5DD4A

Apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
221
structure length
221
Chain Sequence
b'YSSNPTFYLGIDCIIFGFNEGEISLLLLKRNFEPAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGAFGAIDRDPGERVVSIAYYALININEYDRELVQKHNAYWVNINELPALIFDHPEMVDKAREMMKQKASVEPIGFNLLPKLFTLSQLQSLYEAIYGEPMDKRNFRKRVAEMDFIEKTDKIDKLGSKRGAALYKFNGKAYRKDPKFKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR AraR
publication title A novel transcriptional regulator of L-arabinose utilization in human gut bacteria.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Transcription regulator
total genus 55
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dd4A02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5dd4A01
3DKWA 1B9NA 1FX7A 1TLHB 3KFWX 2A8PA 2COMA 3X0QA 4RB1A 4M71A 4TV7A 2QUFA 1FT9A 4AIHA 4AD9A 2XASA 1SOIA 1J2XA 5JR3A 2DHOA 1Z7UA 3WG9A 2XRNA 1BOAA 3Q93A 5D8LB 5H6RA 3FXUA 2QM3A 3E5QA 1AOYA 3I59A 1LVAA 3QRFF 3K0LA 3E6DA 4BYYA 2IA0A 1LDJA 2M8EA 1V8SA 3FJYA 2RNJA 4S2WA 4MTDA 2YU3A 4YPRA 2QKMB 2M5WA 4L9TA 1UFMA 1GXQA 2L4MA 4M72A 5C8LA 3IRQA 3HHGA 4Q47A 3A6UA 4M74A 2PI0A 5D4RA 3NRVA 1YTYA 2Y0MA 2G9WA 2FU4A 1G3YA 3QPHA 2B0VA 2VC1A 2QYOA 1QVJA 1BI2A 2CWEA 1MR2A 5LHHA 3E3VA 5D4SA 1BM9A 1MJ9A 4RGUA 2XAGA 3FX3A 3KP2A 3F8NA 2DK8A 2G7UA 4CGZA 1HSJA 3HHHA 2RDPA 4KMUX 2EA4A 1HW2A 4HBLA 4ZZLA 2FMYA 4A5NA 1RIOH 2KJCA 1U8RA 3RI4A 3LA7A 2EFNA 2H6BA 3HYQA 5HVQC 2OA4A 2EFQA 3EETA 3T0YA 3Q2TA 4Z2YA 1FY7A 1QQIA 4LG0B 2YX4A 2PQVA 4Q5SF 1L3LA 3ABTA 4I02A 4R79A 2AZWA 5L3GA 1TW2A 4HQMA 4H0EA 2FSWA 4YFXF 3I54A 4MGRA 2EFPA 2ZO4A 4P96A 2MLGA 2ICJA 1KHZA 3EF5A 5LBQA 1KGSA 1FP1D 1TNTA 2RC4A 3ID9A 2NS0A 5FFXA 2P6TA 2GXGA 1HKTA 3P6YA 3WU1B 3L7WA 2Q9PA 1P4AA 4FT8A 4RB3C 2JZYA 1SD7A 1IN5A 5LEKA 1QBJA 2QLZA 1GA7A 2FMLA 5D5UB 3GW2A 3GVAA 2XV4S 4ESJA 3MAJA 1P92A 4OIPF 4F7ZA 4P9UA 4WXDA 2ZXJA 3X0SA 3Q91A 1STZA 2ZMEA 2MA3A 1IXSB 5CVJA 3HSEA 5ICGA 4KUMA 3C18A 1LEBA 1ZG1A 2GAUA 4YFKF 3D5LA 5CVUA 2DAOA 1XMKA 4DYWA 1W7PB 3FK9A 4XBFA 3C1DA 1RYAA 2W24A 1SU2A 4MTEA 3M8FA 3OGAA 2STTA 1PP8F 3T5XA 3GO5A 2FKBA 1W7PD 2PMUA 1Z9CA 5BOXA 3BROA 1FZPB 1ZHFA 2VC0A 1CF7B 4S04A 3GFLA 1TNSA 2DUKA 2ZNZA 1ZRFA 2DSDA 2VT3A 5IT9Z 4L0ZB 1Z1DA 1I9AA 1K78B 3HSRA 2QQAA 2A5YB 4HLXA 5HLIA 3ZMSA 4NQWA 2I6KA 1NFSA 4N9HA 3EXQA 1KQ0A 3GWZA 2BYVE 3LFKA 4JZTA 4S2XA 4S05A 1ODDA 2F5FA 3IWZA 2B2KA 3FCMA 1ONVA 1MDMB 4OU0A 4WX9A 1KU2A 5LGUA 5GHJA 3HOSA 4HVYA 4S2VA 2MH9A 4PDKA 4ZZDA 3LQRA 3A6VA 4CZZA 5TRDA 3KP7A 5H20A 4OIRF 1XSDA 2HKOA 3EEUA 5TJJA 3RPQA 1R1TA 1Q27A 2KJBA 4LB6B 4RGRA 4GYIA 3V4GA 1IXRC 4LD5A 1J0RA 3O52A 5ILUA 2XUBA 3GFIA 1ZLJA 2MLKA 4YFNF 4UNOA 1F1ZA 4OIOF 3Q4IA 1Q1HA 3R4KA 5JI6A 3R03A 3F22A 1PPXA 1XSBA 1V4RA 5A2QK 5HS7A 2AS5F 1FSEA 4JQFA 4EVIA 2VXZA 1YFHA 1OMIA 3M9AA 1Z6TA 2OQRA 5D5VB 4O6JA 2XHKA 1XMAA 5BPIA 3E6CC 4L0YB 1PUQA 3HOTA 4A2UA 4U7DA 3JSPA 3H95A 3N4MA 5GHQA 1XD7A 2NRAC 1D3YA 4CXFA 3JAMZ 2J8QA 2A8RA 2Z33A 1UCRA 4A0ZA 1R23A 5IT3A 1UHMA 4HX8A 3HRUA 2V79A 3F6OA 2M45A 3DP7A 1O3SA 4ZH4F 2DSCA 2FBHA 1FSHA 3J81K 4B8XA 1FBSA 3C7JA 3RIRA 5K5QA 1Z91A 1Z6RA 3HIFA 1OKRA 4IRHA 2DLLA 3R61A 1ZGJA 3I64A 2G74A 4HX4A 1PUNA 3LSTA 1VTNC 5HDKA 3AC9A 2E7XA 5LRSA 4M9SA 2KIUA 3ZMZA 2DPUA 1RI7A 4HF2A 1JRKA 5L3EA 4GGGA 4HW0A 5K5OA 2HGCA 4CHUA 1XDSA 1ZG5A 4KDPA 2QWWA 1T39A 2PLYA 3SZPA 3PQKA 1RRQA 3WE3A 2GIVA 2H94A 3KETA 4IHSA 1LNWA 4IF4A 4UVAA 3KP4A 2ACJA 3BOQA 1OPCA 2FE3A 4WCGA 1VK6A 5GHMA 5DCMA 1FYMA 1T0FA 1FNNA 5CFIA 1YIOA 3F6VA 3MZYA 4YOQA 3O6ZA 1Z05A 3TO6A 1BI1A 1F4KA 4XSZF 3IC7A 3X0JA 4IRGA 3BZ6A 4UV8A 3G73A 2UXXA 2O8XA 6PAXA 1S3JA 1JKNA 1BC7C 3K1PA 5DUIA 2PEXA 4B09A 3O8SA 2NNNA 4RGXA 5L3BA 3V8KA 1HXDA 1BN5A 4XLNF 4AVPA 2Y75A 3ECOA 5DV5A 3JSOA 1B1BA 2LF7A 1P4WA 4KYWA 3JTHA 4FX0A 2ADUA 4MEYF 3RKYA 2MH2A 4I01A 1ZLKA 4UVCA 3LAPA 1V8IA 4I0BA 2FRHA 3SMDA 4Y13A 1R1UA 1FYKA 4HQEA 1FBQA 1IRGA 3ACAA 3X0MA 3DUPA 3LQQA 1KU9A 2O5FA 4ZYEA 2O61A 1WWXA 1U20A 1V8UA 2EV6A 2WC2A 2JPBA 2GA2A 1B6AA 3WTYC 2HYFA 5IW4A 3N97A 2A6EF 3HUGA 5FB2A 2P5VA 1IN6A 5H6QA 1MJBA 3M8EA 4G94A 1RNLA 5D6FA 2YR2A 4EGZA 2PJPA 1XN7A 2EV5A 4ASNA 1QZYA 1FOKA 2V1DA 3MZHA 3WGGA 3U2RA 3I71A 5DUKA 1PPVA 3MEXA 4QWQA 3KZYA 3F13A 1BC8C 1HQCA 3I53A 2KRFA 1X3UA 3CUQA 2IVMA 1JGSA 3E57A 3PQJA 4A0YA 1WSUA 2BEOA 4DNCA 3F21A 3VODA 5GHNA 3NEUA 4U0VA 2PN6A 1PVFA 2L54A 4KN7X 1ON2A 4HAMA 1ZRDA 1S29A 2IP2A 4AWXB 2A6HF 4EM1A 4IXAA 2FQ3A 4ENJA 1O57A 5LGTA 3O2PE 3V7CA 2CO5A 1T6SA 3I0TA 2RN7A 3CUOA 5D5WB 3DKUA 2YVMA 3GRNA 1R5GA 3TQNA 1MZBA 2WTEA 3RKWA 1R67A 4D0PA 3RYRA 1W5TA 2K7LA 4UV9A 3M7GA 5GHPA 2BE5F 3BAPA 3O3KA 3BDDA 3WTSC 5ICEA 2HWVA 4M9ZA 2QJTA 1U3EM 4NFXA 3K9TA 5BS6A 4M9XA 4O5VA 1E2XA 4JK1X 3QP5A 4HV6A 3P5TA 3CLOA 2RKHA 4K2EA 5LHGA 1Q54A 5DDGA 3KZZA 4KA4A 2XVCA 3PFIA 2C6YA 2E1CA 3LAJA 2WV0A 3J80Z 1PDNC 5FSMA 4C9XA 2MBFA 1V8VA 2LKPA 2DSBA 4BHCA 1SD5A 3BM4A 2VT2A 4CO8A 5ILVA 2B0LA 3N9UA 5LEJA 4G7ZF 5BPDA 2DT5A 3DEUA 3ZMVA 3F8MA 5JVTA 4WXHA 3FHZA 5C7QA 1IZ1A 3E6BA 2VBYA 1R36A 1SFXA 3VFZA 5JFRA 2HTJA 2KIFA 2JSCA 2Q8KA 3HTSB 1I27A 4EM0B 1R7JA 3TOBA 1MP2A 1BI0A 4CDGA 2A8SA 3EESA 3DF8A 3ZMTA 2W4EA 4I0AA 1BI3A 3U1DA 3WTTC 1Y0UA 1ON1A 3WTUC 2QBYA 5DCMB 1LJ9A 4L9VA 5CVIA 5ILSA 2RVCA 4YIIA 4RAYA 2ZKZA 3KE2A 5DD4A 3Q1PA 5AONA 3WE2A 3WTZA 5A2QZ 1H9TA 4MPOA 3P7NA 4XLPF 3GZ5A 2FVVA 4RB2C 3A6SA 1SZ3A 1ZG3A 1ZYRF 4Q48A 1SFUA 4YIFA 1I1SA 2NNYA 1JHHA 2H27A 2VBXA 2ZCWA 4UXNA 1GHCA 4AIJA 3N77A 2DTRA 5BMZA 4XSXF 1IRYA 1EH8A 4WXCA 1KQ9A 3X0NA 2O03A 3ZN1A 2YVPA 2XAQA 4IPAA 2JRTA 3F8BA 3IHUA 3J81Z 4G9YA 4ZYGA 2CQKA 2VBZA 2HEOA 2RRKA 4NFWA 1MKMA 2VE9A 4YG2F 1USTA 3ROUA 4A6EA 1U78A 2H6CA 1RUNA 2DQLA 1FLIA 5L3CA 3J80K 4IRIA 4HOBA 2F5DA 2HR3A 3FM3A 3B02A 5CVRA 1G0SA 1LEAA 2XAHA 1FBUA 3P9KA 1B4AA 4UUVA 5ANTA 3ZN0A 2GZWA 2DBBA 2HFHA 4ENKA 4Y15A 1XGMA 4BH9A 5AIPA 3X0PA 2IJLA 4G6QA 2CG4A 2E1NA 2V1UA 2LSOA 2XKPA 5E17F 1GXPA 2FBKA 3RYPA 2G73A 5LPGA 3SQNA 3LWFA 4KIBA 4EGYA 1HBXG 3CUQB 1TW3A 1IN8A 4G8XA 1DPUA 4PZJA 4JZVA 4Y17A 3IWFA 1FWZA 4ENMA 5EEGA 5HDGA 3ABUA 3TOAA 2V6CA 3V7RA 1RRSA 1QO0D 5HLHA 1MQWA 1MQEA 5L3DA 2DQRA 4FX4A 3KLOA 5ED4A 1H9GA 3L85A 3KP5A 1K26A 2VNQA 1D5VA 5ICFA 4N1TA 1D8KA 1TQMA 4MQ9F 3V8JA 1V8TA 2XSQA 2X4HA 4OMYA 5GHOA 3D0SA 2V9VA 3I4PA 3WTVC 1SFEA 4GYGA 1I1GA 1P6RA 4AIKA 4ESFA 2OU2A 1UB9A 2YPRA 3W6KB 4BQAA 3F8FA 1YW9A 2A69F 3ZR0A 2IA2A 3ISPA 4L5IA 1KA8A 2OD5A 1BIBA 5LRRA 2TDXA 1ZREA 2FXAA 3E97A 1XB4A 3DPLC 4KFCA 1E17A 1BIAA 4KICA 2YVOA 4CICA 3S2WA 1HSTA 5K1YA 2EJRA 4PCQA 3EDPA 1TTYA 1XSAA 4KNYA 4BNCA 1HW1A 1OYYA 4ICKA 5F64A 3OOPA 2O0YA 2Q2EA 1D8JA 3T8RA 1WKMA 3U9GA 2LF8A 3F23A 4I09A 1QPMA 1X83A 3WODF 3U53A 3ZPLA 4I7HA 2YYHA 1O7FA 2VONA 1A04A 1Q33A 3MFKA 2L01A 2H09A 1U5TA 3SONA 4WK8F 2VOPA 5FSLA 3X0OA 1YW8A 3HRTA 1AWCA 4R1HA 4HV5A 3ECHA 2QBYB 2P6SA 5E8GA 3X0LA 4KYXA 5E8IA 2ISYA 1V8LA 5DPKA 1U2WA 3IKVA 1XGSA 2Z99A 3EUHA 1YG2A 3H92A 4IJAA 3W6JB 2ZNYA 4ZG0A 3BJ6A 2W57A 2GWRA 1WQ2A 3CDHA 2QQ9A 1CGPA 3WU0A 2GT4A 4HLYA 2QVOA 1SAXA 3FMQA 4L5JA 2A8TA 2A07F 2HDCA 1VC8A 5CYVA 1V8YA 1IF1A 2EV0A 4ILQA 3CNGA 5K5RA 3IKTA 1V8WA 2FEZA 5HZXA 1F9NA 2W25A 1KTGA 3ZMUA 2HS5A 2XROA 4N9IA 4NHJA 2DK5A 2ZFWA 3V8LA 4IHTA 2K86A 3MCZA 3QPTA 4G7OF 3MDIA 3WHWA 3HSFA 1DUXC 1IUYA 3TDZC 3SZTA 2GB5A 2O3FA 1SD4A 3FXQA 3R60A 3FF5A 4M73A 2O5WA 3FMSA 3CUQC 2WWYA 3MWMA 4ENNA 1NFZA 2P5LC 2L02A 4KMFA 3GX4X 1VHGA 1J5YA 3GXOA 2GA1A 4P5OA 3KP6A 4LLGF 1G3TA 3BJAA 4HA8A 4LMYA 5F1RA 2X0LA 1G4DA 1F5TA 4A6DA 3GZ8A 1I6XA 1KYZA 1MJAA 2KDVA 2DFIA 4A0XA 3BHOA 3KEOA 2J5PA 2OBPA 2ELHA 1XSXA 2BBYA 1HKQA 1S7OA 3J7AO 3E5UA 1S6LA 3FSPA 2LNBA 4MQVA 1XGNA 1SJYA 2P4WA 3ZQ7A 2GXBA 3SFZA 4KIGA 1QNTA 5FFZA 2EFOA 1TBXA 2XAFA 5EEHA 3X0RA 1J7KA 1RUOA 2K4JA 5FSIA 1W4MA 2OQGA 1VHZA 3EQLF 5FD5A 3FWEA 3WTWC 3SXYA 3WGIA 1S7AA 1YQAA 4CYDA 2STWA 1QZZA 1S8NA 4QLCU 4L9JA 2A3SA 1VIUA 2QQBA 4LFUA 2I8UA 3RTRA 4FHTA 2YSRA 3L9FA 4I98B 1R22A 3DPTA 3CO7C 2HQNA 1DP7P 2QJOA 3F8CA 2K4BA 5D6EA 5HDNA 2P5KA 4LLLA 1T2KA 2W85A 5L3FA 4EV0A 4KIFA 1XCVA 2VE8A 5HOOA 2GT2A 3HRMA 2KIMA 1O3QA 1HZTA 1B59A 3BPXA 3GF2A 5C7TA 1USSA 2UXNA 2Y48A 3K69A 3RH7A 3BPVA 3HHJA 3L2CA 2RGVA 3COUA 2ZBKA 4V14A 3GG6A 2VNPA 3BP8A 3RDIA 3C3WA 2VODA 2ESNA 3MGMA 1TQIA 2BGCA 3REOA 3EYYA 4UVBA 2PQ8A 3I7UA 1KU3A 1FPQA 2JT1A 3MQ0A 1KU7A 3CJNA 1PP7U 3R0JA 4EQQA 4M6XA 4KG3A 2VBWA 3P9CA 2O6GE 2PBIA 2R3SA 3QOPA 3VEPA 4ETSA 4YPHA 3IRRA 3ZMDA 4RS8A 1J9IA 3A6TA 3QU6A 2G7HA 3JW4A 1O3TA 2BV6A 3H3UA 3CTAA 3B73A 1G3SA 1TQPA 2YVNA 5FSOA 1U5TB 5FGMA 1IXCA 1K2EA 1EH7A 5I8UA 1EV7A 1XSCA 3F6AA 4S2YA 3TKYA 1PUSA 1NQZA 3QAHA 1ZAOA 2FNAA 1XCBA 1DPRA 2Z3YA 3FMRA 2R7DA 3ELKA 3FZVA 3ULQB 4MEXF 4LLNA 1YLFA 3KVHA 4KN4X 2JVBA 1OYIA 4ZYDA 4L18B 2QENA 5DD8A 2UZKA 4P9FA 1KQ8A 3SHDA 1F3YA 2FF4A 5FSKA 3O6BB 3MCFA 5HS9A 1X84A 4OIQF 4U0YA 2CW0F 1YO5C 4OINF 4EMSA 1V8MA 4IJXA 2PNYA 1G3WA 2DI3A 2J5OA 3BY6A 3DV8A 2DO7A 1G6NA 3NQOA 5CFJA 1P4XA 5CVVA 3ERED 1IAWA 2A68F 3T8TA 1RZ4A 2QZ8A 2PFBA 3GLXA 1K7AA 5GHIA 5E20A 2P8TA 2CL3A 4BAYA 5ANWA 1VC9A 4BHPA 2ISZA 3E6MA 2AXLA 1MK1A 1HW5A 2MC3A 2M30A 1KT9A 3FXRA 3FM5A 4EM2A 5KVRA 1LDDA 3RPUA 3KCCA 4ESBA 1K6OA 2KKOA 2D1VA 3Q5FA 2DU9A 2DW4A 2PMHA 1YW7A 4G7HF 2HZTA 1MGTA 3GUDA 3QSJA 2IA1A 4BXUA 2JTVA 2A6TA 3GYHX 1L0OC 4PGHA 1IRFA 1K79A 3G0QA 4UHTA 2HOEA 3K2ZA 2I8TA 1B9MA 5D8KB 3KEQA 3F72A 4LB5A 1J59A 1PPWA 4KG4A 3DFGA 1REPC 1O3RA 4KT5C 1MUTA 2R7FA 3BWGA 2EB7A 2XIGA 3I5UA 1X51A 4LK1F 4N0BA 1OR7A 5DCFA 1IN4A 5KK1A 3I58A 4ZYHA 4MNUA 4HDUA 3H3ZA 2ICKA 2Q0OA 2HQRA 2YX7A 3K1NA 1EH6A 3L00A 1VIQA 5DYMA 2FOKA 4WF2A 4O3MA 3GWYA 1QGPA 2F5CA 4IVNA 5JHUA 4U7BA 1UHWA 2B06A 1V8NA 4LGWA 3I9XA 1PUEE 5IW5A 2K02A 1DDNA 3F3XA 1LB2A 3RJPA 2RV8A 5E1WA 2LDUA 5ICCA 5E18F 5FLXZ 2L4AA 1SMTA 2JPCA 4M6YA 3ZP5A 1BBYA 5ISYA 3K1MA 3GFMA 1IN7A 1WRJA 3SHFA 3Q9SA 3X0KA 1P2FA 3J7Ye 1SD6A 4HYEA 3I59B 2D45A 5ANSA 2HTSA 3O61A 1R00A 1V8RA 1JXSA 4I2OA 4HX7A 3VB2A 4XRFA 2F2EA 1ZN2A 2OZUA 2IPQX 3Q9VA 1ZH5A 3HRSA 1SMYF 4HF1A 4EJUA 1OYWA 1ZRCA 4NB5A 1OW2A 2IRFG 5FO5A 2UWMA 3WTXC 2KDWA 5LHIA 1U5TC 3X0IA 4LJZF 5HLGA 4JBAA 2IT0A 2NYXA 3QP6A 2GQQA 3COAC 2PG4A 1NQYA 4OMZA 3EYIA 5DEQA 1G9QA 1JHFA 2XAJA 5HS8A 1J75A 1KYWA 4WWCA 2R5WA 2EFWA 2CFXA 1ZARA 4HDVA 1XSVA 3R6SA 3DXJF 1MD0A 2E7WA 1YS7A 1LDKB 1XDUA 3VOEA 1I5ZA 5IT9K 4HFQA 3OV8A 3DQVC 3V7SA 4G6DA 1FYLA 3BJOA 3GFJA 4LG0A 4RAZA 3Q2SA 2V1XA 1C0WA 3TO7A 2M1BA 3HYIA 5E1XA 2XKOA 4A12A 2FA5A 2A61A 4RGSA 2P7VB 2EA2A 3ML6A 2CSOA 1BJAA 3CO6C 2W84A 2M87A 4K6EA 5AIQA 1VRLA 5J6XA 4GXOA 4Q4ZF 5ANUA 2VN2A 2ZJ2A 3M1EA 4DQ2A 1R58A 3R0AA 2F5EA 3T1BA 5F6FA 3TGNA 1TUMA 4KTBA 2CGPA 2Z9OA 2ETHA 3HTUA 4PGGA 1XGOA 1IW7F 5ANVA 2EK5A 2ESHA 3GZ6A 3I7VA 1FP2A 1W5SA 3TO9A 4GO1A 1ZGAA 4MHGA 5FLXK 4HF0A 2Z5UA 2K27A 3P9IA 1NHAA 4A5MA 4HZFA 5FSNA 1WI9A 1HX3A 1YS6A 5FD6A 2ZMEB 2FBIA 3QU3A 2O1CA 3WGHA 5LLQA 1GVJA 3LA3A 1LQ1A 4U0WA 1W7PA 2RQPA 3LA2A 4P55A 2OAZA 3IL2A 3E5XA 2IW5A 2D1HA 1T98A 3ZR1A 1R5HA 2MD5A 4C9WA 4EJVA 4JZUA 1H0MA 3L09A 3O69A 2P7CB 1JE8A 4RB0A 2HYGD 1O7LA 3KP3A 2A8QA 2HKXA 1CF7A 5LGNA 5CJ9A 1V3FA 4U88A 4E70A 2CYYA 5BQTA 4EJTA 3JAMK 3KLNA 2D2WA 3AAFA 1ULYA 5J8FA 3FFUA 2DPDA 4R8HA 1T38A 1K78A 5J8CA 1R1VA 2L3DA 4BHBA 1U6GA 4JZSA 4GCVA 4EJWA 3JTGA 4L9NA 5ERIA 4N1UA 1MDMA 2FNPA 3TDUC 5E1ZB 5BONA 4LK0F 3GEZA 3RKXA 1VCDA 1FC3A 2OZ6A 5CLSA 2XGXA 4EJOA 3G3ZA 4ON0A 1HKSA 2VOOA 2EWNA 2NAZA 4OOIA 5D5XB 1YYVA 3MDGA
chains in the Genus database with same CATH superfamily
3DKWA 3OSFA 2AQFA 2LK2A 1B9NA 1FX7A 1WFXA 2WAFA 1TLHB 3KFWX 4IO9F 3A01A 2A8PA 2E5ZA 2COMA 3X0QA 1OQYA 4RB1A 4M71A 4TV7A 2F6CA 2QUFA 2QSGX 1FT9A 2R0QC 4AIHA 1VI0A 4AD9A 1PUFA 1ETYA 2XASA 4PJ0C 2JMWA 1SOIA 1E3PA 2VLAA 1VQPI 3UNGC 1J2XA 4AUXA 5JR3A 3HDDA 2DHOA 3BG3A 4IKFA 1Z7UA 3WG9A 3PO2J 3ZXSA 2XRNA 1BOAA 3NARA 3Q93A 4A3EJ 1G8XA 4PUSA 5J3LA 5D8LB 5H6RA 2VI6A 3PJRA 3FXUA 3OYNA 4F3QA 2QM3A 3E5QA 2VKVA 1AOYA 4B1RA 3S1RJ 3I59A 5FKMA 3BZKA 5CQEA 1LVAA 3LSMA 3MMYB 3TW6A 3QRFF 3K0LA 3E6DA 4BYYA 2IA0A 1LDJA 2LP0A 4W97A 2M8EA 1V8SA 3FJYA 2DA5A 2RNJA 3SDBA 4MTDA 2YU3A 4S2WA 4YPRA 2QKMB 5F1JA 3HOZJ 1X2MA 4F92B 2ZXWH 4J19A 1R71A 2M5WA 4L9TA 1CQTA 1ETVA 1UG2A 1UFMA 1GXQA 1X1DA 2L4MA 4M72A 5C8LA 3IRQA 3HHGA 4Q47A 2HXIA 4B3XA 3A6UA 4M74A 3I55I 2I10A 2PI0A 5D4RA 3NRVA 1YTYA 2Y0MA 3MN2A 2M34A 2G9WA 2FU4A 1G3YA 3QPHA 4BJ6C 2VC1A 2JA5J 2B0VA 2QYOA 1QVJA 1BI2A 2CWEA 1MR2A 2VXDA 5LHHA 3E3VA 5D4SA 1BM9A 3IAS2 2L2OA 1IRXA 1R4NB 1QU3A 1MJ9A 4RGUA 2IGOA 5FRNA 2XAGA 1IDZA 3FISA 3FX3A 4Z6YA 3KP2A 3F8NA 3IP4B 2DK8A 4XL9A 2G7UA 4CGZA 1HSJA 3HHHA 4HSTA 1IV6A 2RDPA 4KMUX 3NWSA 2LLKA 2EA4A 3Q3SA 3SZGA 5B66C 1HW2A 4HBLA 4ZZLA 2FMYA 2MGQA 4LITA 4A5NA 1RIOH 2KJCA 1XC5A 3RQIA 1U8RA 1IV8A 3RI4A 3LA7A 2EFNA 4ZDOA 3CZ6A 2H6BA 3ZQFA 3HYQA 3NWTA 1W0UA 5HVQC 2OA4A 2EFQA 1WCMJ 3HKZN 3EETA 3T0YA 3Q2TA 4Z2YA 1FY7A 4Y4RA 1QQIA 4LG0B 2YX4A 4AM3A 3K4KA 4BQQA 2PQVA 2Z1DA 4Q5SF 3EPZA 1L3LA 2CQ7A 3AKZA 4E7SA 5E3NA 3ABTA 4I02A 2AO9A 1A6QA 1IO2A 4FE4A 4R79A 2AZWA 1ZKGA 2DYSH 2ZMEC 2GOXB 5L3GA 1TW2A 1OCOH 2D5VA 4HQMA 4H0EA 2FSWA 2K9LA 3I54A 4MGRA 4YFXF 3K6GA 2EFPA 3ZQIA 1ZELA 2KZGA 2ZO4A 4P96A 3OYAA 2MLGA 1UAAA 2ICJA 4JX4A 1KHZA 3RSNA 1IJWC 3FDYA 1N25A 3EF5A 5LBQA 1KGSA 3B6CA 4KT6A 1FP1D 1TNTA 2RC4A 2X51A 2Y0SA 4XM3A 3ID9A 2NS0A 5FFXA 1WI3A 2P6TA 2P0WA 2N8GA 2GXGA 3S1MJ 1HKTA 3P6YA 3WU1B 3L7WA 2Y69H 2Q9PA 1JT6A 1P4AA 4FT8A 5GTIC 4RB3C 2HNHA 1VQMI 2JZYA 1SD7A 1X4OA 1IN5A 5LEKA 1QBJA 2QLZA 5EEAA 1GA7A 2K9SA 1F36A 2FMLA 3KX2A 5D5UB 2NOJB 2EILH 4M3GA 3GW2A 2BHYA 3GVAA 2XV4S 1WJEA 4C9YA 3J7YJ 5GAGJ 4ESJA 2KT0A 3BT9A 3MAJA 3FKIJ 1P92A 4OIPF 1IG7A 3K4NA 4F7ZA 4P9UA 4WXDA 2ZXJA 3X0SA 3DTKA 2NVUB 4UUSA 3Q91A 1JUMA 1BOBA 1STZA 2MA3A 2ZMEA 3TP3A 5IP9J 1IXSB 3L2RA 1JKRC 5CVJA 4V2GA 3KEYA 3HSEA 5KCMA 5ICGA 1MBKA 4KUMA 3C18A 3OR2C 4QSHA 1LEBA 3NAUA 1ZG1A 2GAUA 3S17J 4E7IA 4YFKF 2X6WA 2LKXA 2MYSA 3D5LA 2DAOA 1XMKA 5CVUA 1W7PB 3FK9A 4DYWA 4XBFA 3DLLF 4XKBA 2DMPA 3LFUA 4YEJA 3C1DA 1HDDC 1BR1A 4HNTA 1RYAA 3RZOJ 4YIRX 4X1EA 2W24A 1RKWA 4FTHA 1SU2A 4MTEA 3M8FA 5FJ8J 1OR7C 3OGAA 1ZGWA 2STTA 1PP8F 2KIQA 4HRIA 3T5XA 3GO5A 3S93A 2V9KA 2FKBA 2X6XA 3GMEA 2WY7Q 1W7PD 2V7FA 3JRIA 4CA0A 2PMUA 4H4KC 3L2UA 1Z9CA 5BOXA 3BROA 1RPWA 3E0JB 2DFHA 1FZPB 2NXNB 1ZHFA 2VC0A 1CF7B 4S04A 3GFLA 2E1MB 1TNSA 1X1PA 2DUKA 2ZNZA 3X2QH 5M5XJ 1ZRFA 2XB0X 4BQNA 1YITI 4BE1A 4NC8A 4PFOA 4RLFA 4XLAA 2RQQA 3G6EI 2DSDA 2VT3A 5IT9Z 2BW3B 2CV2A 1Z1DA 4L0ZB 1I9AA 1K78B 3HSRA 2LY1A 2QQAA 2A5YB 3IH4A 4HLXA 4W1UA 5HLIA 3ZMSA 4NQWA 2R93J 2I6KA 3BQYA 1NFSA 4N9HA 3EXQA 1KQ0A 2BY3A 4DJAA 3GWZA 2BYVE 1HDPA 3LFKA 3TBIA 4JZTA 5B1AH 4S2XA 4S05A 1ODDA 5GPCA 2F5FA 3FK7A 3H5AA 3IWZA 1ONVA 4RM2A 1MDMB 2B2KA 4OU0A 3FCMA 1G59A 2PJRB 2O7OA 3K4MA 4BY1J 4A3FJ 2AQEA 2BZTA 4E7KA 4WX9A 1I3QJ 1KU2A 1VF9A 5LGUA 2WB1A 1GT0C 5GHJA 2CW8A 2M7AA 4XRSA 4IHWA 4XLCA 3HOSA 3DCFA 4HVYA 1ETWA 2A5WA 2LR8A 5F0HA 4S2VA 3PIPF 1R9TJ 2MH9A 4PDKA 4IZZA 2AXTC 4ZZDA 3HPGA 4FISA 3BZCA 3SDGA 2VPRA 3LQRA 3A6VA 4CZZA 5TRDA 5E3LA 3KP7A 5H20A 4OIRF 2R5ZA 1XSDA 2R7ZJ 2HKOA 3EEUA 3S14J 3TW7A 2EIKH 5TJJA 1FIAA 3OIQA 3H35A 2MG4A 2HXOA 3H36A 3RPQA 4P1WA 5IYBJ 2W4SA 1R1TA 1Q27A 4AYBN 1MNMC 2KJBA 4LB6B 4RGRA 4GYIA 1LE8A 3V4GA 4JOMA 4IEJA 1IXRC 5TISC 4XKWA 3S1NJ 4LD5A 1J0RA 3K7AJ 1PUFB 3O52A 1RR8C 2JUCA 5ILUA 2XUBA 3L1PA 2Y30A 3GFIA 1OCRH 1R6RA 1ZLJA 1QVUA 2XRLA 4HNVA 2MLKA 2L7FP 1A6IA 4YFNF 3E1SA 4CYCA 5C3EJ 2L9SA 2DOEA 5B3SH 2M0MA 2Q1ZB 4UNOA 3F0CA 3VYUB 2IS6A 1F1ZA 1GV5A 2H8RA 4OIOF 3U21A 3Q4IA 1A36A 2OTJI 1Q1HA 3R4KA 5JI6A 3R03A 2VKDA 3F22A 1PPXA 2IAIA 2IS1A 4IQJA 2O9LA 1V4RA 1XSBA 3H9JA 4UB8C 5A2QK 4XN3A 5HS7A 4RBOA 2AS5F 3OWTA 1JKPC 3G1LA 4C2UA 4FASD 3DTIA 2LFBA 3PM1A 2MFZA 2F4IA 1FSEA 4JQFA 1X4PA 4EVIA 5LFAA 3TEDA 2VXZA 1YFHA 1OMIA 3H0DA 3M9AA 3I4NJ 1Z6TA 2OQRA 5D5VB 1T33A 2F4OB 5EJCA 3C2GA 1ETOA 2ID6A 4O6JA 2XHKA 1XMAA 5BPIA 1A5JA 3E6CC 4L0YB 1PUQA 1U9OA 3HOTA 4A2UA 2JSPA 4U7DA 3JSPA 3H95A 3N4MA 5GHQA 1XD7A 2NRAC 1D3YA 1TWGJ 3SYTA 4CXFA 1FOYA 2GBYA 2IXSA 3JAMZ 4HSRA 2J8QA 1VQOI 2A8RA 2Z33A 1UCRA 1UMQA 3CCUI 1ZK8A 2KMUA 4A0ZA 3KPHA 1R23A 5IT3A 3M3YJ 3PIOF 1UHMA 4XQFA 4HX8A 1XTAA 2V79A 3ASNH 2M45A 3F6OA 3HRUA 3H3VK 3DP7A 1O3SA 1Y8RB 4ZH4F 2DSCA 2FBHA 1FSHA 2DOAA 3J81K 4B8XA 1FBSA 3C7JA 4CCNA 2IS4A 3RIRA 2RAEA 5K5QA 1Z91A 1Z6RA 3HIFA 1OKRA 2QF7A 4IRHA 2DLLA 3R61A 1ZGJA 4BBSJ 2K3PA 3KYLA 2DT7B 3I64A 2G74A 5F27A 4HX4A 1PUNA 3H9GA 3O8HA 3LSTA 1VTNC 1TZLA 3M07A 5HDKA 3DLAA 3AC9A 2E7XA 4BACA 4PJMA 2JUGA 5LRSA 4M9SA 2KIUA 3ZMZA 2DPUA 3DEEA 1RI7A 4A93J 4XIDA 4HF2A 1JRKA 5L3EA 3QYEA 4GGGA 4HW0A 5K5OA 2R7SA 4BGDA 4IL6C 2HGCA 4CHUA 1XDSA 1ZG5A 4KDPA 3OYFA 2QWWA 1T39A 2PLYA 3QYFA 2X85A 5J1YA 3SZPA 4BDZA 1SFKA 3PQKA 2X9DA 1RRQA 3WE3A 2GIVA 2CRGA 1TP4A 2H94A 3KETA 1VQ4I 4IHSA 1LNWA 4IF4A 2LD5A 4UVAA 3KP4A 4JX5A 3S32A 2CUEA 2ACJA 3BOQA 1OPCA 2B63J 2FE3A 4CH7A 4WCGA 1VK6A 5GHMA 5DCMA 1FYMA 1T0FA 1FNNA 5CFIA 1YIOA 3F6VA 3MZYA 3D1NI 4YOQA 2GIZA 1MNEA 2LRDA 4MFDA 3O6ZA 3A0BC 1P7JA 1Z05A 3TO6A 2FUG2 1BI1A 1F4KA 4XSZF 3HEFA 3IC7A 3X0JA 4IRGA 1FOXA 1BW5A 3BZ6A 3A4CA 4UV8A 3OYCA 3G73A 2Y0SN 2UXXA 1D0ZA 2O8XA 4HG2A 4C30A 6PAXA 3RZDJ 1S3JA 2E1MC 3GTMJ 1JKNA 1BC7C 1BL0A 2K5CA 3BQZA 3K1PA 5DUIA 2PEXA 4B09A 2EIMH 1ZQ3P 3O8SA 2NNNA 3LSGA 4XLEA 4RGXA 1B8IA 5L3BA 4UUSB 3MVPA 3HOUJ 2HQ5A 3V8KA 4E7ZA 1HXDA 1BN5A 4XLNF 4AVPA 5IYCJ 1VZ0A 2Y75A 1Z77A 3ECOA 4CSWA 3ZRGA 5DV5A 3JSOA 4EATA 1B1BA 2LF7A 2V9PA 1P4WA 2B7EA 4KYWA 3JTHA 2VKHA 4FX0A 2ADUA 4ZC3A 4GFBA 4ZYAA 2CUZA 2L9RA 4MEYF 2WADA 2DDBA 3RKYA 2H1KA 1YOVB 2MH2A 4I01A 1V5EA 1ZLKA 3MZ8A 1E0EA 4UVCA 1TT5B 3LAPA 1V8IA 4C3JJ 3J7ZI 4I0BA 2FRHA 3SMDA 4Y13A 1TT0A 1R1UA 1HF0A 1LPQA 1GUUA 2W1OA 3CF2A 4QIWN 3BTIA 2ZJRF 1S72I 1NTCA 1FYKA 3CC2I 3CC7I 4HQEA 1FBQA 1IRGA 3ACAA 4EEFG 3X0MA 3DUPA 3LQQA 1KU9A 2O5FA 1LFUP 4ZYEA 2ELKA 2O61A 2BW3A 1WWXA 1U20A 1V8UA 4A3BJ 2EV6A 2WC2A 2DYRH 2JPBA 3JCUC 2GA2A 5J1RA 2IS2A 1B6AA 2EIJH 3WTYC 4MFEA 2X1CA 2Y2ZA 1S5LC 3FXMA 3MD2A 2HYFA 4NQWB 5IW4A 3N97A 2A6EF 5FROA 3HUGA 4D7NA 3OYMA 3H5NA 3VDXA 2MW8A 2P5VA 1IN6A 5H6QA 4BXFA 5FB2A 4A3MJ 1MJBA 3KYCB 3M8EA 4G94A 2YUSA 1RNLA 4BEHA 5D6FA 2YR2A 4EGZA 2PJPA 1XN7A 1K6YA 1X58A 2EV5A 2TCTA 3BTCA 4ASNA 1QZYA 1FOKA 2V1DA 3MZHA 3WGGA 3U2RA 4G12A 3E7LA 1UG0A 3I71A 1ORKA 3ZOBA 5DUKA 4F52A 1PPVA 4NDLA 3MEXA 2CQNA 4UY8I 3D5RC 2KISA 4QWQA 2CH0A 1OFCX 2R5ZB 2WB1N 3KZYA 3F13A 2R7RA 1BC8C 1HQCA 3I53A 1DU0A 1ETQA 2KRFA 1X3UA 3CUQA 2QQ8A 2IVMA 3BG9A 2DXIA 1JGSA 1SC7A 1TL8A 3E57A 3FHNA 3PQJA 4A0YA 1LE8B 1WSUA 2BEOA 4DNCA 3F21A 2R7OA 1MMAA 3G2BA 3VODA 5GHNA 2XDVA 3NEUA 4U0VA 2F4MB 2PN6A 2L54A 1PVFA 4KN7X 1ON2A 3BR3A 4HAMA 4IOAF 2GLOA 1ZRDA 1S29A 2IP2A 1E3HA 3LSIA 4AWXB 1S9HA 1U0JA 1W0TA 2A6HF 5J1UA 4EM1A 2X6YA 4IXAA 1MSEC 4C2TA 2VQGA 4A3CJ 2FQ3A 4ENJA 1O57A 2OCEA 3ZQGA 2ZSIB 5LGTA 2DMUA 3GCMA 3O2PE 4CYCB 3V7CA 3M4OJ 1OCTC 1EKEA 1UHSA 2CO5A 1T6SA 2DDAA 3I0TA 5CPRB 2HVQA 4KJZA 2RN7A 3FKJA 3S8PA 2OUMA 4J00A 2YS9A 1EF4A 3CUOA 3V42A 5D5WB 3DKUA 3S16J 1RRJA 3OYJA 2YVMA 3GRNA 1R5GA 5FLVA 3TQNA 3WHBA 1MZBA 2WTEA 3RKWA 1YX3A 1R67A 3HPHA 4D0PA 3RYRA 4C2MJ 5DM7F 2EZKA 2HQAA 1V5FA 1K83J 1W5TA 2K7LA 4UV9A 3H9QA 3M7GA 1SVLA 5GHPA 3VSKA 1MMDA 2BE5F 3BAPA 1T08B 3O3KA 1DP3A 3BDDA 1NG6A 5DS9A 5ICEA 2HWVA 4M9ZA 3WTSC 1SAUA 2QJTA 3JRGA 1U3EM 4NFXA 3K9TA 2MSYA 5BS6A 4M9XA 1M1EB 3W3CA 4O5VA 1E2XA 2HPMA 4XN0A 4JK1X 3QP5A 4HV6A 3P5TA 5DTDA 3CLOA 2RKHA 1Y39A 1Z3XA 4AIDA 4K2EA 3IAM2 2OJED 5LHGA 4J7GA 4UB6C 1Q54A 5DDGA 1YJWI 3BCBA 3KZZA 2K85A 4KA4A 2XVCA 3PFIA 2C6YA 4ITVA 4M6VA 2E1CA 3LAJA 2WV0A 3J80Z 1PDNC 1OLTA 5FSMA 4C9XA 2MBFA 1V8VA 2XSDC 2LKPA 1LKXA 1VQ7I 4MO7A 4DYCA 1W5CC 4DYQA 2ZFUA 2DSBA 4BHCA 4UUTA 1SD5A 3BM4A 3ESWB 5FKKA 2VT2A 4CO8A 5ILVA 1ETKA 2B0LA 3N9UA 5LEJA 4G7ZF 2E2IJ 5B1BH 3DTEA 5BPDA 4IHXA 2E34A 2WA0A 3BG7A 2DT5A 1LUJB 3DEUA 5FKNA 3ZMVA 1OCZH 3F8MA 5JVTA 3GTJJ 1FMVA 4WXHA 3FHZA 5C7QA 4PSXA 1IZ1A 3E6BA 2HU9A 1FMWA 2A05A 2VBYA 3AL0B 1MH3A 1R36A 1SFXA 3VFZA 2L9NA 5JFRA 2JA6J 2HTJA 2KIFA 3CJTB 1D0XA 2JSCA 2Q8KA 2HOAA 4XICA 3HTSB 4RMNA 1I27A 4EM0B 1R7JA 3TOBA 1MP2A 1BI0A 3LNQA 2R7UA 4CDGA 1XS9A 2A8SA 3EESA 3DF8A 2LTPA 3ZMTA 4B44A 3HOXJ 3QPLA 4B3AA 2XF6A 3TP0A 2W4EA 4I0AA 1BI3A 3PSIA 3U1DA 3WTTC 1Y0UA 1DGWY 1ON1A 2KQRA 3WTUC 3BG5A 2QBYA 4NC6A 5DCMB 3A0HC 1LJ9A 3IUOA 4V2FA 2QGUA 5EDNA 4L9VA 5CVIA 4JX6A 1MSFC 3UR3C 5ILSA 2RVCA 4YIIA 4X0GA 4V19K 4RAYA 1OCPA 2ZKZA 3OL4A 1XMXA 3KE2A 5DD4A 3CD6I 4F55A 4D5CA 3Q1PA 1I39A 2L7MP 1U8BA 5AONA 1QVTA 3WE2A 3WTZA 1TWFJ 2DMTA 2DJNA 5A2QZ 2WAQA 1H9TA 1FOWA 4CUGA 4XLFA 2BOLA 4RAGA 4MPOA 3P7NA 4XLPF 2BVLA 1B8IB 3FBNB 3GZ5A 2FVVA 4FE7A 4S0HB 1Y56A 4RB2C 1APLC 3A6SA 1OJLA 1SZ3A 1ZG3A 1ZYRF 4Q48A 1SFUA 4YIFA 1I1SA 2XGEA 1H8AC 2LBFA 2NNYA 1JHHA 2H27A 4HEA2 2VBXA 3B6AA 2BY0A 5E3OA 3M1CA 2ZCWA 4UXNA 3ZQLA 1GHCA 4AIJA 2R7QA 3N77A 2DT6A 4BXXJ 1TC3C 2DTRA 5BMZA 2DFFA 3PUBA 5K7FA 5EGOB 4QPQA 4XSXF 2FOWA 5CKTA 2EINH 4NC7A 1IRYA 1EH8A 4WXCA 1DQUA 3DPUA 4CCOA 1KQ9A 4BDYA 3X0NA 2O03A 3ZN1A 1D5YA 2YVPA 2XAQA 4XOPA 4IPAA 5FSIA 2JRTA 3F8BA 3IHUA 3J81Z 4G9YA 4ZYGA 2CQKA 4U87A 4DZJA 5C4JJ 2VBZA 4XKVA 2HEOA 1WJBA 4FCYA 1KONA 2RRKA 4NFWA 2ME0A 1MKMA 4XRMA 4YG2F 2VE9A 1USTA 3ROUA 3FXOA 2ZXIA 4I76A 1E3OC 4A6EA 1U78A 2H6CA 1RUNA 2DQLA 1KZHA 5L3CA 3MKZA 2EBIA 1X19A 3J80K 4IRIA 1FLIA 5CQGA 4HOBA 2F5DA 2HR3A 3FM3A 1HC8A 3B02A 2CQQA 3HUGB 1WHUA 5CVRA 1YJNI 3AG2H 3JREA 1G0SA 4IQ4A 1YJ9I 4XK4A 3K4JA 4PJNA 1LEAA 2XAHA 1FBUA 2MABA 3P9KA 4J01A 4MLOA 1B4AA 4ABZA 4UUVA 4BEHB 5ANTA 3ZN0A 1TWHJ 2GZWA 2DBBA 2HFHA 2PX9A 4B47A 4ENKA 1ZR2A 4Y15A 1XGMA 5KAFC 4BH9A 3WG7H 5HLTA 5AIPA 4BS9A 3FIWA 3SEQA 5F08A 4BL0B 5LD2C 3X0PA 2IJLA 4G6QA 2CG4A 2E1NA 3QYBA 4FETA 4LIVA 3ZGKA 2V1UA 1JKQC 2LSOA 2G0EA 1MMSA 2XKPA 1UZCA 5E17F 2NVTJ 3AG1H 1GXPA 3DBLB 5GADJ 2FBKA 2HOTA 3RYPA 2G73A 1MMGA 5LPGA 2VIXA 3SQNA 3EUKL 3LWFA 4KIBA 2DMQA 1N77A 3CMYA 4EGYA 1HBXG 5BNGA 3CUQB 1TW3A 3KZIC 2IGNA 1IN8A 2LC2A 4G8XA 4PZJA 2NVQJ 1R5ID 1DPUA 4JZVA 2R7WA 1IUFA 2BVMA 4Y17A 5GPAA 3IWFA 2HYJA 3DU6A 4XORA 1FWZA 2OV7A 1YIJI 4ENMA 5EEGA 2RNGA 2ZC2A 1NG7A 4A3LJ 5HDGA 1EA3A 3OR1C 4DBQA 2KRHA 1WJAA 1PJRA 3O8GA 3ABUA 3TOAA 2YU9J 1JJ6C 2ZJPF 2V6CA 3V7RA 5DM6F 1RRSA 5EZGA 1QO0D 2K9QA 2NS7A 5HLHA 1MH4A 4IHVA 1MQWA 1MQEA 5L3DA 2R92J 2DQRA 4FX4A 3KLOA 5ED4A 1H9GA 3L85A 2E1OA 2FJ1A 3KP5A 1K26A 2VNQA 1D5VA 2GOMA 5ICFA 5GP9A 4QTRA 4N1TA 1D8KA 1TQMA 4A69C 4MQ9F 3V8JA 1V8TA 2XSQA 2X4HA 2K3FA 3ASOH 1VQ5I 4OMYA 5GHOA 3D0SA 2V9VA 5EZHA 3I4PA 1VQ6I 3WTVC 1SFEA 4GYGA 1QPIA 1I1GA 4XOTA 3HOYJ 1P6RA 2LOOA 1DGRM 1YE9A 4AIKA 4ESFA 2LH9A 3VPRA 2OU2A 4PJJA 1UB9A 2XPUA 2YPRA 3W6KB 4BQAA 2EPFA 2L5QA 3F8FA 1YW9A 2A69F 3ZR0A 2IA2A 2EZIA 3ISPA 4DIQA 1RKTA 2JA7J 5IP6A 4L5IA 1KA8A 2OD5A 2X1EA 1GV2A 5EG0A 1BIBA 1H89C 4A3DJ 5LRRA 3AL0C 3RKQA 2TDXA 1ZREA 2FXAA 3E97A 1XB4A 1UJ8A 3DPLC 4BUPA 4KFCA 1E17A 2BXYA 1BIAA 2DA2A 2VKEA 4KICA 2DA4A 2V26A 2YVOA 1WH5A 4CICA 1A35A 3S2WA 2H1LA 1HSTA 5K1YA 2KDZA 1WH7A 3OIPA 4CCMA 1VQLI 4E7HA 1T8IA 2JA8J 1W1WE 2EJRA 2DCEA 5E79C 4PCQA 3QQAA 1T0FC 4A3KJ 3S2HJ 1G2HA 3OS1A 1FEXA 1VQ8I 3EDPA 1TTYA 2QSFX 1XSAA 4KNYA 2UV1A 4BNCA 4XMYA 1HW1A 1OYYA 1BR2A 2FX0A 2E60A 4ICKA 2QEXI 5F64A 3OOPA 2O0YA 3F9KA 3VSLA 5E3MA 2WAEA 4Y7NJ 1T95A 2Q2EA 2VJIA 2DN0A 1D8JA 3T8RA 4IX7A 1WKMA 4RDUA 1JGGA 3U9GA 1MMNA 2LF8A 1DU6A 1JI8A 3F23A 4I09A 4JYKA 1QPMA 1VNDA 1X83A 3WODF 1WJFA 1WZ2A 4RA2A 3ERMA 3U53A 1R49A 1YHQI 2JK3A 4I7HA 5F04A 2B9SA 3ZPLA 1O7FA 2VONA 1D1BA 1A04A 2YYHA 2WY8Q 3LSRA 1Q33A 1JUSA 1V55H 3MFKA 2L01A 3TMOA 1ACIA 2H09A 2H8WA 5M3MJ 1U5TA 3SONA 2DODA 3GTPJ 4ANJA 4WK8F 2VOPA 2DA1A 1MW7A 5FSLA 3X0OA 1XG1A 1XPXA 1YW8A 1Q1VA 3HRTA 3DBRB 1AWCA 1GVDA 4R1HA 4HV5A 3ECHA 2XSJC 2RREA 5FKLA 5JVGF 2CFOA 2VB6A 2CU7A 2ZJQF 2QBYB 3GTOJ 2P6SA 5E8GA 3VYTB 5IYDJ 1N75A 3X0LA 2KL4A 3N05A 4KYXA 5E8IA 2ISYA 1V8LA 3LSKA 4ZTJA 5DPKA 1U2WA 3IKVA 1XGSA 2Z99A 3EUHA 1YG2A 2JRMA 1X2NA 2OCCH 3H92A 4IJAA 3W6JB 1XX5A 2ZNYA 4ZG0A 3BJ6A 2W57A 2GWRA 4XKCA 1WQ2A 3CDHA 3ZQQA 2QQ9A 1CGPA 3BTLA 3WU0A 2CZRA 2GT4A 2EZLA 4HLYA 4OAYA 3QWLA 2QVOA 1SAXA 2M4GA 3CCEI 3BR6A 2OPTA 5JLWA 3FMQA 4L5JA 2A8TA 2A07F 2FQ4A 1QA6A 2HDCA 1VC8A 3HZJA 5CYVA 1V8YA 1IF1A 4JP0A 2EV0A 4ILQA 3CNGA 5K5RA 3BR5A 4BJ5C 4DOZA 3IKTA 1V8WA 2ME6A 3Q0VA 2FEZA 3HGGA 2LBFB 3CCLI 2CQXA 5HZXA 4L5EA 1F9NA 2W25A 2DMNA 3ZMUA 4KITB 2HS5A 2XPVA 1KTGA 2CUJA 1YRNA 1Y6IA 2XROA 4N9IA 9ANTA 4NHJA 1Z3YA 3CMMA 2E36A 2DK5A 2ZFWA 3V8LA 3DBHB 4IHTA 3EUAA 2K86A 3MCZA 2W00A 3OIOA 2LY2A 3QPTA 4G7OF 5EGOA 1ITYA 2ECBA 2VASA 3MDIA 2V6EA 1PYVA 3WHWA 3HSFA 1DUXC 1IUYA 3M8JA 3TDZC 3K70D 2LG4A 3SZTA 1VFCA 2GB5A 4ZDPA 2O3FA 1SD4A 2CS3A 3FXQA 3ABMH 3OMYA 3FF5A 3R60A 3LL7A 4F93B 5FRMA 4M73A 3K10A 3KIOA 2GXAA 2XC7A 2O5WA 1P7IA 4OWRB 3OS2A 3CCJI 3FMSA 3CUQC 2WWYA 1SEUA 3D5SC 3MWMA 1AU7A 4ENNA 2JN6A 3Q0WA 1NFZA 2P5LC 2L02A 4KMFA 3WU2C 2M0CA 2AHQA 3GX4X 3LSJA 1VHGA 1J5YA 3GXOA 2GA1A 3PUFA 4P5OA 3KP6A 4LLGF 1G3TA 3PNVA 3BJAA 4HA8A 4LMYA 5F1RA 2X0LA 3OL3A 3OYHA 3MKLA 1G4DA 1F5TA 3I4MJ 4A6DA 3GZ8A 1I6XA 1KYZA 1MJAA 4J7HA 2KDVA 2DFIA 4BU2A 4A0XA 3BHOA 3AG4H 5J40A 3KEOA 3FXJA 2W82A 2J5PA 2OBPA 4Y3OA 2OF7A 5J4VA 2HDWA 2ELHA 1XSXA 4RLQA 2BBYA 2E5NA 4AVZA 3C2BA 1HKQA 2ECCA 1N78A 1S7OA 2VJ4A 3J7AO 3E5UA 1RC9A 1V5GA 1S6LA 3FSPA 2LNBA 4MQVA 4HNUA 2MC4A 4YRVA 3PO3J 1XGNA 1SJYA 4LOCA 2P4WA 3ZQ7A 2GXBA 2HZDA 3JRBA 3QODA 3SFZA 4KIGA 2KPMA 1QNTA 5FFZA 2EFOA 3H0GJ 1TBXA 4AYBA 5TGTA 2XAFA 5EEHA 3X0RA 2X6OA 1J7KA 4FQGA 3BR1A 5M5YJ 3A03A 5J4YA 1RUOA 2K4JA 5KAIC 1W4MA 2E35A 2OQGA 3S2DJ 3EQLF 5FD5A 3FWEA 3WTWC 1FJLA 1VHZA 1NH3A 3SXYA 2M4KA 3G71I 1MBJA 3PNTA 3WGIA 1S7AA 1YQAA 2V4JC 4CYDA 2STWA 1QZZA 1S8NA 4QLCU 2L7ZA 4L9JA 2A3SA 1X3WB 1VIUA 3HOWJ 1WJCA 2QQBA 4LFUA 1ZR4A 1B72A 2I8UA 3RTRA 4FHTA 2YSRA 3L9FA 4I98B 1R22A 3DPTA 3CO7C 1UELB 2HQNA 3CDIA 4M3DA 1DP7P 2QJOA 3F8CA 5J47A 1HCRA 2K4BA 5IOYA 5D6EA 5HDNA 3PSFA 1LFPA 1FIPA 2R5YB 1YX5A 2FD5A 2P5KA 1W36C 4LLLA 1T2KA 4PJLA 2W85A 1SANA 2LREA 5L3FA 3A2KA 4EV0A 4KIFA 1XCVA 2VE8A 1QHHD 3RCOA 4E4HA 5HOOA 5FKOA 2GT2A 3HRMA 2KIMA 2Y31A 1O3QA 1HZTA 3J7AY 1Y1VJ 4DW6A 2JA2A 1B59A 3BPXA 3GF2A 3CCQI 1IC8A 2CV0A 1BR4A 5C7TA 1USSA 1X1BA 2UXNA 2MD0A 2Y48A 3K69A 3RH7A 3BPVA 5EG0B 2IGKA 3HHJA 2XPWA 3L2WA 3H5RA 2RGVA 4ZDLA 2ZBKA 3OYKA 3L2CA 3COUA 1JTYA 4V14A 3GG6A 3HL2A 3S3NA 2VNPA 3BP8A 3RDIA 4Y52J 4BJTA 3C3WA 3BG6A 3P5JA 3IH2A 2VODA 3W2AA 1I50J 1K4TA 2ESNA 2KFDA 3DEWA 3MGMA 3L2QA 1TQIA 2BGCA 3REOA 3VYSB 3EYYA 4UVBA 4KISA 2HVSA 2XAUA 3CLQA 2PQ8A 1U9NA 3I7UA 1P9QC 2JWTA 3GBGA 1AKHB 1MBHA 2OC6A 2ELJA 1KU3A 1ERDA 2VJ5A 3HBLA 1FPQA 2JT1A 3MQ0A 4N4NB 2M7BA 1KU7A 3ZR8X 2Z2SB 3LSPA 2I8DA 3CJNA 1PP7U 2QSHX 3BCAA 4ZJZA 5GAEJ 2DA3A 3R0JA 4EQQA 1VQ9I 4M6XA 3CP2A 3ZCOA 2VBWA 3P9CA 5M3FJ 4KG3A 2O6GE 2LVSA 5EF6A 2PBIA 2R3SA 2VQHA 4D5FA 2NS8A 3QOPA 1OISA 3VEPA 4ETSA 1H88C 4YPHA 2Q2EB 3IRRA 1MBFA 3LSHA 1X3ZB 2ICWG 3ZMDA 4RS8A 1J9IA 3A6TA 2TRTA 3QU6A 2G7HA 3JW4A 1O3TA 2BV6A 3MKYB 2CV1A 2KP6A 1HLVA 3H3UA 1QRYA 3CTAA 4A3GJ 3B73A 1GDTA 1G3SA 3S3OA 1TQPA 3RQ4A 2KDOA 2YVNA 3HOVJ 5FSOA 4BE0A 2WV1A 1U5TB 5FGMA 1IXCA 5IPAA 3CQZJ 1K2EA 3K70C 1EH7A 1GLNA 5I8UA 1EV7A 4XONA 3OYLA 2PMZA 2E2HJ 1XSCA 3F6AA 4S2YA 3TKYA 1PUSA 1NQZA 3QAHA 1ZAOA 2FNAA 1XCBA 1DPRA 2Z3YA 3FMRA 2R7DA 4II2A 5KNLA 3SFIA 3ELKA 3FZVA 3ULQB 4MEXF 4LLNA 3L2VA 1YLFA 3KVHA 2LKSA 2ZB9A 4KN4X 2JVBA 3CCVI 1OYIA 4ZYDA 4L18B 2QENA 5DD8A 2UZKA 4P9FA 1KQ8A 3SHDA 4BBRJ 1F3YA 1AA7A 2FF4A 2ID3A 5FSKA 1WJ5A 3O6BB 4PFPA 5HS9A 3MCFA 1JTXA 2CW7A 1Y0NA 5KHDA 1X84A 4OIQF 4YELA 4U0YA 4NUBA 2CW0F 2BY1A 1YO5C 4OINF 4D1QA 4EMSA 1V8MA 4IJXA 2CMPA 2PNYA 1G3WA 4RAFA 2DI3A 2J5OA 3VYRB 3BY6A 3DV8A 2DO7A 2L7KA 3PFYA 3ZQHA 1K4SA 1G6NA 2IGMA 2KRCA 3NQOA 3CDLA 5CFJA 1P4XA 1X1AA 5CVVA 3ERED 1IAWA 2L9VA 2A68F 1YRNB 2NVXJ 2EH3A 2EQRA 3T8TA 1T56A 4BQOA 1Z21A 2ZXHA 5GTHC 1RZ4A 1OCCH 2DTZA 3FK6A 2CJJA 2QZ8A 2PFBA 1X1CA 1R4MB 2XGCA 1MBEA 1WJDA 3GLXA 1K7AA 4I99C 5GHIA 5E20A 2P8TA 2CL3A 2NVYJ 4BAYA 5ANWA 1VC9A 3DWLE 4BHPA 2ISZA 1Z7LA 3E6MA 2AXLA 1MK1A 1ZTRA 1HW5A 2MC3A 2M30A 1TWAJ 1BJZA 2DFEA 5JLXA 1KT9A 3FXRA 3FM5A 1YI2I 4M3EA 4EM2A 2W7NA 5KVRA 3HM5A 1LDDA 3BLYA 5HODA 2NOGA 3RPUA 3KCCA 4ESBA 1K61A 1K6OA 2KKOA 2D1VA 3Q5FA 1Z67A 2DU9A 2PMHA 2DW4A 1YW7A 4OAZA 1ENHA 2HZTA 4G7HF 4GDFA 1WPKA 3Q0UA 1MGTA 1Y8QB 3GUDA 3QSJA 2IA1A 4BXUA 3K4LA 2JTVA 2A6TA 3GYHX 1L0OC 3ABKH 4PGHA 1IRFA 1K79A 1VQNI 1BA5A 3G0QA 4UHTA 3G1MA 2HOEA 3JRDA 2XGDA 3K2ZA 2I8TA 3CCMI 1B9MA 1IDYA 5D8KB 3KEQA 3F72A 3U1KA 4LB5A 1J59A 3GLLA 4CCJA 3OY9A 3GTGJ 1PPWA 3I3LA 3DKYA 4BKXA 4KG4A 3DFGA 1TWCJ 1REPC 4DZPA 1A31A 1D1CA 4XLHA 4NBQA 1O3RA 4KT5C 1MUTA 1Z0XA 2R7FA 1EJ9A 2JVGA 3BR0A 3S1QJ 2K9NA 3BWGA 2EB7A 2XIGA 4N4OB 5F0FA 3I5UA 1SFOJ 3H1CA 1X51A 4ZTFA 4DBRA 4LK1F 4N0BA 1OR7A 5DCFA 1IN4A 5KK1A 3IH3A 3I58A 4ZYHA 4MNUA 4HDUA 1LFBA 3H3ZA 4GRIA 3W6VA 3DKXA 2ICKA 2Q0OA 2HQRA 2YX7A 3K1NA 3CJQB 1EH6A 4BY7J 3SJMA 1POGA 3L00A 1VIQA 3CCYA 3HJEA 2VUMJ 1I6HJ 1ETXA 4C3HJ 1FTZA 5DYMA 2FOKA 4WF2A 4CCLA 4I6ZA 4O3MA 3OSGA 1S7EA 3GWYA 1QGPA 3I56I 3K4CA 2F5CA 1FTTA 2F48A 4IVNA 5JHUA 4U7BA 3S15J 1WGXA 1UHWA 5C44J 2B06A 2HDDA 3A01B 2KZVA 2LY9A 1V8NA 3W2WA 2DJIA 3K4BA 1B72B 5JHFA 4LGWA 3I9XA 1PUEE 2IBDA 3CF5F 2K02A 5IW5A 1DDNA 3F3XA 1LB2A 3A02A 3RJPA 2RV8A 4F91B 4IOCF 5E1WA 2CUFA 2R5YA 4E7JA 2LDUA 1SVMA 5ICCA 5E18F 5FLXZ 2L4AA 3S3MA 1SMTA 2JQ7A 2OTLI 2JPCA 4M6YA 3ZP5A 1BBYA 5ISYA 3K1MA 3GFMA 1IN7A 1WRJA 3SHFA 3Q9SA 2DA6A 3I9V2 3X0KA 5K7HA 2HI3A 1I3AA 1P2FA 1V54H 3J7Ye 3OS0A 1D1AA 3OYGA 1SD6A 3OYDA 3CESA 5IY5H 4HYEA 4DGWB 4E7LA 3I59B 2R4GA 2D45A 5ANSA 3HB9A 1F43A 2HTSA 3CP8A 3O61A 1R00A 1V8RA 1JXSA 4I2OA 1MNDA 4HX7A 3ONQA 3VB2A 4XRFA 2BY2A 2F2EA 1ZN2A 2OZUA 2IPQX 3Q9VA 2LMDA 3DU5A 3W2VA 3JRCA 1D0YA 4Y33A 3CJRB 1ZH5A 2XF5A 1IRZA 3HRSA 1SMYF 4HF1A 4XNFA 4EJUA 1OYWA 1ZRCA 4NB5A 1OW2A 2IRFG 5FO5A 2UWMA 3WTXC 3OOUA 5F0CA 2Y9ZA 2KDWA 2K9MA 3QOEA 5LHIA 1U5TC 3X0IA 4LJZF 5HLGA 4G6TB 3GTKJ 4JBAA 4M3BA 2IT0A 2P81A 1AKHA 2NYXA 3QP6A 2GQQA 2VQLA 3COAC 2PG4A 1NQYA 4OMZA 3OYBA 2W48A 3EYIA 2M8GX 5DEQA 3FXKA 2KLOA 5HNHA 1G9QA 1JHFA 2XAJA 5HS8A 5K7ZA 3CCRI 3A1YA 1J75A 1KYWA 3HC7A 4B48A 4WWCA 3EUHC 2R5WA 1MIJA 2Z16A 1RETA 2EFWA 2CFXA 1ZARA 4HDVA 3HG9A 1XSVA 3JRFA 3R6SA 3HKZA 4C3IJ 3DXJF 2BXZA 4HPQA 3CMAI 3UKGA 4B4CA 1W36D 1MD0A 1JT0A 2E7WA 1J09A 1YS7A 3WHCA 1LDKB 1XDUA 3VOEA 4D7MA 5IOZA 1I5ZA 1JUPA 5IT9K 3G4SI 4HFQA 3OV8A 4PK4A 3ZQCA 2VPLA 3DQVC 4CCKA 3QPSA 3V7SA 3JR9A 4G6DA 1BW6A 3IV5A 4NNJA 1FYLA 3CMEI 5IP7J 3BJOA 4LIUA 3GFJA 4LG0A 3ABLH 1HOMA 4RAZA 3Q2SA 2X1DA 2R7VA 2KHMA 2V1NA 2V1XA 3KYDB 1C0WA 3TO7A 2O8KA 2M1BA 3HYIA 5H2FC 3GZNB 3K2AA 2I5UA 2X48A 5E1XA 2XKOA 4A12A 2FA5A 3LMMA 2A61A 4RGSA 5M5WJ 3CC4I 2ZSHB 2M2EA 2GM4A 2P7VB 2EA2A 3AFHA 2CSOA 1BJAA 3ML6A 3CO6C 2JJ7A 5B5EC 3HXLA 2W84A 2M87A 4AU7A 4K6EA 4B43A 3BTJA 5AIQA 2XB5A 1VRLA 5J6XA 4GXOA 4Q4ZF 5ANUA 2VN2A 2ZJ2A 3M1EA 4DQ2A 3JRAA 4DYRA 1R58A 3R0AA 3FXLA 2F5EA 3T1BA 5F6FA 3TGNA 2QKLB 1TUMA 4KTBA 2PMZN 1JKOC 2ETHA 2CGPA 2Z9OA 3HTUA 4PGGA 4XR6A 1XGOA 3BC8A 1AHDP 2EZHA 5C4XJ 1IW7F 1QHGA 5ANVA 2F5VA 2EK5A 2ESHA 2XF7A 3GZ6A 3I7VA 1FP2A 4MIMA 2LYCA 4D9JA 1W5SA 3TO9A 3PNYA 4GO1A 1ZGAA 3OYEA 3JRHA 4MHGA 5FLXK 4HF0A 2Z5UA 5HNFA 2K27A 2WAQN 3P9IA 1NHAA 5GAHJ 3TL4X 1IGNA 5FLMJ 2JVHA 2QCOA 4A5MA 1SVOA 4HZFA 5FSNA 2E71A 1WI9A 1JJ8C 1HX3A 3AG3H 1YS6A 2COBA 5FD6A 2R7XA 2M9HA 2ZMEB 4II3A 4A3IJ 4PSWA 2FBIA 2L0KA 3QU3A 2O1CA 3SEZA 1HA8A 2VQCA 3WGHA 5LLQA 1GVJA 3LA3A 3C2HA 2HPIA 1LVKA 1LQ1A 4U0WA 1W7PA 2UUZA 2RQPA 3LA2A 2BHZA 4P55A 1WVRA 2O5RA 4QPOA 1NK2P 2K40A 2OAZA 3IL2A 1MBGA 4XRSG 4LG3A 3E5XA 2IW5A 2D1HA 1Y1WJ 1T98A 3ZR1A 3G1OA 1R5HA 2MD5A 4C9WA 4EJVA 1PVEA 4JZUA 1H0MA 2WBMA 3L09A 3O69A 2P7CB 1JE8A 4RB0A 2HYGD 1O7LA 3KP3A 2A8QA 2E19A 1O4XA 2DA7A 2HKXA 1CF7A 4BE2A 5LGNA 5CJ9A 1V3FA 4U88A 4E70A 2CYYA 2QA4I 5BQTA 3OYIA 4EJTA 4A3JJ 3JAMK 3KLNA 3BR2A 2D2WA 2E2JJ 3AAFA 4AC0A 4IHYA 3RPUD 1ULYA 5J8FA 2DOFA 2DPDA 3FFUA 4R8HA 1T38A 1K78A 1R1VA 5J8CA 3GTQJ 2L3DA 4BHBA 2IEKA 3LOCA 5EYRA 1U6GA 3CCSI 3MKWB 4JZSA 4GCVA 4EJWA 1VQKI 3JTGA 4L9NA 2HOSA 5ERIA 3VWBA 2HVRA 4N1UA 1MDMA 2FNPA 3TDUC 4RM3A 5E1ZB 4X6AJ 5BONA 2PJRA 2Y9YA 4LK0F 3GEZA 3RKXA 1QZEA 3HGYA 1RESA 1VCDA 1FC3A 2M3AA 2OZ6A 5CLSA 2XGXA 4E6KG 3PL8A 2R7TA 2VL8A 4EJOA 4CZCA 3G3ZA 1RR7A 4ON0A 1HKSA 1NK3P 2VOOA 4M3FA 2EWNA 2NAZA 2VJJA 3GTLJ 3FBIB 4OOIA 5D5XB 1YYVA 3MDGA
chains in the Genus database with same CATH topology
3DKWA 1B9NA 1FX7A 1TLHB 3KFWX 2A8PA 2COMA 3X0QA 4RB1A 4M71A 4TV7A 2QUFA 1FT9A 4AIHA 4AD9A 2XASA 1SOIA 1J2XA 5JR3A 2DHOA 1Z7UA 3WG9A 2XRNA 1BOAA 3Q93A 5D8LB 5H6RA 3FXUA 2QM3A 3E5QA 1AOYA 3I59A 1LVAA 3QRFF 3K0LA 3E6DA 4BYYA 2IA0A 1LDJA 2M8EA 1V8SA 3FJYA 2RNJA 4S2WA 4MTDA 2YU3A 4YPRA 2QKMB 2M5WA 4L9TA 1UFMA 1GXQA 2L4MA 4M72A 5C8LA 3IRQA 3HHGA 4Q47A 3A6UA 4M74A 2PI0A 5D4RA 3NRVA 1YTYA 2Y0MA 2G9WA 2FU4A 1G3YA 3QPHA 2B0VA 2VC1A 2QYOA 1QVJA 1BI2A 2CWEA 1MR2A 5LHHA 3E3VA 5D4SA 1BM9A 1MJ9A 4RGUA 2XAGA 3FX3A 3KP2A 3F8NA 2DK8A 2G7UA 4CGZA 1HSJA 3HHHA 2RDPA 4KMUX 2EA4A 1HW2A 4HBLA 4ZZLA 2FMYA 4A5NA 1RIOH 2KJCA 1U8RA 3RI4A 3LA7A 2EFNA 2H6BA 3HYQA 5HVQC 2OA4A 2EFQA 3EETA 3T0YA 3Q2TA 4Z2YA 1FY7A 1QQIA 4LG0B 2YX4A 2PQVA 4Q5SF 1L3LA 3ABTA 4I02A 4R79A 2AZWA 5L3GA 1TW2A 4HQMA 4H0EA 2FSWA 4YFXF 3I54A 4MGRA 2EFPA 2ZO4A 4P96A 2MLGA 2ICJA 1KHZA 3EF5A 5LBQA 1KGSA 1FP1D 1TNTA 2RC4A 3ID9A 2NS0A 5FFXA 2P6TA 2GXGA 1HKTA 3P6YA 3WU1B 3L7WA 2Q9PA 1P4AA 4FT8A 4RB3C 2JZYA 1SD7A 1IN5A 5LEKA 1QBJA 2QLZA 1GA7A 2FMLA 5D5UB 3GW2A 3GVAA 2XV4S 4ESJA 3MAJA 1P92A 4OIPF 4F7ZA 4P9UA 4WXDA 2ZXJA 3X0SA 3Q91A 1STZA 2ZMEA 2MA3A 1IXSB 5CVJA 3HSEA 5ICGA 4KUMA 3C18A 1LEBA 1ZG1A 2GAUA 4YFKF 3D5LA 5CVUA 2DAOA 1XMKA 4DYWA 1W7PB 3FK9A 4XBFA 3C1DA 1RYAA 2W24A 1SU2A 4MTEA 3M8FA 3OGAA 2STTA 1PP8F 3T5XA 3GO5A 2FKBA 1W7PD 2PMUA 1Z9CA 5BOXA 3BROA 1FZPB 1ZHFA 2VC0A 1CF7B 4S04A 3GFLA 1TNSA 2DUKA 2ZNZA 1ZRFA 2DSDA 2VT3A 5IT9Z 4L0ZB 1Z1DA 1I9AA 1K78B 3HSRA 2QQAA 2A5YB 4HLXA 5HLIA 3ZMSA 4NQWA 2I6KA 1NFSA 4N9HA 3EXQA 1KQ0A 3GWZA 2BYVE 3LFKA 4JZTA 4S2XA 4S05A 1ODDA 2F5FA 3IWZA 2B2KA 3FCMA 1ONVA 1MDMB 4OU0A 4WX9A 1KU2A 5LGUA 5GHJA 3HOSA 4HVYA 4S2VA 2MH9A 4PDKA 4ZZDA 3LQRA 3A6VA 4CZZA 5TRDA 3KP7A 5H20A 4OIRF 1XSDA 2HKOA 3EEUA 5TJJA 3RPQA 1R1TA 1Q27A 2KJBA 4LB6B 4RGRA 4GYIA 3V4GA 1IXRC 4LD5A 1J0RA 3O52A 5ILUA 2XUBA 3GFIA 1ZLJA 2MLKA 4YFNF 4UNOA 1F1ZA 4OIOF 3Q4IA 1Q1HA 3R4KA 5JI6A 3R03A 3F22A 1PPXA 1XSBA 1V4RA 5A2QK 5HS7A 2AS5F 1FSEA 4JQFA 4EVIA 2VXZA 1YFHA 1OMIA 3M9AA 1Z6TA 2OQRA 5D5VB 4O6JA 2XHKA 1XMAA 5BPIA 3E6CC 4L0YB 1PUQA 3HOTA 4A2UA 4U7DA 3JSPA 3H95A 3N4MA 5GHQA 1XD7A 2NRAC 1D3YA 4CXFA 3JAMZ 2J8QA 2A8RA 2Z33A 1UCRA 4A0ZA 1R23A 5IT3A 1UHMA 4HX8A 3HRUA 2V79A 3F6OA 2M45A 3DP7A 1O3SA 4ZH4F 2DSCA 2FBHA 1FSHA 3J81K 4B8XA 1FBSA 3C7JA 3RIRA 5K5QA 1Z91A 1Z6RA 3HIFA 1OKRA 4IRHA 2DLLA 3R61A 1ZGJA 3I64A 2G74A 4HX4A 1PUNA 3LSTA 1VTNC 5HDKA 3AC9A 2E7XA 5LRSA 4M9SA 2KIUA 3ZMZA 2DPUA 1RI7A 4HF2A 1JRKA 5L3EA 4GGGA 4HW0A 5K5OA 2HGCA 4CHUA 1XDSA 1ZG5A 4KDPA 2QWWA 1T39A 2PLYA 3SZPA 3PQKA 1RRQA 3WE3A 2GIVA 2H94A 3KETA 4IHSA 1LNWA 4IF4A 4UVAA 3KP4A 2ACJA 3BOQA 1OPCA 2FE3A 4WCGA 1VK6A 5GHMA 5DCMA 1FYMA 1T0FA 1FNNA 5CFIA 1YIOA 3F6VA 3MZYA 4YOQA 3O6ZA 1Z05A 3TO6A 1BI1A 1F4KA 4XSZF 3IC7A 3X0JA 4IRGA 3BZ6A 4UV8A 3G73A 2UXXA 2O8XA 6PAXA 1S3JA 1JKNA 1BC7C 3K1PA 5DUIA 2PEXA 4B09A 3O8SA 2NNNA 4RGXA 5L3BA 3V8KA 1HXDA 1BN5A 4XLNF 4AVPA 2Y75A 3ECOA 5DV5A 3JSOA 1B1BA 2LF7A 1P4WA 4KYWA 3JTHA 4FX0A 2ADUA 4MEYF 3RKYA 2MH2A 4I01A 1ZLKA 4UVCA 3LAPA 1V8IA 4I0BA 2FRHA 3SMDA 4Y13A 1R1UA 1FYKA 4HQEA 1FBQA 1IRGA 3ACAA 3X0MA 3DUPA 3LQQA 1KU9A 2O5FA 4ZYEA 2O61A 1WWXA 1U20A 1V8UA 2EV6A 2WC2A 2JPBA 2GA2A 1B6AA 3WTYC 2HYFA 5IW4A 3N97A 2A6EF 3HUGA 5FB2A 2P5VA 1IN6A 5H6QA 1MJBA 3M8EA 4G94A 1RNLA 5D6FA 2YR2A 4EGZA 2PJPA 1XN7A 2EV5A 4ASNA 1QZYA 1FOKA 2V1DA 3MZHA 3WGGA 3U2RA 3I71A 5DUKA 1PPVA 3MEXA 4QWQA 3KZYA 3F13A 1BC8C 1HQCA 3I53A 2KRFA 1X3UA 3CUQA 2IVMA 1JGSA 3E57A 3PQJA 4A0YA 1WSUA 2BEOA 4DNCA 3F21A 3VODA 5GHNA 3NEUA 4U0VA 2PN6A 1PVFA 2L54A 4KN7X 1ON2A 4HAMA 1ZRDA 1S29A 2IP2A 4AWXB 2A6HF 4EM1A 4IXAA 2FQ3A 4ENJA 1O57A 5LGTA 3O2PE 3V7CA 2CO5A 1T6SA 3I0TA 2RN7A 3CUOA 5D5WB 3DKUA 2YVMA 3GRNA 1R5GA 3TQNA 1MZBA 2WTEA 3RKWA 1R67A 4D0PA 3RYRA 1W5TA 2K7LA 4UV9A 3M7GA 5GHPA 2BE5F 3BAPA 3O3KA 3BDDA 3WTSC 5ICEA 2HWVA 4M9ZA 2QJTA 1U3EM 4NFXA 3K9TA 5BS6A 4M9XA 4O5VA 1E2XA 4JK1X 3QP5A 4HV6A 3P5TA 3CLOA 2RKHA 4K2EA 5LHGA 4J7GA 1Q54A 5DDGA 3KZZA 4KA4A 2XVCA 3PFIA 2C6YA 2E1CA 3LAJA 2WV0A 3J80Z 1PDNC 5FSMA 4C9XA 2MBFA 1V8VA 2LKPA 2DSBA 4BHCA 1SD5A 3BM4A 2VT2A 4CO8A 5ILVA 2B0LA 3N9UA 5LEJA 4G7ZF 5BPDA 2DT5A 3DEUA 3ZMVA 3F8MA 5JVTA 4WXHA 3FHZA 5C7QA 1IZ1A 3E6BA 2VBYA 1R36A 1SFXA 3VFZA 5JFRA 2HTJA 2KIFA 2JSCA 2Q8KA 3HTSB 1I27A 4EM0B 1R7JA 3TOBA 1MP2A 1BI0A 4CDGA 2A8SA 3EESA 3DF8A 3ZMTA 2W4EA 4I0AA 1BI3A 3U1DA 3WTTC 1Y0UA 1ON1A 3WTUC 2QBYA 5DCMB 1LJ9A 4L9VA 5CVIA 5ILSA 2RVCA 4YIIA 4RAYA 2ZKZA 3KE2A 5DD4A 3Q1PA 5AONA 3WE2A 3WTZA 5A2QZ 1H9TA 4MPOA 3P7NA 4XLPF 3GZ5A 2FVVA 4RB2C 3A6SA 1SZ3A 1ZG3A 1ZYRF 4Q48A 1SFUA 4YIFA 1I1SA 2NNYA 1JHHA 2H27A 2VBXA 2ZCWA 4UXNA 1GHCA 4AIJA 3N77A 2DTRA 5BMZA 4XSXF 1IRYA 1EH8A 4WXCA 1KQ9A 3X0NA 2O03A 3ZN1A 2YVPA 2XAQA 4IPAA 2JRTA 3F8BA 3IHUA 3J81Z 4G9YA 4ZYGA 2CQKA 2VBZA 2HEOA 2RRKA 4NFWA 1MKMA 2VE9A 4YG2F 1USTA 3ROUA 4A6EA 1U78A 2H6CA 1RUNA 2DQLA 1FLIA 5L3CA 3J80K 4IRIA 4HOBA 2F5DA 2HR3A 3FM3A 3B02A 5CVRA 1G0SA 1LEAA 2XAHA 1FBUA 3P9KA 1B4AA 4UUVA 5ANTA 3ZN0A 2GZWA 2DBBA 2HFHA 4ENKA 4Y15A 1XGMA 4BH9A 5AIPA 3X0PA 2IJLA 4G6QA 2CG4A 2E1NA 2V1UA 2LSOA 2XKPA 5E17F 1GXPA 2FBKA 3RYPA 2G73A 5LPGA 3SQNA 3LWFA 4KIBA 4EGYA 1HBXG 3CUQB 1TW3A 1IN8A 4G8XA 1DPUA 4PZJA 4JZVA 4Y17A 3IWFA 1FWZA 4ENMA 5EEGA 5HDGA 3ABUA 3TOAA 2V6CA 3V7RA 1RRSA 1QO0D 5HLHA 1MQWA 1MQEA 5L3DA 2DQRA 4FX4A 3KLOA 5ED4A 1H9GA 3L85A 3KP5A 1K26A 2VNQA 1D5VA 5ICFA 4N1TA 1D8KA 1TQMA 4MQ9F 3V8JA 1V8TA 2XSQA 2X4HA 4OMYA 5GHOA 3D0SA 2V9VA 3I4PA 3WTVC 1SFEA 4GYGA 1I1GA 1P6RA 4AIKA 4ESFA 2OU2A 1UB9A 2YPRA 3W6KB 4BQAA 3F8FA 1YW9A 2A69F 3ZR0A 2IA2A 3ISPA 4L5IA 1KA8A 2OD5A 1BIBA 5LRRA 2TDXA 1ZREA 2FXAA 3E97A 1XB4A 3DPLC 4KFCA 1E17A 1BIAA 4KICA 2YVOA 4CICA 3S2WA 1HSTA 5K1YA 2EJRA 4PCQA 3EDPA 1TTYA 1XSAA 4KNYA 4BNCA 1HW1A 1OYYA 4ICKA 5F64A 3OOPA 2O0YA 2Q2EA 1D8JA 3T8RA 1WKMA 3U9GA 2LF8A 3F23A 4I09A 1QPMA 1X83A 3WODF 3U53A 3ZPLA 4I7HA 2YYHA 1O7FA 2VONA 1A04A 1Q33A 3MFKA 2L01A 2H09A 1U5TA 3SONA 4WK8F 2VOPA 5FSLA 3X0OA 1YW8A 3HRTA 1AWCA 4R1HA 4HV5A 3ECHA 2QBYB 2P6SA 5E8GA 3X0LA 4KYXA 5E8IA 2ISYA 1V8LA 5DPKA 1U2WA 3IKVA 1XGSA 2Z99A 3EUHA 1YG2A 3H92A 4IJAA 3W6JB 2ZNYA 4ZG0A 3BJ6A 2W57A 2GWRA 1WQ2A 3CDHA 2QQ9A 1CGPA 3WU0A 2CZRA 2GT4A 4HLYA 2QVOA 1SAXA 3FMQA 4L5JA 2A8TA 2A07F 2HDCA 1VC8A 5CYVA 1V8YA 1IF1A 2EV0A 4ILQA 3CNGA 5K5RA 3IKTA 1V8WA 2FEZA 5HZXA 1F9NA 2W25A 1KTGA 3ZMUA 2HS5A 2XROA 4N9IA 4NHJA 2DK5A 2ZFWA 3V8LA 4IHTA 2K86A 3MCZA 3QPTA 4G7OF 3MDIA 3WHWA 3HSFA 1DUXC 1IUYA 3TDZC 3SZTA 2GB5A 2O3FA 1SD4A 3FXQA 3R60A 3FF5A 4M73A 2O5WA 3FMSA 3CUQC 2WWYA 3MWMA 4ENNA 1NFZA 2P5LC 2L02A 4KMFA 3GX4X 1VHGA 1J5YA 3GXOA 2GA1A 4P5OA 3KP6A 4LLGF 1G3TA 3BJAA 4HA8A 4LMYA 5F1RA 2X0LA 1G4DA 1F5TA 4A6DA 3GZ8A 1I6XA 1KYZA 1MJAA 4J7HA 2KDVA 2DFIA 4A0XA 3BHOA 3KEOA 2J5PA 2OBPA 2ELHA 1XSXA 2BBYA 1HKQA 1S7OA 3J7AO 3E5UA 1S6LA 3FSPA 2LNBA 4MQVA 1XGNA 1SJYA 2P4WA 3ZQ7A 2GXBA 3SFZA 4KIGA 1QNTA 5FFZA 2EFOA 1TBXA 2XAFA 5EEHA 3X0RA 1J7KA 1RUOA 2K4JA 5FSIA 1W4MA 2OQGA 1VHZA 3EQLF 5FD5A 3FWEA 3WTWC 3SXYA 3WGIA 1S7AA 1YQAA 4CYDA 2STWA 1QZZA 1S8NA 4QLCU 4L9JA 2A3SA 1VIUA 2QQBA 4LFUA 2I8UA 3RTRA 4FHTA 2YSRA 3L9FA 4I98B 1R22A 3DPTA 3CO7C 2HQNA 1DP7P 2QJOA 3F8CA 2K4BA 5D6EA 5HDNA 2P5KA 4LLLA 1T2KA 2W85A 5L3FA 4EV0A 4KIFA 1XCVA 2VE8A 5HOOA 2GT2A 3HRMA 2KIMA 1O3QA 1HZTA 1B59A 3BPXA 3GF2A 5C7TA 1USSA 2UXNA 2Y48A 3K69A 3RH7A 3BPVA 3HHJA 3L2CA 2RGVA 3COUA 2ZBKA 4V14A 3GG6A 2VNPA 3BP8A 3RDIA 3C3WA 2VODA 2ESNA 3MGMA 1TQIA 2BGCA 3REOA 3EYYA 4UVBA 2PQ8A 3I7UA 1KU3A 1FPQA 2JT1A 3MQ0A 1KU7A 3CJNA 1PP7U 3R0JA 4EQQA 4M6XA 4KG3A 2VBWA 3P9CA 2O6GE 2PBIA 2R3SA 3QOPA 3VEPA 4ETSA 4YPHA 3IRRA 3ZMDA 4RS8A 1J9IA 3A6TA 3QU6A 2G7HA 3JW4A 1O3TA 2BV6A 3H3UA 3CTAA 3B73A 1G3SA 1TQPA 2YVNA 5FSOA 1U5TB 5FGMA 1IXCA 1K2EA 1EH7A 5I8UA 1EV7A 1XSCA 3F6AA 4S2YA 3TKYA 1PUSA 1NQZA 3QAHA 1ZAOA 2FNAA 1XCBA 1DPRA 2Z3YA 3FMRA 2R7DA 3ELKA 3FZVA 3ULQB 4MEXF 4LLNA 1YLFA 3KVHA 4KN4X 2JVBA 1OYIA 4ZYDA 4L18B 2QENA 5DD8A 2UZKA 4P9FA 1KQ8A 3SHDA 1F3YA 2FF4A 5FSKA 3O6BB 3MCFA 5HS9A 1X84A 4OIQF 4U0YA 2CW0F 1YO5C 4OINF 4EMSA 1V8MA 4IJXA 2PNYA 1G3WA 2DI3A 2J5OA 3BY6A 3DV8A 2DO7A 1G6NA 3NQOA 5CFJA 1P4XA 5CVVA 3ERED 1IAWA 2A68F 3T8TA 1RZ4A 2QZ8A 2PFBA 3GLXA 1K7AA 5GHIA 5E20A 2P8TA 2CL3A 4BAYA 5ANWA 1VC9A 4BHPA 2ISZA 3E6MA 2AXLA 1MK1A 1HW5A 2MC3A 2M30A 1KT9A 3FXRA 3FM5A 4EM2A 5KVRA 1LDDA 3RPUA 3KCCA 4ESBA 1K6OA 2KKOA 2D1VA 3Q5FA 2DU9A 2DW4A 2PMHA 1YW7A 4G7HF 2HZTA 1MGTA 3GUDA 3QSJA 2IA1A 4BXUA 2JTVA 2A6TA 3GYHX 1L0OC 4PGHA 1IRFA 1K79A 3G0QA 4UHTA 2HOEA 3K2ZA 2I8TA 1B9MA 5D8KB 3KEQA 3F72A 4LB5A 1J59A 1PPWA 4KG4A 3DFGA 1REPC 1O3RA 4KT5C 1MUTA 2R7FA 3BWGA 2EB7A 2XIGA 3I5UA 1X51A 4LK1F 4N0BA 1OR7A 5DCFA 1IN4A 5KK1A 3I58A 4ZYHA 4MNUA 4HDUA 3H3ZA 2ICKA 2Q0OA 2HQRA