VIQA 4F7ZA 1HXDA 4P96A 3GZ8A 3BOQA 1V8LA 5J6XA 5CYVA 1VC8A 2LSOA 4L9NA 1F5TA 3EUHA 1B1BA 2XRNA 2O5FA 5LLQA 2J8QA 2LKPA 3V7CA 3QU3A 4WXHA 4ZYGA 2LDUA 2OU2A 1G0SA 1XCBA 4L9VA 3EETA 3E5UA 1YG2A 3F22A 3DEUA 3WTVC 4L0YB 1R7JA 4Y13A 1H9TA 2FA5A 3I4PA 3I9XA 1GXPA 4GXOA 1RZ4A 3X0LA 2FXAA 4I02A 4A6EA 3VB2A 5ANVA 2JZYA 3RPUA 4EJUA 3GWZA 5JVTA 2E7WA 1G6NA 4RGXA 1J59A 4MNUA 1XGMA 1NQYA 3J81Z 1ZG5A 1OR7A 1E17A 1P92A 2W24A 2XAGA 4UXNA 4N1TA 4DQ2A 5L3EA 2BYVE 1P4WA 3LSTA 2QQ9A 2W85A 1ZRCA 4PZJA 4KFCA 1MUTA 4AIHA 2MA3A 2IVMA 2YVNA 1YYVA 5H6RA 2K02A 2QZ8A 2BGCA 1EH8A 2E7XA 3RJPA 1D5VA 3HHGA 3KETA 3KP6A 5LGTA 4JK1X 4I09A 2IT0A 2PN6A 1FNNA 1TW2A 2RQPA 3I0TA 3GWYA 3RDIA 1Q1HA 1ZG1A 4U7BA 3HOTA 5BQTA 2Z9OA 2PLYA 1IXRC 1VRLA 4B09A 3TO7A 3I7UA 1VCDA 1FYMA 4XLPF 3T8TA 3GX4X 2GIVA 2OAZA 2XAQA 1T2KA 1X84A 4M71A 4LGWA 1G3SA 5DV5A 3FX3A 2FVVA 3D5LA 1R1VA 5H6QA 5GHIA 4MEXF 2FKBA 4CO8A 1NHAA 2P6TA 5DPKA 4LB5A 1KU3A 1HKTA 6PAXA 2DW4A 2QWWA 4UV9A 3C3WA 3I71A 1VHGA 5ILVA 5D5WB 3WGHA 3GXOA 1O3QA 1K7AA 4N1UA 1DPRA 1V8TA 1ZREA 1MKMA 2FMLA 4S2YA 2DFIA 1IAWA 4RGUA 3QPHA 1ZRDA 3MWMA 2BE5F 2HTJA 5E18F 2Q8KA 2VXZA 1GA7A 2NAZA 2DLLA 3A6TA 3E6BA 3JSPA 5FSKA 3L09A 3HSRA 4LMYA 2A07F 3X0MA 3GFMA 1JE8A 1MR2A 1U2WA 2QM3A 3DXJF 1WWXA 1FYKA 2KJBA 3ABTA 2LF8A 3DP7A 2HKXA 1JHHA 2XKOA 1BIBA 1FZPB 3P9KA 1Z9CA 4IXAA 4FX0A 4BHCA 5D8LB 1DUXC 4AD9A 3WG9A 4RB3C 3FM3A 5KK1A 3KEOA 5FSOA 3JTHA 4ESJA 1YLFA 4BHBA 3ZMZA 1KQ9A 5AIQA 5FSNA 2M87A 1IN7A 2VE9A 1QZYA 4G8XA 4BAYA 3KP4A 4EMSA 3F13A 2Y48A 1LQ1A 1WRJA 1XGSA 5GHQA 3ZP5A 3MCFA 4N0BA 1V8SA 5ICEA 5LGUA 2C6YA 1ZYRF 4OINF 4ICKA 1EH6A 1IF1A 2ACJA 4S2XA 5KVRA 2JVBA 4IRIA 3M8FA 4PDKA 3E3VA 3F72A 3I54A 1WSUA 1BBYA 4HLYA 5DCMA 2VNPA 2I8TA 1D8KA 2OZUA 3RYPA 1ZRFA 3J7Ye 2F5CA 4U0WA 1YQAA 1XDSA 1ODDA 3GEZA 3K9TA 2RNJA 5BMZA 3ERED 2EFPA 2O3FA 2ELHA 2HQNA 2DO7A 2CYYA 4DYWA 3QPTA 3TDZC 5L3GA 1KU9A 5ISYA 4EGZA 2YVOA 3DPLC 1V8YA 4HX7A 2L54A 3X0QA 5A2QK 3BJOA 4O6JA 3U9GA 1FBUA 3V8JA 4C9XA 3DUPA