5DD4A

Apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
221
structure length
221
Chain Sequence
b'YSSNPTFYLGIDCIIFGFNEGEISLLLLKRNFEPAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGAFGAIDRDPGERVVSIAYYALININEYDRELVQKHNAYWVNINELPALIFDHPEMVDKAREMMKQKASVEPIGFNLLPKLFTLSQLQSLYEAIYGEPMDKRNFRKRVAEMDFIEKTDKIDKLGSKRGAALYKFNGKAYRKDPKFKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR AraR
publication title A novel transcriptional regulator of L-arabinose utilization in human gut bacteria.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Transcription regulator
total genus 55
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dd4A02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5dd4A01
1XCBA 3N77A 2ZO4A 3ZP5A 3X0PA 2O03A 3HHGA 3F21A 2ZCWA 3HTUA 4L9JA 4S2VA 3GXOA 1PUEE 1JXSA 1D8JA 2ZMEB 4O3MA 4I0BA 3L7WA 2H27A 3O61A 4OMYA 2K27A 3EETA 4DQ2A 3DP7A 4HQEA 3FFUA 4CO8A 3R60A 3C7JA 1B1BA 5LRSA 4ASNA 1FT9A 2DAOA 1IXCA 5CLSA 2RV8A 1FOKA 3K0LA 3ZMUA 1WKMA 4RB3C 2EFWA 1R58A 5GHMA 5FSOA 4IVNA 1U5TB 2QQBA 2IJLA 4A6EA 3G0QA 2P5VA 1FSHA 3R03A 2DBBA 3IKVA 1YO5C 1V8YA 3ZQ7A 4KYWA 5K1YA 4GO1A 1NQZA 3H3ZA 3KP6A 3ZPLA 3F6AA 3F8MA 2OBPA 3RYRA 3FXUA 2M5WA 4LB6B 3BY6A 4MEXF 4A0XA 3MCZA 2CL3A 4JQFA 1LDDA 1YTYA 4Q48A 1IF1A 1VCDA 4A2UA 5ED4A 3HSEA 3BZ6A 1KGSA 3CLOA 2OZUA 4ENKA 3RTRA 2I8TA 4LD5A 3KP3A 1ZAOA 1ON2A 4BHCA 1RIOH 3GFMA 1A04A 2MD5A 2IW5A 2YVOA 1RZ4A 4LJZF 1LVAA 2VODA 5L3GA 3L9FA 5H6RA 3GFIA 1IN7A 3CO6C 1WSUA 3L85A 2EB7A 2E1NA 1U3EM 4G7OF 2J5OA 4M9SA 3QPTA 1Q54A 5FD5A 1J75A 5H20A 5K5RA 3Q91A 4KDPA 1YS7A 4ESFA 2PI0A 3IL2A 2EK5A 2Z3YA 2YR2A 2X4HA 1SZ3A 2G9WA 2XASA 1I5ZA 3FJYA 1OPCA 4XSXF 2VOOA 2XHKA 3P7NA 1XGSA 4ZYDA 3EQLF 3WTWC 2YYHA 4V14A 4O6JA 2TDXA 1BJAA 2PFBA 2DI3A 1DP7P 2Q9PA 1X3UA 5D5XB 5HOOA 2DSDA 3WE3A 3VB2A 2FNPA 5HVQC 1T0FA 1H9GA 5DYMA 1EH7A 2GIVA 2O5WA 2G7UA 2Y75A 2HWVA 2QLZA 4EGZA 3BJ6A 1MKMA 3K2ZA 4I09A 4HA8A 2F5FA 4A0ZA 5IT3A 1JHHA 5E20A 3R6SA 2YVNA 2HS5A 4AIKA 6PAXA 2FMLA 1Q33A 3Q4IA 5DD4A 3HRTA 4EM2A 1FLIA 4RB1A 5DCMA 1GXPA 3LAJA 4IJXA 3U9GA 1LB2A 1KU9A 2A6TA 1XSAA 3A6VA 3TO7A 2VN2A 3E57A 3WE2A 1YS6A 3F8CA 1XMAA 3HRSA 5DEQA 2XAGA 1J7KA 4NFXA 4E70A 2QENA 3M8EA 3H3UA 4XRFA 3SQNA 2LF8A 1Z91A 1P4WA 2Z99A 1IN5A 2V1DA 3R4KA 3R0JA 1TNTA 1DPUA 3CO7C 3NRVA 4CXFA 1B6AA 5KK1A 5CFIA 2A68F 4L18B 1KU7A 2YVMA 1NFZA 2P5KA 5CVIA 4Y17A 1ONVA 4EMSA 2PEXA 1YIOA 2V1XA 3I0TA 4KUMA 4HLYA 2VNPA 3EXQA 4AIHA 2DFIA 4WXHA 3O2PE 2QVOA 4HOBA 2R7FA 5EEGA 3MGMA 1PUQA 1NQYA 3J80Z 2YSRA 3SFZA 4Y15A 2BV6A 2HFHA 3ZMZA 4HDVA 3RPUA 1HKQA 3M7GA 1J2XA 2W4EA 1ON1A 3O8SA 4RGUA 3GG6A 1O3QA 2C6YA 4L9VA 2PLYA 3NQOA 2NNNA 4BHPA 3K1NA 4EQQA 3BM4A 2W85A 3ZR1A 2HEOA 3TO6A 4A5NA 1BI1A 5AONA 3P9IA 2H6CA 1XSXA 5H6QA 1XSBA 2IA2A 2L54A 4L5JA 4OU0A 4U7BA 3BJOA 4WF2A 4LG0B 2FRHA 2HQRA 1FX7A 4DNCA 2A6HF 3TDUC 2O61A 1HW1A 2HTSA 4WXDA 4CZZA 2HKOA 3HYIA 2UZKA 4IPAA 3FHZA 3GW2A 2UWMA 1R5GA 2VE8A 4KMFA 1QBJA 2DUKA 3KLNA 1Q27A 3M9AA 3VEPA 2ZKZA 2ISZA 1OMIA 3DUPA 3QSJA 5E1XA 5DV5A 2J5PA 3I59A 1LEAA 3RDIA 2JSCA 3SZPA 2NRAC 3RJPA 1P4AA 2P8TA 3R0AA 1QZYA 2VT3A 5DUKA 4UVAA 1K2EA 5HDKA 2ZBKA 2FKBA 1HZTA 5JR3A 4DYWA 1R1UA 4U7DA 3ROUA 5C7QA 1T98A 4HQMA 3Q9SA 1V8RA 2LKPA 2V9VA 2DSCA 1KHZA 1BM9A 3GRNA 3BAPA 2ZJ2A 3K1MA 3KE2A 1XCVA 4U88A 1EV7A 3MZYA 5CJ9A 2XGXA 1YG2A 2P6SA 3MAJA 5ILVA 2XROA 1SFUA 5GHJA 2O6GE 4HV5A 3HHJA 3Q1PA 4UHTA 4IF4A 1RRSA 1R1VA 1ZRCA 4L5IA 2EV0A 2ICJA 4G7ZF 3Q2TA 1MGTA 2BYVE 2M87A 5DD8A 2FF4A 3T0YA 1G0SA 1BIAA 1YYVA 2GXBA 1HBXG 3X0NA 4EM1A 2COMA 1UHWA 2X0LA 4UXNA 2WWYA 4S2XA 3FMQA 4RS8A 2EJRA 5FSNA 2A3SA 1NHAA 2E7WA 3HTSB 4MGRA 3PFIA 1TTYA 2CW0F 2HYFA 2CSOA 1X51A 4CDGA 4HFQA 3MDGA 4IJAA 5ICFA 5LGTA 4MQVA 3TOAA 1S8NA 4U0YA 1REPC 2QUFA 5F64A 2ZNYA 1G3WA 2PJPA 2GXGA 5HS9A 3MDIA 2O8XA 4H0EA 4N0BA 3REOA 1S7OA 2H6BA 2HKXA 2L01A 3E97A 3RPQA 4R1HA 1VTNC 5D4SA 3ACAA 2K02A 3MQ0A 3KP5A 3MEXA 3KETA 1YW9A 4UVCA 4BAYA 5K5QA 1UCRA 4RGRA 1ZRDA 2V1UA 2YPRA 2BGCA 1D8KA 1WI9A 1E17A 3KFWX 4KT5C 1O7FA 1FNNA 2XVCA 1O7LA 3I59B 2E7XA 3CUQA 1IAWA 1E2XA 1ZG1A 4YFNF 1F5TA 2GT2A 2R7DA 3FM5A 1V8UA 2VBXA 2P7VB 2IPQX 5HDGA 3O3KA 2VBWA 3F8FA 3F22A 3BJAA 4P5OA 5L3CA 2DO7A 2QWWA 3E6CC 1VHGA 3MCFA 5ANWA 2R3SA 4OIRF 2Q8KA 3FK9A 2PMHA 2QJOA 1U78A 4KIGA 2DK5A 5CFJA 4QLCU 1G3SA 1FP2A 2GWRA 2ETHA 1RRQA 2G7HA 5ANTA 2PQVA 2QBYB 3K9TA 2FBHA 1IXSB 5L3DA 2B2KA 1J59A 4Q4ZF 1PVFA 3SZTA 4MHGA 3WU0A 3J81K 3DV8A 1BIBA 2EFQA 4G6DA 5HLHA 1MD0A 3FMSA 2KIUA 3X0RA 4OOIA 3DPTA 4IHTA 3RKYA 1MQWA 3ISPA 3IWFA 1AWCA 5LHHA 1U20A 1J9IA 1BN5A 5DPKA 4ZYHA 4ESBA 1SD5A 3WGHA 3Q9VA 1U6GA 3J7AO 3M8FA 4EJOA 3ERED 1Z6RA 1VIQA 5ANUA 1UB9A 3LA7A 3E6MA 2AXLA 5DDGA 4M6XA 1STZA 4LMYA 4FHTA 1OYIA 4OIOF 2RKHA 2A07F 2B06A 4EJWA 3FSPA 1LDKB 1Y0UA 4N9IA 3ECHA 3N97A 1PP7U 1IW7F 2D1VA 4JBAA 1EH8A 5HDNA 1X83A 5FSMA 2HQNA 1CGPA 4N1TA 4BQAA 1G3YA 1TQMA 4R8HA 3T1BA 3CUQB 1KU3A 1TQIA 1LDJA 1IRFA 1QGPA 2DTRA 3NEUA 1KQ0A 2MH9A 2B0LA 1P6RA 1FPQA 1D3YA 4AWXB 5JVTA 2CG4A 1IZ1A 1MP2A 5I8UA 5E1WA 3GZ5A 2F5EA 1QZZA 5D8LB 4LB5A 3JW4A 1USSA 2LF7A 3OGAA 1JE8A 4HAMA 4RAZA 4HLXA 1LQ1A 4IXAA 4JZVA 5HS8A 1MZBA 2QKMB 4I0AA 4LGWA 1F9NA 5LEJA 4KICA 4OIPF 5DUIA 4NQWA 4IRHA 2GB5A 1VRLA 3N9UA 4G8XA 1XN7A 2O3FA 5LPGA 1W7PA 1QQIA 3L09A 1VC8A 4HZFA 2W24A 3P6YA 2GT4A 2M30A 5ICCA 5GHPA 4JZTA 3KEQA 2FE3A 1BI0A 4KG4A 3C18A 2XAFA 2FMYA 1Z1DA 4ZG0A 1ZH5A 1V8TA 2CO5A 3JAMK 5CVVA 4FX4A 4HW0A 1JRKA 5TJJA 1RUOA 1TLHB 2L4AA 2ADUA 5D6FA 2OQGA 3EF5A 4UUVA 4P9FA 1QNTA 3RKXA 2LSOA 3QRFF 1MK1A 2Z33A 2GQQA 3VFZA 3FCMA 4XLPF 2P4WA 3WHWA 1Q1HA 2HZTA 3WTZA 3OV8A 1MJBA 2FBKA 2AZWA 4AD9A 1B59A 3KZYA 1RUNA 2STTA 3Q2SA 1GHCA 3B73A 3K69A 1NFSA 3MWMA 3FZVA 5LHIA 5C8LA 2STWA 4P96A 2R5WA 3M1EA 1IXRC 5BONA 4KG3A 2PG4A 4LLGF 1MUTA 3I5UA 2JTVA 4PDKA 3SXYA 2DSBA 4M73A 4WWCA 1SMTA 3I9XA 3TKYA 4O5VA 1K26A 3X0QA 1V8LA 3LAPA 1KQ8A 5E17F 1ZGAA 2FA5A 3KCCA 3E5XA 5IT9Z 1SAXA 1ZGJA 2Q0OA 2A8QA 1FZPB 2GAUA 3E5UA 1W5TA 2BBYA 4F7ZA 5J6XA 5CVJA 2VBYA 3RIRA 1FBQA 2KJCA 4EJTA 4HF1A 3ZN1A 1I6XA 1SMYF 4CYDA 1IN4A 3KP4A 2YX7A 5EEHA 2K4BA 2XIGA 2HYGD 4YOQA 4EJUA 1RNLA 2XRNA 2D45A 3GEZA 3U2RA 3KP7A 1RI7A 3RKWA 1B9MA 3CJNA 4XSZF 3WTVC 4NHJA 1R36A 4FX0A 2L02A 4KNYA 1TW3A 1SD6A 4I7HA 2FNAA 1KA8A 2RC4A 4P9UA 4BH9A 1YW7A 2QM3A 4ILQA 3BHOA 3WTXC 1F1ZA 1R00A 1USTA 1OYWA 2Z9OA 2G73A 5BS6A 1TBXA 2J8QA 3FMRA 2IP2A 3HIFA 2HOEA 3HYQA 3KZZA 2O1CA 3EEUA 3HOTA 4PCQA 2MC3A 4K6EA 3I54A 3E3VA 5D6EA 5LLQA 2QQAA 1K78A 3V7CA 2VOPA 2E1CA 5LBQA 4KA4A 3BWGA 1GVJA 3RYPA 1B9NA 2PQ8A 4HX8A 5AIQA 2FSWA 5AIPA 5J8FA 5DCMB 1XGOA 3I4PA 1HSTA 4A12A 3JSPA 1ODDA 3ML6A 4NFWA 5IW4A 3SONA 2EWNA 1ZARA 3V7SA 3I53A 2OD5A 1MR2A 4PGHA 2IRFG 3CNGA 1P2FA 3C3WA 1O3TA 3JTHA 4MEYF 4U0WA 2O5FA 1MJAA 2F5DA 1IN6A 2IVMA 5L3FA 3BP8A 2EFNA 2KJBA 1XDSA 1RYAA 2GZWA 3J7Ye 2OA4A 1V8SA 4I02A 5DCFA 4S04A 1B4AA 3F8BA 4HX4A 3GF2A 4WXCA 2BEOA 4HVYA 1HKSA 1FYKA 1SD4A 4RB0A 4ZH4F 4U0VA 3GO5A 5IW5A 2EA4A 2DPUA 2IA0A 3EESA 4C9WA 4EJVA 2P5LC 3QP6A 2ZNZA 4XBFA 2VT2A 2A8PA 3JTGA 3X0SA 1WWXA 3X0MA 1XSVA 2F5CA 1J0RA 1EH6A 4OMZA 4LK0F 1T2KA 3TGNA 3GUDA 1KT9A 2A69F 4ESJA 1QO0D 1G4DA 1YW8A 1R67A 2MH2A 3GZ6A 4WCGA 2PNYA 5BQTA 3BDDA 2DLLA 2NNYA 3HOSA 1D5VA 3ABTA 2K86A 3HRUA 4ON0A 4RAYA 3LQQA 5CVUA 5E18F 3ID9A 3Q93A 3P9KA 2RN7A 3F3XA 4Y13A 4LFUA 1OW2A 1SJYA 2A8RA 2ZMEA 1XDUA 3U1DA 5HS7A 3ULQB 3A6TA 1PPXA 5D8KB 2A8TA 4C9XA 5FB2A 2W57A 3IKTA 4BNCA 5FSIA 1BOAA 4Q5SF 3FXQA 3X0OA 1JKNA 5J8CA 1I27A 2RVCA 1IN8A 1XSDA 1KQ9A 3RH7A 3DEUA 3QAHA 1U5TA 3GLXA 2PBIA 4GYIA 4A5MA 4HV6A 2OAZA 1T38A 1H0MA 2JRTA 3ZN0A 1IRGA 3CUQC 2M1BA 2O0YA 2VC0A 1J5YA 3TDZC 5TRDA 1F3YA 1OKRA 2IA1A 2EV5A 3LFKA 4XLNF 3DPLC 4YFKF 5K5OA 3HUGA 4BXUA 2DT5A 2RRKA 2Q2EA 1ZN2A 2W25A 4RGSA 1G9QA 2K7LA 2VC1A 1QVJA 1Z6TA 3P5TA 1FBSA 4GGGA 5ILUA 3WODF 5F6FA 1BC8C 2A61A 2M45A 2JZYA 1JGSA 4ENJA 3WU1B 3PQKA 2ZXJA 3CTAA 2BE5F 2WV0A 2CQKA 2RDPA 1V8WA 3A6UA 4B8XA 4WK8F 1L3LA 3QP5A 3Q5FA 4KIBA 2A6EF 2ESNA 4GXOA 4ENMA 3MFKA 4YPHA 5JFRA 3ZMSA 1V4RA 1V8IA 3VOEA 3G73A 2QYOA 2A8SA 2MA3A 3W6JB 2LNBA 4Z2YA 1V8NA 1GXQA 3IRQA 4HX7A 3K1PA 3P9CA 2EFOA 1PUSA 3GVAA 1QPMA 3LSTA 3AC9A 5LGNA 3O52A 3G3ZA 1FYLA 1PP8F 5E8IA 2XAJA 2HTJA 1I9AA 5FO5A 4FT8A 1XB4A 3GWZA 5IT9K 3FXRA 2P7CB 1PUNA 3V4GA 4A6DA 1HXDA 4L9NA 4M72A 1O57A 4CGZA 4KTBA 3EDPA 1O3RA 1W4MA 1OYYA 5ICGA 2VNQA 1L0OC 4YFXF 3O69A 1ZHFA 4L0ZB 1S6LA 3QU6A 3J80K 3F72A 4RGXA 1F4KA 3SHDA 3R61A 5ANSA 4KN4X 1KTGA 3GWYA 1S7AA 5ILSA 3GYHX 4ICKA 1R7JA 3ZR0A 4UNOA 3D5LA 4RB2C 1MDMA 4YIIA 1H9TA 1BI3A 3MZHA 3F23A 3F6VA 3ZMDA 1FC3A 1K7AA 2ESHA 3GFJA 4I2OA 1IRYA 4G6QA 5BMZA 3SMDA 1ZLJA 3IWZA 5FFXA 3WTSC 2GA1A 1BC7C 1KYZA 2OU2A 5FSKA 2B0VA 1PPWA 4CHUA 4MTDA 2H94A 3T8RA 3VODA 4TV7A 3FWEA 4S05A 2DU9A 2FBIA 4D0PA 1R1TA 2PN6A 1XSCA 2KDWA 2VBZA 4IRGA 3V8KA 4G94A 2XSQA 4YIFA 2KDVA 2K4JA 5GHNA 4N9HA 3JSOA 5FLXZ 1LNWA 3GX4X 1R5HA 2VXZA 2FEZA 2OZ6A 4Q47A 1VK6A 4KYXA 3L2CA 4KMUX 1T6SA 1FYMA 1UFMA 3GFLA 1XMKA 1ZYRF 4S2YA 5ICEA 3WTYC 1SFEA 2ICKA 1WRJA 2MBFA 3LA2A 1I1SA 1BI2A 1G6NA 2JVBA 5FD6A 1VHZA 5LEKA 5L3EA 1MQEA 2DQLA 2XKPA 1XGNA 2NS0A 1WQ2A 2D1HA 5HZXA 4ZYEA 2EV6A 5A2QZ 3CUOA 1KYWA 5ERIA 1JHFA 4MQ9F 4I98B 1G3TA 3I58A 3T5XA 1ZRFA 2IT0A 2FVVA 3LA3A 4LG0A 1DUXC 2DHOA 2DW4A 2L3DA 4LLNA 3E5QA 3X0KA 5D5VB 3B02A 3L00A 1HX3A 3LWFA 5F1RA 3RI4A 4IHSA 3COAC 2Z5UA 4OINF 4B09A 2NAZA 1HQCA 3HHHA 1P92A 1MDMB 3COUA 1HKTA 3J81Z 5C7TA 2CYYA 5JHUA 1BBYA 2MLKA 1Z05A 3TO9A 1S29A 3V8LA 4HDUA 3A6SA 5LHGA 2EFPA 1KU2A 1PDNC 1HW5A 2JT1A 4EGYA 3HRMA 2VE9A 2WC2A 3GZ8A 3X0LA 4K2EA 2I6KA 3TOBA 4I01A 3DXJF 2KIFA 4PZJA 3E6BA 3IC7A 1CF7A 1SD7A 3KLOA 4YPRA 1YLFA 2YU3A 1FP1D 1TNSA 2XKOA 2XV4S 2UXXA 1ZG3A 2A5YB 1FSEA 2HDCA 5L3BA 3EYYA 5FSLA 3PQJA 4ZYGA 1K79A 1W7PB 4LK1F 5ISYA 3I7UA 2F2EA 2D2WA 3F13A 3DFGA 4KFCA 4EVIA 4M9XA 3X0JA 3X0IA 3O6BB 3BOQA 3F6OA 3WGIA 1SOIA 3QOPA 2WTEA 3D0SA 4KN7X 3BPXA 1LJ9A 4L9TA 3QPHA 4P55A 2W84A 4N1UA 4G9YA 5CVRA 3FM3A 4IRIA 2ELHA 3AAFA 3W6KB 3H95A 3T8TA 4HYEA 3F8NA 5HLGA 3HSFA 1SU2A 2DQRA 4QWQA 3I64A 5FGMA 2JPCA 4EM0B 5JI6A 2MLGA 4CICA 3DF8A 3IRRA 5LGUA 1I1GA 2QQ9A 2VONA 2DK8A 1UHMA 2JPBA 1HW2A 2ZFWA 4AVPA 4HF2A 3I7VA 4M74A 1XGMA 4M71A 2QZ8A 3WTTC 4PGGA 4HBLA 1FWZA 2LDUA 1V8VA 3WTUC 2PMUA 4ZZLA 2ACJA 4S2WA 1MJ9A 1ULYA 4ENNA 2FXAA 3C1DA 5FFZA 4M6YA 3N4MA 2KRFA 4YG2F 1DPRA 3JAMZ 1CF7B 3V8JA 2L4MA 4BYYA 4UV9A 1R22A 1U8RA 1FY7A 3FX3A 5D4RA 4NB5A 1U2WA 5LRRA 2RQPA 3BPVA 1ZG5A 1Z9CA 1K6OA 1X84A 3H92A 2UXNA 2QBYA 1TUMA 3S2WA 1DDNA 1C0WA 1W5SA 1Z7UA 3SHFA 1AOYA 4ETSA 1P4XA 3DKUA 4JZUA 2CFXA 2P6TA 2YVPA 1TQPA 2HGCA 2FQ3A 3LQRA 1T39A 2AS5F 3EYIA 1LEBA 5BPDA 4MNUA 3KP2A 3IHUA 2QJTA 4BHBA 2M8EA 3ELKA 3FF5A 5BPIA 2OQRA 5KVRA 3DQVC 2CGPA 1TW2A 4JZSA 1IUYA 2DPDA 4A0YA 3WG9A 4EV0A 5GHOA 4GYGA 2CWEA 2EA2A 1K78B 5CYVA 3ABUA 3CDHA 2G74A 1S3JA 2V6CA 3EUHA 3QU3A 3BROA 4JK1X 1OR7A 4LLLA 4OIQF 1XD7A 2RGVA 1U5TC 1PPVA 5FLXK 2V79A 3KVHA 5ANVA 3ZMVA 1SFXA 2NYXA 3E6DA 4UVBA 3HSRA 5D5WB 1O3SA 2FU4A 4G7HF 1VIUA 3I71A 1HSJA 4M9ZA 2I8UA 3DKWA 2Y48A 3O6ZA 1R23A 1W7PD 1GA7A 3TQNA 4ZZDA 2FOKA 1YQAA 4KIFA 4GCVA 3ECOA 2H09A 4HF0A 4MTEA 4UV8A 2GA2A 4L0YB 1VC9A 3V7RA 4MPOA 5A2QK 1FBUA 5D5UB 5BOXA 2KIMA 2YX4A 4AIJA 2XUBA 2RNJA 3OOPA 5GHIA 5E1ZB 2XAQA 1V3FA 1V8MA 5E8GA 3U53A 3KEOA 5GHQA 2HR3A 2XAHA 2Y0MA 1ZLKA 3ZMTA 1YFHA 3WGGA 1ZREA 4R79A 4WX9A 5HLIA 2ISYA 2KKOA
chains in the Genus database with same CATH superfamily
2COBA 3NWTA 5J40A 4E7LA 3GLLA 3FXKA 2O9LA 1XCBA 4IOCF 3N77A 3D5SC 2ZO4A 1E3OC 3ZP5A 3X0PA 2O03A 3HHGA 3F21A 3BTCA 3DLAA 2W4SA 2ZCWA 3CCVI 2NS8A 3HTUA 2ZSIB 3K7AJ 4L9JA 2I5UA 2LR8A 4S2VA 3GXOA 1PUEE 2Y30A 1JXSA 1NK3P 1D8JA 3H9QA 3G4SI 2ZMEB 4LITA 4O3MA 3K4JA 2LKXA 4I0BA 3L7WA 1QA6A 2H27A 3O61A 3BZCA 2K27A 3EETA 4OMYA 4DQ2A 3JREA 3DP7A 4C2MJ 4HQEA 3FFUA 4CO8A 3R60A 3C7JA 5DS9A 1B1BA 5LRSA 3MVPA 1FT9A 4ASNA 2DAOA 2JA5J 3IH4A 1IXCA 5CLSA 2DOAA 3U21A 2GBYA 3OSFA 1FOYA 2RV8A 3C2GA 1FOKA 3K0LA 1T56A 2R7QA 4HNVA 2CUZA 1WKMA 3ZMUA 4RB3C 4A3EJ 2EFWA 1R58A 4JX6A 5GHMA 4XRMA 5FSOA 4IVNA 1U5TB 2QQBA 4Y33A 2IJLA 2DA1A 4A6EA 4DW6A 3CJQB 3G0QA 2P5VA 1UELB 1FSHA 4A3KJ 1S7EA 3IAM2 2DBBA 3IKVA 3R03A 2MYSA 1WFXA 5M3MJ 5J3LA 1YO5C 1V8YA 1TP4A 3ZQ7A 5B1BH 4KYWA 1QVUA 5K1YA 5FKKA 4GO1A 1NQZA 3BZKA 4G6TB 3H3ZA 4IL6C 3KP6A 3ZPLA 1ITYA 3F6AA 2EINH 2OBPA 3F8MA 4MO7A 5F08A 3RYRA 3FXUA 3SDGA 2M5WA 5GAHJ 2PJRB 4LB6B 2QQ8A 3BY6A 4MEXF 4A0XA 3HZJA 3RPUD 4XQFA 3HUGB 3I4MJ 3MCZA 4BBRJ 2CL3A 4JQFA 1X3ZB 1LDDA 1YTYA 4Q48A 4E7JA 1Y1VJ 3JRIA 1IF1A 1YOVB 3KX2A 1VCDA 4A2UA 2Q2EB 5ED4A 3HSEA 4U87A 3BZ6A 1KGSA 3CLOA 2OZUA 4ENKA 1MH3A 3RTRA 2TCTA 2IS6A 5EZHA 2I8TA 4LD5A 3KP3A 4XONA 1ZAOA 1FIPA 2DDAA 3RQ4A 1ON2A 1MBHA 2OUMA 4BHCA 1RIOH 3FXJA 3GFMA 4PJJA 1A04A 2WB1N 2MD5A 2IW5A 2YVOA 1RZ4A 4LJZF 2IS4A 1R5ID 1LVAA 4C30A 1B72A 2VODA 2WAQA 5L3GA 2EZLA 2MG4A 4UY8I 3L9FA 5H6RA 2CZRA 3GFIA 1IN7A 3CO6C 1WSUA 3I4NJ 3OYGA 3EPZA 3L85A 2EB7A 1D1AA 5DM6F 5EF6A 1ETVA 3CCYA 2E1NA 1V55H 4F3QA 3PSIA 1U3EM 4G7OF 2J5OA 1K4SA 4M9SA 3OYAA 2BHZA 3B6AA 3QPTA 1Q54A 5FD5A 2VASA 1YJWI 1J75A 5H20A 5B1AH 2NVQJ 2O7OA 5K5RA 4A3DJ 1Z77A 3DU6A 3Q91A 4KDPA 1YS7A 4ESFA 1XS9A 2HVRA 2PI0A 2WAEA 3HXLA 3GTGJ 1X1AA 2I8DA 3IL2A 5J4YA 4HSRA 5JHFA 2EK5A 2Z3YA 2YR2A 1OISA 2X4HA 2LP0A 1SZ3A 5B66C 2G9WA 2XASA 3QODA 1I5ZA 2CQ7A 3FJYA 1OPCA 4XSXF 1X2MA 2DOFA 5C44J 1N77A 3A0HC 4RLFA 1U8BA 2VOOA 2XHKA 3P7NA 1XGSA 4ZYDA 2XAUA 2EBIA 3EQLF 3WTWC 2YYHA 4V14A 4O6JA 4XLCA 3JRAA 3QPLA 2TDXA 5EEAA 1BJAA 4D1QA 1LE8A 2PFBA 2V26A 1MMAA 3FISA 3ZQCA 2HZDA 3HOXJ 3OSGA 2M4GA 2DI3A 3Q3SA 1DP7P 3EUAA 2Q9PA 4QPOA 1X3UA 5IOYA 5D5XB 5HOOA 4ZJZA 2DSDA 2EZKA 4XM3A 3WE3A 4PUSA 3HPHA 2F48A 4J19A 3VB2A 2WBMA 2MSYA 4XLHA 2FNPA 3MMYB 5HVQC 4II2A 1T0FA 2HOTA 1H9GA 5DYMA 1EH7A 3QYBA 2ID6A 3OYCA 2GIVA 5CQGA 5EJCA 4A3IJ 2G7UA 3BTLA 5J4VA 4GFBA 2JUGA 2O5WA 2Y75A 2HWVA 4BJ6C 2NVTJ 2QLZA 2X1EA 4EGZA 3BJ6A 2CJJA 1MKMA 3K2ZA 4I09A 4HA8A 3BR0A 3I55I 2F5FA 2X9DA 4KISA 3HGGA 4A0ZA 2LFBA 5IT3A 1JHHA 5E20A 2F4MB 3R6SA 2YVNA 2R7ZJ 2HS5A 4XMYA 3PIOF 2DFEA 1YRNA 4AIKA 6PAXA 3PM1A 1D1CA 2FMLA 1WGXA 1I39A 4A3FJ 2VXDA 5DD4A 1EJ9A 3HRTA 2V6EA 1Q33A 3Q4IA 4EM2A 4AVZA 2B63J 1FLIA 4RB1A 2QEXI 2IGNA 1AA7A 5DCMA 5B5EC 1GXPA 3LAJA 4IJXA 3IP4B 3U9GA 4HNUA 1LB2A 1KU9A 3DEEA 1GDTA 2A6TA 2HU9A 4IQJA 1XSAA 3OYBA 3A6VA 3TO7A 2VN2A 3E57A 3BCAA 3WE2A 2NOGA 1YS6A 1IRXA 1N78A 3F8CA 1XMAA 1DQUA 3HRSA 3KZIC 2R7VA 5DEQA 2XAGA 3TMOA 4UUSA 1J7KA 1ZK8A 4C3IJ 4NFXA 1WZ2A 2E71A 4LIUA 4XORA 3ZQFA 2QENA 4E70A 3M8EA 3H3UA 4XRFA 1Y6IA 3SQNA 1NH3A 1JUPA 1PJRA 2LF8A 1Z91A 1P4WA 4A3JJ 2VJ5A 1IN5A 2Z99A 4NDLA 2V1DA 3G71I 3R4KA 3R0JA 3K6GA 1TNTA 1HLVA 1DPUA 3CO7C 1Y1WJ 3NRVA 3VYUB 1RKTA 4CXFA 1B6AA 4BL0B 1B72B 1X19A 1TT0A 2TRTA 3KYCB 5KK1A 4IKFA 5CFIA 4BXFA 4V2GA 2A68F 3C2HA 3K4LA 4L18B 1KU7A 2YVMA 3DKXA 1WH5A 3LNQA 1NFZA 2P5KA 5CVIA 4DYCA 4XN3A 4Y17A 1ONVA 4EMSA 2PEXA 3L2UA 1YIOA 2V1XA 3ZCOA 4Z6YA 3HKZN 1S72I 3I0TA 4KUMA 4M3DA 4NC8A 1QPIA 4HLYA 2VNPA 1RPWA 2DCEA 3EXQA 1YIJI 2X51A 4AIHA 2DFIA 1LFUP 4WXHA 3O2PE 1NG7A 2QVOA 1WVRA 2LREA 4HOBA 2R7FA 4MFDA 5EEGA 3MGMA 2P0WA 1PUQA 4IZZA 1NQYA 3J80Z 4B4CA 2YSRA 3SFZA 3M3YJ 2LMDA 4Y15A 2BV6A 1R71A 1CQTA 4BUPA 2CH0A 3H36A 2HFHA 3ZMZA 1TWGJ 4HDVA 2VQGA 3RPUA 5K7HA 1HKQA 2VKDA 4J01A 3M7GA 1J2XA 2W4EA 3GCMA 4X0GA 3TL4X 1ON1A 3O8SA 4RGUA 3GG6A 2JA2A 3GTOJ 3QPSA 1O3QA 2C6YA 2W1OA 4L9VA 2PLYA 4XN0A 4CCMA 4C3HJ 3NQOA 2NNNA 4BHPA 3K1NA 4EQQA 2CUEA 3BM4A 2W85A 3MKZA 4D7MA 3ZR1A 2HEOA 1SANA 5F27A 3TO6A 4A5NA 1BI1A 5AONA 3P9IA 2H6CA 1XSXA 1A6QA 3M4OJ 4AU7A 1PUFA 3PNVA 2VKEA 1E3PA 5H6QA 1XSBA 2IA2A 2L54A 4BE1A 4L5JA 5FROA 4OU0A 4U7BA 3BJOA 2V7FA 4WF2A 1AKHB 4LG0B 2FRHA 2H8WA 4BXXJ 2ZXIA 2HQRA 3A2KA 4FE4A 2KRHA 1FX7A 4DNCA 3CMMA 2A6HF 3TDUC 1V5FA 2O61A 3HOYJ 1HW1A 2AHQA 2HTSA 4WXDA 4B43A 1TWFJ 4CZZA 2HKOA 1W5CC 3S1NJ 3HYIA 2UZKA 3H0DA 3A01A 4IPAA 3FHZA 4M3EA 3GW2A 3F0CA 2UWMA 1R5GA 2JMWA 1A36A 2VQCA 2DA2A 2VE8A 2IAIA 2R5ZB 3MZ8A 3Q0UA 4RLQA 4KMFA 1QBJA 2DUKA 1VNDA 1T08B 2ZJPF 3KLNA 1Q27A 2IGOA 3L2VA 3M9AA 1WHUA 3MN2A 4PSXA 2DMPA 1VQ9I 3E7LA 1OJLA 1ETWA 3VEPA 2ZKZA 2ISZA 1OMIA 3DUPA 3QSJA 5E1XA 5DV5A 1WJAA 2J5PA 4XLEA 3I59A 1LEAA 3ONQA 3RDIA 2JSCA 3SZPA 2VJIA 2E2HJ 4ZTJA 2NRAC 2LVSA 5E3OA 1MMSA 3RJPA 4UUSB 1P4AA 1WJEA 3BQZA 2P8TA 5C3EJ 3HC7A 3R0AA 1QZYA 2VT3A 5DUKA 4UVAA 3FKIJ 1K2EA 3ZR8X 3H0GJ 5HDKA 2ZBKA 2FKBA 1HZTA 5JR3A 4DYWA 1R1UA 2AQFA 3SDBA 3ZXSA 4U7DA 3IUOA 4XK4A 3ABMH 3LOCA 2F4IA 2ME6A 3ROUA 5C7QA 1T98A 2JRMA 4HQMA 4AIDA 3G1MA 3JRGA 2KT0A 1MNEA 3Q9SA 1V8RA 2LKPA 3S3MA 2V9VA 2DSCA 1KHZA 2CS3A 3S15J 1BM9A 3GRNA 2M34A 2RNGA 3BAPA 2ZJ2A 3K1MA 3KE2A 1XCVA 4U88A 1EV7A 3MZYA 3WG7H 5CJ9A 1YJ9I 2XGXA 2EIKH 1YG2A 2P6SA 3MAJA 5ILVA 2XROA 1SFUA 5GHJA 2O6GE 4HV5A 4QSHA 3HHJA 3Q1PA 4UHTA 4IF4A 1RRSA 1R1VA 1ZRCA 4L5IA 2EV0A 2ICJA 4G7ZF 3Q2TA 3CDLA 2RAEA 2EQRA 1MGTA 1X58A 4I99C 2BYVE 5FLMJ 2M9HA 2M87A 2L7FP 5DD8A 2FF4A 2IXSA 2Q1ZB 2DA6A 1BJZA 3T0YA 4CCOA 1G0SA 1BIAA 1YYVA 1TWHJ 3PSFA 1HBXG 2GXBA 3X0NA 4EM1A 2COMA 4ZYAA 1UHWA 2X0LA 4UXNA 5J1RA 2WWYA 5GTHC 2NVXJ 1A35A 4S2XA 1IUFA 3FMQA 4RS8A 2EJRA 5FSNA 3H9GA 2A3SA 2CV0A 2VKVA 1NHAA 2E7WA 3HTSB 2Y0SN 3W6VA 5C4XJ 3OR2C 4MGRA 4PFOA 4E7HA 3PFIA 3S14J 2BW3A 3H35A 1TTYA 2CW0F 3M8JA 2HYFA 3DTEA 1OCCH 2CSOA 2QSFX 1X51A 4CDGA 4HFQA 3MDGA 4IJAA 1VZ0A 5ICFA 5LGTA 4MQVA 3TOAA 1S8NA 2GOMA 4U0YA 3S2HJ 1REPC 2QUFA 5F64A 2ZNYA 3Q0WA 1YJNI 1IO2A 1GV5A 5M5YJ 1G3WA 2PJPA 3PUBA 2GXGA 2M7AA 3EUHC 5HS9A 3MDIA 4DZJA 1OR7C 1OCOH 2O8XA 4H0EA 1DGRM 3A01B 4BQNA 4BE0A 4N0BA 3REOA 1S7OA 2H6BA 2HKXA 5GAGJ 1VQ6I 3L2RA 3G6EI 2L01A 3E97A 3RPQA 4R1HA 3BC8A 1VTNC 5D4SA 3ACAA 3BR5A 2K02A 3MQ0A 3KP5A 3MEXA 3G1LA 4XKVA 1ZR4A 3KETA 1YW9A 4UVCA 4BAYA 4C2TA 5K5QA 1UCRA 4RGRA 1ZRDA 1FMVA 1GVDA 2V1UA 4A93J 2YPRA 2BGCA 1D8KA 1WI9A 1E17A 3KFWX 2KDOA 4KT5C 3S8PA 1VQPI 1O7FA 2A5WA 1FNNA 4E7SA 2XVCA 1O7LA 3I59B 2E7XA 3LL7A 4RBOA 3CUQA 1YI2I 1IAWA 1E2XA 1ZGWA 1POGA 4A3CJ 1EA3A 1ZG1A 4YFNF 3CMYA 1T8IA 1F5TA 1P9QC 2GT2A 4UUTA 2R7DA 3H9JA 3FM5A 1V8UA 2E5ZA 2VBXA 2P7VB 2IPQX 5HDGA 5E3MA 3O3KA 4ABZA 1GLNA 2VBWA 3F8FA 3KPHA 3F22A 3L2QA 1R4MB 3BJAA 1FTTA 4P5OA 2IEKA 4CZCA 2Y2ZA 3CCEI 5L3CA 2DO7A 2JUCA 5HNFA 2QWWA 2F6CA 3E6CC 1VHGA 3MCFA 5ANWA 1QHHD 2R3SA 3A4CA 4OIRF 1W1WE 2Q8KA 2VI6A 3NWSA 3AG2H 3FK9A 2PMHA 2QJOA 2DTZA 3OWTA 1U78A 1AU7A 1G2HA 4KIGA 1OQYA 2DK5A 5CFJA 4QLCU 1G3SA 3HOZJ 1FP2A 2GWRA 2ETHA 1SFOJ 1RRQA 2G7HA 5ANTA 3K4KA 2PQVA 2QBYB 3K9TA 2FBHA 1IXSB 3GTKJ 2I10A 5L3DA 2B2KA 1J59A 4AUXA 4Q4ZF 1U0JA 1PVFA 3SZTA 1D0YA 4MHGA 3FBIB 4PJLA 3WU0A 3J81K 3DKYA 3DV8A 1K61A 3BG9A 1BIBA 1XG1A 2EFQA 2M3AA 2LY2A 4G6DA 5HLHA 4EATA 3EUKL 4XR6A 1MD0A 4YELA 3FMSA 4ZDPA 2KIUA 3X0RA 2OCEA 2DJIA 4FETA 1ETXA 3OYDA 4OOIA 3DPTA 2L9VA 1LPQA 1JUSA 4IHTA 3RKYA 1MQWA 2BXYA 3ISPA 3IWFA 2H8RA 1HOMA 1AWCA 5LHHA 1U20A 1J9IA 1BN5A 5DPKA 4ZYHA 2ZC2A 1ACIA 4ESBA 1SD5A 2K85A 4IEJA 3Q9VA 3WGHA 1U6GA 1X1CA 3W2VA 3J7AO 3M8FA 4EJOA 3ERED 4CA0A 1Z6RA 2QCOA 2QA4I 1VIQA 2E36A 4RA2A 1NK2P 5ANUA 2L9NA 1UB9A 3LA7A 5JVGF 4N4NB 2M7BA 3E6MA 3GTJJ 5CQEA 1ZTRA 2AXLA 5DDGA 3O8HA 1Z3YA 4M6XA 2E5NA 1MH4A 1STZA 4QIWN 4LMYA 3LSIA 3FXOA 1S9HA 1OYIA 2DJNA 2W00A 4FHTA 4OIOF 4V19K 3D5RC 2NS7A 4IO9F 2RKHA 2A07F 2B06A 2IBDA 4EJWA 3FSPA 1LDKB 1Y0UA 4N9IA 3ECHA 3N97A 1P7IA 1PP7U 1IW7F 2D1VA 2X85A 2BY2A 2R93J 4JBAA 1EH8A 5HDNA 1X83A 4RM3A 2R0QC 5GAEJ 5FSMA 2HQNA 2E1MB 4A3LJ 1CGPA 4N1TA 1P7JA 4BQAA 1G3YA 1TQMA 4R8HA 1WCMJ 2NOJB 3T1BA 3CUQB 1KU3A 4CCJA 1TQIA 1LDJA 2HXIA 1OFCX 1IC8A 1YITI 1IRFA 1QGPA 4CCKA 2DTRA 3NEUA 1KQ0A 2QSHX 2MH9A 2B0LA 1P6RA 1FPQA 1D3YA 2MABA 2ZB9A 4RM2A 4AWXB 5JVTA 2CG4A 1IZ1A 4UB6C 3M07A 3CMAI 1MP2A 5I8UA 2UUZA 5E1WA 3GZ5A 1Y0NA 1PVEA 5JLXA 2F5EA 2WV1A 1QZZA 5D8LB 4LB5A 3JW4A 1USSA 2KZGA 2LF7A 1HCRA 2DXIA 1ETOA 2DOEA 1JE8A 1ZELA 3OGAA 3RSNA 2LBFB 4HAMA 2KMUA 4RAZA 2DMQA 3QQAA 2DFHA 1I3QJ 4HLXA 1LQ1A 1RR7A 4IXAA 4JZVA 5HS8A 1MZBA 4CSWA 1BOBA 2QKMB 2PMZN 1Z7LA 3HB9A 4I0AA 4LGWA 1V54H 1F9NA 3I3LA 2R5YA 3O8GA 5LEJA 4KICA 2R92J 4OIPF 2ZXHA 2ECCA 5DUIA 4NQWA 3F9KA 1FIAA 4IRHA 4W97A 4FE7A 2GB5A 4XRSA 1VRLA 2MFZA 2EZIA 5IP6A 3N9UA 4G8XA 2M0MA 4CCNA 3OYEA 1XN7A 4EEFG 1NG6A 3MKLA 4DIQA 2O3FA 3JRCA 5LPGA 1W7PA 1QQIA 3L09A 1VC8A 4HZFA 2ZJRF 2W24A 3P6YA 1I6HJ 1VQ8I 2GT4A 2M30A 1X1DA 5ICCA 5GHPA 4JZTA 3KEQA 2FE3A 1BI0A 4KG4A 3C18A 2XAFA 2VB6A 2FMYA 1RKWA 1Z1DA 3BTJA 3K4CA 4FCYA 4ZG0A 2DMTA 2OF7A 1ZH5A 1V8TA 1APLC 2LOOA 4M3GA 2CO5A 3JAMK 5CVVA 3SYTA 2XF6A 4HW0A 4FX4A 1JRKA 5TJJA 2P81A 1RUOA 4IHWA 1TLHB 2L4AA 2ADUA 3BR1A 1OCPA 3OIOA 2BVLA 5D6FA 4E4HA 5HODA 2KZVA 1Z21A 2OQGA 3OYFA 1R49A 3OMYA 3EF5A 4UUVA 4P9FA 3S1MJ 3FHNA 1QNTA 3RKXA 4DOZA 2LSOA 1MMGA 3QRFF 3CC2I 1MK1A 2Z33A 2GQQA 3VFZA 2XC7A 4XLPF 3FCMA 2X48A 1SC7A 1R4NB 3JRBA 2P4WA 3WHWA 4HG2A 1Q1HA 2HZTA 3WTZA 5IPAA 1A31A 3OV8A 1MJBA 4C3JJ 2E2JJ 1D1BA 5FKMA 2CMPA 2FBKA 2AZWA 4BE2A 2H1KA 4AD9A 4AYBN 1LUJB 4A3BJ 1B59A 3KZYA 1RUNA 2STTA 1I50J 4MIMA 3S93A 1ORKA 1GHCA 3Q2SA 3AL0B 3B73A 3K69A 4HPQA 1NFSA 3MWMA 3FZVA 3HM5A 5LHIA 1R9TJ 5C8LA 2STWA 5FKOA 4P96A 3AKZA 1X3WB 2R5WA 3M1EA 2MGQA 1SVOA 1IXRC 3VPRA 5BONA 3A02A 2FD5A 4KG3A 3H3VK 2PG4A 4LLGF 1MUTA 3CCRI 3LSPA 1G8XA 3I5UA 2JTVA 4PDKA 3SXYA 5IYCJ 4JX4A 4M73A 1U9NA 4WWCA 2DSBA 2FUG2 4CH7A 1BL0A 1SMTA 2JA7J 3CDIA 3I9XA 3TKYA 4O5VA 1K26A 3X0QA 1V8LA 3LAPA 4PK4A 3TW7A 1EF4A 3W3CA 1KQ8A 5E17F 1ZGAA 2FA5A 3KCCA 3E5XA 3HG9A 5IT9Z 9ANTA 1SAXA 1ZGJA 3Q0VA 2Q0OA 2A8QA 4XIDA 3K4MA 1FZPB 4AM3A 2VPLA 1QHGA 2GAUA 4PJMA 3E5UA 1W5TA 3DPUA 2BBYA 4F7ZA 3OS2A 5J6XA 5CVJA 2VBYA 4KITB 3RIRA 1FBQA 2KJCA 4EJTA 4HF1A 3G2BA 1XC5A 2LTPA 4BQOA 3ZN1A 3CCJI 4OAZA 1I6XA 3SJMA 5FLVA 1SMYF 4CYDA 1IN4A 3KP4A 2YX7A 1MNMC 3HJEA 4Y4RA 2K4BA 2OJED 5EEHA 3A0BC 2XIGA 2HYGD 4YOQA 3PUFA 2LG4A 1RNLA 4EJUA 5EGOA 1ERDA 2XRNA 2D45A 3GEZA 5FKNA 3RKQA 3U2RA 4XOTA 4DJAA 2BVMA 1MNDA 2B7EA 3KP7A 1RI7A 3RKWA 1JJ6C 1B9MA 3CJNA 1YE9A 4XSZF 3WTVC 4XKWA 1R36A 4NHJA 1B8IA 4FX0A 2L02A 3S17J 4KNYA 1TW3A 1SD6A 2XB0X 4I7HA 2KQRA 2IGKA 4YEJA 2FNAA 2L9RA 1KA8A 1VF9A 2RC4A 5CPRB 4BH9A 1YW7A 4P9UA 1LE8B 1JKPC 3S2DJ 2JJ7A 4A3MJ 2QM3A 4ILQA 3ZQIA 1IJWC 3BHOA 3WTXC 2KLOA 3ZQHA 1F1ZA 4BJ5C 1OCTC 5EZGA 1X1PA 1R00A 2MD0A 3OL3A 1USTA 2HPIA 1OYWA 2Z9OA 1GV2A 2G73A 1X1BA 1F43A 3IAS2 5BS6A 1TBXA 2J8QA 2HOAA 5GP9A 3FMRA 4F55A 2IP2A 3HIFA 4RDUA 2HOEA 3HYQA 1FMWA 3KZZA 2O1CA 3EEUA 3HOTA 2CFOA 4PCQA 5HNHA 2R7RA 4IHVA 2XGDA 2MC3A 2NXNB 3OYNA 4E6KG 5DM7F 2KHMA 4K6EA 3BQYA 1MBGA 3I54A 3E3VA 3G1OA 5D6EA 3WHBA 5LLQA 3PIPF 2QQAA 1K78A 1F36A 1RR8C 2JA8J 1YRNB 2L2OA 3V7CA 3JR9A 4IHYA 2E1CA 2VOPA 5LBQA 4KA4A 1IV6A 2RQQA 4G12A 3OYKA 3BWGA 1GVJA 3RYPA 1B9NA 2PQ8A 4HX8A 4MFEA 2IS1A 1HDPA 5AIQA 2FSWA 3QOEA 5AIPA 5J8FA 5DCMB 1XGOA 3I4PA 1HSTA 4A12A 3RQIA 3JSPA 3M1CA 4XKBA 3NARA 1ODDA 3ML6A 1X4PA 4NFWA 2WB1A 3RZDJ 5IW4A 3UNGC 3SONA 3ZOBA 2EWNA 1JUMA 2Z2SB 1VQOI 1QU3A 2EILH 1K6YA 1ZARA 1OCZH 3V7SA 1MBEA 3ERMA 2OD5A 3I53A 5LFAA 5IY5H 4PGHA 1MR2A 3ABLH 2XGEA 2IRFG 3CNGA 1P2FA 3C3WA 1O3TA 2WAFA 3JTHA 2QF7A 4MEYF 1WH7A 2E1OA 4U0WA 2HVSA 2LC2A 2O5FA 1MJAA 3AFHA 2F5DA 1IN6A 2IVMA 5L3FA 1UAAA 2CU7A 3BP8A 2EFNA 3S1RJ 1GT0C 4BGDA 4B47A 4C9YA 1JTYA 2KJBA 5F04A 1XDSA 1RYAA 4NUBA 5B3SH 3W2AA 2GZWA 3J7Ye 1RC9A 2OA4A 2B9SA 1V8SA 4I02A 1IRZA 5DCFA 2CV2A 4S04A 1B4AA 3S3OA 3F8BA 4HX4A 1Q1VA 3GF2A 2NVYJ 4WXCA 3TEDA 4D7NA 1WJDA 2BEOA 4HVYA 1HKSA 5F0FA 1FYKA 1SD4A 4RB0A 4ZH4F 3H5NA 3LSMA 2IGMA 2DA7A 4U0VA 3GO5A 5EGOB 5IW5A 2EA4A 2DPUA 2IA0A 2HQ5A 3EESA 4C9WA 4EJVA 2QKLB 2P5LC 4Y3OA 3QP6A 2ZNZA 4XBFA 2M4KA 3CCMI 4BU2A 3CQZJ 3OY9A 3MD2A 2VT2A 2A8PA 3JTGA 3X0SA 1WWXA 3X0MA 1B8IB 4V2FA 1XSVA 2F5CA 1J0RA 1EH6A 4OMZA 2AXTC 3VWBA 1JT0A 3ESWB 4LK0F 3V42A 1T2KA 3TGNA 3GUDA 2BZTA 2A69F 3TW6A 4ESJA 1KT9A 1QO0D 3CP8A 1G4DA 1YW8A 1LKXA 2VQLA 1R67A 3ZQLA 2MH2A 4CYCA 3GZ6A 1Y56A 1DGWY 1BR1A 4PSWA 4WCGA 3ASOH 5BQTA 2PNYA 2LH9A 1TWCJ 3BDDA 2DLLA 2NNYA 3HOSA 2V4JC 3ABTA 1D5VA 1PUFB 2ZFUA 2K86A 1MMDA 2OC6A 3HRUA 3LQQA 4RAYA 3DWLE 5CVUA 4ON0A 5IP9J 5E18F 2O8KA 3ID9A 1QZEA 3Q93A 3P9KA 1BA5A 2RN7A 4JYKA 3F3XA 3CJRB 1JGGA 4Y13A 4LFUA 1OW2A 3OYIA 1SJYA 1ENHA 2A8RA 2V9PA 2GIZA 2ZMEA 4LOCA 1V5EA 2YU9J 1XDUA 3U1DA 2L7ZA 5HS7A 4FQGA 3ULQB 3A6TA 2EIMH 1PPXA 5D8KB 2A8TA 4C9XA 2ZJQF 5FB2A 3J7ZI 2W57A 3IKTA 4BNCA 2DT7B 2M8GX 5FSIA 4ZDLA 4GRIA 1BOAA 1LFPA 1Y8QB 4Q5SF 3VDXA 2FOWA 1SFKA 1WI3A 2K9LA 2OCCH 3FXQA 5K7ZA 3X0OA 2VJJA 2YUSA 4XLFA 1JKNA 5J8CA 1I27A 2RVCA 2Y69H 3VYTB 1IG7A 3A1YA 1IN8A 1XSDA 1KQ9A 3RH7A 1X2NA 3DEUA 4P1WA 1E0EA 3QAHA 1U5TA 3GLXA 2IS2A 2PBIA 2DA4A 3DU5A 4GYIA 1HDDC 2E1MC 4A5MA 4CCLA 4HV6A 2OAZA 1H8AC 5EYRA 4E7IA 1T38A 1H0MA 2JRTA 3ZN0A 1IRGA 1TT5B 2M1BA 3CUQC 1W36C 2O0YA 2VC0A 2ID3A 3MKWB 1J5YA 3FK7A 4DBQA 2D5VA 1WPKA 4DBRA 2E19A 3TDZC 5J1YA 2E35A 2LYCA 5TRDA 3NAUA 1OKRA 1F3YA 2IA1A 3K70C 2EV5A 3LFKA 2YS9A 4XLNF 2PJRA 1GUUA 3HKZA 2K9QA 3DPLC 4YFKF 5K5OA 3HUGA 4QPQA 3SEZA 4BXUA 2DMNA 3U1KA 3VYSB 5M5WJ 3PO2J 5E79C 4HNTA 2DT5A 3D1NI 2RRKA 2QGUA 2Q2EA 1ZN2A 2W25A 4RGSA 1G9QA 4J00A 3GTPJ 2K7LA 2VC1A 1QVJA 1Z6TA 2VKHA 1AHDP 3P5TA 1FBSA 1M1EB 4GGGA 5J47A 5KAFC 3I9V2 5ILUA 1JKRC 3WODF 5F6FA 1BC8C 1JT6A 2A61A 3W2WA 1ETQA 2M45A 3BG3A 1JJ8C 2JZYA 1S5LC 1JGSA 4ENJA 5KAIC 1TWAJ 4XLAA 3WU1B 4FISA 3ABKH 3PQKA 2ZXJA 3OS0A 3CTAA 2BE5F 2WV0A 2CQKA 2RDPA 1V8WA 1MSEC 4E7KA 4I6ZA 2EH3A 2BOLA 3A6UA 2BY0A 4B8XA 2F4OB 4WK8F 2X6XA 3DBLB 5BNGA 3SFIA 1L3LA 3CC4I 3QP5A 3Q5FA 2HDWA 4KIBA 2A6EF 2ESNA 4GXOA 5GADJ 4ENMA 3MFKA 4YPHA 3J7AY 5JFRA 3ZMSA 1V4RA 3AG3H 4H4KC 1V8IA 3RZOJ 3VOEA 3G73A 2QYOA 2A8SA 2MA3A 3W6JB 1OLTA 1VQNI 2XB5A 2LNBA 4Z2YA 1XX5A 1V8NA 1GXQA 3IRQA 4HX7A 3K1PA 3CMEI 1ZKGA 3P9CA 2EFOA 4S0HB 1PUSA 3GVAA 1XPXA 4CYCB 3CCQI 1QPMA 3LSTA 2VUMJ 2L7MP 3AC9A 2H1LA 5LGNA 3O52A 3S1QJ 2BW3B 2ZSHB 3G3ZA 1FYLA 1PP8F 5E8IA 3WHCA 3GTQJ 4BKXA 2R7WA 2XAJA 3KIOA 2HVQA 2HTJA 3VYRB 2QSGX 2R7OA 3TP0A 1I9AA 5FO5A 3HBLA 3CLQA 4FT8A 1XB4A 3GWZA 5IT9K 1J09A 3FXRA 2P7CB 1PUNA 3V4GA 4A6DA 5EG0A 1HXDA 3K4NA 2FJ1A 4L9NA 4DGWB 4M72A 1O57A 4CGZA 5IYDJ 4KTBA 3EDPA 1FOXA 3AG4H 1O3RA 1W4MA 4FTHA 1OYYA 5ICGA 3DLLF 1SVLA 2VNQA 1L0OC 2LLKA 4YFXF 1QVTA 5FJ8J 1ETYA 3LSJA 4ZDOA 5FRMA 3O69A 4F91B 1ZHFA 4L0ZB 3PFYA 1S6LA 5IP7J 3QU6A 3J80K 2DT6A 3F72A 4RGXA 4XKCA 1F4KA 4RMNA 3R61A 4NNJA 3SHDA 5ANSA 4KN4X 1KTGA 3GWYA 2XSDC 3FDYA 1S7AA 5ILSA 4D5CA 3BG7A 3GYHX 3AL0C 4ICKA 2VJ4A 2X1CA 1R7JA 3ZR0A 4B3XA 2K3PA 4UNOA 3D5LA 4RB2C 1MDMA 2CUJA 3H1CA 4YIIA 1H9TA 1BI3A 3MZHA 1T33A 3CJTB 3F23A 1SEUA 3S32A 1BW5A 3F6VA 2N8GA 3ZMDA 1W0TA 2LY9A 4J7HA 1FTZA 3SZGA 1FC3A 2VL8A 4BY7J 3QWLA 3HGYA 4RAFA 2DFFA 1K7AA 2ESHA 3GFJA 4PJ0C 4I2OA 2R7UA 2HPMA 2VQHA 1RESA 1IRYA 2HI3A 4G6QA 5BMZA 1ETKA 3SMDA 1MBFA 2CUFA 4LG3A 4BDZA 2GXAA 4BQQA 1ZLJA 1D0XA 3IWZA 5F1JA 5FFXA 4BY1J 2K9MA 3CCUI 1LVKA 3WTSC 1EKEA 3TBIA 2GA1A 2MC4A 1BC7C 1KYZA 2OU2A 2ECBA 4A69C 3HOVJ 2ELKA 2B0VA 5FSKA 1PPWA 2JWTA 4CHUA 4MTDA 2H94A 3T8RA 3VODA 4TV7A 2KISA 3FWEA 4DYRA 4S05A 1JKOC 2DU9A 2FBIA 4D0PA 1R1TA 2PN6A 2XGCA 1WJCA 1XSCA 2KDWA 4HSTA 2VBZA 4IRGA 4DZPA 3V8KA 1VQMI 4G94A 4OWRB 4KT6A 2XSQA 4YIFA 2KDVA 3GTLJ 2K4JA 2R7TA 2Y0SA 5GHNA 4N9HA 3JSOA 5FLXZ 2VPRA 1LNWA 1PYVA 1R5HA 2VXZA 3GX4X 2FEZA 2XDVA 3OYLA 2OZ6A 2ELJA 3OYHA 4Q47A 1VK6A 4KYXA 3L2CA 2JA6J 4KMUX 1T6SA 1UG0A 5GPCA 2HOSA 3WU2C 3IH2A 1FYMA 2CQQA 1UFMA 3GFLA 2DYSH 4RAGA 1XMKA 1T95A 5F0CA 1ZYRF 4S2YA 5ICEA 1WJBA 3WTYC 1SFEA 1G59A 2ICKA 2XF7A 1WRJA 2CW8A 2MBFA 4DYQA 1XTAA 5DTDA 1IDZA 3A03A 3BT9A 3LA2A 1I1SA 1BI2A 1G6NA 5GTIC 2JVBA 3HL2A 5FD6A 1UZCA 1VHZA 5LEKA 3ZGKA 3JRFA 1T0FC 2CRGA 5L3EA 1MQEA 2DQLA 2BXZA 2XKPA 5CKTA 1XGNA 4HEA2 5EG0B 4C2UA 2NS0A 1Y8RB 2X1DA 1WQ2A 2D1HA 4BJTA 2X6WA 3RCOA 5HZXA 1OCRH 2XRLA 4ZYEA 2EV6A 4Y52J 5A2QZ 3CUOA 1KYWA 5ERIA 2V9KA 1UHSA 1JHFA 3FKJA 3ZQQA 2ZXWH 3H5RA 4MQ9F 4I98B 5F0HA 1G3TA 3I58A 3T5XA 1ZRFA 2IT0A 2FVVA 1AKHA 3LA3A 4LG0A 1DUXC 2JSPA 2DHOA 1VFCA 3L2WA 2DW4A 2L3DA 2LK2A 3K2AA 3E5QA 4LLNA 3X0KA 2M0CA 5D5VB 3B02A 3L00A 3PL8A 1HX3A 3LWFA 5F1RA 1ZR2A 3E0JB 3RI4A 4IHSA 3COAC 2Z5UA 3UKGA 4OINF 3JRHA 2GLOA 4Y7NJ 4B09A 2NAZA 4GDFA 2GOXB 5FKLA 1HQCA 3HHHA 1P92A 4YRVA 1WJFA 1MDMB 3UR3C 2K9SA 2R5ZA 4II3A 3BG5A 3DTIA 4ANJA 2JQ7A 3COUA 5M3FJ 1DU0A 2O5RA 2HXOA 3SEQA 1HKTA 3J81Z 2WA0A 5C7TA 3ZRGA 2CYYA 4J7GA 5JHUA 1BBYA 2MLKA 1Z05A 3TO9A 1S29A 4F93B 1HA8A 3V8LA 4HDUA 3PO3J 3A6SA 5JLWA 5LHGA 3CC7I 2EFPA 1VQLI 1VQ5I 1JKQC 1KU2A 1PDNC 1HW5A 1TL8A 1LFBA 2JT1A 4EGYA 2CV1A 3HRMA 2KRCA 2EZHA 2VE9A 2WC2A 3FXLA 1MSFC 1TC3C 2DODA 3GZ8A 1UG2A 3X0LA 4K2EA 2I6KA 3TOBA 1FOWA 4I01A 3DXJF 2KIFA 4PZJA 4F92B 3DBRB 3E6BA 3IC7A 1CF7A 2ICWG 1SD7A 5KHDA 3LSHA 3KLOA 2R5YB 1H88C 4YPRA 3BG6A 2DDBA 1WJ5A 1YLFA 2YU3A 1FP1D 1TNSA 4NQWB 2XKOA 2KL4A 4KJZA 2XV4S 2UXXA 1IGNA 1ZG3A 2A5YB 4NC7A 1FSEA 3S3NA 2HDCA 5TISC 4CUGA 5L3BA 3OIQA 4BS9A 1N75A 2Y9ZA 3EYYA 3BR3A 1TZLA 5FSLA 3I56I 1YHQI 4XICA 3PQJA 4ZC3A 4ZYGA 4XNFA 1K79A 1W7PB 4LK1F 3CF5F 5KCMA 1QRYA 5ISYA 3L1PA 3QYEA 2LY1A 3I7UA 2F2EA 2D2WA 3F13A 3BCBA 3DFGA 4BACA 2WADA 4KFCA 1D0ZA 2K40A 4M9XA 4EVIA 3X0JA 3X0IA 4IHXA 3O6BB 1RRJA 3BOQA 2WY8Q 2AO9A 3F6OA 3WGIA 1SOIA 3QOPA 2WTEA 3LSRA 4JX5A 2DMUA 3D0SA 4KN7X 3BPXA 1LJ9A 4L9TA 5EDNA 3MKYB 3QPHA 3DBHB 3GTMJ 4P55A 3PJRA 2W84A 3CCLI 2XPWA 4N1UA 1W36D 3OYJA 1BR2A 2LKSA 4G9YA 2Y9YA 2E2IJ 5CVRA 2X6OA 3FM3A 4JOMA 5C4JJ 4D9JA 4IRIA 2Z1DA 2OPTA 1A5JA 1MMNA 2ELHA 4LIVA 4N4OB 3AAFA 3W6KB 3K70D 3H95A 2R7XA 4D5FA 3T8TA 4HYEA 2CQXA 3F8NA 3S16J 4FASD 5HLGA 2F5VA 3HSFA 1SU2A 5IYBJ 3CD6I 2DQRA 2PX9A 2X6YA 4QWQA 3DEWA 3JRDA 5K7FA 3I64A 3FBNB 2M2EA 5FGMA 5M5XJ 1R6RA 2JPCA 4EM0B 5JI6A 4ZTFA 4M3BA 2EPFA 3HEFA 2MLGA 4CICA 3DF8A 3IRRA 5LGUA 1I1GA 2QQ9A 2DA3A 2DYRH 1MBKA 2VONA 1VQ7I 2DK8A 1UHMA 3LSGA 1BW6A 2BY3A 2CQNA 2JPBA 2W48A 1K83J 4MLOA 1HW2A 2E60A 4BDYA 3E1SA 2K5CA 2ZFWA 4AVPA 4HF2A 3I7VA 1Z3XA 1NTCA 4M74A 1XGMA 1VQKI 1ZQ3P 1YX5A 3JCUC 3CESA 4ITVA 4M71A 2PMZA 2QZ8A 3WTTC 4PGGA 2OTLI 4YIRX 2VLAA 1DP3A 4HBLA 3LFUA 1FWZA 3CZ6A 2LDUA 1V8VA 1HF0A 4NC6A 3FK6A 3WTUC 2PMUA 4ZZLA 2ACJA 4S2WA 1MJ9A 1IV8A 1N25A 2L9SA 1ULYA 2XF5A 4ENNA 1KONA 2FXAA 3C1DA 4M6YA 5FFZA 3N4MA 3KYDB 1I3AA 2KRFA 2KPMA 1K4TA 3HOUJ 2BY1A 3H5AA 1DPRA 4YG2F 3QYFA 3JAMZ 1CF7B 3V8JA 2DA5A 2K9NA 2L5QA 2L4MA 1DU6A 4BYYA 4UV9A 1R22A 1U8RA 3ZQGA 1FY7A 3FX3A 1SAUA 3OR1C 5D4RA 4NB5A 2Z16A 2HYJA 1U2WA 3ASNH 5FRNA 2VIXA 5LRRA 2RQPA 3BPVA 1ZG5A 4QTRA 1Z9CA 1K6OA 1X84A 3H92A 2V1NA 4IX7A 2UXNA 2QBYA 1TUMA 3S2WA 1DDNA 1BR4A 2WAQN 1C0WA 1MBJA 1W5SA 1Z7UA 3SHFA 4F52A 3BLYA 2XPUA 4AC0A 4ETSA 4I76A 1AOYA 1P4XA 1Z67A 4M3FA 1D5YA 3DKUA 1E3HA 2R4GA 4BEHA 4JZUA 2LRDA 2GM4A 3BR6A 2W7NA 3AG1H 2CFXA 2P6TA 2YVPA 3VSLA 1TQPA 2HGCA 2OTJI 3PNYA 2FQ3A 5J1UA 3LQRA 1T39A 2AS5F 3EYIA 3GZNB 3GMEA 4PJNA 3BR2A 1FEXA 3GBGA 2NVUB 2JVHA 1LEBA 5BPDA 4MNUA 3KP2A 3IHUA 2QJTA 3BTIA 3C2BA 4BHBA 2M8EA 3ELKA 3FF5A 5BPIA 2OQRA 2L0KA 2HDDA 2OV7A 1UJ8A 1RETA 3FXMA 5KVRA 3DQVC 1XMXA 3KYLA 2CGPA 3CF2A 1TW2A 2K3FA 3OL4A 4JZSA 2L7KA 1IUYA 4AYBA 3OS1A 1JTXA 2DPDA 4A0YA 2JVGA 3WG9A 1W0UA 2BHYA 2ZMEC 4EV0A 4X6AJ 5GHOA 1IDYA 4A3GJ 3LSKA 4GYGA 2CWEA 2EA2A 1K78B 5GPAA 1SVMA 4JP0A 3KEYA 5CYVA 2WY7Q 4M6VA 2FX0A 3ABUA 3CDHA 3IH3A 1Y39A 2G74A 4UB8C 1S3JA 3DCFA 3IV5A 2V6CA 3EUHA 3QU3A 1VQ4I 4B44A 2AQEA 1UMQA 3BROA 4JK1X 1OR7A 2UV1A 4L5EA 4LLLA 5KNLA 4OIQF 1XD7A 2LD5A 4E7ZA 3PNTA 2RGVA 1U5TC 3HDDA 3OIPA 1PPVA 5FLXK 4B3AA 2V79A 3KVHA 5IOZA 5ANVA 3ZMVA 1Z0XA 2EIJH 4NBQA 1SFXA 2NYXA 5H2FC 3E6DA 4UVBA 3B6CA 3HSRA 5D5WB 1O3SA 2KIQA 3K4BA 1MW7A 2XPVA 2FU4A 5E3LA 4G7HF 3HPGA 1VIUA 3I71A 1HSJA 2Y31A 4W1UA 2E34A 4M9ZA 1FJLA 1V5GA 2FQ4A 2I8UA 3TP3A 1YX3A 2R7SA 3DKWA 4X1EA 2MW8A 2Y48A 3O6ZA 4BBSJ 1R23A 1W7PD 5E3NA 3OOUA 1HC8A 4IQ4A 1GA7A 3TQNA 2G0EA 4ZZDA 2FOKA 3X2QH 1YQAA 4KIFA 4GCVA 4OAYA 3N05A 3ECOA 2H09A 4HF0A 4PFPA 4MTEA 4UV8A 4XL9A 5HLTA 2KFDA 2A05A 2GA2A 4L0YB 3DTKA 1O4XA 1VC9A 3V7RA 4MPOA 5A2QK 3OYMA 1FBUA 2HQAA 1JI8A 5D5UB 4XRSG 2CW7A 2HNHA 2KP6A 4B1RA 4XOPA 3VSKA 2KIMA 5BOXA 3J7YJ 1X4OA 2LBFA 4B48A 4IOAF 2YX4A 4AIJA 2XUBA 3P5JA 1A6IA 2RNJA 3OOPA 4HRIA 5E1ZB 5GHIA 3LMMA 2XAQA 5TGTA 1V3FA 1V8MA 5E8GA 3U53A 3KEOA 5GHQA 2HR3A 3CCSI 2JK3A 1U9OA 2XAHA 2JN6A 2Y0MA 1H89C 3HOWJ 1ZLKA 3ZMTA 1YFHA 3K10A 3WGGA 1ZREA 4R79A 2ME0A 2W82A 3CP2A 1KZHA 4BEHB 4WX9A 5HLIA 3FIWA 2KDZA 5LD2C 2ISYA 2DN0A 2KKOA 2XSJC 1VI0A 2RREA 1MIJA
chains in the Genus database with same CATH topology
1XCBA 3N77A 2ZO4A 3ZP5A 3X0PA 2O03A 3HHGA 3F21A 2ZCWA 3HTUA 4L9JA 4S2VA 3GXOA 1PUEE 1JXSA 1D8JA 2ZMEB 4O3MA 4I0BA 3L7WA 2H27A 3O61A 4OMYA 2K27A 3EETA 4DQ2A 3DP7A 4HQEA 3FFUA 4CO8A 3R60A 3C7JA 1B1BA 5LRSA 4ASNA 1FT9A 2DAOA 1IXCA 5CLSA 2RV8A 1FOKA 3K0LA 3ZMUA 1WKMA 4RB3C 2EFWA 1R58A 5GHMA 5FSOA 4IVNA 1U5TB 2QQBA 2IJLA 4A6EA 3G0QA 2P5VA 1FSHA 3R03A 2DBBA 3IKVA 1YO5C 1V8YA 3ZQ7A 4KYWA 5K1YA 4GO1A 1NQZA 3H3ZA 3KP6A 3ZPLA 3F6AA 3F8MA 2OBPA 3RYRA 3FXUA 2M5WA 4LB6B 3BY6A 4MEXF 4A0XA 3MCZA 2CL3A 4JQFA 1LDDA 1YTYA 4Q48A 1IF1A 1VCDA 4A2UA 5ED4A 3HSEA 3BZ6A 1KGSA 3CLOA 2OZUA 4ENKA 3RTRA 2I8TA 4LD5A 3KP3A 1ZAOA 1ON2A 4BHCA 1RIOH 3GFMA 1A04A 2MD5A 2IW5A 2YVOA 1RZ4A 4LJZF 1LVAA 2VODA 5L3GA 3L9FA 5H6RA 2CZRA 3GFIA 1IN7A 3CO6C 1WSUA 3L85A 2EB7A 2E1NA 1U3EM 4G7OF 2J5OA 4M9SA 3QPTA 1Q54A 5FD5A 1J75A 5H20A 5K5RA 3Q91A 4KDPA 1YS7A 4ESFA 2PI0A 3IL2A 2EK5A 2Z3YA 2YR2A 2X4HA 1SZ3A 2G9WA 2XASA 1I5ZA 3FJYA 1OPCA 4XSXF 2VOOA 2XHKA 3P7NA 1XGSA 4ZYDA 3EQLF 3WTWC 2YYHA 4V14A 4O6JA 2TDXA 1BJAA 2PFBA 2DI3A 1DP7P 2Q9PA 1X3UA 5D5XB 5HOOA 2DSDA 3WE3A 3VB2A 2FNPA 5HVQC 1T0FA 1H9GA 5DYMA 1EH7A 2GIVA 2O5WA 2G7UA 2Y75A 2HWVA 2QLZA 4EGZA 3BJ6A 1MKMA 3K2ZA 4I09A 4HA8A 2F5FA 4A0ZA 5IT3A 1JHHA 5E20A 3R6SA 2YVNA 2HS5A 4AIKA 6PAXA 2FMLA 1Q33A 3Q4IA 5DD4A 3HRTA 4EM2A 1FLIA 4RB1A 5DCMA 1GXPA 3LAJA 4IJXA 3U9GA 1LB2A 1KU9A 2A6TA 1XSAA 3A6VA 3TO7A 2VN2A 3E57A 3WE2A 1YS6A 3F8CA 1XMAA 3HRSA 5DEQA 2XAGA 1J7KA 4NFXA 4E70A 2QENA 3M8EA 3H3UA 4XRFA 3SQNA 2LF8A 1Z91A 1P4WA 2Z99A 1IN5A 2V1DA 3R4KA 3R0JA 1TNTA 1DPUA 3CO7C 3NRVA 4CXFA 1B6AA 5KK1A 5CFIA 2A68F 4L18B 1KU7A 2YVMA 1NFZA 2P5KA 5CVIA 4Y17A 1ONVA 4EMSA 2PEXA 1YIOA 2V1XA 3I0TA 4KUMA 4HLYA 2VNPA 3EXQA 4AIHA 2DFIA 4WXHA 3O2PE 2QVOA 4HOBA 2R7FA 5EEGA 3MGMA 1PUQA 1NQYA 3J80Z 2YSRA 3SFZA 4Y15A 2BV6A 2HFHA 3ZMZA 4HDVA 3RPUA 1HKQA 3M7GA 1J2XA 2W4EA 1ON1A 3O8SA 4RGUA 3GG6A 1O3QA 2C6YA 4L9VA 2PLYA 3NQOA 2NNNA 4BHPA 3K1NA 4EQQA 3BM4A 2W85A 3ZR1A 2HEOA 3TO6A 4A5NA 1BI1A 5AONA 3P9IA 2H6CA 1XSXA 5H6QA 1XSBA 2IA2A 2L54A 4L5JA 4OU0A 4U7BA 3BJOA 4WF2A 4LG0B 2FRHA 2HQRA 1FX7A 4DNCA 2A6HF 3TDUC 2O61A 1HW1A 2HTSA 4WXDA 4CZZA 2HKOA 3HYIA 2UZKA 4IPAA 3FHZA 3GW2A 2UWMA 1R5GA 2VE8A 4KMFA 1QBJA 2DUKA 3KLNA 1Q27A 3M9AA 3VEPA 2ZKZA 2ISZA 1OMIA 3DUPA 3QSJA 5E1XA 5DV5A 2J5PA 3I59A 1LEAA 3RDIA 2JSCA 3SZPA 2NRAC 3RJPA 1P4AA 2P8TA 3R0AA 1QZYA 2VT3A 5DUKA 4UVAA 1K2EA 5HDKA 2ZBKA 2FKBA 1HZTA 5JR3A 4DYWA 1R1UA 4U7DA 3ROUA 5C7QA 1T98A 4HQMA 3Q9SA 1V8RA 2LKPA 2V9VA 2DSCA 1KHZA 1BM9A 3GRNA 3BAPA 2ZJ2A 3K1MA 3KE2A 1XCVA 4U88A 1EV7A 3MZYA 5CJ9A 2XGXA 1YG2A 2P6SA 3MAJA 5ILVA 2XROA 1SFUA 5GHJA 2O6GE 4HV5A 3HHJA 3Q1PA 4UHTA 4IF4A 1RRSA 1R1VA 1ZRCA 4L5IA 2EV0A 2ICJA 4G7ZF 3Q2TA 1MGTA 2BYVE 2M87A 5DD8A 2FF4A 3T0YA 1G0SA 1BIAA 1YYVA 2GXBA 1HBXG 3X0NA 4EM1A 2COMA 1UHWA 2X0LA 4UXNA 2WWYA 4S2XA 3FMQA 4RS8A 2EJRA 5FSNA 2A3SA 1NHAA 2E7WA 3HTSB 4MGRA 3PFIA 1TTYA 2CW0F 2HYFA 2CSOA 1X51A 4CDGA 4HFQA 3MDGA 4IJAA 5ICFA 5LGTA 4MQVA 3TOAA 1S8NA 4U0YA 1REPC 2QUFA 5F64A 2ZNYA 1G3WA 2PJPA 2GXGA 5HS9A 3MDIA 2O8XA 4H0EA 4N0BA 3REOA 1S7OA 2H6BA 2HKXA 2L01A 3E97A 3RPQA 4R1HA 1VTNC 5D4SA 3ACAA 2K02A 3MQ0A 3KP5A 3MEXA 3KETA 1YW9A 4UVCA 4BAYA 5K5QA 1UCRA 4RGRA 1ZRDA 2V1UA 2YPRA 2BGCA 1D8KA 1WI9A 1E17A 3KFWX 4KT5C 1O7FA 1FNNA 2XVCA 1O7LA 3I59B 2E7XA 3CUQA 1IAWA 1E2XA 1ZG1A 4YFNF 1F5TA 2GT2A 2R7DA 3FM5A 1V8UA 2VBXA 2P7VB 2IPQX 5HDGA 3O3KA 2VBWA 3F8FA 3F22A 3BJAA 4P5OA 5L3CA 2DO7A 2QWWA 3E6CC 1VHGA 3MCFA 5ANWA 2R3SA 4OIRF 2Q8KA 3FK9A 2PMHA 2QJOA 1U78A 4KIGA 2DK5A 5CFJA 4QLCU 1G3SA 1FP2A 2GWRA 2ETHA 1RRQA 2G7HA 5ANTA 2PQVA 2QBYB 3K9TA 2FBHA 1IXSB 5L3DA 2B2KA 1J59A 4Q4ZF 1PVFA 3SZTA 4MHGA 3WU0A 3J81K 3DV8A 1BIBA 2EFQA 4G6DA 5HLHA 1MD0A 3FMSA 2KIUA 3X0RA 4OOIA 3DPTA 4IHTA 3RKYA 1MQWA 3ISPA 3IWFA 1AWCA 5LHHA 1U20A 1J9IA 1BN5A 5DPKA 4ZYHA 4ESBA 1SD5A 3WGHA 3Q9VA 1U6GA 3J7AO 3M8FA 4EJOA 3ERED 1Z6RA 1VIQA 5ANUA 1UB9A 3LA7A 3E6MA 2AXLA 5DDGA 4M6XA 1STZA 4LMYA 4FHTA 1OYIA 4OIOF 2RKHA 2A07F 2B06A 4EJWA 3FSPA 1LDKB 1Y0UA 4N9IA 3ECHA 3N97A 1PP7U 1IW7F 2D1VA 4JBAA 1EH8A 5HDNA 1X83A 5FSMA 2HQNA 1CGPA 4N1TA 4BQAA 1G3YA 1TQMA 4R8HA 3T1BA 3CUQB 1KU3A 1TQIA 1LDJA 1IRFA 1QGPA 2DTRA 3NEUA 1KQ0A 2MH9A 2B0LA 1P6RA 1FPQA 1D3YA 4AWXB 5JVTA 2CG4A 1IZ1A 1MP2A 5I8UA 5E1WA 3GZ5A 2F5EA 1QZZA 5D8LB 4LB5A 3JW4A 1USSA 2LF7A 3OGAA 1JE8A 4HAMA 4RAZA 4HLXA 1LQ1A 4IXAA 4JZVA 5HS8A 1MZBA 2QKMB 4I0AA 4LGWA 1F9NA 5LEJA 4KICA 4OIPF 5DUIA 4NQWA 4IRHA 2GB5A 1VRLA 3N9UA 4G8XA 1XN7A 2O3FA 5LPGA 1W7PA 1QQIA 3L09A 1VC8A 4HZFA 2W24A 3P6YA 2GT4A 2M30A 5ICCA 5GHPA 4JZTA 3KEQA 2FE3A 1BI0A 4KG4A 3C18A 2XAFA 2FMYA 1Z1DA 4ZG0A 1ZH5A 1V8TA 2CO5A 3JAMK 5CVVA 4FX4A 4HW0A 1JRKA 5TJJA 1RUOA 1TLHB 2L4AA 2ADUA 5D6FA 2OQGA 3EF5A 4UUVA 4P9FA 1QNTA 3RKXA 2LSOA 3QRFF 1MK1A 2Z33A 2GQQA 3VFZA 3FCMA 4XLPF 2P4WA 3WHWA 1Q1HA 2HZTA 3WTZA 3OV8A 1MJBA 2FBKA 2AZWA 4AD9A 1B59A 3KZYA 1RUNA 2STTA 3Q2SA 1GHCA 3B73A 3K69A 1NFSA 3MWMA 3FZVA 5LHIA 5C8LA 2STWA 4P96A 2R5WA 3M1EA 1IXRC 5BONA 4KG3A 2PG4A 4LLGF 1MUTA 3I5UA 2JTVA 4PDKA 3SXYA 2DSBA 4M73A 4WWCA 1SMTA 3I9XA 3TKYA 4O5VA 1K26A 3X0QA 1V8LA 3LAPA 1KQ8A 5E17F 1ZGAA 2FA5A 3KCCA 3E5XA 5IT9Z 1SAXA 1ZGJA 2Q0OA 2A8QA 1FZPB 2GAUA 3E5UA 1W5TA 2BBYA 4F7ZA 5J6XA 5CVJA 2VBYA 3RIRA 1FBQA 2KJCA 4EJTA 4HF1A 3ZN1A 1I6XA 1SMYF 4CYDA 1IN4A 3KP4A 2YX7A 5EEHA 2K4BA 2XIGA 2HYGD 4YOQA 4EJUA 1RNLA 2XRNA 2D45A 3GEZA 3U2RA 3KP7A 1RI7A 3RKWA 1B9MA 3CJNA 4XSZF 3WTVC 4NHJA 1R36A 4FX0A 2L02A 4KNYA 1TW3A 1SD6A 4I7HA 2FNAA 1KA8A 2RC4A 4P9UA 4BH9A 1YW7A 2QM3A 4ILQA 3BHOA 3WTXC 1F1ZA 1R00A 1USTA 1OYWA 2Z9OA 2G73A 5BS6A 1TBXA 2J8QA 3FMRA 2IP2A 3HIFA 2HOEA 3HYQA 3KZZA 2O1CA 3EEUA 3HOTA 4PCQA 2MC3A 4K6EA 3I54A 3E3VA 5D6EA 5LLQA 2QQAA 1K78A 3V7CA 2VOPA 2E1CA 5LBQA 4KA4A 3BWGA 1GVJA 3RYPA 1B9NA 2PQ8A 4HX8A 5AIQA 2FSWA 5AIPA 5J8FA 5DCMB 1XGOA 3I4PA 1HSTA 4A12A 3JSPA 1ODDA 3ML6A 4NFWA 5IW4A 3SONA 2EWNA 1ZARA 3V7SA 3I53A 2OD5A 1MR2A 4PGHA 2IRFG 3CNGA 1P2FA 3C3WA 1O3TA 3JTHA 4MEYF 4U0WA 2O5FA 1MJAA 2F5DA 1IN6A 2IVMA 5L3FA 3BP8A 2EFNA 2KJBA 1XDSA 1RYAA 2GZWA 3J7Ye 2OA4A 1V8SA 4I02A 5DCFA 4S04A 1B4AA 3F8BA 4HX4A 3GF2A 4WXCA 2BEOA 4HVYA 1HKSA 1FYKA 1SD4A 4RB0A 4ZH4F 4U0VA 3GO5A 5IW5A 2EA4A 2DPUA 2IA0A 3EESA 4C9WA 4EJVA 2P5LC 3QP6A 2ZNZA 4XBFA 2VT2A 2A8PA 3JTGA 3X0SA 1WWXA 3X0MA 1XSVA 2F5CA 1J0RA 1EH6A 4OMZA 4LK0F 1T2KA 3TGNA 3GUDA 1KT9A 2A69F 4ESJA 1QO0D 1G4DA 1YW8A 1R67A 2MH2A 3GZ6A 4WCGA 2PNYA 5BQTA 3BDDA 2DLLA 2NNYA 3HOSA 1D5VA 3ABTA 2K86A 3HRUA 4ON0A 4RAYA 3LQQA 5CVUA 5E18F 3ID9A 3Q93A 3P9KA 2RN7A 3F3XA 4Y13A 4LFUA 1OW2A 1SJYA 2A8RA 2ZMEA 1XDUA 3U1DA 5HS7A 3ULQB 3A6TA 1PPXA 5D8KB 2A8TA 4C9XA 5FB2A 2W57A 3IKTA 4BNCA 5FSIA 1BOAA 4Q5SF 3FXQA 3X0OA 1JKNA 5J8CA 1I27A 2RVCA 1IN8A 1XSDA 1KQ9A 3RH7A 3DEUA 3QAHA 1U5TA 3GLXA 2PBIA 4GYIA 4A5MA 4HV6A 2OAZA 1T38A 1H0MA 2JRTA 3ZN0A 1IRGA 3CUQC 2M1BA 2O0YA 2VC0A 1J5YA 3TDZC 5TRDA 1F3YA 1OKRA 2IA1A 2EV5A 3LFKA 4XLNF 3DPLC 4YFKF 5K5OA 3HUGA 4BXUA 2DT5A 2RRKA 2Q2EA 1ZN2A 2W25A 4RGSA 1G9QA 2K7LA 2VC1A 1QVJA 1Z6TA 3P5TA 1FBSA 4GGGA 5ILUA 3WODF 5F6FA 1BC8C 2A61A 2M45A 2JZYA 1JGSA 4ENJA 3WU1B 3PQKA 2ZXJA 3CTAA 2BE5F 2WV0A 2CQKA 2RDPA 1V8WA 3A6UA 4B8XA 4WK8F 1L3LA 3QP5A 3Q5FA 4KIBA 2A6EF 2ESNA 4GXOA 4ENMA 3MFKA 4YPHA 5JFRA 3ZMSA 1V4RA 1V8IA 3VOEA 3G73A 2QYOA 2A8SA 2MA3A 3W6JB 2LNBA 4Z2YA 1V8NA 1GXQA 3IRQA 4HX7A 3K1PA 3P9CA 2EFOA 1PUSA 3GVAA 1QPMA 3LSTA 3AC9A 5LGNA 3O52A 3G3ZA 1FYLA 1PP8F 5E8IA 2XAJA 2HTJA 1I9AA 5FO5A 4FT8A 1XB4A 3GWZA 5IT9K 3FXRA 2P7CB 1PUNA 3V4GA 4A6DA 1HXDA 4L9NA 4M72A 1O57A 4CGZA 4KTBA 3EDPA 1O3RA 1W4MA 1OYYA 5ICGA 2VNQA 1L0OC 4YFXF 3O69A 1ZHFA 4L0ZB 1S6LA 3QU6A 3J80K 3F72A 4RGXA 1F4KA 3SHDA 3R61A 5ANSA 4KN4X 1KTGA 3GWYA 1S7AA 5ILSA 3GYHX 4ICKA 1R7JA 3ZR0A 4UNOA 3D5LA 4RB2C 1MDMA 4YIIA 1H9TA 1BI3A 3MZHA 3F23A 3F6VA 3ZMDA 4J7HA 1FC3A 1K7AA 2ESHA 3GFJA 4I2OA 1IRYA 4G6QA 5BMZA 3SMDA 1ZLJA 3IWZA 5FFXA 3WTSC 2GA1A 1BC7C 1KYZA 2OU2A 5FSKA 2B0VA 1PPWA 4CHUA 4MTDA 2H94A 3T8RA 3VODA 4TV7A 3FWEA 4S05A 2DU9A 2FBIA 4D0PA 1R1TA 2PN6A 1XSCA 2KDWA 2VBZA 4IRGA 3V8KA 4G94A 2XSQA 4YIFA 2KDVA 2K4JA 5GHNA 4N9HA 3JSOA 5FLXZ 1LNWA 3GX4X 1R5HA 2VXZA 2FEZA 2OZ6A 4Q47A 1VK6A 4KYXA 3L2CA 4KMUX 1T6SA 1FYMA 1UFMA 3GFLA 1XMKA 1ZYRF 4S2YA 5ICEA 3WTYC 1SFEA 2ICKA 1WRJA 2MBFA 3LA2A 1I1SA 1BI2A 1G6NA 2JVBA 5FD6A 1VHZA 5LEKA 5L3EA 1MQEA 2DQLA 2XKPA 1XGNA 2NS0A 1WQ2A 2D1HA 5HZXA 4ZYEA 2EV6A 5A2QZ 3CUOA 1KYWA 5ERIA 1JHFA 4MQ9F 4I98B 1G3TA 3I58A 3T5XA 1ZRFA 2IT0A 2FVVA 3LA3A 4LG0A 1DUXC 2DHOA 2DW4A 2L3DA 4LLNA 3E5QA 3X0KA 5D5VB 3B02A 3L00A 1HX3A 3LWFA 5F1RA 3RI4A 4IHSA 3COAC 2Z5UA 4OINF 4B09A 2NAZA 1HQCA 3HHHA 1P92A 1MDMB 3COUA 1HKTA 3J81Z 5C7TA 2CYYA 4J7GA 5JHUA 1BBYA 2MLKA 1Z05A 3TO9A 1S29A 3V8LA 4HDUA 3A6SA 5LHGA 2EFPA