5DD4A

Apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
221
structure length
221
Chain Sequence
YSSNPTFYLGIDCIIFGFNEGEISLLLLKRNFEPAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGAFGAIDRDPGERVVSIAYYALININEYDRELVQKHNAYWVNINELPALIFDHPEMVDKAREMMKQKASVEPIGFNLLPKLFTLSQLQSLYEAIYGEPMDKRNFRKRVAEMDFIEKTDKIDKLGSKRGAALYKFNGKAYRKDPKFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR AraR
publication title A novel transcriptional regulator of L-arabinose utilization in human gut bacteria.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Transcription regulator
total genus 55
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dd4A02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5dd4A01
2YVOA 1ZYRF 4MQVA 3WU1B 2CWEA 1TBXA 3R03A 3SHDA 4O6JA 2BV6A 5ICFA 3TO6A 4FHTA 1LDJA 2EA4A 1U2WA 2F5EA 2QVOA 3E5XA 1S29A 5FSNA 1UFMA 2HZTA 3E3VA 5HVQC 1L0OC 1FNNA 4CZZA 3HTSB 5E1XA 3IKTA 2DBBA 2XAFA 1J7KA 3HSFA 1XCBA 2FF4A 1VCDA 1NFSA 5FSIA 5E1WA 1U8RA 1B1BA 2KIMA 1QBJA 2I8UA 4IJAA 2CQKA 5ILSA 4MHGA 2KDWA 3I0TA 1V8LA 3HOSA 2PEXA 3WTXC 2P7VB 2XV4S 5ANWA 1QQIA 4HF2A 1J0RA 2QQAA 3GW2A 1SZ3A 4UXNA 4UHTA 3I4PA 1AWCA 2QM3A 1ZG1A 5BS6A 1XGMA 1IRYA 3BROA 2TDXA 4Y15A 2HR3A 3DQVC 3EESA 2LF7A 1SFEA 4UVAA 2OQGA 1XMAA 4BHBA 3G0QA 4HYEA 4KG4A 3JSOA 3CUQB 4KIBA 3HRSA 1PP7U 2PMUA 2OA4A 5CVJA 3F8FA 2OAZA 5CFIA 1BJAA 3DP7A 3EUHA 4EJUA 3KETA 4ESFA 4ZZDA 2VC0A 2P5LC 4KMFA 4GCVA 4OMZA 3X0MA 3CO6C 4UV8A 4TV7A 1OW2A 1Z91A 1IXCA 4HVYA 3TO7A 4YPRA 4G7OF 2VODA 5LHHA 1KU2A 1TW2A 2A6TA 3FSPA 4ZYDA 3B02A 4LD5A 4NFXA 1YIOA 2LNBA 3G3ZA 3P5TA 3L09A 3IWFA 2WC2A 1DUXC 3KP5A 2D45A 4ENNA 4KA4A 4M6XA 3ECHA 5HS7A 4BQAA 2B06A 1OYYA 5K5RA 2GA1A 1PVFA 3C1DA 4HV6A 2MC3A 4L9VA 1NQYA 1HBXG 2PI0A 3X0KA 4LG0B 3RYPA 3K0LA 5H6RA 3HRMA 2JPBA 5D5XB 3JSPA 2JPCA 4I2OA 1XB4A 1SU2A 1FBUA 3FFUA 1SFUA 1T98A 2YVPA 2VBYA 5CFJA 5JHUA 1RRQA 3JTGA 2L02A 5LEKA 2B0VA 2Y48A 3KP6A 2D1VA 1IUYA 4K2EA 3F8BA 4OMYA 3BAPA 2K27A 4NQWA 4RS8A 1U3EM 5FO5A 5F1RA 4I0AA 5ICGA 1D3YA 1XGSA 3CO7C 5JVTA 3M9AA 3V8JA 2V1XA 3SZTA 2W85A 1R22A 2L54A 3DXJF 1NQZA 4YPHA 4B09A 1ZREA 5EEGA 1IN6A 2FSWA 2MH2A 3TKYA 4EJWA 1LDKB 2BGCA 5D5VB 2RGVA 4EMSA 3E5UA 3J7Ye 4PGGA 2ZKZA 4YG2F 5D5WB 2KKOA 2E7XA 2K7LA 1MKMA 1K79A 3MQ0A 2JVBA 3KP2A 3I71A 2DPDA 4PGHA 1HKSA 4Q4ZF 5FSLA 4KN7X 1X84A 2V79A 3BP8A 3DPLC 3LA7A 3COUA 1TQMA 1FC3A 3CUQA 1Y0UA 1HKTA 1YTYA 5HLIA 4S05A 1YFHA 2PN6A 3COAC 2A6EF 1V8YA 4YFXF 3V4GA 3JAMK 4LMYA 4EV0A 1CF7B 2L4MA 1QNTA 1QVJA 4IRIA 2L01A 1X3UA 1W7PD 1YO5C 2EFNA 2P5KA 2Q0OA 1LEAA 3JAMZ 2XIGA 1I1GA 2LSOA 3TQNA 2ZMEB 3D5LA 2X4HA 3GWYA 3T0YA 1G3TA 2OD5A 4OIRF 1KU7A 1I9AA 4L0ZB 1PUEE 5ANSA 2QUFA 5K5QA 4IHSA 3GEZA 3FX3A 1H9GA 4R79A 1K6OA 1XN7A 2VE8A 1QO0D 3DKUA 2GXGA 4LG0A 3GG6A 4LLLA 1HZTA 2VBZA 2VBWA 4FT8A 1MUTA 1FX7A 5J8FA 2NS0A 3CNGA 4K6EA 3KFWX 3SONA 3X0JA 3T5XA 4OIOF 2EWNA 5CJ9A 3GZ5A 4Q47A 2R3SA 1TTYA 2V1DA 4A6EA 3RJPA 2O8XA 3F13A 4MEXF 1G3YA 1QPMA 4MNUA 3Q91A 3HSEA 2VNQA 2ELHA 2PLYA 1T6SA 3MCFA 2EV0A 2O1CA 1ZGAA 3X0PA 2RKHA 2A6HF 2X0LA 4LB5A 3K69A 2VT2A 1XGOA 1F4KA 5F64A 2XUBA 2L3DA 5DCMA 1REPC 1Q1HA 5GHMA 3R0JA 1IN7A 2DSCA 4U7DA 3F23A 1FYKA 5FSMA 1BIBA 2FA5A 4DNCA 5IT3A 3I58A 1XSAA 4JZSA 1GXQA 3E6BA 3FWEA 3A6UA 2MBFA 1USTA 3TGNA 1XSVA 4KTBA 5HLGA 2H94A 3L9FA 1ZAOA 1D8KA 5FFZA 1JKNA 3ZQ7A 2DAOA 3OV8A 1H9TA 1YLFA 5A2QK 2XAJA 3PQKA 1WQ2A 2J5PA 5BONA 1SMTA 2O5FA 3QRFF 2GT2A 4PCQA 3GX4X 4RGSA 1CF7A 5A2QZ 2Q9PA 3K2ZA 1RYAA 2XAGA 4KG3A 2QJTA 3I9XA 1RI7A 2KJCA 5K5OA 2RV8A 3QSJA 3Q1PA 2WV0A 2ZMEA 3R6SA 1VHZA 5HS8A 1R36A 1I27A 2D2WA 2IT0A 2QQ9A 5ILUA 2A8TA 1V8SA 3C7JA 3IHUA 1RNLA 4MQ9F 3ML6A 3ECOA 1VIQA 3I7UA 3DUPA 4KIGA 5CVRA 4XSZF 4WXHA 2P8TA 4M9ZA 3H3ZA 4L5IA 1IZ1A 2XHKA 3RYRA 1R7JA 3O6BB 2VOPA 3N97A 1V8MA 3P9IA 4GXOA 1SJYA 2FXAA 4HF1A 3GYHX 1S6LA 2YSRA 5LHGA 2NNYA 2QJOA 2FQ3A 2HKXA 2ZCWA 5E17F 3AC9A 3J80K 1P6RA 1W5SA 2STTA 2AXLA 4WWCA 2IA2A 3WE2A 3A6VA 1SMYF 4ESJA 4YFKF 1Q27A 1JRKA 2YVMA 1GXPA 3L85A 1XSBA 3J80Z 5E8GA 2W57A 1TW3A 3ERED 4Z2YA 3J7AO 2BE5F 1HQCA 4ETSA 4ENMA 1ZRCA 3LAJA 1BBYA 4LLGF 2GXBA 3ZMUA 3LA3A 3CUQC 4CDGA 3L00A 2ZXJA 2HYFA 2R7FA 4CICA 3ZPLA 2EFPA 4G94A 3GF2A 2ADUA 2V1UA 1U20A 3P6YA 2AZWA 5JI6A 3FXUA 1VK6A 5C7TA 3B73A 2FOKA 3RIRA 3K1PA 1OKRA 4ICKA 3EETA 2DSBA 2XASA 1MJ9A 4EJOA 1U78A 3GFLA 3JTHA 4N9IA 3VFZA 2DT5A 2MA3A 2YU3A 4EJVA 1O3RA 4CO8A 1YW8A 2UXXA 4IJXA 2QKMB 5BPDA 2PQVA 3DFGA 2FBHA 1U5TB 3EF5A 1W7PB 1O57A 1SFXA 4RGXA 1FLIA 4P9FA 4S04A 3F22A 1DDNA 4S2YA 3IL2A 4G6DA 2HEOA 1J59A 2QLZA 1NFZA 4A2UA 3HHJA 1HSTA 1T39A 4L18B 2UZKA 3O3KA 3S2WA 1FOKA 2GAUA 5JFRA 5J6XA 3V8KA 1ZN2A 2L4AA 4MGRA 4H0EA 3QAHA 1K78B 4KFCA 3F72A 1USSA 3P9KA 3DPTA 5LEJA 4BH9A 1J75A 4EJTA 3MFKA 5D8KB 5LGNA 1T38A 3OOPA 3ZMDA 4MEYF 5F6FA 4OIQF 3TDUC 4IF4A 5GHOA 2EV6A 3FMSA 4JBAA 2YPRA 5ICEA 5LRSA 4O5VA 4KMUX 1XDUA 3WTUC 2YX7A 3AAFA 3LQRA 1BI2A 2HDCA 1FT9A 1B6AA 2DK5A 3HOTA 5D6EA 5L3EA 1IF1A 4I0BA 1S7OA 3O52A 1IRFA 1AOYA 3BHOA 2GB5A 1PUSA 1HW5A 1P92A 4HF0A 2FRHA 1TNSA 3RPUA 4RB3C 2Z9OA 4ESBA 3NQOA 4LJZF 1TQPA 4HLYA 3TDZC 5GHJA 1RUNA 5J8CA 2V6CA 1B9NA 1F5TA 4QWQA 4WF2A 2VXZA 1R1TA 2IRFG 1OR7A 5D6FA 2DFIA 1X51A 2FNAA 1KYZA 1Z1DA 2ZNYA 4Y13A 4L5JA 5CYVA 4ON0A 4S2XA 2GT4A 4XLPF 2XAHA 4U88A 1WKMA 1FY7A 1KQ8A 1U5TA 4CGZA 5BOXA 4BHCA 1G9QA 1W7PA 1GVJA 4NFWA 1Q54A 1G6NA 1B59A 5L3BA 2P4WA 3BY6A 4A5MA 3MEXA 5ERIA 5IT9K 4N1TA 4ZG0A 3O61A 2COMA 1SAXA 3KP4A 2CO5A 3BM4A 2A69F 3ELKA 3M8FA 3JW4A 3O6ZA 2G7UA 3P7NA 4ZYHA 2M8EA 4U0WA 3MZHA 1EH7A 5DCMB 1MQEA 3IRQA 1K78A 5IT9Z 3ISPA 3QOPA 3WG9A 4ZYEA 1V8RA 3K1MA 4LK0F 1JE8A 1O7FA 4JK1X 3VODA 2KIUA 1W5TA 4G8XA 2PFBA 1JGSA 3A6TA 4NHJA 5L3FA 2HS5A 1F9NA 4OINF 2HTJA 3RH7A 4FX4A 5KK1A 3V7SA 2QBYB 2EFWA 1KQ0A 4N9HA 1RZ4A 3A6SA 3O8SA 2RQPA 1D8JA 1I6XA 4HDVA 3FMQA 1PPXA 3F8CA 4KIFA 2QZ8A 3KZZA 2GIVA 1F3YA 1NHAA 2R7DA 2DI3A 2RVCA 3MDGA 3K1NA 3HIFA 1H0MA 1MK1A 3GVAA 3EEUA 4M9SA 1UHWA 1KA8A 4MTEA 2YVNA 1V8WA 1ZH5A 1MJBA 4IXAA 4LLNA 1UHMA 2O3FA 1FSEA 2XROA 2NRAC 1LEBA 3WTYC 2HTSA 2XVCA 5DD8A 2HQRA 1V3FA 4RAZA 1IRGA 5BQTA 4M71A 3TOAA 2E1NA 3W6KB 3HHHA 4LK1F 5ISYA 2BEOA 2IP2A 4CYDA 2Y75A 4KDPA 3FXRA 2KRFA 2A68F 3I53A 4UUVA 2OZ6A 2FU4A 5DD4A 3LAPA 1V8VA 2DQRA 4C9XA 2ZBKA 1R1VA 4EGYA 4WX9A 2OQRA 4Q5SF 3K9TA 2IPQX 4HQMA 4UV9A 2XKOA 3REOA 2DSDA 1Z6RA 4AD9A 3GO5A 3SFZA 2MLKA 1O3QA 1YYVA 5JR3A 3PQJA 1VC8A 4HX4A 3ABUA 5H6QA 3E5QA 1KU9A 4HX7A 1IAWA 3RKXA 4RB0A 2M45A 4RGUA 3ZN0A 5LRRA 4MPOA 1J5YA 4EGZA 3R61A 4RB2C 2LF8A 4HLXA 2DO7A 4A5NA 2DHOA 1O7LA 2M1BA 4IPAA 4BHPA 1R23A 1IXSB 1Z05A 2ZJ2A 2GZWA 2KDVA 2JRTA 5LGTA 5HS9A 2QYOA 1BC7C 4KT5C 2A8QA 3QU3A 3ZMVA 5FSOA 3GFMA 1SOIA 2FBKA 1S7AA 5C8LA 4I09A 2R5WA 3ID9A 3BJ6A 1BIAA 4U7BA 4HV5A 3VOEA 2QBYA 4GYGA 2ICJA 1P4WA 4G6QA 4AWXB 2Q2EA 3FHZA 3X0SA 1G0SA 4F7ZA 3WTSC 3O69A 2B2KA 1BM9A 2K02A 3ZMZA 1TUMA 4XRFA 5FFXA 4CHUA 3C3WA 2C6YA 4ZYGA 1G3SA 3WTZA 3J81K 4A12A 3F21A 2WTEA 1SD6A 4A0YA 1ZG5A 4HA8A 1S3JA 1K2EA 3FXQA 1I5ZA 5GHIA 1Z9CA 1SD7A 2YR2A 4AVPA 4E70A 3E6MA 3J81Z 4HW0A 5FSKA 3FZVA 1J2XA 3NRVA 3EXQA 1EH8A 3E97A 4XLNF 3LQQA 1GA7A 3Q9SA 1IW7F 1CGPA 2MD5A 1QGPA 4M9XA 2Z99A 1A04A 3ZMTA 1OYWA 2EB7A 1U5TC 2PMHA 2XRNA 3KP3A 1BN5A 3LFKA 1B9MA 2LDUA 4MTDA 2EJRA 1ON1A 3QPTA 4D0PA 4HOBA 1KT9A 3GXOA 5FLXK 3ZR0A 3FM3A 3I54A 3F3XA 2O5WA 3EQLF 3ULQB 3RKWA 5E8IA 3KEOA 3T8RA 3X0RA 1Z7UA 5L3GA 4KYWA 2EA2A 1YW9A 5CVIA 2DTRA 2FBIA 2CG4A 2PG4A 4B8XA 4U0VA 3FK9A 5FLXZ 2KIFA 3W6JB 3ABTA 4GGGA 3RDIA 3V7RA 3WGGA 5IW5A 2O03A 1YG2A 1XDSA 3GZ8A 4RAYA 2F2EA 1FZPB 1HW2A 3KZYA 1JHFA 3IC7A 2DK8A 1T2KA 2H6CA 5HOOA 1VC9A 3P9CA 4U0YA 4HBLA 5D8LB 4R8HA 3KP7A 2PQ8A 3U2RA 1PDNC 2FKBA 4BNCA 1Z6TA 3M8EA 3CJNA 3T1BA 1HSJA 4ZZLA 3X0IA 4RB1A 3SZPA 1SD5A 2W4EA 3ZR1A 3FM5A 5C7QA 1U6GA 1P2FA 2RDPA 4V14A 4N1UA 2CFXA 3O2PE 1I1SA 2VN2A 1R00A 3GUDA 3MDIA 2JT1A 4ILQA 4L9NA 4JZUA 3MGMA 1KTGA 1ONVA 1RUOA 3LWFA 1VHGA 2XKPA 5HLHA 3HRTA 3L2CA 4IRGA 5LBQA 2NNNA 2FMLA 3WTTC 3V7CA 2J5OA 5DUKA 1G3WA 4FX0A 4KYXA 3EYYA 4M6YA 4PZJA 2H27A 1STZA 5LHIA 4UNOA 4EQQA 4OOIA 3HYIA 3Q2TA 3GRNA 4HX8A 5ANVA 3BOQA 2P5VA 1W4MA 5E20A 1V8IA 5CVUA 2P7CB 3RI4A 4EM2A 5ANTA 5FD5A 3M1EA 3BPVA 2G74A 5BPIA 2M5WA 4ZH4F 3Q4IA 2KJBA 4I7HA 4EVIA 1FP2A 4CXFA 1ZG3A 1DPRA 4EM1A 2YX4A 1HXDA 2QENA 2GWRA 1Q33A 2HQNA 2XAQA 4LFUA 3MWMA 3QU6A 3BPXA 4IRHA 1E2XA 2OZUA 1XCVA 3WODF 2I8TA 2QQBA 1RRSA 2M30A 1BI0A 3F8NA 2FEZA 3BZ6A 2MH9A 1ON2A 1GHCA 2B0LA 2DW4A 2HFHA 2P6TA 1VTNC 3C18A 3EDPA 4I98B 1R5GA 4KN4X 2H6BA 2IW5A 1UCRA 4WK8F 2RRKA 1WSUA 2E1CA 1VIUA 2Z33A 3KEQA 1V8TA 1O3TA 1P4XA 4NB5A 3I64A 1ZRFA 2FVVA 1FPQA 3FMRA 1S8NA 2DUKA 4YOQA 5L3DA 1LB2A 4I02A 1E17A 2I6KA 5K1YA 3MZYA 5E18F 3TO9A 4BXUA 3GFJA 2VOOA 5CLSA 1L3LA 2HGCA 2HWVA 4KNYA 1P4AA 3HYQA 1QZZA 2WWYA 1FYMA 1PUNA 4P55A 4BYYA 2E7WA 2M87A 5HDKA 2STWA 1WI9A 4GO1A 3N9UA 3Q5FA 4DYWA 2CL3A 3D0SA 1EH6A 2VE9A 5ILVA 2PNYA 2IJLA 2ISYA 2GA2A 3LSTA 2GQQA 2OU2A 3CTAA 5DUIA 1IN4A 1ZLKA 4P96A 3WE3A 3F6VA 5TJJA 5D5UB 1D5VA 4G7HF 3X0OA 1IN8A 3VEPA 4G9YA 3WTVC 2QWWA 2ETHA 3ZP5A 5LPGA 1QZYA 1OYIA 2W25A 4L0YB 3RPQA 1XSXA 3KLNA 4O3MA 3IKVA 4JZTA 3U1DA 5GHQA 5ANUA 2Q8KA 2K4JA 1G4DA 3ACAA 2EFOA 1K7AA 1EV7A 1J9IA 4UVBA 5AIPA 4OIPF 5DDGA 1KGSA 1C0WA 5D4SA 3U9GA 1XMKA 3HUGA 2CW0F 4A6DA 5D4RA 4XSXF 2MLGA 3TOBA 1LQ1A 2A3SA 3DEUA 3E6CC 2D1HA 3HSRA 3X0NA 4S2WA 3SQNA 1ZARA 2Z3YA 5LGUA 2G7HA 4GYIA 1DP7P 4HAMA 2ZFWA 4L9TA 3N77A 1LJ9A 5CVVA 3T8TA 4L9JA 2IVMA 1PPWA 1XGNA 2EK5A 1R67A 5DYMA 1PPVA 2O61A 2NAZA 3BDDA 2HYGD 1FSHA 2ICKA 1UB9A 2A8SA 2A07F 4YFNF 4HQEA 3R0AA 3QP6A 2DQLA 2JZYA 4Y17A 1XSCA 3I7VA 2ESHA 2H09A 3HRUA 2VC1A 2JSCA 1X83A 5AIQA 1LVAA 2DU9A 2NYXA 2A8RA 1MDMB 4HDUA 1HW1A 3GWZA 3ROUA 3FF5A 3Q2SA 2BYVE 1ZHFA 3V8LA 1MJAA 3G73A 3FCMA 4JQFA 4C9WA 1B4AA 5DV5A 5GHNA 2CGPA 5ED4A 4S2VA 4R1HA 2LKPA 3L7WA 2DPUA 1XD7A 4LB6B 2OBPA 2ZNZA 5LLQA 2ACJA 1V8NA 1ODDA 3DKWA 2XSQA 2HKOA 1HX3A 6PAXA 3RTRA 1RIOH 5HDGA 1TNTA 1MGTA 2V9VA 2K86A 3HHGA 4KUMA 2O6GE 2YYHA 3E57A 1FP1D 5IW4A 3Q93A 1BI3A 3I59B 2P6SA 4M72A 3BWGA 3WGIA 3DF8A 2IA0A 2K4BA 4HZFA 3R60A 2ESNA 1MD0A 4DQ2A 1R58A 4YIIA 1TQIA 3SXYA 1BI1A 1MR2A 5ICCA 4AIJA 1YS7A 5KVRA 2AS5F 5GHPA 5EEHA 1OMIA 2IA1A 4IHTA 4BAYA 2RNJA 2VNPA 3QP5A 5FB2A 4N0BA 2FMYA 3DV8A 3X0QA 3QPHA 4AIHA 1PP8F 1WRJA 2F5DA 3KE2A 3RKYA 2DLLA 1ULYA 4AIKA 5FD6A 4LGWA 1DPUA 3PFIA 3WHWA 3GLXA 3LA2A 3WU0A 5HZXA 2FNPA 1BOAA 3CDHA 3EYIA 2BBYA 1KQ9A 2UXNA 4XBFA 4EM0B 4KICA 4RGRA 2Y0MA 5TRDA 1FBSA 4P9UA 4A0ZA 1R5HA 2EFQA 3MCZA 1IN5A 3VB2A 2FE3A 2VBXA 3SMDA 1FWZA 3H3UA 4OU0A 1R1UA 1LDDA 4UVCA 1LNWA 1T0FA 2O0YA 1ZLJA 5DEQA 4JZVA 1KU3A 1V8UA 4IVNA 5I8UA 1MDMA 3ZN1A 5E1ZB 1VRLA 1ZRDA 5HDNA 4ENJA 2G9WA 2JTVA 2Z5UA 3ZMSA 1KHZA 1JXSA 3H92A 3E6DA 5L3CA 5H20A 1YW7A 3F8MA 1F1ZA 4HFQA 4WXDA 2PBIA 3U53A 3X0LA 4M74A 3IRRA 3I5UA 1JHHA 1HKQA 1FBQA 5DPKA 5DCFA 2ZO4A 2ISZA 2CSOA 1ZGJA 3BJOA 3HTUA 3WTWC 1YS6A 3KVHA 4QLCU 1FYLA 3CUOA 2W24A 4M73A 1K26A 2A61A 2CYYA 3KCCA 2VONA 3I59A 4YIFA 2EV5A 4A0XA 3MAJA 3H95A 3M7GA 3R4KA 1BC8C 4G7ZF 3OGAA 2J8QA 2PJPA 2F5CA 3BJAA 1PUQA 1IXRC 2W84A 1TLHB 1MQWA 3CLOA 2UWMA 3GFIA 2A5YB 3Q9VA 1MZBA 3F6AA 2HOEA 2G73A 2RN7A 2XGXA 4Q48A 1SD4A 1KYWA 4ASNA 3NEUA 3WGHA 1O3SA 1YQAA 5FGMA 3KLOA 4WCGA 5AONA 1MP2A 3FJYA 3SHFA 1XSDA 2A8PA 1OPCA 3IWZA 4ENKA 4P5OA 3F6OA 1WWXA 2RC4A 2VT3A 1V4RA 4I01A 3N4MA 5BMZA 4WXCA 2F5FA 3GZ6A 4PDKA
chains in the Genus database with same CATH superfamily
1K4SA 2YVOA 1ZYRF 4MQVA 3SJMA 3TW6A 2LY9A 1KZHA 4BQNA 3HOWJ 2MGQA 2CWEA 4QIWN 3WU1B 1TBXA 3R03A 3SHDA 1E3PA 4O6JA 2R7VA 1V5GA 1X4OA 4RLQA 2BV6A 5ICFA 3S1NJ 2QA4I 5E3NA 4XOTA 3TO6A 1ETVA 1SAUA 4FHTA 3ONQA 1LDJA 2EA4A 2OCCH 5DM6F 3TEDA 1U2WA 4CYCA 2F5EA 2QVOA 3E5XA 1S29A 4NQWB 1SEUA 5FSNA 4DBRA 1UFMA 2EBIA 4QSHA 2HZTA 3E3VA 5HVQC 2VQCA 1L0OC 1FNNA 5GAEJ 4CZZA 3HTSB 5E1XA 3IKTA 3E7LA 2R0QC 2O8KA 3M1CA 2DBBA 2XAFA 1J7KA 4V2GA 2K9MA 3HSFA 3P5JA 1XCBA 3SDGA 2FF4A 2M0CA 3HUGB 3GTKJ 1VCDA 3IH4A 3JRFA 1NFSA 5FSIA 2F4OB 1A36A 5E1WA 3Q3SA 1B1BA 2KIMA 1U8RA 1X4PA 1QBJA 2I8UA 3S3MA 4IJAA 2CQKA 3K4MA 5ILSA 4MHGA 4GFBA 2KDWA 3I0TA 2Y9YA 1V8LA 3HOSA 1ENHA 2PEXA 3WTXC 1FTZA 5IYDJ 2P7VB 2DOEA 3DLLF 2XV4S 1K6YA 3PUFA 4NC6A 5ANWA 3IV5A 1QQIA 4HF2A 1J0RA 2QQAA 3GW2A 3ZOBA 3S3NA 3LSMA 4EATA 1SZ3A 4M6VA 4UXNA 4UHTA 3I4PA 3BTJA 2QM3A 4V2FA 1AWCA 1ZG1A 3ZXSA 5BS6A 2BXZA 2HXOA 1XGMA 3PIPF 1IRYA 3BROA 2AHQA 4IHYA 2TDXA 4Y15A 2HR3A 3DQVC 3EESA 3K70C 2LF7A 2R7RA 3KZIC 4DBQA 1SFEA 2BY3A 1X1PA 2JN6A 4UVAA 2OQGA 1XMAA 4BHBA 3G0QA 1QHHD 1X3WB 4HYEA 2CV2A 4KG4A 3JSOA 3CUQB 3BG9A 1TWGJ 2DA5A 3HRSA 4KIBA 4XQFA 2ELJA 2VL8A 1PP7U 2PMUA 2VIXA 2OA4A 2NVQJ 5CVJA 3F8FA 2OAZA 3BG6A 2HPMA 5CFIA 2KHMA 3JRAA 1BJAA 3DP7A 3ZQCA 1YJNI 5K7ZA 3H5AA 3Q0UA 4MFEA 3S2HJ 3VYSB 2VJJA 2XF7A 3EUHA 4EJUA 3KETA 4ESFA 3K2AA 4ZZDA 2K5CA 2VC0A 3CF2A 2P5LC 4BUPA 3G2BA 1JT6A 1TWFJ 2O9LA 4KMFA 4KT6A 1TC3C 4GCVA 1T08B 4OMZA 3X0MA 3CO6C 4UV8A 4TV7A 1RETA 1OW2A 1Z91A 1IXCA 2HVQA 4HVYA 3TO7A 5IP9J 4YPRA 5GAGJ 4G7OF 2VODA 2HPIA 2NVYJ 4ITVA 1T33A 5LHHA 1KU2A 1TW2A 2R7UA 1ZKGA 2A6TA 3FSPA 4ZYDA 3B02A 3HEFA 4LD5A 4NFXA 1YIOA 3DBHB 2JSPA 2LNBA 2LREA 3OOUA 3G3ZA 1HOMA 3P5TA 2V26A 3A0HC 3L09A 3IWFA 2WC2A 4KJZA 3KP5A 1DUXC 2VPLA 1YHQI 2D45A 4ENNA 4KA4A 4M6XA 3ECHA 2Y31A 5HS7A 4BQAA 1YX5A 2B06A 3DEEA 1OYYA 5K5RA 2GA1A 1PVFA 1D0XA 4XIDA 1T0FC 3C1DA 4HV6A 2MC3A 4L9VA 3PJRA 1NQYA 1HBXG 4IL6C 2PI0A 3X0KA 1DU0A 4LG0B 4HNUA 3RYPA 3K0LA 2OUMA 4XKCA 5H6RA 3HRMA 2JPBA 5D5XB 3HKZN 4JOMA 5E3LA 3JSPA 3H0DA 1RR8C 5FKKA 1A6IA 2JPCA 4RA2A 3OSGA 1XB4A 4I2OA 1SU2A 1FBUA 3FFUA 2LVSA 2LD5A 1SFUA 2BVMA 1T98A 2YVPA 2VBYA 4V19K 5CFJA 5JHUA 1RRQA 3JTGA 2L02A 2KZVA 2CRGA 2BXYA 2JUGA 4ABZA 5LEKA 1SFOJ 2B0VA 2Y48A 3KP6A 2D1VA 2E35A 1FIAA 3JRGA 4ZJZA 1WJAA 2JJ7A 1IUYA 4K2EA 3F8BA 4OMYA 3BAPA 2K27A 3OIOA 3OWTA 4NQWA 4RS8A 4C3IJ 1U3EM 1R71A 1H89C 2ECCA 1VQ8I 1U8BA 4J7HA 5FO5A 1DGWY 5F1RA 4JX4A 4I0AA 1FTTA 5ICGA 1D3YA 1XGSA 3CO7C 4FQGA 1WPKA 2PMZN 3HBLA 4UB8C 5JVTA 3M9AA 3V8JA 1EJ9A 4XR6A 1LFBA 2E60A 2V1XA 3M3YJ 1PYVA 3SZTA 2W85A 1LFUP 1R22A 3UKGA 2L54A 2X1CA 3DXJF 1NQZA 1VFCA 2K40A 4YPHA 2WB1A 1BW6A 3L2WA 4B09A 3CCSI 1ZREA 2X6XA 2FX0A 5EEGA 1IN6A 2IAIA 2FSWA 1FIPA 2MH2A 3TKYA 2CV0A 4PFPA 2DDBA 4EJWA 1LDKB 2BGCA 1VQ7I 1IG7A 5D5VB 2RGVA 4PUSA 2UUZA 4EMSA 3E5UA 3J7Ye 4PGGA 3QQAA 2ZKZA 3W3CA 4YG2F 3RQ4A 2KKOA 2E7XA 5D5WB 2K7LA 5LD2C 3J7ZI 1MKMA 3O8HA 4NC8A 1K79A 3MQ0A 4A3CJ 2JVBA 3KP2A 3QPSA 3I71A 2DPDA 4PGHA 3OYAA 1HKSA 4Q4ZF 5FSLA 4HNVA 4KN7X 3FBIB 1T8IA 1X84A 2V79A 4W97A 5FRMA 3CP2A 3BP8A 5JHFA 3S14J 3WHBA 3E1SA 3GTOJ 3DPLC 3LA7A 1OCZH 3COUA 1TQMA 1FC3A 1TT0A 2Y0SN 4BE1A 3CUQA 3OYMA 1Y0UA 3QPLA 1HKTA 1NTCA 3ZR8X 1YTYA 5HLIA 2KDZA 3CD6I 4S05A 4A69C 2BHYA 1YFHA 2M34A 1XS9A 5B66C 3G71I 2PN6A 3COAC 3H5NA 3M8JA 2A6EF 1V8YA 4YFXF 2CZRA 3KYDB 4MO7A 3HOZJ 3BR3A 4E6KG 3V4GA 1PUFB 1LFPA 3JAMK 3KYLA 2ZXWH 2B9SA 4LMYA 4EV0A 1E3OC 1CF7B 2OTJI 2HXIA 2L4MA 1N77A 1QNTA 3ZQHA 1QVJA 4P1WA 4IRIA 3FK6A 5C44J 4II2A 3I3LA 2L01A 1X3UA 1W7PD 2V9PA 1YO5C 2EFNA 1MBFA 3OS2A 2P5KA 4A3DJ 2Q0OA 1LEAA 4D5CA 1BR2A 3JAMZ 2XIGA 2CUZA 1I1GA 2LSOA 3TQNA 2ZMEB 3D5LA 4E7IA 2X4HA 4HEA2 2WAFA 1X58A 3GWYA 3T0YA 1G3TA 2K9NA 2OD5A 4OIRF 1KU7A 2MABA 1I9AA 4L0ZB 1PUEE 5ANSA 2O7OA 3BLYA 3KIOA 2E2HJ 3FBNB 1RESA 2DDAA 2QUFA 3QOEA 5K5QA 4IHSA 2CS3A 2O5RA 3GEZA 2VXDA 2Z1DA 1Z21A 3FX3A 1H9GA 4R79A 3OYJA 1K6OA 1PJRA 1XN7A 3OR2C 2VE8A 4F91B 1QO0D 4M3FA 3DKUA 1Y56A 2GXGA 5GAHJ 5C4XJ 1EF4A 1GVDA 4LG0A 4ZYAA 3GG6A 4LLLA 1HZTA 3SFIA 4AM3A 2VBZA 2VBWA 4FT8A 1MUTA 1Z67A 1FX7A 5J8FA 2NS0A 3CNGA 4K6EA 3KFWX 4BXFA 3AKZA 3SONA 2YU9J 3T5XA 4C3HJ 3TMOA 4OIOF 3X0JA 2EWNA 4NNJA 2DT7B 2EIKH 3QWLA 1U0JA 3GZ5A 5CJ9A 4Q47A 3LSJA 4FETA 2R3SA 1B72B 1TTYA 2V1DA 4A6EA 3RJPA 2R7QA 1GUUA 2O8XA 4EEFG 1Y1WJ 3F13A 4MEXF 1G3YA 5FKLA 3A1YA 1QPMA 2PX9A 4B4CA 2CUFA 2DCEA 4MNUA 2JA7J 3Q91A 3HSEA 4DZPA 2VNQA 2ELHA 2PLYA 1UAAA 2WA0A 1T6SA 3MCFA 2EV0A 2XRLA 3H35A 2O1CA 1ZGAA 3X0PA 3CESA 5HNHA 2RKHA 2CUJA 2A6HF 2X0LA 5J3LA 4LB5A 3A2KA 3K69A 4W1UA 3I55I 3PO2J 1M1EB 2VT2A 1XGOA 3JRDA 1F4KA 5F64A 2XUBA 2ID6A 2B7EA 2R92J 1Q1VA 4IHXA 2L3DA 2L9VA 4ZDLA 5DCMA 1REPC 5FLMJ 1Q1HA 2E5ZA 5GHMA 3R0JA 1IN7A 2DSCA 1IRXA 4U7DA 3F23A 2DFEA 5DTDA 5HLTA 1FYKA 3G1MA 5FSMA 2DT6A 1BIBA 3CDIA 2FA5A 3EUHC 2LFBA 1TZLA 3GZNB 4DNCA 3ZQLA 5IT3A 1WJBA 2JUCA 3I58A 1XSAA 1H88C 4JZSA 1GXQA 3E6BA 3FWEA 3H9GA 2GM4A 3A6UA 2MBFA 1USTA 3TGNA 3DU6A 1XSVA 4BE2A 1P7JA 4KTBA 2VQHA 2H94A 4XLHA 3L9FA 1ZAOA 3U21A 5HLGA 2R7XA 1D8KA 2ZXIA 5FFZA 1GDTA 1JTYA 1JKNA 5IPAA 3ZQ7A 2DAOA 3OV8A 3PNTA 1H9TA 1X19A 1YLFA 5A2QK 2XAJA 1J09A 5IYCJ 1B8IB 3PQKA 1WQ2A 2HVSA 3OR1C 2J5PA 5BONA 1SMTA 2O5FA 3QRFF 2ID3A 4FISA 3LNQA 2GT2A 3BR2A 2HVRA 4H4KC 4PCQA 3GX4X 1XPXA 4RGSA 5IOZA 4N4OB 3H9JA 5LFAA 1CF7A 5A2QZ 1FJLA 2Q9PA 3K2ZA 1RYAA 2XAGA 4KG3A 4JX5A 2QJTA 3I9XA 1RI7A 2F4IA 2KJCA 4AYBA 5K5OA 2RV8A 2NVTJ 3QSJA 2CW8A 3V42A 2VQGA 2BVLA 2I8DA 2LY2A 3Q1PA 1MBGA 4BJ5C 3FIWA 5GP9A 2WV0A 2ZMEA 3R6SA 1VHZA 5HS8A 1R36A 1I27A 3LSGA 2D2WA 2IT0A 2QQ9A 5ILUA 2A8TA 1V8SA 2OC6A 1F36A 3C7JA 3IHUA 2DN0A 1RNLA 4MQ9F 3ML6A 4OWRB 4IKFA 2ECBA 3ECOA 1VIQA 1ZR2A 3IH2A 4JP0A 4CCMA 3I7UA 4ZC3A 2XPVA 2I5UA 3DUPA 1VF9A 4KIGA 2YS9A 4BACA 4A3BJ 3L2VA 2E19A 5CVRA 1TWCJ 4XSZF 3GTQJ 4WXHA 2P8TA 4M9ZA 3H3ZA 4L5IA 1IZ1A 1YITI 2XHKA 2X85A 5M5XJ 3RYRA 1R7JA 3O6BB 2VOPA 3N97A 1V8MA 3WG7H 1WH7A 3P9IA 4GXOA 1SJYA 1ORKA 2FXAA 4HF1A 3GYHX 1S6LA 2YSRA 5LHGA 2NNYA 1FMWA 2QJOA 2FQ3A 2HKXA 2ZCWA 3GBGA 1MBEA 5E17F 2BY1A 3AC9A 2M4KA 3J80K 2LK2A 1RR7A 1XC5A 3LSKA 1P6RA 2Z16A 4D1QA 1W5SA 2STTA 3H5RA 2AXLA 4WWCA 2IA2A 3WE2A 2VPRA 3A6VA 1SMYF 4DJAA 3HPHA 4ZDOA 4ESJA 4YFKF 4PSWA 4IOAF 1Q27A 1B72A 3ABLH 5E3OA 4OAZA 1JRKA 2YVMA 1GV2A 3G1OA 1S72I 1GXPA 3L85A 2OF7A 1XSBA 3J80Z 2HU9A 2WAEA 5E8GA 4AC0A 4KITB 1YI2I 2LKXA 2W57A 1TW3A 3K4LA 3ERED 4IEJA 3VPRA 4Z2YA 4XNFA 1ETQA 2VI6A 4XM3A 3B6AA 3GTPJ 3J7AO 3PSIA 2BE5F 1HQCA 5F1JA 1A6QA 4ETSA 3ZRGA 4ENMA 1S7EA 1ZRCA 3NWTA 3LAJA 3PNYA 1BBYA 4N4NB 2QSFX 2Y69H 3ZQIA 5IP6A 4LLGF 2GXBA 3ZMUA 2Y9ZA 3LA3A 4ZTJA 2XPUA 3CUQC 5JLXA 2R5ZA 4CDGA 4A93J 3L00A 2ZXJA 4RBOA 2HYFA 5DS9A 2ZFUA 2R7FA 3TP0A 4CICA 3ZPLA 2X51A 2DYRH 2XSDC 2EFPA 4G94A 1UG0A 3GF2A 1MMNA 2ADUA 2WAQN 2V1UA 4XRSG 1U20A 2AZWA 3P6YA 1AHDP 4RLFA 3JRBA 1FOWA 4BEHB 5K7FA 5JI6A 3FXUA 1VK6A 5C7TA 2LR8A 1G8XA 3B73A 1BA5A 2FOKA 3RIRA 3K1PA 1OKRA 1IDYA 1LPQA 2IBDA 1W0TA 3GTGJ 4ICKA 3EETA 1ACIA 4XK4A 2DSBA 2XASA 1MJ9A 4EJOA 4OAYA 1U78A 3GFLA 3JTHA 4N9IA 1VZ0A 3VFZA 2CQ7A 2DT5A 2MA3A 4X1EA 1B8IA 2VUMJ 1W36D 2PJRB 1KONA 2YU3A 4EJVA 4F52A 1O3RA 4CO8A 5GADJ 4J19A 4A3EJ 1YW8A 2EQRA 2UXXA 4IJXA 4CH7A 3BZCA 3OYIA 2QKMB 5BPDA 2XC7A 3OSFA 2PQVA 3DFGA 2FBHA 1U5TB 3EF5A 1W7PB 1O57A 1SFXA 4RGXA 3FKIJ 1FLIA 4P9FA 4S04A 3F22A 3CC7I 1DDNA 2CQXA 4S2YA 1MNMC 3IL2A 4G6DA 2HEOA 3JR9A 2EIJH 2LOOA 1J59A 2QLZA 1NFZA 4A2UA 5EGOA 3E0JB 3HHJA 1JUPA 1HSTA 3PM1A 1T39A 4L18B 2UZKA 3O3KA 3S2WA 4J01A 1X1DA 4C2MJ 1FOKA 2GAUA 5JFRA 5J6XA 3V8KA 3RZOJ 1ZN2A 2L4AA 2L2OA 2DFHA 4MGRA 4H0EA 2ZJPF 4Y52J 3QAHA 5J1YA 4XORA 1K78B 2IGMA 1BL0A 4KFCA 3F72A 4PJJA 2R7WA 3IUOA 1USSA 3P9KA 2MD0A 3HM5A 3DPTA 5LEJA 1SFKA 4BH9A 2JWTA 1J75A 2W00A 1RKTA 5FKNA 4EJTA 1ETKA 5KHDA 3MFKA 5D8KB 2ME0A 5LGNA 1T38A 4JYKA 3DPUA 3QYEA 3AL0B 1V5EA 3OOPA 2JRMA 2E5NA 4M3EA 3OYEA 4BBSJ 3ZMDA 4MEYF 1RKWA 5F6FA 5J40A 3UR3C 2F4MB 4OIQF 3TDUC 2ELKA 4IF4A 2JK3A 5GHOA 2EV6A 3FMSA 3PFYA 4JBAA 2YPRA 5ICEA 5LRSA 4BU2A 4QPQA 4O5VA 1PVEA 2L7FP 4KMUX 1XDUA 2VKDA 4LIVA 3WTUC 2M4GA 2YX7A 3AAFA 3LQRA 1BI2A 3HPGA 4CCJA 2HDCA 1FT9A 5JVGF 1B6AA 2DK5A 3H3VK 3LSRA 1IJWC 3HOTA 3VSLA 5GTHC 5D6EA 2Y2ZA 3EUAA 5L3EA 1IF1A 3OL4A 4I0BA 1S7OA 3X2QH 1QVTA 3O52A 1IRFA 1AOYA 1TWAJ 2DXIA 5FKMA 3BHOA 4NBQA 4E4HA 2GB5A 1PUSA 1HW5A 1P92A 4HF0A 2FRHA 1TNSA 3RPUA 4B47A 4RB3C 2Z9OA 4ESBA 5B3SH 5J1RA 3NQOA 1NH3A 4LJZF 3CF5F 1TQPA 3S2DJ 4HLYA 3TDZC 1WI3A 5GHJA 1RUNA 2KPMA 3CQZJ 3PNVA 4A3FJ 4BEHA 5J8CA 3OYBA 4DYQA 4HNTA 2V6CA 1B9NA 1F5TA 4QWQA 3S17J 4BE0A 3CJQB 4F55A 2L9SA 4WF2A 2DMNA 2M8GX 2VXZA 3I56I 4D7MA 5J4VA 2ZJQF 2FQ4A 1R1TA 1HDPA 2IRFG 1OR7A 5F0HA 2CV1A 3HB9A 5KCMA 5D6FA 2DFIA 1X51A 2FNAA 2ZMEC 4IQ4A 3S1QJ 1KYZA 3U1KA 1Z1DA 5EZHA 1N25A 3RCOA 2ZNYA 2PJRA 4Y13A 4L5JA 2CQNA 5CYVA 4ON0A 4S2XA 3GTLJ 2GT4A 4XLPF 1G59A 2XAHA 1UZCA 2LP0A 1MBHA 4U88A 1WKMA 3CZ6A 2HNHA 1FY7A 5FKOA 4XLFA 3CCRI 1KQ8A 1S9HA 1U5TA 1XX5A 4CGZA 5BOXA 4BHCA 2XGDA 1G9QA 1W7PA 1GVJA 4NFWA 2NOGA 1Q54A 3D5SC 1JT0A 1G6NA 1B59A 5F27A 5L3BA 2P4WA 3CDLA 2XB5A 2BHZA 3BY6A 3MEXA 5ERIA 4A5MA 5IT9K 2R7TA 4N1TA 2A05A 4ZG0A 3O61A 1X1CA 2COMA 1SAXA 3OYDA 2B63J 3KP4A 3QYFA 2CO5A 2DA2A 3BM4A 5IY5H 2A69F 3ELKA 3M8FA 3JW4A 3O6ZA 1SVOA 2VB6A 2G7UA 3P7NA 4ZYHA 2M8EA 4U0WA 2RQQA 3MZHA 1EH7A 5DCMB 4B43A 2KP6A 3RPUD 1W36C 2DMTA 3HXLA 2VQLA 4IQJA 1MQEA 3IRQA 1K78A 3C2BA 5IT9Z 4BGDA 3ISPA 4DYCA 5GPAA 3QOPA 3WG9A 2OJED 3K4BA 4PK4A 4ZYEA 3J7YJ 1V8RA 3K1MA 4LK0F 4LG3A 2LY1A 1O7FA 5EF6A 1JE8A 4JK1X 3TBIA 3VODA 2DOFA 3QYBA 3LSHA 2KIUA 4L5EA 1HF0A 1W5TA 3G1LA 3EUKL 1OQYA 4G8XA 2PFBA 1JGSA 2LYCA 2WY8Q 3A6TA 4NHJA 2HS5A 1F9NA 5L3FA 4OINF 4HSTA 2HTJA 3KYCB 3RH7A 4FX4A 5KK1A 2W82A 3V7SA 2QBYB 2EFWA 5BNGA 2CQQA 2KISA 1KQ0A 1WVRA 2XSJC 1POGA 1RZ4A 4N9HA 3ZCOA 3A6SA 3O8SA 4C30A 2IS4A 2RQPA 1D8JA 2XAUA 5C3EJ 3FXKA 1I6XA 4HDVA 3FMQA 3JRIA 3F8CA 1PPXA 3PSFA 4KIFA 3VDXA 2QZ8A 2KT0A 3OYKA 3KZZA 2GIVA 1F3YA 1NHAA 3HOVJ 2R7DA 5FLVA 2DI3A 2RVCA 3MDGA 2AQFA 3K1NA 2GOXB 3HIFA 1H0MA 1WFXA 4RDUA 1MK1A 3GVAA 3UNGC 3EEUA 4M9SA 1UHWA 1KA8A 2EZIA 2X6WA 4MTEA 1OJLA 1XTAA 3BQYA 2YVNA 3S32A 4CCKA 1SVMA 4DZJA 5JLWA 3DBLB 1HCRA 2EH3A 2N8GA 1V8WA 1ZH5A 4Y4RA 1MJBA 4IXAA 4LLNA 1UHMA 2GBYA 2O3FA 2M0MA 1FSEA 3ABKH 2XROA 4JX6A 4ZDPA 2NRAC 2QF7A 1LEBA 3WTYC 2NS8A 2HTSA 3OL3A 2XVCA 5DD8A 3W2VA 2M7BA 3OYGA 2HQRA 3CCYA 5EDNA 1V3FA 2G0EA 1BR4A 4RAZA 1IRGA 5BQTA 2QKLB 4M71A 4XOPA 4BJTA 3TOAA 2E1NA 3A0BC 3CCMI 5HNFA 1NG6A 2EZLA 2V7FA 3OMYA 1X1BA 2HOAA 3W6KB 3HHHA 1GLNA 1WH5A 4LK1F 2WB1N 5ISYA 1D1CA 1TWHJ 2BEOA 4AU7A 2IP2A 2K3PA 3ABMH 3GMEA 2Y75A 2VKEA 4CYDA 3FXRA 4XLCA 4KDPA 2KRFA 2A68F 1HDDC 1DGRM 1ZQ3P 3I53A 1WGXA 4UUVA 2OZ6A 2FU4A 5DD4A 3M07A 2L9NA 4C2UA 3AG2H 1VQKI 4BS9A 2NVXJ 2FOWA 3LAPA 1V8VA 2DQRA 3JRCA 4C9XA 3A02A 2ZBKA 1R1VA 5IYBJ 4KISA 4EGYA 4WX9A 2OQRA 1X2MA 4PJMA 4Q5SF 3K9TA 4XKBA 2IPQX 4HQMA 4UV9A 2XKOA 1ETXA 2L0KA 3REOA 3JCUC 2DSDA 1Z6RA 2IGNA 4Y33A 3GO5A 4AD9A 3L2UA 3CMEI 3A01B 3SFZA 2X1EA 3CMAI 2MLKA 1O3QA 3D1NI 1YYVA 1Z0XA 4B44A 5JR3A 1ETWA 3PQJA 3S3OA 1VC8A 1WJDA 3K6GA 3BTCA 4HX4A 3ABUA 5H6QA 2RREA 4PJLA 1Z3XA 2IEKA 1KU9A 3E5QA 4HX7A 1Z77A 4I99C 3RKXA 1IAWA 1VQLI 1AKHB 2TCTA 3IH3A 4RB0A 9ANTA 1K83J 2M45A 4RGUA 3ZN0A 5LRRA 5K7HA 1J5YA 2LRDA 4MPOA 4EGZA 3R61A 4RB2C 1IC8A 2LF8A 1YRNB 1QZEA 4HLXA 3VWBA 2DO7A 1Y6IA 3F0CA 1FEXA 4A5NA 3A4CA 2R5ZB 2L7KA 1Y8RB 2DHOA 1O7LA 3GTJJ 2M1BA 3WU2C 2GIZA 4BY7J 4IPAA 4BHPA 1R23A 1IXSB 1Z05A 1MBKA 2ZJ2A 2GZWA 2KDVA 2CJJA 4NDLA 5IP7J 2JRTA 5LGTA 2K9LA 3I4MJ 1RC9A 3PL8A 5HS9A 2QYOA 1BC7C 4KT5C 2A8QA 3QU3A 3ZMVA 3S15J 5FSOA 2E2JJ 4G12A 3GFMA 4FCYA 1SOIA 2FBKA 2LMDA 2E1MB 1S7AA 2XGEA 3HOXJ 4I09A 5C8LA 2R5WA 2DA3A 3ID9A 4HRIA 3BJ6A 3CCJI 1BIAA 4U7BA 4HV5A 3VOEA 2QBYA 1XMXA 4GYGA 1P4WA 1I6HJ 2ICJA 3S93A 3BCAA 4G6QA 4AWXB 3MKYB 1TP4A 2Q2EA 3FHZA 3X0SA 1OCOH 1G0SA 4F7ZA 1JGGA 1MMSA 3DEWA 3OYHA 5CPRB 3LL7A 3WTSC 2QSGX 3O69A 2B2KA 1BM9A 5IOYA 2K02A 3CJTB 3DBRB 3ZMZA 1TUMA 4XRFA 3CCVI 3G4SI 1JTXA 5FFXA 5KAFC 3JRHA 1W1WE 4XICA 3C3WA 4CHUA 2OTLI 4FASD 2CW7A 2C6YA 3BG5A 4ZYGA 1G3SA 3WTZA 3J81K 2HDWA 4E7LA 2DJIA 5M5WJ 4A12A 3F21A 4B48A 3TL4X 3BR6A 3SYTA 2WTEA 5EGOB 1SD6A 4A0YA 4BXXJ 1ZG5A 2FD5A 3BG7A 2BY2A 4HA8A 1S3JA 1NK3P 1K2EA 3KEYA 3FXQA 1I5ZA 4BY1J 5GHIA 1V54H 4XN0A 1SD7A 1Z9CA 1APLC 2ICWG 2YR2A 1FOXA 1OR7C 2IS1A 4RMNA 4AVPA 2JQ7A 4E70A 3E6MA 3J81Z 4HW0A 2OPTA 5FSKA 1YIJI 3K70D 2NS7A 2DA6A 1MNEA 3FZVA 1J2XA 4FTHA 3NRVA 3CC4I 3EXQA 1UHSA 1EH8A 2LKSA 3E97A 4XLNF 1MMGA 3LQQA 1GA7A 3Q9SA 1IW7F 1CGPA 2MD5A 1QGPA 4M9XA 2Z99A 3NWSA 1A04A 3ZMTA 1OYWA 2EB7A 1U5TC 2UV1A 2PMHA 2W7NA 2XRNA 3KP3A 1BN5A 3LFKA 1B9MA 2LDUA 3PIOF 3C2HA 4MTDA 2EJRA 1ON1A 1JKRC 3QPTA 3LSIA 4D0PA 3ZGKA 3HJEA 4HOBA 1KT9A 3GXOA 5FLXK 3ZR0A 3FM3A 3I54A 4HG2A 3F3XA 1VQ5I 5B1AH 1R6RA 2O5WA 2VASA 3EQLF 3ULQB 3RKWA 5E8IA 3KEOA 3T8RA 3KPHA 5F0FA 2IS2A 1ZR4A 3X0RA 1Z7UA 4RAGA 2MSYA 5L3GA 4KYWA 1IDZA 5H2FC 2EA2A 3H0GJ 1CQTA 3RQIA 2JA2A 1YW9A 5CVIA 2DTRA 2FBIA 2KMUA 3NAUA 3A01A 2CG4A 1XG1A 2PG4A 4U0VA 4B8XA 3FK9A 5FLXZ 2W4SA 1JUMA 2KIFA 5EEAA 3W6JB 3ABTA 4GGGA 3L1PA 3RDIA 2KQRA 3V7RA 3WGGA 5IW5A 2QQ8A 3ESWB 2O03A 2X6OA 1YG2A 2COBA 1I3AA 3SDBA 4C9YA 1XDSA 3GZ8A 2ZB9A 3SEQA 4RAYA 5B5EC 2F2EA 1FZPB 4HPQA 1AKHA 1HW2A 2CFOA 4A3IJ 3KZYA 3W2AA 1JHFA 3IC7A 2DK8A 3MD2A 4I76A 3AL0C 1YRNA 1DU6A 5J1UA 1T2KA 3BQZA 2H6CA 2MFZA 5HOOA 1VC9A 1FMVA 3P9CA 3Q0WA 4U0YA 4HBLA 5D8LB 4AYBN 4R8HA 3KP7A 2PQ8A 2WADA 3U2RA 1JKPC 2VJ4A 4B3AA 4IO9F 1PDNC 1E0EA 2FKBA 4BNCA 2M3AA 3OIPA 1Z6TA 3M8EA 5B1BH 2VJ5A 3CJNA 3T1BA 1HSJA 4ZZLA 3X0IA 4RB1A 2WV1A 3SZPA 1SD5A 3FXOA 3G6EI 2W4EA 2F48A 3ZR1A 3FM5A 5C7QA 3LMMA 2E34A 1VQ6I 1IGNA 2R93J 1U6GA 1P2FA 2BY0A 2RDPA 2F5VA 4V14A 3TP3A 4N1UA 2CFXA 3O2PE 1I1SA 2VN2A 2R4GA 1VQPI 1R00A 3GUDA 3MDIA 1W0UA 3I4NJ 1S5LC 2HZDA 2JT1A 2MYSA 4ILQA 4L9NA 4JZUA 3MGMA 4MLOA 2K9SA 1KTGA 1ONVA 2L9RA 1RUOA 3LWFA 3ASOH 2XKPA 1VHGA 5F08A 1MW7A 5HLHA 3HRTA 3L2CA 4IRGA 2LBFB 3H36A 5LBQA 2JA6J 2NNNA 2FMLA 2IS6A 3WTTC 3V7CA 1D1BA 4IHWA 2J5OA 4IOCF 5DUKA 5F04A 1G3WA 4A3MJ 4FX0A 2IXSA 4KYXA 5CQEA 3A03A 3EYYA 4M6YA 4PZJA 2H27A 2W1OA 4A3GJ 3DCFA 4QPOA 3PO3J 1STZA 1NG7A 1WJEA 4EQQA 5LHIA 4UNOA 4A3JJ 2DJNA 3VYUB 1ETYA 4XN3A 4OOIA 1TL8A 3HYIA 3DKYA 1MMAA 2QEXI 4CUGA 1WJFA 2JMWA 1AA7A 3Q2TA 2Z2SB 3GRNA 1P7IA 4HX8A 1E3HA 5ANVA 3BOQA 2P5VA 3DWLE 4XLAA 3OY9A 1W4MA 5E20A 3VYRB 1V8IA 3OS1A 5CVUA 2P7CB 3RI4A 4EM2A 5ANTA 5FD5A 3M1EA 1BOBA 3BPVA 2G74A 1TT5B 5BPIA 2M5WA 4ZH4F 3Q4IA 2KJBA 1F43A 4F92B 4I7HA 4EVIA 1FP2A 4CXFA 1ZG3A 3CC2I 1DPRA 4EM1A 2LLKA 2YX4A 1HXDA 2QENA 3DTKA 3O8GA 2D5VA 1DQUA 2DFFA 2GWRA 1Q33A 2CH0A 2HQNA 4RM2A 2XAQA 4LFUA 3MWMA 3QU6A 1IV8A 3S8PA 2E36A 2M7AA 4E7JA 3VSKA 2EILH 3BPXA 3MMYB 1E2XA 4IRHA 2OZUA 3HKZA 3J7AY 1XCVA 3WODF 2I8TA 2QQBA 1RRSA 1SVLA 2M30A 1BI0A 3F8NA 4S0HB 2JA5J 2FEZA 3BZ6A 2MH9A 1ON2A 1GHCA 2DA1A 2B0LA 2DW4A 1OCCH 2HYJA 3S1MJ 3HC7A 2HFHA 2KRHA 2P6TA 3C18A 4AIDA 1VTNC 1VNDA 3BG3A 4UUSB 3EDPA 3BR5A 2ZSHB 4I98B 1D1AA 1R5GA 4KN4X 2H6BA 2IW5A 1UCRA 1VQ9I 2DOAA 4WK8F 1JKQC 2K85A 2RRKA 2X1DA 2WY7Q 1WSUA 4CA0A 2E1CA 1VQNI 1VIUA 2Z33A 3VYTB 3FXJA 3KEQA 1V8TA 1O3TA 1P4XA 2HQ5A 4NB5A 4A3LJ 2PMZA 3I64A 1ZRFA 2FVVA 3CCLI 1FPQA 3FMRA 1S8NA 1Y1VJ 2DUKA 4YOQA 3WHCA 4BDZA 5M3MJ 5L3DA 4CZCA 1JUSA 1LB2A 4I02A 1VQ4I 2R7OA 4IZZA 3HG9A 1E17A 3FISA 2I6KA 5K1YA 3MZYA 5E18F 3TO9A 2E2IJ 4BXUA 3MN2A 3GFJA 4PJNA 2VOOA 5CLSA 3OS0A 1L3LA 2HGCA 2E71A 2HWVA 2LG4A 4KNYA 4LOCA 1P4AA 3HYQA 5GPCA 1GV5A 1QZZA 2WWYA 1FYMA 2HOSA 1PUNA 4P55A 2BZTA 4BYYA 3W6VA 2E7WA 4UY8I 3C2GA 1UG2A 2M87A 5HDKA 1X1AA 2LC2A 1ZTRA 2STWA 1WI9A 4GO1A 3N9UA 2H1LA 2RNGA 3Q5FA 4DYWA 4E7ZA 5FRNA 2CL3A 3D0SA 1EH6A 2VE9A 1SC7A 1T95A 2DA4A 3H1CA 5ILVA 2PNYA 2IJLA 2ISYA 3ASNH 1LE8A 2GA2A 2BOLA 5KAIC 1MMDA 2Y0SA 2QCOA 3LSTA 2GQQA 2R5YB 4E7KA 4PFOA 4DYRA 2OU2A 3CTAA 5DUIA 3IAM2 5GTIC 2HQAA 1IN4A 1ZLKA 4P96A 3MVPA 3WE3A 2KLOA 2AO9A 2W48A 3F6VA 5TJJA 5D5UB 3RKQA 1D5VA 3GLLA 4G7HF 1R9TJ 3X0OA 4F3QA 1IN8A 3VEPA 1QHGA 2LBFA 4G9YA 5DM7F 3DKXA 5EZGA 1IV6A 3CMMA 3WTVC 2QWWA 2ETHA 3ZP5A 3RZDJ 5LPGA 2RAEA 3OIQA 1QZYA 1OYIA 1Y39A 2W25A 2AXTC 2P0WA 4L0YB 2EIMH 4RM3A 2NOJB 3RPQA 1XSXA 3KLNA 4XKVA 3K4CA 1NK2P 4J00A 4IHVA 4O3MA 2EZHA 2QGUA 3CLQA 3OYCA 4M3GA 2ZSIB 3IKVA 3K4KA 4JZTA 3U1DA 5GHQA 1Z7LA 1R4NB 4YEJA 5ANUA 2Q8KA 2K4JA 1G4DA 5TISC 3ACAA 2EFOA 2OCEA 1K7AA 2KFDA 3BR1A 4BKXA 1EV7A 1J9IA 4UVBA 5AIPA 3IP4B 4OIPF 2NVUB 5DDGA 3K10A 1KGSA 3NARA 3CJRB 1C0WA 5D4SA 2GOMA 5F0CA 1XMKA 1X2NA 1BR1A 1LVKA 3U9GA 4DOZA 3HUGA 2CW0F 3BTIA 3ERMA 3BZKA 4A6DA 5TGTA 5D4RA 3ZQGA 1QU3A 3I9V2 4XSXF 2MLGA 2ZXHA 3TOBA 1LQ1A 2A3SA 3DEUA 2MW8A 3E6CC 2D1HA 3HSRA 3X0NA 4S2WA 3SQNA 1ZARA 4F93B 2Z3YA 5LGUA 3L2QA 2G7HA 4GYIA 3BCBA 1DP7P 4HAMA 2ZFWA 4L9TA 1YX3A 4UB6C 2XF6A 1UELB 2Q2EB 1MBJA 3CCUI 3N77A 1LJ9A 5CVVA 3AFHA 4J7GA 3T8TA 4L9JA 2IVMA 1PPWA 1XGNA 2EK5A 1R67A 5DYMA 4AVZA 1PPVA 4DGWB 2IGOA 4B3XA 2O61A 2NAZA 3BDDA 2NXNB 5M5YJ 2HYGD 1FSHA 1IUFA 4MIMA 3FK7A 4UUSA 1JJ6C 2ICKA 1UB9A 2A8SA 3K4NA 2A07F 3BR0A 3K7AJ 4YFNF 4XRSA 4A3KJ 1JJ8C 2MC4A 3GTMJ 1RRJA 4HQEA 3R0AA 1HA8A 3QP6A 1WZ2A 3S1RJ 2AQEA 1ZELA 2DQLA 5E79C 1MNDA 2JZYA 4XL9A 4Y17A 1XSCA 4D7NA 3S16J 3I7VA 1U9NA 2ESHA 2H09A 1R5ID 3HRUA 5CQGA 2E1MC 2VC1A 4BQQA 5FJ8J 1T56A 2JSCA 2EPFA 3LFUA 4ANJA 1EKEA 1X83A 5AIQA 1LVAA 2DU9A 3BT9A 5EG0B 2NYXA 2FJ1A 3N05A 2F6CA 2A8RA 1MDMB 2XDVA 3M4OJ 4HDUA 3IAS2 5KNLA 1HW1A 2Q1ZB 3GWZA 1Y0NA 3ROUA 3FF5A 3Q2SA 2BYVE 1ZHFA 1ITYA 1VI0A 3PUBA 3V8LA 1MJAA 1ZGWA 1MSFC 3G73A 2R7ZJ 3FCMA 2DMUA 4JQFA 4C9WA 1B4AA 5DV5A 2DYSH 3DTIA 5GHNA 2CGPA 2TRTA 3OYFA 5ED4A 4PSXA 5M3FJ 4S2VA 1BW5A 3KX2A 2LKPA 4R1HA 2HDDA 3L7WA 1WJCA 1XD7A 2DPUA 1RPWA 2X9DA 4LB6B 2OBPA 2ZNZA 1OCPA 1QVUA 1IO2A 5LLQA 2ACJA 1MSEC 1U9OA 1V8NA 3FDYA 1YJWI 1ODDA 3DKWA 2K9QA 1YOVB 4CCNA 2R5YA 4Y7NJ 3EPZA 2XSQA 2HKOA 1HX3A 6PAXA 3RTRA 2E1OA 4Z6YA 4BBRJ 4CSWA 2M2EA 1MH3A 2K3FA 2X48A 5HDGA 1RIOH 2GLOA 1TNTA 1MGTA 2V9VA 2K86A 3HHGA 4KUMA 4XMYA 1R4MB 4BL0B 4E7HA 2O6GE 5E3MA 2R7SA 4C3JJ 2YYHA 1N75A 4DW6A 2KIQA 3E57A 1FP1D 2BW3B 3CMYA 5FROA 2V6EA 5IW4A 2JVGA 3HZJA 3Q93A 1BI3A 2DODA 2P6SA 3I59B 3MZ8A 4M72A 3BWGA 3WGIA 4X6AJ 3DF8A 1WCMJ 4M3BA 3HOUJ 1LKXA 4BJ6C 2YUSA 1W5CC 2IA0A 4X0GA 2HI3A 2K4BA 4HZFA 4NUBA 3R60A 2ESNA 3CCQI 1MD0A 4DQ2A 1R58A 2Y30A 4II3A 4YELA 1K61A 2FUG2 2WBMA 4YIIA 4AUXA 1TQIA 1G2HA 4FE7A 2ZJRF 3SXYA 3OYLA 1BI1A 4NC7A 1D5YA 1ZK8A 1MR2A 5ICCA 4AIJA 1YS7A 3AG1H 5KVRA 3SEZA 2AS5F 2ZC2A 4G6TB 5HODA 1DP3A 5GHPA 2GXAA 1I3QJ 2VKVA 5CKTA 3QODA 4PJ0C 3FXMA 5EEHA 3FKJA 3LOCA 4CCLA 1OMIA 1A5JA 2IA1A 2EINH 4IHTA 2JA8J 4BAYA 2RNJA 2VNPA 3QP5A 5FB2A 3MKLA 2ME6A 4N0BA 4YRVA 2FMYA 3DV8A 3X0QA 4QTRA 3JREA 1FOYA 3QPHA 4GRIA 4AIHA 1PP8F 2A5WA 1WRJA 2F5DA 5J4YA 3KE2A 3RKYA 4IX7A 1K4TA 1QA6A 2DLLA 1ULYA 4AIKA 5FD6A 4LGWA 4BQOA 2QSHX 1DPUA 3DTEA 3PFIA 3WHWA 1A31A 3GLXA 3MKZA 1QRYA 4XLEA 3LA2A 1Z3YA 3LSPA 3WU0A 2CUEA 5HZXA 2FNPA 1BOAA 5C4JJ 3CDHA 3EYIA 1P9QC 2BBYA 2H8WA 2X6YA 1KQ9A 2L7ZA 2L7MP 2UXNA 4XBFA 4EM0B 4KICA 4RGRA 2H1KA 1ETOA 2Y0MA 4C2TA 5TRDA 1FBSA 4FE4A 4P9UA 3AG4H 1V5FA 4Y3OA 2DTZA 1QPIA 4LITA 1H8AC 4A0ZA 2V1NA 1R5HA 3HOYJ 1VQMI 2EFQA 3MCZA 1IN5A 3VB2A 2FE3A 2VBXA 3SMDA 1FWZA 1D0YA 4CYCB 3HDDA 1IRZA 3H3UA 4OU0A 1R1UA 1LDDA 4UVCA 1LNWA 1T0FA 2O0YA 4YIRX 1PUFA 1ZLJA 2CU7A 2P81A 5DEQA 1OFCX 1SANA 5EG0A 3AG3H 4JZVA 1KU3A 1I39A 2DA7A 1V8UA 1OISA 3H9QA 4IVNA 4LIUA 2LTPA 1OLTA 5I8UA 1HLVA 2XF5A 4D9JA 2M9HA 1MDMA 3ZN1A 1LUJB 3OYNA 4CCOA 5E1ZB 1VRLA 1Y8QB 1ZRDA 5HDNA 1EA3A 3FHNA 3D5RC 4ENJA 2G9WA 2WAQA 2MG4A 2JTVA 2Z5UA 4RAFA 3BC8A 3ZMSA 1JI8A 5EJCA 1KHZA 1JXSA 3H92A 3E6DA 5L3CA 1WHUA 5H20A 1YW7A 2KDOA 3F8MA 2KRCA 1F1ZA 1YJ9I 4HFQA 2XB0X 1HC8A 1ERDA 3F9KA 5EYRA 4WXDA 2PBIA 3U53A 1UJ8A 3X0LA 4M74A 3IRRA 2VLAA 2JVHA 4D5FA 1AU7A 3I5UA 2L5QA 1JHHA 4B1RA 1HKQA 1FBQA 2KZGA 4XONA 5DPKA 5DCFA 3GCMA 3SZGA 2ZO4A 3CP8A 2ISZA 2CSOA 4ZTFA 1ZGJA 3BJOA 3HTUA 2DMPA 1YS6A 3WTWC 1MIJA 3KVHA 4QLCU 1OCRH 5J47A 4HSRA 3B6CA 3CUOA 3ZQQA 1FYLA 2W24A 2V4JC 4M73A 1O4XA 1K26A 2A61A 4GDFA 1A35A 1R49A 2CYYA 4UUTA 2BW3A 3KCCA 2VONA 1BJZA 3I59A 4YIFA 2EV5A 4XRMA 2DMQA 3DLAA 3BTLA 4A0XA 3MAJA 3CCEI 3H95A 3M7GA 2I10A 3R4KA 1BC8C 1D0ZA 2KL4A 4G7ZF 3OGAA 4U87A 2J8QA 2PJPA 3W2WA 3BJAA 2F5CA 1PUQA 3HL2A 1IXRC 2W84A 1TLHB 1MQWA 3CLOA 2OV7A 2LH9A 3GFIA 2UWMA 2A5YB 3HGGA 1MZBA 3FXLA 3Q9VA 3MKWB 3F6AA 1N78A 2HOEA 2G73A 2RN7A 1X3ZB 1OCTC 2XGXA 4XKWA 2HOTA 4Q48A 3DU5A 2CMPA 1SD4A 2VJIA 1KYWA 2XGCA 4ASNA 4DIQA 1UMQA 3K4JA 3NEUA 3WGHA 1O3SA 1MH4A 1YQAA 5FGMA 3KLOA 1I50J 4WCGA 4E7SA 5AONA 3RSNA 4BDYA 1GT0C 2H8RA 1MP2A 3FJYA 1JKOC 3SHFA 1XSDA 2EZKA 4I6ZA 2A8PA 2VKHA 1OPCA 3IWZA 1V55H 2XPWA 4ENKA 4P5OA 1YE9A 3F6OA 1WWXA 2V9KA 4MFDA 2RC4A 1LE8B 2VT3A 1V4RA 3Q0VA 4I01A 2IGKA 3N4MA 1VQOI 5BMZA 1WJ5A 4WXCA 2F5FA 3GZ6A 3TW7A 3ZQFA 3HGYA 3L2RA 4M3DA 4PDKA
chains in the Genus database with same CATH topology
2YVOA 1ZYRF 4MQVA 3WU1B 2CWEA 1TBXA 3R03A 3SHDA 4O6JA 2BV6A 5ICFA 3TO6A 4FHTA 1LDJA 2EA4A 1U2WA 2F5EA 2QVOA 3E5XA 1S29A 5FSNA 1UFMA 2HZTA 3E3VA 5HVQC 1L0OC 1FNNA 4CZZA 3HTSB 5E1XA 3IKTA 2DBBA 2XAFA 1J7KA 3HSFA 1XCBA 2FF4A 1VCDA 1NFSA 5FSIA 5E1WA 1U8RA 1B1BA 2KIMA 1QBJA 2I8UA 4IJAA 2CQKA 5ILSA 4MHGA 2KDWA 3I0TA 1V8LA 3HOSA 2PEXA 3WTXC 2P7VB 2XV4S 5ANWA 1QQIA 4HF2A 1J0RA 2QQAA 3GW2A 1SZ3A 4UXNA 4UHTA 3I4PA 1AWCA 2QM3A 1ZG1A 5BS6A 1XGMA 1IRYA 3BROA 2TDXA 4Y15A 2HR3A 3DQVC 3EESA 2LF7A 1SFEA 4UVAA 2OQGA 1XMAA 4BHBA 3G0QA 4HYEA 4KG4A 3JSOA 3CUQB 4KIBA 3HRSA 1PP7U 2PMUA 2OA4A 5CVJA 3F8FA 2OAZA 5CFIA 1BJAA 3DP7A 3EUHA 4EJUA 3KETA 4ESFA 4ZZDA 2VC0A 2P5LC 4KMFA 4GCVA 4OMZA 3X0MA 3CO6C 4UV8A 4TV7A 1OW2A 1Z91A 1IXCA 4HVYA 3TO7A 4YPRA 4G7OF 2VODA 5LHHA 1KU2A 1TW2A 2A6TA 3FSPA 4ZYDA 3B02A 4LD5A 4NFXA 1YIOA 2LNBA 3G3ZA 3P5TA 3L09A 3IWFA 2WC2A 1DUXC 3KP5A 2D45A 4ENNA 4KA4A 4M6XA 3ECHA 5HS7A 4BQAA 2B06A 1OYYA 5K5RA 2GA1A 1PVFA 3C1DA 4HV6A 2MC3A 4L9VA 1NQYA 1HBXG 2PI0A 3X0KA 4LG0B 3RYPA 3K0LA 5H6RA 3HRMA 2JPBA 5D5XB 3JSPA 2JPCA 4I2OA 1XB4A 1SU2A 1FBUA 3FFUA 1SFUA 1T98A 2YVPA 2VBYA 5CFJA 5JHUA 1RRQA 3JTGA 2L02A 5LEKA 2B0VA 2Y48A 3KP6A 2D1VA 1IUYA 4K2EA 3F8BA 4OMYA 3BAPA 2K27A 4NQWA 4RS8A 1U3EM 4J7HA 5FO5A 5F1RA 4I0AA 5ICGA 1D3YA 1XGSA 3CO7C 5JVTA 3M9AA 3V8JA 2V1XA 3SZTA 2W85A 1R22A 2L54A 3DXJF 1NQZA 4YPHA 4B09A 1ZREA 5EEGA 1IN6A 2FSWA 2MH2A 3TKYA 4EJWA 1LDKB 2BGCA 5D5VB 2RGVA 4EMSA 3E5UA 3J7Ye 4PGGA 2ZKZA 4YG2F 5D5WB 2KKOA 2E7XA 2K7LA 1MKMA 1K79A 3MQ0A 2JVBA 3KP2A 3I71A 2DPDA 4PGHA 1HKSA 4Q4ZF 5FSLA 4KN7X 1X84A 2V79A 3BP8A 3DPLC 3LA7A 3COUA 1TQMA 1FC3A 3CUQA 1Y0UA 1HKTA 1YTYA 5HLIA 4S05A 1YFHA 2PN6A 3COAC 2A6EF 1V8YA 4YFXF 2CZRA 3V4GA 3JAMK 4LMYA 4EV0A 1CF7B 2L4MA 1QNTA 1QVJA 4IRIA 2L01A 1X3UA 1W7PD 1YO5C 2EFNA 2P5KA 2Q0OA 1LEAA 3JAMZ 2XIGA 1I1GA 2LSOA 3TQNA 2ZMEB 3D5LA 2X4HA 3GWYA 3T0YA 1G3TA 2OD5A 4OIRF 1KU7A 1I9AA 4L0ZB 1PUEE 5ANSA 2QUFA 5K5QA 4IHSA 3GEZA 3FX3A 1H9GA 4R79A 1K6OA 1XN7A 2VE8A 1QO0D 3DKUA 2GXGA 4LG0A 3GG6A 4LLLA 1HZTA 2VBZA 2VBWA 4FT8A 1MUTA 1FX7A 5J8FA 2NS0A 3CNGA 4K6EA 3KFWX 3SONA 3X0JA 3T5XA 4OIOF 2EWNA 5CJ9A 3GZ5A 4Q47A 2R3SA 1TTYA 2V1DA 4A6EA 3RJPA 2O8XA 3F13A 4MEXF 1G3YA 1QPMA 4MNUA 3Q91A 3HSEA 2VNQA 2ELHA 2PLYA 1T6SA 3MCFA 2EV0A 2O1CA 1ZGAA 3X0PA 2RKHA 2A6HF 2X0LA 4LB5A 3K69A 2VT2A 1XGOA 1F4KA 5F64A 2XUBA 2L3DA 5DCMA 1REPC 1Q1HA 5GHMA 3R0JA 1IN7A 2DSCA 4U7DA 3F23A 1FYKA 5FSMA 1BIBA 2FA5A 4DNCA 5IT3A 3I58A 1XSAA 4JZSA 1GXQA 3E6BA 3FWEA 3A6UA 2MBFA 1USTA 3TGNA 1XSVA 4KTBA 5HLGA 2H94A 3L9FA 1ZAOA 1D8KA 5FFZA 1JKNA 3ZQ7A 2DAOA 3OV8A 1H9TA 1YLFA 5A2QK 2XAJA 3PQKA 1WQ2A 2J5PA 5BONA 1SMTA 2O5FA 3QRFF 2GT2A 4PCQA 3GX4X 4RGSA 1CF7A 5A2QZ 2Q9PA 3K2ZA 1RYAA 2XAGA 4KG3A 2QJTA 3I9XA 1RI7A 2KJCA 5K5OA 2RV8A 3QSJA 3Q1PA 2WV0A 2ZMEA 3R6SA 1VHZA 5HS8A 1R36A 1I27A 2D2WA 2IT0A 2QQ9A 5ILUA 2A8TA 1V8SA 3C7JA 3IHUA 1RNLA 4MQ9F 3ML6A 3ECOA 1VIQA 3I7UA 3DUPA 4KIGA 5CVRA 4XSZF 4WXHA 2P8TA 4M9ZA 3H3ZA 4L5IA 1IZ1A 2XHKA 3RYRA 1R7JA 3O6BB 2VOPA 3N97A 1V8MA 3P9IA 4GXOA 1SJYA 2FXAA 4HF1A 3GYHX 1S6LA 2YSRA 5LHGA 2NNYA 2QJOA 2FQ3A 2HKXA 2ZCWA 5E17F 3AC9A 3J80K 1P6RA 1W5SA 2STTA 2AXLA 4WWCA 2IA2A 3WE2A 3A6VA 1SMYF 4ESJA 4YFKF 1Q27A 1JRKA 2YVMA 1GXPA 3L85A 1XSBA 3J80Z 5E8GA 2W57A 1TW3A 3ERED 4Z2YA 3J7AO 2BE5F 1HQCA 4ETSA 4ENMA 1ZRCA 3LAJA 1BBYA 4LLGF 2GXBA 3ZMUA 3LA3A 3CUQC 4CDGA 3L00A 2ZXJA 2HYFA 2R7FA 4CICA 3ZPLA 2EFPA 4G94A 3GF2A 2ADUA 2V1UA 1U20A 3P6YA 2AZWA 5JI6A 3FXUA 1VK6A 5C7TA 3B73A 2FOKA 3RIRA 3K1PA 1OKRA 4ICKA 3EETA 2DSBA 2XASA 1MJ9A 4EJOA 1U78A 3GFLA 3JTHA 4N9IA 3VFZA 2DT5A 2MA3A 2YU3A 4EJVA 1O3RA 4CO8A 1YW8A 2UXXA 4IJXA 2QKMB 5BPDA 2PQVA 3DFGA 2FBHA 1U5TB 3EF5A 1W7PB 1O57A 1SFXA 4RGXA 1FLIA 4P9FA 4S04A 3F22A 1DDNA 4S2YA 3IL2A 4G6DA 2HEOA 1J59A 2QLZA 1NFZA 4A2UA 3HHJA 1HSTA 1T39A 4L18B 2UZKA 3O3KA 3S2WA 1FOKA 2GAUA 5JFRA 5J6XA 3V8KA 1ZN2A 2L4AA 4MGRA 4H0EA 3QAHA 1K78B 4KFCA 3F72A 1USSA 3P9KA 3DPTA 5LEJA 4BH9A 1J75A 4EJTA 3MFKA 5D8KB 5LGNA 1T38A 3OOPA 3ZMDA 4MEYF 5F6FA 4OIQF 3TDUC 4IF4A 5GHOA 2EV6A 3FMSA 4JBAA 2YPRA 5ICEA 5LRSA 4O5VA 4KMUX 1XDUA 3WTUC 2YX7A 3AAFA 3LQRA 1BI2A 2HDCA 1FT9A 1B6AA 2DK5A 3HOTA 5D6EA 5L3EA 1IF1A 4I0BA 1S7OA 3O52A 1IRFA 1AOYA 3BHOA 2GB5A 1PUSA 1HW5A 1P92A 4HF0A 2FRHA 1TNSA 3RPUA 4RB3C 2Z9OA 4ESBA 3NQOA 4LJZF 1TQPA 4HLYA 3TDZC 5GHJA 1RUNA 5J8CA 2V6CA 1B9NA 1F5TA 4QWQA 4WF2A 2VXZA 1R1TA 2IRFG 1OR7A 5D6FA 2DFIA 1X51A 2FNAA 1KYZA 1Z1DA 2ZNYA 4Y13A 4L5JA 5CYVA 4ON0A 4S2XA 2GT4A 4XLPF 2XAHA 4U88A 1WKMA 1FY7A 1KQ8A 1U5TA 4CGZA 5BOXA 4BHCA 1G9QA 1W7PA 1GVJA 4NFWA 1Q54A 1G6NA 1B59A 5L3BA 2P4WA 3BY6A 4A5MA 3MEXA 5ERIA 5IT9K 4N1TA 4ZG0A 3O61A 2COMA 1SAXA 3KP4A 2CO5A 3BM4A 2A69F 3ELKA 3M8FA 3JW4A 3O6ZA 2G7UA 3P7NA 4ZYHA 2M8EA 4U0WA 3MZHA 1EH7A 5DCMB 1MQEA 3IRQA 1K78A 5IT9Z 3ISPA 3QOPA 3WG9A 4ZYEA 1V8RA 3K1MA 4LK0F 1JE8A 1O7FA 4JK1X 3VODA 2KIUA 1W5TA 4G8XA 2PFBA 1JGSA 3A6TA 4NHJA 5L3FA 2HS5A 1F9NA 4OINF 2HTJA 3RH7A 4FX4A 5KK1A 3V7SA 2QBYB 2EFWA 1KQ0A 4N9HA 1RZ4A 3A6SA 3O8SA 2RQPA 1D8JA 1I6XA 4HDVA 3FMQA 1PPXA 3F8CA 4KIFA 2QZ8A 3KZZA 2GIVA 1F3YA 1NHAA 2R7DA 2DI3A 2RVCA 3MDGA 3K1NA 3HIFA 1H0MA 1MK1A 3GVAA 3EEUA 4M9SA 1UHWA 1KA8A 4MTEA 2YVNA 1V8WA 1ZH5A 1MJBA 4IXAA 4LLNA 1UHMA 2O3FA 1FSEA 2XROA 2NRAC 1LEBA 3WTYC 2HTSA 2XVCA 5DD8A 2HQRA 1V3FA 4RAZA 1IRGA 5BQTA 4M71A 3TOAA 2E1NA 3W6KB 3HHHA 4LK1F 5ISYA 2BEOA 2IP2A 4CYDA 2Y75A 4KDPA 3FXRA 2KRFA 2A68F 3I53A 4UUVA 2OZ6A 2FU4A 5DD4A 3LAPA 1V8VA 2DQRA 4C9XA 2ZBKA 1R1VA 4EGYA 4WX9A 2OQRA 4Q5SF 3K9TA 2IPQX 4HQMA 4UV9A 2XKOA 3REOA 2DSDA 1Z6RA 4AD9A 3GO5A 3SFZA 2MLKA 1O3QA 1YYVA 5JR3A 3PQJA 1VC8A 4HX4A 3ABUA 5H6QA 3E5QA 1KU9A 4HX7A 1IAWA 3RKXA 4RB0A 2M45A 4RGUA 3ZN0A 5LRRA 4MPOA 1J5YA 4EGZA 3R61A 4RB2C 2LF8A 4HLXA 2DO7A 4A5NA 2DHOA 1O7LA 2M1BA 4IPAA 4BHPA 1R23A 1IXSB 1Z05A 2ZJ2A 2GZWA 2KDVA 2JRTA 5LGTA 5HS9A 2QYOA 1BC7C 4KT5C 2A8QA 3QU3A 3ZMVA 5FSOA 3GFMA 1SOIA 2FBKA 1S7AA 5C8LA 4I09A 2R5WA 3ID9A 3BJ6A 1BIAA 4U7BA 4HV5A 3VOEA 2QBYA 4GYGA 2ICJA 1P4WA 4G6QA 4AWXB 2Q2EA 3FHZA 3X0SA 1G0SA 4F7ZA 3WTSC 3O69A 2B2KA 1BM9A 2K02A 3ZMZA 1TUMA 4XRFA 5FFXA 4CHUA 3C3WA 2C6YA 4ZYGA 1G3SA 3WTZA 3J81K 4A12A 3F21A 2WTEA 1SD6A 4A0YA 1ZG5A 4HA8A 1S3JA 1K2EA 3FXQA 1I5ZA 5GHIA 1Z9CA 1SD7A 2YR2A 4AVPA 4E70A 3E6MA 3J81Z 4HW0A 5FSKA 3FZVA 1J2XA 3NRVA 3EXQA 1EH8A 3E97A 4XLNF 3LQQA 1GA7A 3Q9SA 1IW7F 1CGPA 2MD5A 1QGPA 4M9XA 2Z99A 1A04A 3ZMTA 1OYWA 2EB7A 1U5TC 2PMHA 2XRNA 3KP3A 1BN5A 3LFKA 1B9MA 2LDUA 4MTDA 2EJRA 1ON1A 3QPTA 4D0PA 4HOBA 1KT9A 3GXOA 5FLXK 3ZR0A 3FM3A 3I54A 3F3XA 2O5WA 3EQLF 3ULQB 3RKWA 5E8IA 3KEOA 3T8RA 3X0RA 1Z7UA 5L3GA 4KYWA 2EA2A 1YW9A 5CVIA 2DTRA 2FBIA 2CG4A 2PG4A 4B8XA 4U0VA 3FK9A 5FLXZ 2KIFA 3W6JB 3ABTA 4GGGA 3RDIA 3V7RA 3WGGA 5IW5A 2O03A 1YG2A 1XDSA 3GZ8A 4RAYA 2F2EA 1FZPB 1HW2A 3KZYA 1JHFA 3IC7A 2DK8A 1T2KA 2H6CA 5HOOA 1VC9A 3P9CA 4U0YA 4HBLA 5D8LB 4R8HA 3KP7A 2PQ8A 3U2RA 1PDNC 2FKBA 4BNCA 1Z6TA 3M8EA 3CJNA 3T1BA 1HSJA 4ZZLA 3X0IA 4RB1A 3SZPA 1SD5A 2W4EA 3ZR1A 3FM5A 5C7QA 1U6GA 1P2FA 2RDPA 4V14A 4N1UA 2CFXA 3O2PE 1I1SA 2VN2A 1R00A 3GUDA 3MDIA 2JT1A 4ILQA 4L9NA 4JZUA 3MGMA 1KTGA 1ONVA 1RUOA 3LWFA 1VHGA 2XKPA 5HLHA 3HRTA 3L2CA 4IRGA 5LBQA 2NNNA 2FMLA 3WTTC 3V7CA 2J5OA 5DUKA 1G3WA 4FX0A 4KYXA 3EYYA 4M6YA 4PZJA 2H27A 1STZA 5LHIA 4UNOA 4EQQA 4OOIA 3HYIA 3Q2TA 3GRNA 4HX8A 5ANVA 3BOQA 2P5VA 1W4MA 5E20A 1V8IA 5CVUA 2P7CB 3RI4A 4EM2A 5ANTA 5FD5A 3M1EA 3BPVA 2G74A 5BPIA 2M5WA 4ZH4F 3Q4IA 2KJBA 4I7HA 4EVIA 1FP2A 4CXFA 1ZG3A 1DPRA 4EM1A 2YX4A 1HXDA 2QENA 2GWRA 1Q33A 2HQNA 2XAQA 4LFUA 3MWMA 3QU6A 3BPXA 4IRHA 1E2XA 2OZUA 1XCVA 3WODF 2I8TA 2QQBA 1RRSA 2M30A 1BI0A 3F8NA 2FEZA 3BZ6A 2MH9A 1ON2A 1GHCA 2B0LA 2DW4A 2HFHA 2P6TA 1VTNC 3C18A 3EDPA 4I98B 1R5GA 4KN4X 2H6BA 2IW5A 1UCRA 4WK8F 2RRKA 1WSUA 2E1CA 1VIUA 2Z33A 3KEQA 1V8TA 1O3TA 1P4XA 4NB5A 3I64A 1ZRFA 2FVVA 1FPQA 3FMRA 1S8NA 2DUKA 4YOQA 5L3DA 1LB2A 4I02A 1E17A 2I6KA 5K1YA 3MZYA 5E18F 3TO9A 4BXUA 3GFJA 2VOOA 5CLSA 1L3LA 2HGCA 2HWVA 4KNYA 1P4AA 3HYQA 1QZZA 2WWYA 1FYMA 1PUNA 4P55A 4BYYA 2E7WA 2M87A 5HDKA 2STWA 1WI9A 4GO1A 3N9UA 3Q5FA 4DYWA 2CL3A 3D0SA 1EH6A 2VE9A 5ILVA 2PNYA 2IJLA 2ISYA 2GA2A 3LSTA 2GQQA 2OU2A 3CTAA 5DUIA 1IN4A 1ZLKA 4P96A 3WE3A 3F6VA 5TJJA 5D5UB 1D5VA 4G7HF 3X0OA 1IN8A 3VEPA 4G9YA 3WTVC 2QWWA 2ETHA 3ZP5A 5LPGA 1QZYA 1OYIA 2W25A 4L0YB 3RPQA 1XSXA 3KLNA 4O3MA 3IKVA 4JZTA 3U1DA 5GHQA 5ANUA 2Q8KA 2K4JA 1G4DA 3ACAA 2EFOA 1K7AA 1EV7A 1J9IA 4UVBA 5AIPA 4OIPF 5DDGA 1KGSA 1C0WA 5D4SA 3U9GA 1XMKA 3HUGA 2CW0F 4A6DA 5D4RA 4XSXF 2MLGA 3TOBA 1LQ1A 2A3SA 3DEUA 3E6CC 2D1HA 3HSRA 3X0NA 4S2WA 3SQNA 1ZARA 2Z3YA 5LGUA 2G7HA 4GYIA 1DP7P 4HAMA 2ZFWA 4L9TA 3N77A 1LJ9A 5CVVA 4J7GA 3T8TA 4L9JA 2IVMA 1PPWA 1XGNA 2EK5A 1R67A 5DYMA 1PPVA 2O61A 2NAZA