5DD4A

Apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
221
structure length
221
Chain Sequence
YSSNPTFYLGIDCIIFGFNEGEISLLLLKRNFEPAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGAFGAIDRDPGERVVSIAYYALININEYDRELVQKHNAYWVNINELPALIFDHPEMVDKAREMMKQKASVEPIGFNLLPKLFTLSQLQSLYEAIYGEPMDKRNFRKRVAEMDFIEKTDKIDKLGSKRGAALYKFNGKAYRKDPKFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel transcriptional regulator of L-arabinose utilization in human gut bacteria.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Transcription regulator
molecule keywords TRANSCRIPTIONAL REGULATOR AraR
total genus 55
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dd4A02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5dd4A01
3RPUA 1PPVA 2YX7A 2LDUA 3DKUA 4I0AA 3K1NA 5F1RA 4WXHA 2VE9A 3WTYC 3E6MA 1X3UA 3P9CA 3K69A 1V8LA 1ZRDA 5FSMA 1KGSA 1T98A 3VB2A 2OQRA 5DCMB 1LEAA 4EV0A 1MD0A 1FP1D 3I0TA 3RTRA 2IW5A 3X0LA 1PVFA 5E17F 5FLXK 1CF7B 4XSZF 2XROA 1HXDA 4Y13A 1HKTA 3GFJA 1MUTA 2VC1A 2GIVA 2ZNZA 5LRSA 1R1UA 1BIBA 5GHQA 2Q2EA 3GEZA 1ZN2A 5GHIA 2DQRA 1XSXA 5ANTA 1GHCA 1UFMA 5LEJA 1K2EA 3T5XA 3I53A 1IN7A 1IN8A 1LDKB 5LHHA 2G7HA 1LB2A 2Y48A 5LHIA 3I9XA 2I8UA 1BI3A 5LBQA 2NNNA 4KG4A 2HFHA 1RUNA 2PI0A 3JSPA 1PPWA 3GO5A 5D4RA 5F6FA 1ZG3A 3HRMA 1J5YA 4IRIA 1PP8F 1LDJA 3WODF 1MGTA 1SFUA 2ACJA 1QGPA 5ICCA 4HFQA 2ZKZA 2W85A 2VBXA 5LPGA 3GYHX 3ZMZA 5K1YA 3RDIA 2F2EA 2KJCA 2A8SA 2FRHA 1XSDA 1ON2A 2PEXA 4Q5SF 1SOIA 1RIOH 4N9HA 3O8SA 2Y0MA 1U8RA 2ICKA 3FMRA 3OGAA 5LHGA 1OYWA 3HIFA 3DEUA 2BE5F 3CUQA 4N1TA 1J9IA 2K86A 1ZRFA 5L3EA 4KFCA 2PG4A 2Z99A 1XGOA 2KIUA 2IA0A 1IXSB 2EV0A 3GUDA 2ZFWA 2VODA 3QPHA 3HHGA 3EYYA 5HZXA 3MEXA 1HBXG 1EH7A 2GA1A 2PNYA 2QQBA 2RDPA 3QRFF 2E7XA 4U88A 4EJWA 3X0PA 3K0LA 2CG4A 4UUVA 4EJOA 2DBBA 2GAUA 3JTHA 2FU4A 2M87A 2E1CA 2E1NA 2A61A 1U5TB 3U1DA 3MCFA 3T1BA 4A0YA 4EM1A 1R67A 4KN7X 5IT9K 2VOPA 1SZ3A 4JBAA 3Q91A 5DDGA 3GVAA 2ZO4A 1W7PA 3Q4IA 2MH9A 5E8IA 2XKPA 3I58A 4KIGA 3BZ6A 5C8LA 3F21A 4HV6A 2L3DA 4IJXA 1SJYA 4KYWA 1MR2A 3WTSC 1PDNC 4R1HA 4RAZA 5E18F 5JVTA 3ZR1A 2XAGA 3E5QA 4AVPA 2V9VA 1NQZA 2DT5A 1ONVA 2HWVA 4L18B 4RS8A 2FMYA 2G73A 4NFWA 2IVMA 1MP2A 1Q54A 1RYAA 3ELKA 2YR2A 2ZJ2A 3KEQA 1UHWA 1FZPB 3ML6A 2Z3YA 2MBFA 4P55A 2GT4A 2GXBA 5A2QZ 4KUMA 4MGRA 4Q4ZF 4HX8A 4DYWA 5ERIA 1YTYA 2BYVE 2GWRA 4ESBA 1USTA 5ED4A 2DSBA 3Q9SA 2PMUA 3CTAA 3M9AA 4A5MA 4EMSA 3DV8A 1R1VA 4OIRF 3GF2A 4A6EA 4Y15A 1JKNA 5ILUA 2VN2A 2ZXJA 3WGGA 1FSEA 1H9TA 3WGHA 1SD6A 3SZPA 5DPKA 1ZYRF 3LA3A 3SXYA 4S2XA 4YOQA 3ZP5A 1K78B 1ZH5A 5J8FA 3COAC 5DD4A 4OU0A 2YSRA 5E1XA 4UXNA 2YVOA 3IC7A 4D0PA 3GW2A 1LQ1A 2XASA 2M8EA 2FQ3A 1R5HA 2FA5A 2MA3A 3BAPA 3ZMUA 3RKYA 3CLOA 4YFNF 3J80K 3MDGA 4NQWA 3KCCA 1JXSA 4MPOA 5E1ZB 2V1DA 5LGUA 1KU3A 4EGZA 2A8PA 2UXXA 4I09A 1LDDA 5HLIA 1IRGA 3LQQA 2O3FA 3DPLC 2LNBA 1X51A 2O5FA 3V7SA 1O3SA 2OZ6A 3KP5A 4I2OA 1BIAA 1VRLA 1DUXC 1TTYA 1NHAA 2JZYA 1FX7A 1V8WA 2Z33A 4M71A 1AWCA 1TUMA 4HAMA 1W5SA 3C7JA 2ISZA 2A69F 1Z05A 1KTGA 3REOA 2ZCWA 5D5XB 3BM4A 5KVRA 1FY7A 1J7KA 4HV5A 2R5WA 1S7AA 2DSCA 2YYHA 3GG6A 1DPRA 1JHFA 3KP6A 1KU9A 4XLPF 2HOEA 3BY6A 2K02A 2A6HF 1YG2A 1AOYA 2WWYA 3Q93A 3DQVC 3HSFA 3TGNA 3F22A 5HOOA 2MLKA 3I5UA 3FMSA 3J7Ye 1BN5A 3MFKA 2EFOA 3KP3A 2CGPA 3WU1B 4V14A 1HW5A 4Q47A 2ESNA 4P96A 3R6SA 3LWFA 1L0OC 4OIOF 4WXCA 3BHOA 4TV7A 3JSOA 3I4PA 3E57A 1DP7P 1B4AA 5FO5A 1V8SA 2IA1A 2AXLA 1MJBA 1WRJA 1X84A 1MDMB 5I8UA 3BOQA 1OMIA 3L7WA 5D6EA 1RRQA 1G9QA 1B1BA 1CF7A 3R61A 1IRFA 5FFZA 2RGVA 4YPHA 4LK1F 4GYIA 5FD5A 2P8TA 4HDVA 1NFSA 3FHZA 2QQ9A 3CNGA 2L54A 5K5QA 1KU7A 3M1EA 4ZG0A 4U7DA 4FX4A 4Z2YA 1O7FA 3KFWX 1NFZA 1YQAA 2F5CA 3B73A 3ZMVA 4L9TA 5IW5A 2IPQX 3QSJA 4IF4A 1TW2A 2EV6A 2Z5UA 2A8TA 2HDCA 1HW2A 4KT5C 4OIQF 3MAJA 1KU2A 3L9FA 1FBUA 4G7HF 1SFXA 1SAXA 4L0YB 2FNPA 5HVQC 1B9NA 4LGWA 3NEUA 3ZMSA 5FSLA 3JAMK 1FYMA 4ZH4F 4ESFA 3J80Z 5E1WA 3MGMA 1IXRC 3ZN0A 4AD9A 3SFZA 2VBYA 3O6BB 1B6AA 2RQPA 2FKBA 1FLIA 4M73A 3GZ5A 3QU6A 4CGZA 4BHBA 2XAFA 4DQ2A 2VNPA 1TNTA 4UNOA 3QP5A 2FEZA 3EETA 2XSQA 4MNUA 2NNYA 4S05A 4F7ZA 3FK9A 3SHFA 2CL3A 4ICKA 1YS6A 3CDHA 1Z7UA 3IWZA 4U7BA 2I8TA 2F5EA 2O5WA 3RI4A 1ZGJA 5DEQA 2LF8A 3IWFA 4XRFA 4XSXF 1K6OA 2L01A 3KLNA 5L3DA 1XCVA 3GWZA 3O2PE 4A0ZA 2DLLA 2J8QA 4R8HA 2R3SA 2VONA 1RRSA 4LLGF 3R60A 2PQ8A 1T0FA 1XGSA 1LEBA 3HRTA 1SU2A 1KQ9A 2J5OA 2ESHA 5LGTA 5ICFA 2B06A 5D6FA 3Q2SA 1SD7A 2C6YA 1TQMA 1R5GA 4LB6B 5ILVA 3SZTA 1WI9A 3FF5A 4WF2A 2QWWA 3RKWA 2B2KA 2HTSA 2WC2A 4G8XA 2V6CA 4L9JA 4B09A 3FSPA 1VC8A 4UVCA 1MJ9A 3L85A 4YIFA 2BGCA 1D5VA 2W57A 2DK8A 2CW0F 1IXCA 3BPXA 5D8KB 4HQEA 2ZBKA 4ENJA 4FX0A 1QZYA 1T39A 3U9GA 1KQ8A 1I6XA 2V1UA 3Q5FA 2PN6A 2CO5A 2A07F 4M72A 2DU9A 3O61A 5GHPA 1DPUA 1OW2A 1OYYA 1U5TA 2EFNA 3T0YA 1QBJA 1RUOA 1RZ4A 3V8JA 5D8LB 2PJPA 1XD7A 2P6TA 4KDPA 5AIQA 2V1XA 1GXQA 3RPQA 2JT1A 1U3EM 2KDWA 3KLOA 3AAFA 4IJAA 2RV8A 2YVMA 3H92A 2D45A 2O6GE 2FVVA 3V7CA 4M9SA 3GFMA 4G6DA 2M1BA 3GZ6A 1PUEE 4ASNA 5IT3A 4A12A 3QOPA 3EQLF 3VODA 4JZUA 3GRNA 3R03A 4JZVA 2GXGA 4MTDA 2KKOA 1ZGAA 4BAYA 1V8YA 4HX4A 1IUYA 3ZN1A 3NQOA 5JR3A 3N77A 5BQTA 3BP8A 1HQCA 4RAYA 1G3TA 4PDKA 2O61A 2A6TA 2FNAA 4KYXA 4IPAA 2XAJA 1XSAA 4IXAA 1R22A 1K7AA 5HDGA 3K1PA 4S2YA 2K27A 3E6BA 5AIPA 4A6DA 1WQ2A 1KYWA 3ABTA 3FJYA 1G3YA 4WK8F 1HKQA 3P7NA 4NFXA 2QVOA 1JE8A 1V4RA 2W25A 5FSNA 4WWCA 1Y0UA 1J75A 3ECOA 4Q48A 2G9WA 2XGXA 4H0EA 3CUQC 1KYZA 2FBKA 1SMYF 2JPCA 2JPBA 1YYVA 3HHHA 5DV5A 2PQVA 2QBYB 6PAXA 2DO7A 1WKMA 3RKXA 4MEXF 2DTRA 3ZQ7A 5EEGA 4BXUA 3AC9A 5J8CA 5BOXA 1KA8A 3F6AA 3ISPA 4ENNA 5BPDA 3WTTC 1MJAA 5HDNA 2F5FA 1FWZA 1A04A 5FSOA 2AS5F 5D5VB 4HF2A 4ENMA 2XV4S 3SQNA 3A6VA 2A5YB 5DUKA 5CLSA 4PCQA 4EM0B 3J7AO 3U53A 1GXPA 3K1MA 4OMZA 1P92A 5L3FA 1SMTA 1XDUA 2B0VA 3HSRA 3G3ZA 4M6XA 3VEPA 3EF5A 1S8NA 4UHTA 5LEKA 1MDMA 2GB5A 2I6KA 5FGMA 3MDIA 2DW4A 2G7UA 2G74A 1FYLA 1P4WA 5CFIA 5CFJA 2EK5A 1LNWA 1BOAA 2R7DA 2EB7A 2P5LC 2QZ8A 4HF0A 1XSCA 4UVBA 2VBWA 3BWGA 3O3KA 5IW4A 4HBLA 4RB3C 3B02A 4MQVA 3ZMTA 4C9XA 4RGXA 1QO0D 2IP2A 3PFIA 4IRHA 3F23A 4K6EA 3N97A 3EEUA 1Q27A 4KIFA 2ZNYA 3FZVA 3M8FA 4I0BA 1YW8A 1YFHA 1ZLKA 2K7LA 5GHMA 3LSTA 5C7TA 1O3RA 2CSOA 4A0XA 3OV8A 3FXQA 4HVYA 3GXOA 3FWEA 2IRFG 3WTZA 5ICGA 3I7UA 4M9ZA 2KDVA 2EFWA 2B0LA 1STZA 2JVBA 4KNYA 2RVCA 3F13A 3N9UA 4C9WA 4QWQA 1I1SA 4IVNA 1HSJA 2VC0A 3ZR0A 3GWYA 4ZYGA 2VOOA 1KHZA 1D3YA 3IL2A 3F8NA 5ILSA 3X0RA 1TNSA 2H6BA 4S2WA 1IN4A 4U0WA 3HYQA 4RB1A 2FOKA 1LVAA 2DI3A 1O57A 4RB2C 1RI7A 3WU0A 5H6RA 4XLNF 3I71A 3X0OA 2L4AA 4OIPF 1FPQA 3WTUC 4U0YA 4MHGA 3O6ZA 4KN4X 1OYIA 1HZTA 1W7PD 3DKWA 4HDUA 4RGRA 4O6JA 2GZWA 3Q2TA 2FMLA 3VOEA 1JRKA 4M6YA 2HQRA 1BI2A 2EFPA 3J81K 3Q1PA 2QKMB 3DF8A 4ZZDA 1IW7F 4O5VA 3E6DA 5J6XA 1Q33A 2RC4A 2XVCA 5ANVA 2AZWA 1Z6TA 4ZZLA 2QQAA 3L2CA 2Q0OA 3ACAA 2DUKA 4Y17A 3KVHA 1R23A 1XGNA 3OOPA 2OBPA 2EJRA 1LJ9A 1P4AA 2BBYA 1TW3A 2UWMA 1Z6RA 1E17A 3X0IA 4HF1A 1ZARA 3BROA 5GHJA 3RYRA 2P5KA 4G94A 2D1VA 2MD5A 3TKYA 2IA2A 3D5LA 2DHOA 2X0LA 5HS8A 1RNLA 3K2ZA 2VT3A 1L3LA 5TRDA 1V8UA 3R0JA 3C1DA 2STTA 2W24A 3HTUA 1ULYA 1ZREA 1XCBA 3WGIA 3IRRA 1FOKA 2W84A 1IAWA 5DCMA 1MQEA 2DK5A 3COUA 5LGNA 3P5TA 1YW9A 3PQJA 1R1TA 1PUNA 3R0AA 1BI1A 2BV6A 2UXNA 1VHGA 4G9YA 4CZZA 5IT9Z 4LG0A 1FP2A 2K4BA 1K26A 3I59B 4LFUA 2XAQA 3EDPA 4CXFA 4YPRA 2ZMEA 2NS0A 1I9AA 5BONA 3X0MA 1V8IA 3W6KB 1ZHFA 4CDGA 4RGSA 4OMYA 1T2KA 1VCDA 2PMHA 4KIBA 2EV5A 1GVJA 4ZYHA 2A68F 2E7WA 5CVUA 3IKTA 1QQIA 3H3ZA 4G7ZF 2R7FA 1IZ1A 1J2XA 1OKRA 4BYYA 2VBZA 5BS6A 1V8TA 3H95A 3GZ8A 3WTWC 3CO7C 5BMZA 3PQKA 2CWEA 2VNQA 3L00A 3V8KA 4LK0F 3HOSA 3I59A 3IRQA 3ECHA 3X0QA 4P9FA 2OA4A 4CHUA 3BPVA 3D0SA 3G73A 4KMUX 2L4MA 5HLHA 3TQNA 5D4SA 4EJUA 2O03A 3ABUA 5K5OA 5L3BA 2CQKA 5FD6A 2H6CA 3DPTA 4HOBA 5DD8A 3HHJA 3DXJF 3DFGA 2MH2A 4HYEA 3SMDA 3KZZA 3BJ6A 2XRNA 4JZSA 1Z9CA 2HR3A 4L0ZB 3V8LA 2HGCA 2WTEA 5HS7A 2DQLA 5HS9A 3P9IA 5CVJA 5CVIA 5H20A 4L5IA 1P4XA 4EQQA 5FB2A 3TO7A 1EH8A 2MLGA 5ANUA 1FNNA 5GHNA 1G3WA 3A6TA 3X0SA 2NYXA 1ON1A 4CYDA 2HKXA 2XIGA 1HSTA 5E8GA 1XGMA 4I98B 3KETA 1S6LA 5BPIA 2Y75A 3F3XA 3CO6C 2JSCA 2ADUA 2HS5A 3ZMDA 4FHTA 3K9TA 1C0WA 2OD5A 1IN6A 1IRYA 1MKMA 1U20A 2D1HA 2P7VB 3F8MA 3WE2A 4KTBA 4UVAA 1V8NA 1G0SA 5ICEA 3F6VA 3R4KA 3GFLA 2LKPA 1QZZA 1MK1A 2O8XA 1R58A 5E20A 3LAJA 1PUSA 4LB5A 1MZBA 4JZTA 1GA7A 1O7LA 1QPMA 3TO6A 1S3JA 4JK1X 3KEOA 5L3CA 2M30A 3QP6A 2ICJA 2A8QA 1VC9A 3ULQB 1J0RA 3FXUA 4G6QA 2H27A 2DSDA 3CUQB 4O3MA 3FM3A 3KE2A 2HTJA 4HLYA 3IKVA 3EYIA 1G3SA 2Q8KA 3RJPA 4AIKA 3QAHA 4IRGA 5C7QA 3QU3A 1W7PB 3EXQA 3QPTA 3WTVC 4KICA 1Z91A 1YO5C 5JFRA 4LLNA 3S2WA 3TOBA 3ERED 3WG9A 3O69A 4L9VA 5JI6A 2A8RA 5CJ9A 3CJNA 1W5TA 3SONA 4YFKF 4KMFA 2ZMEB 3WE3A 5FLXZ 2WV0A 4PGGA 1KQ0A 3LA2A 1HX3A 3F8CA 1VIQA 4NHJA 1R36A 2EWNA 4HLXA 4DNCA 2RN7A 1XDSA 1JHHA 1I27A 5DYMA 4G7OF 1ZLJA 3HRUA 2LF7A 1ZAOA 3E5UA 4BHPA 3WTXC 1OR7A 1SD4A 1VIUA 3MZHA 3P6YA 2XUBA 1F9NA 1VHZA 2XAHA 2FBHA 3DP7A 4ENKA 3KP2A 4WCGA 1HKSA 3T8TA 5ANWA 3X0JA 1H0MA 4IHSA 2QJOA 4YFXF 2L02A 1BJAA 1SFEA 1I5ZA 2QYOA 4FT8A 5FSKA 2IJLA 4CO8A 1O3QA 4PZJA 4ZYDA 1B59A 4MQ9F 2OQGA 1USSA 1F1ZA 3A6UA 1UB9A 4LD5A 5DCFA 2PFBA 3BJOA 3HTSB 3ROUA 3LQRA 1WWXA 1P2FA 2P6SA 4EGYA 3KP7A 2FE3A 1TQIA 3FXRA 3WHWA 2H94A 4RGUA 4N1UA 2VT2A 5F64A 3EESA 3RH7A 4P5OA 4M74A 3JAMZ 3E5XA 4ILQA 3X0KA 1YS7A 5CVRA 3W6JB 4HQMA 1J59A 2HEOA 1JGSA 3TO9A 4N0BA 2YPRA 3FCMA 3SHDA 3TDZC 3ZPLA 1FBQA 3MCZA 3JTGA 2P4WA 3Q9VA 2F5DA 4HA8A 1U5TC 1FC3A 2IT0A 2RRKA 2P7CB 1QVJA 5AONA 4AWXB 5D5UB 4S04A 1P6RA 1O3TA 4WX9A 4I01A 3H3UA 1T38A 3FX3A 4E70A 1UCRA 3KP4A 4OOIA 5KK1A 3BJAA 3T8RA 2V79A 5D5WB 1V8VA 1XSBA 3E6CC 3FM5A 5HDKA 1Q1HA 2A3SA 1XN7A 4YIIA 2EA2A 1W4MA 1U6GA 1CGPA 1ODDA 1FT9A 1S7OA 2COMA 3M8EA 2PLYA 5ISYA 1YW7A 2ELHA 5CVVA 4LG0B 1G4DA 1H9GA 1BI0A 1D8KA 4L5JA 3TDUC 2M5WA 2QLZA 1U2WA 2PBIA 4I7HA 1IF1A 2HZTA 2O0YA 2A6EF 1QNTA 1X83A 4RB0A 5FFXA 3F8BA 1EH6A 1BM9A 3LFKA 4EJTA 2P5VA 4HX7A 4UV8A 3F72A 3GLXA 2VXZA 2W4EA 3IHUA 1D8JA 4HW0A 1V3FA 1REPC 3P9KA 2MC3A 4I02A 1NQYA 1TBXA 3F6OA 1U78A 2QM3A 3L09A 3E97A 2KIMA 2Z9OA 2H09A 5HLGA 4BHCA 2LSOA 2GT2A 4S2VA 4ETSA 2CFXA 1SD5A 2XKOA 2JTVA 1XSVA 2FSWA 2HYGD 4AIHA 1FSHA 2K4JA 3A6SA 1F5TA 2KRFA 4M9XA 4CICA 1HW1A 4QLCU 5H6QA 5L3GA 1V8MA 4BQAA 2J5PA 1OPCA 5K5RA 1R7JA 5GHOA 1BBYA 4BH9A 2EFQA 2YX4A 1UHMA 3HUGA 4PGHA 3I7VA 1TLHB 1MQWA 4LLLA 2JRTA 3G0QA 1ZG5A 5JHUA 4A2UA 3FFUA 4EM2A 2HKOA 3F8FA 3LA7A 3X0NA 2XHKA 4MTEA 4GO1A 3U2RA 5LRRA 2VE8A 2QUFA 5FSIA 3O52A 5ANSA 2FF4A 2YU3A 1YIOA 1I1GA 4ESJA 4MEYF 3GX4X 4R79A 2STWA 4OINF 3FMQA 3V7RA 3JW4A 3V4GA 2DPDA 1TQPA 1G6NA 2OU2A 2DAOA 3TOAA 4L9NA 1KT9A 3HRSA 4NB5A 3HOTA 4KG3A 4ZYEA 4HZFA 1VTNC 5LLQA 3EUHA 3I54A 2QBYA 4GYGA 1ZG1A 3ID9A 1K79A 3M7GA 2OAZA 4GCVA 4KA4A 4XBFA 4IHTA 4WXDA 1T6SA 1DDNA 3MZYA 3C3WA 4LJZF 4UV9A 1V8RA 4AIJA 4A5NA 4EJVA 5A2QK 1EV7A 1PPXA 3DUPA 2QENA 3NRVA 2Q9PA 5DUIA 2QJTA 1BC7C 2GA2A 3VFZA 2O1CA 2FXAA 3HSEA 4JQFA 4U0VA 3GFIA 1B9MA 2TDXA 4K2EA 2FBIA 4BNCA 3C18A 4GGGA 3N4MA 1Z1DA 5EEHA 2EA4A 2NRAC 4B8XA 2NAZA 4YG2F 3CUOA 2YVNA 1K78A 1PP7U 1YLFA 3I64A 1F4KA 1XMAA 2HQNA 2ETHA 3RYPA 1E2XA 1XMKA 3E3VA 1F3YA 2KJBA 3MWMA 2D2WA 2HYFA 2GQQA 3RIRA 3BDDA 2UZKA 1ZRCA 2BEOA 1S29A 2RKHA 5CYVA 2DPUA 2OZUA 3HYIA 4P9UA 2X4HA 4ON0A 4N9IA 1VK6A 2M45A 2RNJA 2CYYA 2ISYA 1XB4A 1IN5A 2DFIA 3MQ0A 1FYKA 3KZYA 2YVPA 2KIFA 3LAPA 1R00A 4LMYA 1WSUA 4EVIA 1FBSA 1BC8C 1PUQA 4GXOA 3J81Z 5TJJA
chains in the Genus database with same CATH superfamily
3RPUA 3SEQA 1PPVA 2YX7A 1JTXA 1MBGA 2LDUA 3DKUA 4I0AA 3RCOA 3K1NA 5F1RA 2IGKA 4WXHA 2VE9A 3WTYC 4N4NB 3BTLA 4EATA 3E6MA 3CMYA 1X3UA 2LY1A 3P9CA 1VQPI 3K69A 4PUSA 1V8LA 2MYSA 1YJ9I 4BQOA 4H4KC 1ZRDA 5FSMA 2MW8A 1KGSA 1T98A 3VB2A 2OQRA 5DCMB 3S1QJ 1LEAA 4EV0A 2LOOA 4BBSJ 1MD0A 1FP1D 3I0TA 3RTRA 1LKXA 2LMDA 4J7GA 2IW5A 2X6YA 1JI8A 2YU9J 2HQAA 1PJRA 1PVFA 3X0LA 3W2WA 2Y9ZA 3K4BA 4V19K 3GTKJ 5E17F 2VL8A 5EJCA 1CF7B 5FLXK 4HSTA 4DBRA 5IPAA 4XSZF 5KAFC 2XROA 1HXDA 3I9V2 4Y13A 1HKTA 4YRVA 1PYVA 3GFJA 4CH7A 4FQGA 1MUTA 2VC1A 2GIVA 2ZNZA 4AM3A 4JX6A 2EZHA 4QSHA 5LRSA 2BZTA 1R1UA 1IGNA 1BIBA 2O5RA 5KNLA 5GHQA 1W36C 2Q2EA 2HDWA 2VJ4A 3GEZA 3FXOA 1ZN2A 5GHIA 3JRGA 2DQRA 1XSXA 5ANTA 2I5UA 1GHCA 2CUZA 1UFMA 2VXDA 5LEJA 2ECCA 3T5XA 3W6VA 3I53A 1IN7A 1K2EA 1IN8A 1LDKB 5LHHA 4XIDA 2G7HA 1LB2A 1HDDC 1B72B 1UELB 5IY5H 1FIPA 2Y48A 5LHIA 3L2UA 3I9XA 2XF6A 1BI3A 5LBQA 4UUSB 2I8UA 2NNNA 5IP9J 2HFHA 1RUNA 4KG4A 2PI0A 2CW8A 3JSPA 1PPWA 2L9RA 3GO5A 3QOEA 5D4RA 1YX3A 2LFBA 5F6FA 4OAYA 2E2IJ 1ZG3A 3HRMA 1J5YA 4IRIA 1PP8F 4KJZA 1KZHA 2XGEA 1LDJA 3WODF 2DJNA 3PIPF 4CUGA 1MGTA 2EBIA 2K40A 2ACJA 1SFUA 4BQNA 1QGPA 5ICCA 2M4KA 5E3NA 2ZKZA 2W85A 4HFQA 1TWCJ 2VBXA 1SVOA 2QSHX 5DM6F 3GYHX 3ZMZA 5LPGA 5K1YA 3RDIA 3ZCOA 4M3BA 3RH7A 4ABZA 2F2EA 4BBRJ 5IYBJ 2MD0A 2ZSHB 2KJCA 3AG1H 3JRIA 1OCCH 4XKVA 2A8SA 3L2QA 2FRHA 2M8GX 1XSDA 1ON2A 2PEXA 5JHFA 4Q5SF 1SOIA 2VQGA 1RIOH 3PSFA 4N9HA 1LPQA 3O8SA 4PK4A 2Y0MA 1U8RA 2R93J 5HLTA 2LH9A 2DMUA 2JA2A 3FMRA 2ICKA 3OGAA 5LHGA 2X6WA 1OYWA 4IHYA 4E7JA 3HIFA 2NS8A 3DEUA 2BE5F 1K83J 3CUQA 4N1TA 4PJLA 1J9IA 2X85A 2K86A 1ZRFA 5L3EA 2Y0SN 3OYCA 1PUFA 4KFCA 2PG4A 2E19A 2Z99A 2DCEA 1JUSA 1XGOA 2KIUA 1HC8A 2IA0A 2R7WA 2X1EA 1AA7A 4PFPA 4FCYA 1POGA 1IXSB 2EV0A 3EPZA 4OWRB 3GUDA 1VQ9I 3W2AA 2ZFWA 2W82A 4MIMA 3PO3J 3FXJA 2VODA 2DOEA 3QPHA 3HHGA 3EYYA 4F91B 1VQMI 2DXIA 2WV1A 3MEXA 3LOCA 1HBXG 1EH7A 2V7FA 2GA1A 5HZXA 3M1CA 5GTHC 2PNYA 3FXMA 4LG3A 4F92B 3SDBA 2QQBA 2RDPA 3CP2A 2R5ZA 3QRFF 2E7XA 2MABA 4U88A 4EJWA 4QIWN 3X0PA 4DOZA 3ONQA 5LFAA 3KEYA 3K0LA 3PM1A 2Q2EB 2CG4A 3HM5A 4UUVA 4EJOA 3HKZN 3PNYA 3DU5A 2DBBA 2GAUA 3JTHA 2FU4A 2M87A 2E1CA 2WAFA 2E1NA 4D5CA 2A61A 1U5TB 3IAS2 3OYKA 3U1DA 3MCFA 5E3OA 3TEDA 3BLYA 3OOUA 3TW7A 3FK6A 3T1BA 5HNHA 3HBLA 4A3KJ 2M7BA 2QQ8A 2L7KA 4A0YA 3KYLA 3CP8A 4Y3OA 4EM1A 1R67A 4KN7X 2R92J 5IT9K 2VOPA 4C3JJ 1SZ3A 3FBIB 1RESA 4JBAA 3Q91A 4CCKA 1ETKA 5DDGA 2W48A 3GVAA 1ZGWA 2ZO4A 1W7PA 3Q4IA 2MH9A 2DYRH 3CDLA 2HZDA 5E8IA 2XKPA 3I58A 4KIGA 3BZ6A 5C8LA 3F21A 4HV6A 2DMQA 2L3DA 4IJXA 1SJYA 2XGDA 3AL0B 2HOSA 3OYIA 4KYWA 1MR2A 4U87A 3WTSC 1PDNC 4R1HA 4RAZA 5E18F 5JVTA 1X2NA 3ZR1A 2XAGA 4DBQA 5GPCA 4JOMA 3E5QA 4AVPA 3N05A 2V9VA 3MKYB 1NQZA 3CMEI 2DT5A 1ONVA 2HWVA 4L18B 1MBKA 1ZR4A 2DYSH 2DMTA 4RS8A 2FMYA 2G73A 3PIOF 4NFWA 2IVMA 3NARA 1VQ8I 1MP2A 1P7JA 1Q54A 1RYAA 2V26A 3ELKA 2CS3A 2YR2A 2ZJ2A 3KEQA 1RR8C 1UHWA 1FZPB 3ML6A 2Z3YA 2MBFA 4P55A 2GT4A 2GXBA 5C4XJ 5A2QZ 4KUMA 4MGRA 3TBIA 4Q4ZF 2VUMJ 4HX8A 2WB1N 3TW6A 3CCSI 5ERIA 4DYWA 1YTYA 3PFYA 4I76A 2BYVE 2GWRA 4ESBA 4YELA 1USTA 5ED4A 4II3A 2DSBA 4RMNA 4J01A 3S3OA 3Q9SA 2PMUA 3CTAA 3IH4A 2ZFUA 3M9AA 4A5MA 4EMSA 3FXKA 3DV8A 2XSJC 4HPQA 2H1KA 2VKVA 1R1VA 4OIRF 2E34A 3GF2A 4A6EA 4Y15A 1JKNA 5ILUA 2HNHA 1VZ0A 2VN2A 1LVKA 3DTIA 1X19A 2ZXJA 2V6EA 2PJRA 1BOBA 3G4SI 2QSFX 3WGGA 1FSEA 3A4CA 3HJEA 1H9TA 3WGHA 1EJ9A 4IL6C 1UAAA 1SD6A 3HB9A 1TC3C 3DLAA 3SZPA 1Z7LA 5DPKA 2Y2ZA 1ZYRF 3LA3A 3HZJA 3SXYA 2K3FA 4S2XA 4YOQA 2RAEA 2ZC2A 3ZP5A 1K78B 3PJRA 1ZH5A 5J8FA 3COAC 5DD4A 4OU0A 2YSRA 5E1XA 4UXNA 1D1BA 2YVOA 5GAEJ 3IC7A 4D0PA 3GW2A 1LQ1A 3OL3A 2XASA 1JKPC 2M8EA 4ZTFA 2LY2A 4FE7A 2R0QC 4FE4A 2GXAA 2FQ3A 2KLOA 1R5HA 2FA5A 2MA3A 3DBRB 4NNJA 1J09A 3OY9A 3BAPA 1SVLA 2FX0A 2W1OA 3CLOA 3RKYA 3ZMUA 2IGOA 1D0YA 2BY0A 2ZSIB 5M5YJ 2JA6J 3MZ8A 4XOTA 4YFNF 1M1EB 3J80K 3MDGA 4NQWA 3KCCA 2P0WA 2KMUA 1JXSA 3DEEA 4MPOA 5E1ZB 2V1DA 5LGUA 5M5WJ 1UG0A 5FKNA 1KU3A 4EGZA 5JLWA 2V9PA 2A8PA 3GTOJ 2UXXA 2A05A 3B6CA 2M4GA 4I09A 1LDDA 2IS2A 5HLIA 1IRGA 3HL2A 3HOWJ 3LQQA 3ZQLA 2O3FA 3DPLC 3OIOA 2LNBA 2DFHA 1X51A 1YX5A 2O5FA 5J47A 3K6GA 2X51A 2KPMA 1X3ZB 3V7SA 1O3SA 3S3MA 2OZ6A 3DPUA 3KP5A 4I2OA 5KAIC 2M2EA 1YOVB 1BIAA 5DS9A 2K9LA 3BTIA 1VRLA 1DUXC 3D5RC 2WAEA 1TTYA 1JTYA 2VJIA 2EZLA 1NHAA 3O8HA 3L2WA 2JZYA 1FX7A 4IHWA 4E7IA 1OCPA 2LKSA 2HVRA 3OYEA 2Z33A 3K2AA 3UR3C 1TWFJ 3M8JA 4M71A 1AWCA 1TUMA 4HAMA 3DKXA 3A01A 2GLOA 1W5SA 3RKQA 3C7JA 3OIPA 3LSPA 2ISZA 2A69F 4HNVA 1Z05A 2ID3A 1KTGA 3REOA 2ZCWA 3HPHA 5D5XB 3ZXSA 3BM4A 3S2HJ 2K9QA 5KVRA 1FY7A 1J7KA 1TWHJ 2WAQN 2BW3A 3K4CA 1LFUP 3VYRB 4AYBA 4KISA 4HV5A 4CYCA 2R5WA 1S7AA 2Q1ZB 2DSCA 2YYHA 3GG6A 1DPRA 1LE8A 4A3MJ 3G2BA 1JHFA 2L5QA 4BL0B 3KP6A 1KU9A 2DA5A 4RAFA 4XLPF 1D5YA 1W0UA 1I6HJ 5J1YA 1GV2A 3JREA 2HOEA 3BY6A 3QWLA 2K02A 2ME6A 2FD5A 5FLVA 1Y1WJ 2A6HF 1YG2A 1AOYA 1Z3XA 4XN3A 4D1QA 4XONA 2WWYA 3Q93A 5GTIC 3DQVC 5J1UA 3HSFA 4LIVA 3TGNA 3F22A 5HOOA 2CJJA 2MLKA 3TP3A 1JUMA 3I5UA 3FMSA 1ENHA 4E7LA 3J7Ye 1BN5A 3MFKA 2EFOA 5EZGA 3KP3A 1QVUA 4C3HJ 4F52A 2JRMA 2CQXA 2CGPA 4NC6A 1I39A 3WU1B 4V14A 1HW5A 4Q47A 2XPUA 2ESNA 4P96A 3R6SA 4QPQA 3LWFA 1L0OC 1V54H 4OIOF 1ITYA 4WXCA 3S1NJ 3BHOA 4TV7A 3CCMI 3LSMA 3GTJJ 3JSOA 1JJ6C 3I4PA 3E57A 2KRHA 1DP7P 1B4AA 1QVTA 5FO5A 1V8SA 2E1MC 2IA1A 2AXLA 2E5NA 4CA0A 2KFDA 1MJBA 1WRJA 1X84A 2X48A 4A93J 5B66C 2DTZA 1MDMB 4A69C 5I8UA 3BOQA 1OMIA 3L7WA 5D6EA 5EEAA 2JUGA 1MSEC 4D9JA 1RRQA 1G9QA 1B1BA 1OJLA 3R61A 3VYSB 1CF7A 3P5JA 4GFBA 1IRFA 3I56I 5FFZA 2RGVA 4YPHA 2QF7A 4LK1F 4GYIA 5FD5A 2P8TA 4HDVA 1NFSA 3FHZA 2QQ9A 3CNGA 3BR1A 2L54A 2QKLB 3CJQB 5K5QA 5M3FJ 3ERMA 2R7QA 1KU7A 3M1EA 4ZG0A 4U7DA 3MN2A 4Z2YA 4FX4A 1O7FA 3KFWX 1NFZA 1YQAA 2F5CA 2LC2A 3B73A 3FHNA 3KX2A 3ZMVA 2KIQA 3BQYA 2DFFA 4L9TA 4XLEA 5F0FA 2GOXB 2L7FP 5IW5A 5IOZA 2IPQX 4II2A 3QSJA 4IF4A 1TW2A 2EV6A 4NBQA 2Z5UA 2A8TA 3QPLA 3CCUI 1QPIA 2HDDA 2HDCA 1HW2A 4KT5C 4OIQF 2PX9A 3MAJA 1KU2A 2KL4A 3L9FA 1FBUA 1UJ8A 4G7HF 1SFXA 1SAXA 1A5JA 4BEHA 4L0YB 2FNPA 5HVQC 2BXZA 1B9NA 3FIWA 4LGWA 2Y69H 3OYLA 3NEUA 3ZMSA 5FSLA 3JAMK 1FYMA 3K70C 4ZH4F 3B6AA 2K9NA 4I99C 4ESFA 4CCJA 3J80Z 3GZNB 5E1WA 2KQRA 2H1LA 5KCMA 3MGMA 1IXRC 3ZN0A 4AD9A 3SFZA 1MMNA 5F0CA 2VBYA 1SAUA 3BZCA 2RNGA 1B6AA 3O6BB 3VSKA 3H0GJ 4E7HA 2RQPA 2O9LA 1H89C 2FKBA 4BY7J 3CMMA 4DIQA 1FLIA 4M73A 3MVPA 1AKHB 3GZ5A 3QU6A 3S32A 4CGZA 4XLFA 2BY2A 2M0CA 4MO7A 3AG2H 4BHBA 2RREA 2XAFA 4DQ2A 2VNPA 1TNTA 4UNOA 3QP5A 2FEZA 3EETA 2XSQA 2OTLI 1FOYA 4MNUA 2NNYA 3AKZA 3DU6A 4S05A 4F7ZA 4GRIA 3FK9A 3SHFA 2CL3A 4ICKA 3L2VA 2E36A 4QTRA 1YS6A 3CDHA 1Z7UA 3ZQQA 3IWZA 4NQWB 4U7BA 4PJNA 4XN0A 1O4XA 1VQLI 2I8TA 3H9QA 1IDZA 2F5EA 3BZKA 2O5WA 3RI4A 1ZGJA 5DEQA 2LF8A 3IWFA 4XRFA 2VB6A 4XSXF 1K6OA 2ZJRF 2L01A 3KLNA 5L3DA 1R71A 4FASD 2DOAA 1XCVA 3GWZA 3O2PE 1W5CC 4A0ZA 2M34A 4PJMA 2DLLA 2J8QA 4R8HA 2R3SA 2VONA 1RRSA 4LLGF 3R60A 2PQ8A 5LD2C 1D0ZA 1T0FA 1XGSA 2O8KA 1LEBA 3PL8A 3HRTA 3FKJA 4M3GA 4UB6C 4M3DA 1SU2A 1KQ9A 3IV5A 2J5OA 2W4SA 2ESHA 1AKHA 5LGTA 1ETWA 5ICFA 2B06A 1V5FA 5D6FA 2IGNA 1T8IA 3Q2SA 1V8WA 4E6KG 1SD7A 1TQMA 1R5GA 4LB6B 5ILVA 3OYDA 2C6YA 2KZVA 2Y9YA 3SZTA 1WI9A 3FF5A 4WF2A 2QWWA 3RKWA 2B2KA 2HTSA 2E2JJ 2FUG2 4C2MJ 1JT0A 2WC2A 4G8XA 2V6CA 4L9JA 1SANA 3DBLB 4B09A 3FSPA 1VC8A 4UVCA 1MJ9A 2E1MB 3L85A 3W3CA 3MKWB 4YIFA 1NH3A 1D0XA 2BGCA 1D5VA 2W57A 2DK8A 2CW0F 1IXCA 2E2HJ 1X4OA 3BPXA 4PSWA 5IP6A 1H88C 3QPSA 5D8KB 3BG7A 1Y8RB 1OR7C 3JRCA 3Q0UA 4E7ZA 3A0HC 1MH4A 1Y1VJ 2HVSA 1D1AA 4Y4RA 4HQEA 2ZBKA 4ENJA 2W7NA 1SEUA 4FX0A 1QZYA 1TP4A 1T39A 4IOAF 3AG4H 3U9GA 1KQ8A 2K9SA 1I6XA 2ZXHA 2V1UA 3Q5FA 4UUSA 5FKLA 2PN6A 2CO5A 2A07F 4M72A 2DU9A 4HSRA 3O61A 5GHPA 1MMSA 2X6OA 3E1SA 1DPUA 1OW2A 1OYYA 1ORKA 3GTGJ 5H2FC 1P7IA 1FOWA 1U5TA 5IYCJ 2EFNA 2EINH 3T0YA 2HXIA 2NS7A 4XRSG 1QBJA 5F27A 3M3YJ 1RUOA 4XLHA 1RZ4A 3V8JA 5D8LB 1WJAA 2PJPA 1XD7A 1OCOH 2P6TA 1DU0A 1FMVA 3VYTB 3TMOA 2CUFA 1MNMC 2BHZA 4KDPA 5AIQA 2DDBA 2MC4A 2V1XA 3GTQJ 2EZKA 1GXQA 3RPQA 2JT1A 1U3EM 2KDWA 3KLOA 2M0MA 1X1DA 3AAFA 2BW3B 1NG6A 4IJAA 2Z16A 2RV8A 3CCRI 2YVMA 1DP3A 3H92A 1WJCA 2JMWA 3VPRA 2D45A 2LG4A 2O6GE 2FVVA 3V7CA 1WJ5A 2DT6A 5EGOA 4M9SA 3GFMA 4G6DA 2M1BA 3GZ6A 3HG9A 3DKYA 1PUEE 4ASNA 2WA0A 3PNTA 5IT3A 4A12A 3WHCA 3QOPA 3H3VK 3EQLF 3VODA 1ETOA 2XF7A 4XICA 5FROA 4BY1J 4JZUA 3FKIJ 2OTJI 3MKZA 4BEHB 2Y0SA 4CCMA 4FTHA 4DJAA 3GRNA 3R03A 4DZPA 4JZVA 2DMPA 2GXGA 4MTDA 2OC6A 2KKOA 1ZGAA 1RETA 1YITI 4BAYA 1V8YA 4HX4A 1VQKI 3ZN1A 3NQOA 5JR3A 2PMZN 2WBMA 4HNTA 3I4MJ 1WFXA 1IUYA 3N77A 2KZGA 5BQTA 3BP8A 1HQCA 4B43A 1RKWA 4HRIA 3QYFA 1P9QC 1G3TA 4RAYA 4PDKA 2A6TA 2O61A 2FNAA 3RSNA 5K7ZA 2BXYA 4OAZA 4KYXA 4IPAA 4D7NA 2XAJA 1XSAA 2UUZA 3D5SC 4IXAA 3K4LA 1JKOC 1R22A 1K7AA 5EYRA 5HDGA 3K1PA 3CCJI 4S2YA 2K27A 3E6BA 5AIPA 5C4JJ 3G1OA 4A6DA 1EF4A 1WQ2A 1KYWA 3ABTA 4ANJA 1G3YA 3FJYA 5HODA 3K10A 4BJ6C 1ACIA 1ETXA 3IUOA 2V9KA 4WK8F 1QU3A 3G71I 1HKQA 3P7NA 4NFXA 2QVOA 1JE8A 1V4RA 3Q0VA 3ASOH 2W25A 3JRAA 2KP6A 2JA5J 5FSNA 4WWCA 1Y0UA 1J75A 1FTTA 2AXTC 4A3CJ 1X1BA 3ECOA 2PMZA 4Q48A 1Z21A 3M4OJ 2G9WA 1DGRM 2XGXA 4H0EA 3CUQC 2K5CA 3MMYB 1KYZA 1GVDA 2FBKA 2VJJA 4IHXA 2LR8A 1SMYF 2JPCA 3EUKL 3A03A 2JPBA 3ZQIA 1YYVA 5B3SH 2LY9A 3HHHA 3LSJA 5DV5A 5M3MJ 2PQVA 5B1AH 2QBYB 2V4JC 1VQOI 2JWTA 6PAXA 2DO7A 1WKMA 2UV1A 2M7AA 3RKXA 4MEXF 3RZOJ 2DTRA 3HC7A 2G0EA 3ZQ7A 5EEGA 4BXUA 2CQQA 1A35A 2VQLA 3AC9A 3NAUA 5J8CA 1T0FC 5BOXA 1KA8A 1AHDP 3F6AA 5J4VA 3UNGC 3ISPA 3CJTB 3BQZA 4ENNA 5BPDA 1YIJI 4A3DJ 3G1LA 3H1CA 3WTTC 1MJAA 5HDNA 1R4NB 1E3PA 2F5FA 3JRBA 2XB0X 1FWZA 4RM2A 1A04A 1CQTA 2AS5F 5FSOA 5D5VB 2FQ4A 4HF2A 4ENMA 2XV4S 3SQNA 4CCNA 4CSWA 1X1PA 3A6VA 2GIZA 2A5YB 5DUKA 5CLSA 4PCQA 1ERDA 4F3QA 4EM0B 3J7AO 3U53A 2VLAA 1GXPA 1WI3A 3KZIC 1VQ5I 4C3IJ 3K1MA 4OMZA 1P92A 1FTZA 3BR2A 3PUBA 2AO9A 3HPGA 5L3FA 4XL9A 2EIKH 1SMTA 3JCUC 2QEXI 1XDUA 2B0VA 3HSRA 3G3ZA 5JLXA 2WADA 3CCYA 3IP4B 4M6XA 1TT5B 1MNDA 2IS6A 5B1BH 3OSGA 2NXNB 3OMYA 3WG7H 3VEPA 3EF5A 2VQCA 1S8NA 4UHTA 5LEKA 3JRHA 1MDMA 2GB5A 2I6KA 2CV2A 5FGMA 3MDIA 2DW4A 2G7UA 5DTDA 1GV5A 4I6ZA 3IH2A 4RBOA 2JA7J 2G74A 4JX4A 2Y31A 1FYLA 1P4WA 1RR7A 5CFIA 5CFJA 2EK5A 1LNWA 1BOAA 2R7DA 2EB7A 2JVGA 2E5ZA 2P5LC 2QZ8A 2VPRA 4HF0A 1XSCA 1A6QA 4UVBA 2VBWA 3BWGA 2ZJQF 1TWAJ 3O3KA 2QSGX 5IW4A 3LSRA 4HBLA 5CQEA 4RB3C 3B02A 1ETYA 4MQVA 3ZMTA 1N25A 1QO0D 3DTKA 4RGXA 2IP2A 4C9XA 3AFHA 3CF2A 2VJ5A 3PFIA 2GOMA 3ABKH 3WHBA 3NWTA 2QCOA 3E0JB 2DJIA 4IRHA 2M9HA 2E60A 2HYJA 2PJRB 3F23A 4XM3A 1Y0NA 2L9SA 4K6EA 3N97A 1NK2P 5GADJ 2NVQJ 2F4OB 3EEUA 1Q27A 3OSFA 1XTAA 4KIFA 2ZNYA 1MMDA 2VKHA 3H9JA 3FZVA 3M8FA 4I0BA 1BR4A 2ZXWH 1YW8A 3OWTA 4QPOA 3I55I 1YFHA 1ZLKA 4XK4A 2D5VA 2K7LA 2LREA 4UB8C 5GHMA 2K9MA 3LSTA 5C7TA 1O3RA 2CSOA 4A0XA 3OV8A 3FXQA 4HVYA 4DYCA 3S8PA 1R49A 2OUMA 2I10A 3GXOA 3S14J 1VI0A 3FWEA 2IRFG 3WTZA 3RZDJ 4AU7A 5ICGA 1FEXA 4BJTA 3I7UA 3SZGA 2GM4A 3HGGA 2V1NA 4M9ZA 2KDVA 2EFWA 3QYEA 3DLLF 1I50J 2B0LA 1STZA 3ZQHA 4PFOA 3A0BC 2JVBA 4KNYA 2RVCA 3F13A 3N9UA 4C9WA 1QRYA 3FK7A 4F93B 2JVHA 3OIQA 4QWQA 1I1SA 4IVNA 4UUTA 1HSJA 2VC0A 3ZR0A 3A01B 3GWYA 4ZYGA 2VOOA 1R9TJ 1KHZA 1BL0A 3FXLA 1Z77A 1D3YA 3IL2A 3F8NA 5ILSA 4HG2A 3X0RA 1TNSA 2H6BA 4NC7A 1IN4A 4U0WA 3HYQA 4S2WA 4RB1A 2FOKA 3IH3A 1LVAA 2BOLA 2DI3A 1O57A 4RB2C 1WZ2A 1S9HA 4IZZA 1RI7A 3KIOA 2IS4A 3ABMH 5H6RA 3WU0A 4AUXA 4B44A 3CCQI 3DTEA 4XLNF 3I71A 3X0OA 2KDZA 1X58A 1WH5A 2AHQA 3CCLI 2L4AA 4OIPF 1FPQA 2E35A 3WTUC 4U0YA 4BDZA 2VKEA 4MHGA 1VFCA 4FETA 4KN4X 4YEJA 3J7ZI 3O6ZA 4BDYA 1OYIA 3I3LA 1HZTA 1WCMJ 3VDXA 1W7PD 3DKWA 3OL4A 4HDUA 4RGRA 4O6JA 2KISA 2GZWA 2JK3A 4JP0A 3Q2TA 1QZEA 2LTPA 2FMLA 1OFCX 3VOEA 1Z3YA 1Y56A 1JRKA 4M6YA 2NOGA 2HQRA 1BI2A 2EFPA 1BW6A 4EEFG 1XMXA 1W36D 3GCMA 4A3LJ 3J81K 2ZJPF 2R7VA 4BE0A 3Q1PA 2QKMB 3DF8A 5FJ8J 4ZZDA 1X3WB 1IW7F 4XRSA 4O5VA 3DCFA 3Q3SA 3E6DA 5J6XA 1Q33A 2RC4A 2XVCA 5ANVA 3U1KA 4NC8A 2AZWA 1Z6TA 4ZZLA 2QQAA 3CD6I 4PJJA 3L2CA 2Q0OA 3VYUB 2XAUA 3ACAA 2DFEA 2DUKA 3GTPJ 3KYCB 2HPMA 4Y17A 3BG3A 4BE1A 3KVHA 1A6IA 3K4KA 4C2UA 3QQAA 4J7HA 1R23A 2L0KA 4RAGA 1GT0C 1XGNA 3OOPA 2OBPA 4CYCB 2EJRA 1ZTRA 1IG7A 1LJ9A 1P4AA 3H36A 3RQ4A 5F08A 2BBYA 3ESWB 1TW3A 2LLKA 2UWMA 1IRZA 1APLC 1Z6RA 1YRNB 1E17A 3X0IA 4HF1A 1ZARA 3BROA 5GHJA 5GP9A 2R7SA 2GBYA 3BTJA 2HOTA 3RYRA 2COBA 2P5KA 4G94A 2CW7A 5FKOA 2D1VA 2MD5A 2XPVA 2QGUA 2IA2A 3TKYA 5B5EC 3PSIA 3ZGKA 3D5LA 4D7MA 2DHOA 2X0LA 5HS8A 1RNLA 5EG0B 4F55A 2HVQA 2VT3A 3K2ZA 1GDTA 1L3LA 5TRDA 1V8UA 3R0JA 3C1DA 2STTA 3H5AA 2W24A 1TZLA 2DMNA 2LYCA 1JGGA 4M3FA 1TWGJ 3HTUA 1ULYA 1ZREA 1XCBA 5FKKA 3GTLJ 3RQIA 3FBNB 3WGIA 2XF5A 4J19A 2ICWG 2MSYA 3IRRA 1FOKA 2W84A 5GAHJ 4YIRX 1IAWA 3J7AY 4AC0A 1V55H 1NG7A 2TRTA 5DCMA 1MQEA 2DK5A 1R5ID 3COUA 2ECBA 3QODA 5LGNA 1T33A 1QHHD 3P5TA 1YW9A 2K3PA 5DM7F 3PQJA 4RDUA 4NUBA 3OR1C 1R1TA 2H8WA 1IV8A 3R0AA 1PUNA 1BI1A 2BV6A 2OCCH 2UXNA 3S3NA 1VHGA 4G9YA 4CZZA 2H8RA 5IT9Z 3L1PA 4LG0A 1IC8A 3ZQFA 1K4SA 1RRJA 2KDOA 2LVSA 1FP2A 2K4BA 1K26A 3I59B 5E3LA 1XPXA 4LFUA 2XAQA 3EDPA 3Q0WA 4CXFA 4IHVA 4YPRA 2ZMEA 3QYBA 2NS0A 1I9AA 5BONA 3ZQGA 3X0MA 1ETVA 2I8DA 5C44J 1V8IA 4PSXA 3JR9A 3W6KB 1ZHFA 1HA8A 3CC7I 1T56A 4CDGA 4RGSA 4OMYA 1T2KA 1VCDA 3C2HA 3ABLH 2PMHA 2YUSA 4KIBA 3HEFA 4XRMA 3PUFA 2EV5A 2MGQA 2DOFA 1GVJA 2CFOA 4XQFA 4ZYHA 1N75A 4B3AA 5FLMJ 2A68F 3EUAA 2Z2SB 2E7WA 2O7OA 5CVUA 3IKTA 1QQIA 3H3ZA 2R7FA 1IZ1A 1J2XA 2DA4A 4G7ZF 1OKRA 4BYYA 2VBZA 2R7UA 1Y8QB 4DW6A 5BS6A 1V8TA 1K61A 1G8XA 2X6XA 4J00A 3H95A 3GZ8A 2L7MP 5CKTA 4B3XA 1UHSA 3WTWC 2DA2A 3CO7C 5BMZA 5FRNA 1GUUA 3PQKA 3OS2A 2CU7A 1BW5A 2R7OA 2X9DA 2CWEA 2VNQA 3L00A 2F4IA 3V8KA 3LSKA 4LK0F 3HOSA 2R7ZJ 3OYGA 1MH3A 3I59A 3IRQA 2L2OA 2MFZA 1Z67A 3ECHA 3X0QA 5TGTA 1V5GA 2IEKA 4P9FA 2OA4A 4CHUA 1IO2A 1QHGA 2CH0A 5IOYA 3BPVA 3D0SA 3G73A 4KMUX 2L4MA 3BG9A 5HLHA 3TQNA 5D4SA 4EJUA 2O03A 3ABUA 2AQFA 5K5OA 5L3BA 2CQKA 1N78A 5FD6A 2H6CA 3DPTA 3S15J 4HOBA 5DD8A 5E79C 3HHJA 3DXJF 4A3IJ 5J4YA 3OYMA 3DFGA 2MH2A 4HYEA 3SMDA 3KZZA 3BJ6A 2XRNA 4JZSA 3SYTA 1Z9CA 2HR3A 1JKQC 4L0ZB 3V8LA 4ZJZA 2HGCA 1R4MB 1RKTA 2WTEA 5HS7A 1PUFB 2DQLA 5HS9A 3P9IA 2XSDC 5CVJA 5CVIA 5H20A 4MFDA 3BTCA 4X1EA 3BR6A 4L5IA 4E7KA 3HOUJ 1P4XA 4EQQA 5FB2A 2X1CA 3WU2C 2DA3A 3TO7A 3BG6A 4N4OB 1EH8A 2MLGA 2YS9A 5ANUA 1FNNA 5GHNA 1G3WA 2WY8Q 3A6TA 2NYXA 3X0SA 1ON1A 4CYDA 2EZIA 2HKXA 2XIGA 1HSTA 1OISA 5E8GA 1XGMA 4I98B 3KETA 1S6LA 3SJMA 5BPIA 4XMYA 1JJ8C 3PO2J 2F6CA 1EA3A 3CF5F 2EH3A 2Y75A 2Z1DA 2HXOA 3F3XA 3CO6C 2JSCA 2VQHA 2ADUA 2EILH 2HS5A 3A02A 3ZMDA 4B48A 4FHTA 3K9TA 1TL8A 1YHQI 2OD5A 1IN6A 1C0WA 2R7XA 1MBHA 1IRYA 2EIJH 5C3EJ 1H8AC 4B1RA 1MKMA 2A5WA 4LOCA 1U20A 4ZDOA 2XC7A 2D1HA 2P7VB 3F8MA 2QA4I 3WE2A 4KTBA 2F5VA 3J7YJ 4UVAA 1V8NA 4CCLA 1G0SA 5ICEA 5F1JA 3F6VA 1FOXA 1BJZA 3R4KA 2OV7A 3GFLA 1YE9A 2LKPA 1QZZA 1MK1A 2O8XA 1WPKA 4JX5A 1F36A 3LNQA 2OF7A 1G2HA 1WJDA 2OPTA 1W1WE 1R58A 5E20A 3LAJA 1B72A 1PUSA 2R7TA 4KT6A 4LB5A 2R5YA 1MZBA 4RA2A 2HOAA 1GA7A 4JZTA 1XS9A 1O7LA 1OCZH 1QPMA 1VNDA 3TO6A 2L9VA 3CLQA 1S3JA 3G1MA 4JK1X 1Y39A 3KEOA 1X1AA 1VQNI 5L3CA 2M30A 3HUGB 3AG3H 1WJBA 3QP6A 4XLAA 2DDAA 2ICJA 2A8QA 1VC9A 3ULQB 1J0RA 4A3GJ 4C2TA 1FIAA 2IGMA 2L7ZA 3FXUA 1ZKGA 4G6QA 2H27A 1D1CA 1WHUA 2DSDA 2CV1A 3CUQB 4O3MA 3FM3A 3K70D 5CPRB 1JKRC 3KE2A 2HTJA 4HLYA 1S7EA 2RQQA 2BY3A 3IKVA 3EYIA 1LUJB 1G3SA 2Q8KA 3RJPA 4AIKA 4XORA 4E4HA 4X0GA 3QAHA 3LSHA 4IRGA 5C7QA 3QU3A 1W7PB 1WGXA 3EXQA 3JRDA 4XOPA 3F9KA 3FISA 4B4CA 4IO9F 3QPTA 3WTVC 4KICA 1U9NA 1Z91A 1YO5C 5JFRA 4LLNA 3S2WA 3TOBA 3ERED 3WG9A 4B47A 2R5ZB 3O69A 4L9VA 5JI6A 4DGWB 2A8RA 5CJ9A 2ME0A 3CJNA 2HQ5A 1W5TA 3SONA 3RPUD 4YFKF 2LP0A 1KONA 4KMFA 2ZMEB 3WE3A 5FLXZ 4GDFA 1HOMA 2WV0A 4PGGA 1KQ0A 3LA2A 1HX3A 3F8CA 2BVMA 2CMPA 4NHJA 1VIQA 1OCTC 1R36A 3OYBA 3SDGA 2EWNA 5IP7J 1ZR2A 3PNVA 2N8GA 4HLXA 2ZXIA 1PVEA 4DNCA 2CZRA 2RN7A 4IOCF 1E0EA 1XDSA 4DZJA 1JHHA 1BA5A 2M3AA 1I27A 3K4MA 5DYMA 4A3FJ 4G7OF 4BQQA 1ZLJA 4BXFA 4BE2A 3HRUA 2LF7A 1G59A 1ZAOA 1E3OC 1EKEA 4XKWA 3E5UA 4BHPA 1NK3P 3ZRGA 3WTXC 1OR7A 5EF6A 1MBJA 1VQ6I 1SD4A 2DA6A 1VIUA 3MZHA 3C2GA 3P6YA 2XUBA 2BVLA 1F9NA 4BUPA 1VHZA 2XAHA 5JVGF 2FBHA 3DP7A 1MNEA 1WVRA 4N1UA 4ENKA 1QA6A 3KP2A 4ZC3A 4WCGA 2XPWA 1UG2A 1HKSA 1BR1A 3T8TA 5ANWA 3X0JA 1SFKA 2EQRA 1WH7A 1H0MA 4IHSA 1RC9A 2QJOA 4YFXF 2L02A 1BJAA 1SFEA 5EDNA 1I5ZA 1B8IB 2DODA 2QYOA 4FT8A 5BNGA 5FSKA 2IJLA 2DT7B 4CO8A 3O8GA 3FDYA 5M5XJ 3S1RJ 1IJWC 2BY1A 5EGOB 1O3QA 3M07A 4PZJA 1ZK8A 4ZYDA 1B59A 4MQ9F 3V42A 4PJ0C 2OQGA 3HGYA 1USSA 1F1ZA 3HOZJ 2B9SA 4XLCA 4IQJA 1MBEA 3A6UA 2WAQA 3K4JA 1X4PA 5K7HA 4M6VA 1UB9A 4LD5A 3W2VA 2CV0A 5DCFA 2L9NA 2PFBA 3MD2A 3BJOA 3HTSB 3ROUA 4A3BJ 3LQRA 1JT6A 3CCVI 1WWXA 2BHYA 4AVZA 1P2FA 2P6SA 4EGYA 3KP7A 2FE3A 5J1RA 1TQIA 3FXRA 3WHWA 2F4MB 2H94A 4RGUA 2VT2A 1S5LC 5CQGA 5F64A 4Y52J 3EESA 4M3EA 4P5OA 2CQNA 4ITVA 4P1WA 4M74A 3JAMZ 3E5XA 3L2RA 1MMAA 4ILQA 3H35A 2XRLA 4IQ4A 1XX5A 2E1OA 1LE8B 3X0KA 1YS7A 1K6YA 5CVRA 3W6JB 4HQMA 1S72I 1J59A 2HEOA 2CUEA 4Y33A 1HLVA 1JGSA 1ETQA 3TO9A 3ZOBA 4N0BA 1LFPA 2YPRA 3FCMA 3SHDA 3SFIA 1Y6IA 3C2BA 1DQUA 3TDZC 3ZPLA 1FBQA 2HPIA 2DA7A 3MCZA 3JTGA 3BC8A 2P4WA 3Q9VA 3HOYJ 2F5DA 3K4NA 4HA8A 1U5TC 3HKZA 3JRFA 2IS1A 1FC3A 3E7LA 4MLOA 2IT0A 2RRKA 1U9OA 2P7CB 4ZTJA 1QVJA 1U8BA 1FMWA 5AONA 4AWXB 5D5UB 4S04A 1P6RA 1O3TA 5TISC 1OCRH 4WX9A 3CMAI 4I01A 3OYFA 3H3UA 1T38A 3FX3A 4D5FA 4E70A 1UCRA 3KP4A 4OOIA 5KK1A 3BJAA 3T8RA 1OLTA 3CC4I 3U21A 4BACA 5FRMA 2V79A 3HOVJ 3K7AJ 5D5WB 3ZQCA 1V8VA 2HU9A 4DYQA 1XSBA 3E6CC 3FM5A 2ID6A 5HDKA 1NTCA 1Q1HA 2VASA 2FJ1A 4C30A 2A3SA 2HI3A 2JJ7A 2Y30A 1XN7A 4YIIA 2EA2A 1F43A 1W4MA 5F0HA 1U6GA 2LK2A 2X1DA 3I4NJ 4ZDPA 4BKXA 1CGPA 2VPLA 1ODDA 1FT9A 1SC7A 1S7OA 2COMA 3M8EA 2PLYA 5ISYA 1I3QJ 2LBFB 3ASNH 3BR0A 1YW7A 2ELHA 5CVVA 5KHDA 3D1NI 4LG0B 1G4DA 1H9GA 1XG1A 4LITA 1BI0A 1E3HA 1AU7A 1D8KA 4L5JA 2F48A 2LRDA 2M5WA 3TDUC 2QLZA 2JSPA 1U2WA 2PBIA 4RLQA 2KT0A 4I7HA 1IF1A 2HZTA 2O0YA 1VF9A 2A6EF 1QNTA 2IAIA 1X83A 4RB0A 1WJEA 3OYNA 5FFXA 1JUPA 3F8BA 1EH6A 1BM9A 2XDVA 3LSGA 3LFKA 2VI6A 4EJTA 1HDPA 5J3LA 2XB5A 2P5VA 4HX7A 4UV8A 3BR3A 2WB1A 3F72A 1W0TA 2ELKA 2VXZA 3GLXA 3TL4X 2W4EA 2JUCA 3IHUA 1D8JA 2EPFA 4Y7NJ 4HW0A 1V3FA 4V2GA 2JQ7A 1REPC 3P9KA 2MC3A 4I02A 5EG0A 1NQYA 1TBXA 3F6OA 1U78A 2QM3A 3KPHA 3L09A 4IX7A 2CQ7A 3BT9A 3E97A 2KIMA 4ZYAA 2Z9OA 2H09A 3TP0A 5K7FA 5HLGA 4BHCA 2LSOA 2E71A 3OYHA 2GT2A 3CC2I 2R7RA 4S2VA 2XGCA 3GMEA 4ETSA 1HCRA 1MSFC 2CFXA 3GTMJ 1SD5A 2XKOA 5E3MA 2JTVA 1XSVA 2FSWA 2HYGD 4AIHA 1FSHA 2K4JA 2NVTJ 3HOXJ 3A6SA 1F5TA 2EIMH 2KRFA 2ZMEC 2KRCA 3EUHC 4M9XA 2OJED 4BU2A 1T08B 4CICA 5IYDJ 3BR5A 1HW1A 5J40A 4QLCU 4XKCA 5H6QA 5L3GA 3CZ6A 3ZR8X 1V8MA 1I3AA 1MBFA 4BQAA 2J5PA 4JYKA 4DYRA 1OPCA 2B7EA 5K5RA 1YI2I 1R7JA 4Z6YA 5GHOA 3A1YA 2VKDA 1BBYA 1UMQA 1X2MA 4BH9A 2EFQA 4AIDA 1U0JA 2YX4A 3BCBA 1UHMA 3HUGA 4PGHA 3OR2C 4A3EJ 3I7VA 2KHMA 1TLHB 1MQWA 2LKXA 4V2FA 4LLLA 3S16J 2JRTA 4UY8I 3G0QA 4KITB 1VQ4I 1ZG5A 1XC5A 5JHUA 2DA1A 2FOWA 4A2UA 3FFUA 4EM2A 2HKOA 3F8FA 3LA7A 3X0NA 2ELJA 2XHKA 4RM3A 4MTEA 4GO1A 3U2RA 5LRRA 4W1UA 1FJLA 3BCAA 2VE8A 2QUFA 1MMGA 1Q1VA 3CESA 5FSIA 4C9YA 3O52A 4NDLA 3LFUA 2W00A 2ZB9A 5ANSA 2FF4A 3S1MJ 2LD5A 3HXLA 2YU3A 1YIOA 1I1GA 4ESJA 3NWSA 4L5EA 1IRXA 4MEYF 4XNFA 1ZELA 3GX4X 3VSLA 4R79A 2STWA 4OINF 5GAGJ 3FMQA 2CUJA 3IAM2 2R4GA 3V7RA 2K85A 1N77A 4IKFA 3JW4A 3V4GA 2DPDA 1TQPA 1DGWY 1IDYA 1MIJA 4A3JJ 1G6NA 1K4TA 2OU2A 2DAOA 3LL7A 3S2DJ 3OS1A 3TOAA 2MG4A 2WY7Q 4L9NA 4LIUA 1V5EA 3HRSA 4NB5A 3HOTA 1KT9A 4ZYEA 4KG3A 3DBHB 4HZFA 3OYAA 1VTNC 2NVUB 5LLQA 3S93A 3EUHA 3I54A 2QBYA 4GYGA 1ZG1A 3BG5A 1K79A 3A2KA 3ID9A 3M7GA 2OAZA 3DEWA 1HF0A 2VIXA 4GCVA 4KA4A 4XBFA 4IHTA 4WXDA 1T6SA 1DDNA 3MZYA 3GLLA 3C3WA 2OCEA 4LJZF 2JN6A 2NOJB 9ANTA 4UV9A 4ZDLA 1VQ7I 1V8RA 4AIJA 2NVXJ 4A5NA 4EJVA 5A2QK 4G6TB 1EV7A 1PPXA 3DUPA 1MW7A 2QENA 3NRVA 2Q9PA 5DUIA 1A31A 4RLFA 4IEJA 2QJTA 2GA2A 3OYJA 1BC7C 1SVMA 3VFZA 2O1CA 2FXAA 3HSEA 1TT0A 4JQFA 4U0VA 3GFIA 4AYBN 1B9MA 4W97A 2IBDA 2TDXA 4K2EA 1SFOJ 4X6AJ 3SEZA 2NVYJ 2FBIA 4BNCA 3GBGA 4XKBA 3C18A 4GGGA 4S0HB 1Z1DA 1X1CA 3N4MA 5EEHA 2EA4A 3H5RA 1IV6A 2NRAC 3CJRB 4B8XA 2NAZA 4CCOA 1UZCA 4YG2F 3CUOA 4FISA 2YVNA 4BS9A 1PP7U 1K78A 1YLFA 1IUFA 3I64A 4BJ5C 5GPAA 1F4KA 1XMAA 5HNFA 1ZQ3P 2HQNA 4G12A 2ETHA 3RYPA 4HNUA 1YJWI 4BGDA 1E2XA 1XMKA 2CRGA 3E3VA 3VWBA 1F3YA 4BXXJ 2KJBA 1LFBA 3MWMA 2D2WA 3H5NA 3X2QH 1RPWA 2HYFA 1B8IA 5FKMA 2GQQA 3RIRA 3BDDA 3H9GA 1WJFA 2UZKA 1ZRCA 3HDDA 4XR6A 2BEOA 1S29A 2RKHA 2TCTA 4E7SA 5CYVA 3G6EI 2DPUA 2OZUA 3HYIA 1R6RA 3DWLE 2P81A 4P9UA 2X4HA 1YJNI 4ON0A 3F0CA 3MKLA 3H0DA 4N9IA 1VK6A 5EZHA 2M45A 2RNJA 4CZCA 2CYYA 1DU6A 2DN0A 2ISYA 1XB4A 1IN5A 2DFIA 3MQ0A 2AQEA 1BR2A 5F04A 3S17J 1GLNA 1YRNA 1FYKA 3KZYA 1A36A 2YVPA 1T95A 3KYDB 3CDIA 2B63J 2JA8J 1Z0XA 3UKGA 2KIFA 3LAPA 2R5YB 1R00A 1OQYA 4LMYA 1WSUA 4EVIA 1FBSA 3LMMA 3AL0C 1BC8C 1PUQA 4GXOA 4MFEA 3OS0A 3J81Z 3CQZJ 2IXSA 3LSIA 4HEA2 3CCEI 2LBFA 5TJJA
chains in the Genus database with same CATH topology
3RPUA 1PPVA 2YX7A 2LDUA 3DKUA 4I0AA 3K1NA 5F1RA 4WXHA 2VE9A 3WTYC 3E6MA 1X3UA 3P9CA 3K69A 1V8LA 1ZRDA 5FSMA 1KGSA 1T98A 3VB2A 2OQRA 5DCMB 1LEAA 4EV0A 1MD0A 1FP1D 3I0TA 3RTRA 4J7GA 2IW5A 3X0LA 1PVFA 5E17F 5FLXK 1CF7B 4XSZF 2XROA 1HXDA 4Y13A 1HKTA 3GFJA 1MUTA 2VC1A 2GIVA 2ZNZA 5LRSA 1R1UA 1BIBA 5GHQA 2Q2EA 3GEZA 1ZN2A 5GHIA 2DQRA 1XSXA 5ANTA 1GHCA 1UFMA 5LEJA 1K2EA 3T5XA 3I53A 1IN7A 1IN8A 1LDKB 5LHHA 2G7HA 1LB2A 2Y48A 5LHIA 3I9XA 2I8UA 1BI3A 5LBQA 2NNNA 4KG4A 2HFHA 1RUNA 2PI0A 3JSPA 1PPWA 3GO5A 5D4RA 5F6FA 1ZG3A 3HRMA 1J5YA 4IRIA 1PP8F 1LDJA 3WODF 1MGTA 1SFUA 2ACJA 1QGPA 5ICCA 4HFQA 2ZKZA 2W85A 2VBXA 5LPGA 3GYHX 3ZMZA 5K1YA 3RDIA 2F2EA 2KJCA 2A8SA 2FRHA 1XSDA 1ON2A 2PEXA 4Q5SF 1SOIA 1RIOH 4N9HA 3O8SA 2Y0MA 1U8RA 2ICKA 3FMRA 3OGAA 5LHGA 1OYWA 3HIFA 3DEUA 2BE5F 3CUQA 4N1TA 1J9IA 2K86A 1ZRFA 5L3EA 4KFCA 2PG4A 2Z99A 1XGOA 2KIUA 2IA0A 1IXSB 2EV0A 3GUDA 2ZFWA 2VODA 3QPHA 3HHGA 3EYYA 5HZXA 3MEXA 1HBXG 1EH7A 2GA1A 2PNYA 2QQBA 2RDPA 3QRFF 2E7XA 4U88A 4EJWA 3X0PA 3K0LA 2CG4A 4UUVA 4EJOA 2DBBA 2GAUA 3JTHA 2FU4A 2M87A 2E1CA 2E1NA 2A61A 1U5TB 3U1DA 3MCFA 3T1BA 4A0YA 4EM1A 1R67A 4KN7X 5IT9K 2VOPA 1SZ3A 4JBAA 3Q91A 5DDGA 3GVAA 2ZO4A 1W7PA 3Q4IA 2MH9A 5E8IA 2XKPA 3I58A 4KIGA 3BZ6A 5C8LA 3F21A 4HV6A 2L3DA 4IJXA 1SJYA 4KYWA 1MR2A 3WTSC 1PDNC 4R1HA 4RAZA 5E18F 5JVTA 3ZR1A 2XAGA 3E5QA 4AVPA 2V9VA 1NQZA 2DT5A 1ONVA 2HWVA 4L18B 4RS8A 2FMYA 2G73A 4NFWA 2IVMA 1MP2A 1Q54A 1RYAA 3ELKA 2YR2A 2ZJ2A 3KEQA 1UHWA 1FZPB 3ML6A 2Z3YA 2MBFA 4P55A 2GT4A 2GXBA 5A2QZ 4KUMA 4MGRA 4Q4ZF 4HX8A 4DYWA 5ERIA 1YTYA 2BYVE 2GWRA 4ESBA 1USTA 5ED4A 2DSBA 3Q9SA 2PMUA 3CTAA 3M9AA 4A5MA 4EMSA 3DV8A 1R1VA 4OIRF 3GF2A 4A6EA 4Y15A 1JKNA 5ILUA 2VN2A 2ZXJA 3WGGA 1FSEA 1H9TA 3WGHA 1SD6A 3SZPA 5DPKA 1ZYRF 3LA3A 3SXYA 4S2XA 4YOQA 3ZP5A 1K78B 1ZH5A 5J8FA 3COAC 5DD4A 4OU0A 2YSRA 5E1XA 4UXNA 2YVOA 3IC7A 4D0PA 3GW2A 1LQ1A 2XASA 2M8EA 2FQ3A 1R5HA 2FA5A 2MA3A 3BAPA 3ZMUA 3RKYA 3CLOA 4YFNF 3J80K 3MDGA 4NQWA 3KCCA 1JXSA 4MPOA 5E1ZB 2V1DA 5LGUA 1KU3A 4EGZA 2A8PA 2UXXA 4I09A 1LDDA 5HLIA 1IRGA 3LQQA 2O3FA 3DPLC 2LNBA 1X51A 2O5FA 3V7SA 1O3SA 2OZ6A 3KP5A 4I2OA 1BIAA 1VRLA 1DUXC 1TTYA 1NHAA 2JZYA 1FX7A 1V8WA 2Z33A 4M71A 1AWCA 1TUMA 4HAMA 1W5SA 3C7JA 2ISZA 2A69F 1Z05A 1KTGA 3REOA 2ZCWA 5D5XB 3BM4A 5KVRA 1FY7A 1J7KA 4HV5A 2R5WA 1S7AA 2DSCA 2YYHA 3GG6A 1DPRA 1JHFA 3KP6A 1KU9A 4XLPF 2HOEA 3BY6A 2K02A 2A6HF 1YG2A 1AOYA 2WWYA 3Q93A 3DQVC 3HSFA 3TGNA 3F22A 5HOOA 2MLKA 3I5UA 3FMSA 3J7Ye 1BN5A 3MFKA 2EFOA 3KP3A 2CGPA 3WU1B 4V14A 1HW5A 4Q47A 2ESNA 4P96A 3R6SA 3LWFA 1L0OC 4OIOF 4WXCA 3BHOA 4TV7A 3JSOA 3I4PA 3E57A 1DP7P 1B4AA 5FO5A 1V8SA 2IA1A 2AXLA 1MJBA 1WRJA 1X84A 1MDMB 5I8UA 3BOQA 1OMIA 3L7WA 5D6EA 1RRQA 1G9QA 1B1BA 1CF7A 3R61A 1IRFA 5FFZA 2RGVA 4YPHA 4LK1F 4GYIA 5FD5A 2P8TA 4HDVA 1NFSA 3FHZA 2QQ9A 3CNGA 2L54A 5K5QA 1KU7A 3M1EA 4ZG0A 4U7DA 4FX4A 4Z2YA 1O7FA 3KFWX 1NFZA 1YQAA 2F5CA 3B73A 3ZMVA 4L9TA 5IW5A 2IPQX 3QSJA 4IF4A 1TW2A 2EV6A 2Z5UA 2A8TA 2HDCA 1HW2A 4KT5C 4OIQF 3MAJA 1KU2A 3L9FA 1FBUA 4G7HF 1SFXA 1SAXA 4L0YB 2FNPA 5HVQC 1B9NA 4LGWA 3NEUA 3ZMSA 5FSLA 3JAMK 1FYMA 4ZH4F 4ESFA 3J80Z 5E1WA 3MGMA 1IXRC 3ZN0A 4AD9A 3SFZA 2VBYA 3O6BB 1B6AA 2RQPA 2FKBA 1FLIA 4M73A 3GZ5A 3QU6A 4CGZA 4BHBA 2XAFA 4DQ2A 2VNPA 1TNTA 4UNOA 3QP5A 2FEZA 3EETA 2XSQA 4MNUA 2NNYA 4S05A 4F7ZA 3FK9A 3SHFA 2CL3A 4ICKA 1YS6A 3CDHA 1Z7UA 3IWZA 4U7BA 2I8TA 2F5EA 2O5WA 3RI4A 1ZGJA 5DEQA 2LF8A 3IWFA 4XRFA 4XSXF 1K6OA 2L01A 3KLNA 5L3DA 1XCVA 3GWZA 3O2PE 4A0ZA 2DLLA 2J8QA 4R8HA 2R3SA 2VONA 1RRSA 4LLGF 3R60A 2PQ8A 1T0FA 1XGSA 1LEBA 3HRTA 1SU2A 1KQ9A 2J5OA 2ESHA 5LGTA 5ICFA 2B06A 5D6FA 3Q2SA 1SD7A 2C6YA 1TQMA 1R5GA 4LB6B 5ILVA 3SZTA 1WI9A 3FF5A 4WF2A 2QWWA 3RKWA 2B2KA 2HTSA 2WC2A 4G8XA 2V6CA 4L9JA 4B09A 3FSPA 1VC8A 4UVCA 1MJ9A 3L85A 4YIFA 2BGCA 1D5VA 2W57A 2DK8A 2CW0F 1IXCA 3BPXA 5D8KB 4HQEA 2ZBKA 4ENJA 4FX0A 1QZYA 1T39A 3U9GA 1KQ8A 1I6XA 2V1UA 3Q5FA 2PN6A 2CO5A 2A07F 4M72A 2DU9A 3O61A 5GHPA 1DPUA 1OW2A 1OYYA 1U5TA 2EFNA 3T0YA 1QBJA 1RUOA 1RZ4A 3V8JA 5D8LB 2PJPA 1XD7A 2P6TA 4KDPA 5AIQA 2V1XA 1GXQA 3RPQA 2JT1A 1U3EM 2KDWA 3KLOA 3AAFA 4IJAA 2RV8A 2YVMA 3H92A 2D45A 2O6GE 2FVVA 3V7CA 4M9SA 3GFMA 4G6DA 2M1BA 3GZ6A 1PUEE 4ASNA 5IT3A 4A12A 3QOPA 3EQLF 3VODA 4JZUA 3GRNA 3R03A 4JZVA 2GXGA 4MTDA 2KKOA 1ZGAA 4BAYA 1V8YA 4HX4A 1IUYA 3ZN1A 3NQOA 5JR3A 3N77A 5BQTA 3BP8A 1HQCA 4RAYA 1G3TA 4PDKA 2O61A 2A6TA 2FNAA 4KYXA 4IPAA 2XAJA 1XSAA 4IXAA 1R22A 1K7AA 5HDGA 3K1PA 4S2YA 2K27A 3E6BA 5AIPA 4A6DA 1WQ2A 1KYWA 3ABTA 3FJYA 1G3YA 4WK8F 1HKQA 3P7NA 4NFXA 2QVOA 1JE8A 1V4RA 2W25A 5FSNA 4WWCA 1Y0UA 1J75A 3ECOA 4Q48A 2G9WA 2XGXA 4H0EA 3CUQC 1KYZA 2FBKA 1SMYF 2JPCA 2JPBA 1YYVA 3HHHA 5DV5A 2PQVA 2QBYB 6PAXA 2DO7A 1WKMA 3RKXA 4MEXF 2DTRA 3ZQ7A 5EEGA 4BXUA 3AC9A 5J8CA 5BOXA 1KA8A 3F6AA 3ISPA 4ENNA 5BPDA 3WTTC 1MJAA 5HDNA 2F5FA 1FWZA 1A04A 5FSOA 2AS5F 5D5VB 4HF2A 4ENMA 2XV4S 3SQNA 3A6VA 2A5YB 5DUKA 5CLSA 4PCQA 4EM0B 3J7AO 3U53A 1GXPA 3K1MA 4OMZA 1P92A 5L3FA 1SMTA 1XDUA 2B0VA 3HSRA 3G3ZA 4M6XA 3VEPA 3EF5A 1S8NA 4UHTA 5LEKA 1MDMA 2GB5A 2I6KA 5FGMA 3MDIA 2DW4A 2G7UA 2G74A 1FYLA 1P4WA 5CFIA 5CFJA 2EK5A 1LNWA 1BOAA 2R7DA 2EB7A 2P5LC 2QZ8A 4HF0A 1XSCA 4UVBA 2VBWA 3BWGA 3O3KA 5IW4A 4HBLA 4RB3C 3B02A 4MQVA 3ZMTA 4C9XA 4RGXA 1QO0D 2IP2A 3PFIA 4IRHA 3F23A 4K6EA 3N97A 3EEUA 1Q27A 4KIFA 2ZNYA 3FZVA 3M8FA 4I0BA 1YW8A 1YFHA 1ZLKA 2K7LA 5GHMA 3LSTA 5C7TA 1O3RA 2CSOA 4A0XA 3OV8A 3FXQA 4HVYA 3GXOA 3FWEA 2IRFG 3WTZA 5ICGA 3I7UA 4M9ZA 2KDVA 2EFWA 2B0LA 1STZA 2JVBA 4KNYA 2RVCA 3F13A 3N9UA 4C9WA 4QWQA 1I1SA 4IVNA 1HSJA 2VC0A 3ZR0A 3GWYA 4ZYGA 2VOOA 1KHZA 1D3YA 3IL2A 3F8NA 5ILSA 3X0RA 1TNSA 2H6BA 4S2WA 1IN4A 4U0WA 3HYQA 4RB1A 2FOKA 1LVAA 2DI3A 1O57A 4RB2C 1RI7A 3WU0A 5H6RA 4XLNF 3I71A 3X0OA 2L4AA 4OIPF 1FPQA 3WTUC 4U0YA 4MHGA 3O6ZA 4KN4X 1OYIA 1HZTA 1W7PD 3DKWA 4HDUA 4RGRA 4O6JA 2GZWA 3Q2TA 2FMLA 3VOEA 1JRKA 4M6YA 2HQRA 1BI2A 2EFPA 3J81K 3Q1PA 2QKMB 3DF8A 4ZZDA 1IW7F 4O5VA 3E6DA 5J6XA 1Q33A 2RC4A 2XVCA 5ANVA 2AZWA 1Z6TA 4ZZLA 2QQAA 3L2CA 2Q0OA 3ACAA 2DUKA 4Y17A 3KVHA 4J7HA 1R23A 1XGNA 3OOPA 2OBPA 2EJRA 1LJ9A 1P4AA 2BBYA 1TW3A 2UWMA 1Z6RA 1E17A 3X0IA 4HF1A 1ZARA 3BROA 5GHJA 3RYRA 2P5KA 4G94A 2D1VA 2MD5A 3TKYA 2IA2A 3D5LA 2DHOA 2X0LA 5HS8A 1RNLA 3K2ZA 2VT3A 1L3LA 5TRDA 1V8UA 3R0JA 3C1DA 2STTA 2W24A 3HTUA 1ULYA 1ZREA 1XCBA 3WGIA 3IRRA 1FOKA 2W84A 1IAWA 5DCMA 1MQEA 2DK5A 3COUA 5LGNA 3P5TA 1YW9A 3PQJA 1R1TA 1PUNA 3R0AA 1BI1A 2BV6A 2UXNA 1VHGA 4G9YA 4CZZA 5IT9Z 4LG0A 1FP2A 2K4BA 1K26A 3I59B 4LFUA 2XAQA 3EDPA 4CXFA 4YPRA 2ZMEA 2NS0A 1I9AA 5BONA 3X0MA 1V8IA 3W6KB 1ZHFA 4CDGA 4RGSA 4OMYA 1T2KA 1VCDA 2PMHA 4KIBA 2EV5A 1GVJA 4ZYHA 2A68F 2E7WA 5CVUA 3IKTA 1QQIA 3H3ZA 4G7ZF 2R7FA 1IZ1A 1J2XA 1OKRA 4BYYA 2VBZA 5BS6A 1V8TA 3H95A 3GZ8A 3WTWC 3CO7C 5BMZA 3PQKA 2CWEA 2VNQA 3L00A 3V8KA 4LK0F 3HOSA 3I59A 3IRQA 3ECHA 3X0QA 4P9FA 2OA4A 4CHUA 3BPVA 3D0SA 3G73A 4KMUX 2L4MA 5HLHA 3TQNA 5D4SA 4EJUA 2O03A 3ABUA 5K5OA 5L3BA 2CQKA 5FD6A 2H6CA 3DPTA 4HOBA 5DD8A 3HHJA 3DXJF 3DFGA 2MH2A 4HYEA 3SMDA 3KZZA 3BJ6A 2XRNA 4JZSA 1Z9CA 2HR3A 4L0ZB 3V8LA 2HGCA 2WTEA 5HS7A 2DQLA 5HS9A 3P9IA 5CVJA 5CVIA 5H20A 4L5IA 1P4XA 4EQQA 5FB2A 3TO7A 1EH8A 2MLGA 5ANUA 1FNNA 5GHNA 1G3WA 3A6TA 3X0SA 2NYXA 1ON1A 4CYDA 2HKXA 2XIGA 1HSTA 5E8GA 1XGMA 4I98B 3KETA 1S6LA 5BPIA 2Y75A 3F3XA 3CO6C 2JSCA 2ADUA 2HS5A 3ZMDA 4FHTA 3K9TA 1C0WA 2OD5A 1IN6A 1IRYA 1MKMA 1U20A 2D1HA 2P7VB 3F8MA 3WE2A 4KTBA 4UVAA 1V8NA 1G0SA 5ICEA 3F6VA 3R4KA 3GFLA 2LKPA 1QZZA 1MK1A 2O8XA 1R58A 5E20A 3LAJA 1PUSA 4LB5A 1MZBA 4JZTA 1GA7A 1O7LA 1QPMA 3TO6A 1S3JA 4JK1X 3KEOA 5L3CA 2M30A 3QP6A 2ICJA 2A8QA 1VC9A 3ULQB 1J0RA 3FXUA 4G6QA 2H27A 2DSDA 3CUQB 4O3MA 3FM3A 3KE2A 2HTJA 4HLYA 3IKVA 3EYIA 1G3SA 2Q8KA 3RJPA 4AIKA 3QAHA 4IRGA 5C7QA 3QU3A 1W7PB 3EXQA 3QPTA 3WTVC 4KICA 1Z91A 1YO5C 5JFRA 4LLNA 3S2WA 3TOBA 3ERED 3WG9A 3O69A 4L9VA 5JI6A 2A8RA 5CJ9A 3CJNA 1W5TA 3SONA 4YFKF 4KMFA 2ZMEB 3WE3A 5FLXZ 2WV0A 4PGGA 1KQ0A 3LA2A 1HX3A 3F8CA 1VIQA 4NHJA 1R36A 2EWNA 4HLXA 4DNCA 2CZRA 2RN7A 1XDSA 1JHHA 1I27A 5DYMA 4G7OF 1ZLJA 3HRUA 2LF7A 1ZAOA 3E5UA 4BHPA 3WTXC 1OR7A 1SD4A 1VIUA 3MZHA 3P6YA 2XUBA 1F9NA 1VHZA 2XAHA 2FBHA 3DP7A 4ENKA 3KP2A 4WCGA 1HKSA 3T8TA 5ANWA 3X0JA 1H0MA 4IHSA 2QJOA 4YFXF 2L02A 1BJAA 1SFEA 1I5ZA 2QYOA 4FT8A 5FSKA 2IJLA 4CO8A 1O3QA 4PZJA 4ZYDA 1B59A 4MQ9F 2OQGA 1USSA 1F1ZA 3A6UA 1UB9A 4LD5A 5DCFA 2PFBA 3BJOA 3HTSB 3ROUA 3LQRA 1WWXA 1P2FA 2P6SA 4EGYA 3KP7A 2FE3A 1TQIA 3FXRA 3WHWA 2H94A 4RGUA 4N1UA 2VT2A 5F64A 3EESA 3RH7A 4P5OA 4M74A 3JAMZ 3E5XA 4ILQA 3X0KA 1YS7A 5CVRA 3W6JB 4HQMA 1J59A 2HEOA 1JGSA 3TO9A 4N0BA 2YPRA 3FCMA 3SHDA 3TDZC 3ZPLA 1FBQA 3MCZA 3JTGA 2P4WA 3Q9VA 2F5DA 4HA8A 1U5TC 1FC3A 2IT0A 2RRKA 2P7CB 1QVJA 5AONA 4AWXB 5D5UB 4S04A 1P6RA 1O3TA 4WX9A 4I01A 3H3UA